5CGEA

Structure of hydroxyethylthiazole kinase thim from staphylococcus aureus in complex with substrate analog 2-(2-methyl-1h-imidazole-1-yl)ethanol
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
264
structure length
255
Chain Sequence
MNYLNNIRIENPLTICYTNDVVKNFTANGLLSIGASPAMSEAPEEAEEFYKVAQALLINIGTLTAQNEQDIIAIAQTANEAGLPIVFDPVAVGASTYRKQFCKLLLKSAKVSVIKGNASEILALIDDTATLDAVTIAKKAYAIYKTAIVITGKEDVIVQGDKAIVLANGSPLLARVTGAGCLLGGIIAGFLFRETEPDIEALIEAVSVFNIAAEVAAENENCGGPGTFSPLLLDTLYHLNETTYQQRIRIQEVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ThiM from Vitamin B1 biosynthetic pathway of Staphylococcus aureus - Insights into a novel pro-drug approach addressing MRSA infections.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mrsa252
molecule tags Transferase
molecule keywords Hydroxyethylthiazole kinase
total genus 91
structure length 255
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.50: Hydroxyethylthiazole kinase.
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02110 HK Hydroxyethylthiazole kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 5cgeA00
1DGMA 1WYEA 3RTAA 3H49A 3RPHA 3RSFA 1LIKA 4S1MA 3PZSA 3KTNA 3KD6A 5BYDA 2HW1A 3PL2A 3NC9A 2I5BA 1TD2A 1LHPA 1UA4A 2C49A 5BYEA 1GQTA 3NBWA 2DDMA 4JKUA 3B1OA 3I3YA 2PKKA 4K8CA 3UQDA 4K9IA 3H74A 4EOHA 4KADA 2PKNA 2RBCA 3Q1YA 4K8TA 5C3ZA 2R3BA 1LIIA 2FV7A 3RT9A 3LHXA 4N08A 3QAIA 3UBOA 5CGEA 3RO4A 2YXUA 3OTXA 4WJMA 5EY7A 3HYOA 3RTDA 3GO7A 3RQ8A 1VI9A 3RSSA 1RKDA 4C5NA 2ABQA 3RQ2A 1JXIA 1TZ6A 1GC5A 3NM1A 2C4EA 4XDAA 5TRWA 2VARA 3W4SA 4E69A 4XF7A 2XTBA 3IN1A 1RKSA 3RTGA 2DDWA 3RQHA 1V1AA 4E8YA 3IBQA 4DC3A 3Q92A 5CM5A 3KEUA 1V1BA 2AB8A 1EKQA 3FHYA 4YL5A 3RQ5A 1BX4A 5EYNA 5F11A 1ESJA 3JULA 1LHRA 1VM7A 3UQ6A 3RQXA 5F0ZA 2F02A 3B1NA 3IH0A 3NL2A 3RY7A 1RKAA 3LOOA 3NL3A 4JKSA 3RM5A 3ZS7A 4DU5A 3DZVA 2R3EA 4PVVA 4XCKA 4LBGA 5C41A 4K9CA 1JXHA 3LKIA 2NWHA 3RS8A 2A9YA 2AA0A 2AX3A 5C40A 4B8SA 3UMPA 4U7XA 5BYCA 4EN4A 1YGKA 4K93A 2YXTA 4LBXA 1EKKA 1YGJA 2AJPA 4S1IB 4S1IA 3GBUA 3NC2A 2JG1A 4LC4A 3B1RA 3EWMA 3RRFA 2JGVA 3B3LA 5B6AA 3RSGA 1UB0A 4E8ZA 5COJA 2AJRA 5TQIA 4O1GA 3RT7A 3UMOA 1YHJA 3GO6A 3BGKA 3N1CA 2AFBA 4LCAA 3RRBA 1V19A 4KALA 1TYYA 4O1LA 3LJSA 1TZ3A 2F7KA 2JG5A 3RRJA 3RS9A 4C5JA 3IQ0A 1RFUA 4E8WA 3RTEA 3B1PA 3RPZA 2HQQA 2Q5RA 3HICA 2A9ZA 3MBJA 3IKHA 1C3QA 2ABSA 3BF5A 2V78A 3NBVA 4S1HA 4UBEA 3VASA 4C5MA 4EBUA 4JJPA 3NCAA 4KAHA 3K5WA 4C5LA 3DRWA 4E84A 5CGAA 3RQQA 3HPDA 1KYHA 2DDOA 2QHPA 3B1QA 4N09A 5BYFA 2I6AA 5C3YA 4C5KA 2HLZA 1LIOA 4XF6A 4X8FA 3RREA 3VAQA 3IE7A 2AWDA 1U2XA 4B8RA 1LIJA 4YWRA 4KANA 4EUMA 3UQEA 3RU3A 3NL5A 3CQDA 1ESQA 1RFVA 2DCNA 3MBHA 4K8PA 3RQ6A 2PKMA 3QA2A 1RK2A 1RFTA 1L2LA 4K8KA 4KBEA 3UQ9A 3KZHA 3NM3A 3RTCA 4E3AA 3RU2A 3FHXA 3NL6A 1VK4A 4GM6A 3RSQA 1V1SA 2PKFA 3RTBA 2I6BA 2QCVA 3K9EA
chains in the Genus database with same CATH superfamily
1DGMA 1WYEA 3RTAA 2Y68A 3H49A 1GQQA 3RPHA 1LIKA 4S1MA 3PZSA 3KTNA 3RSFA 3KD6A 5BYDA 2XPCA 4C13A 2HW1A 3PL2A 3NC9A 2I5BA 1TD2A 1LHPA 1UA4A 2C49A 5BYEA 2GCAA 1GQTA 3NBWA 2DDMA 4JKUA 4BUCA 3B1OA 2X5OA 3I3YA 2PKKA 4K8CA 3UQDA 5A5EA 4K9IA 3H74A 4EOHA 4E3AA 4KADA 2PKNA 5B6AA 2Y67A 2RBCA 3Q1YA 4K8TA 4BUBA 5C3ZA 2R3BA 2GC6A 2Y66A 3ZM6A 4C12A 1LIIA 2FV7A 3RT9A 3LHXA 4ZIYA 4N08A 1FGSA 2JFFA 3QAIA 3UBOA 5CGEA 3RO4A 2YXUA 3OTXA 4WJMA 5EY7A 3HYOA 3RTDA 3GO7A 3RQ8A 1VI9A 3RSSA 1RKDA 4C5NA 2VORA 4QF5A 2ABQA 2F00A 2GC5A 1EEHA 1JXIA 1GC5A 1TZ6A 2JFGA 3N2AA 3NM1A 2C4EA 4UAGA 4XDAA 1P31A 2VARA 5TRWA 1JBVA 3W4SA 4E69A 4XF7A 2XTBA 3IN1A 1RKSA 3RTGA 2DDWA 4QDIA 1V1AA 3RQHA 4CVMA 2GCBA 4E8YA 3IBQA 4DC3A 3HJ6A 3Q92A 5CM5A 3KEUA 1V1BA 2AB8A 1EKQA 3FHYA 4YL5A 3RQ5A 1BX4A 3NRSA 5EYNA 4HV4A 5F11A 1ESJA 3JULA 3UAGA 1LHRA 1VM7A 2JFHA 2Y1OA 3UQ6A 3RQXA 5F0ZA 4CVLA 2F02A 2UUOA 3B1NA 3IH0A 3NL2A 3RY7A 2VOSA 1RKAA 3LOOA 3NL3A 4JKSA 3RM5A 3ZS7A 4DU5A 3DZVA 3LK7A 2R3EA 4PVVA 4XCKA 4LBGA 5C41A 4K9CA 1JXHA 3LKIA 2NWHA 5A5FA 3RS8A 2A9YA 2AA0A 2AX3A 5C40A 4B8SA 3UMPA 4U7XA 5BYCA 4EN4A 1YGKA 3QCZA 4K93A 2YXTA 4LBXA 1EKKA 1YGJA 2AJPA 4S1IB 4S1IA 3GBUA 3NC2A 1E8CA 2JG1A 3B1RA 3EWMA 4LC4A 2JGVA 3B3LA 3RRFA 3RSGA 1W7KA 1UB0A 4E8ZA 1P3DA 5COJA 2AJRA 5TQIA 4O1GA 3RT7A 3UMOA 1JBWA 1YHJA 3GO6A 3BGKA 3N1CA 2AFBA 4LCAA 3RRBA 1V19A 4KALA 1TYYA 4O1LA 1UAGA 3LJSA 1GQYA 1TZ3A 2F7KA 3HN7A 2JG5A 2UUPA 3RRJA 3RS9A 3IQ0A 4C5JA 1RFUA 4E8WA 3RTEA 3B1PA 3RPZA 2WJPA 2HQQA 2Q5RA 3HICA 2A9ZA 3MBJA 3IKHA 1C3QA 2ABSA 3BF5A 2V78A 2UAGA 3EAGA 3NBVA 4S1HA 4UBEA 3VASA 4C5MA 4EBUA 4JJPA 3NCAA 2AM1A 4KAHA 3ZM5A 3K5WA 4C5LA 3DRWA 1W78A 3PYZA 4E84A 5CGAA 3RQQA 3HPDA 1KYHA 2DDOA 2QHPA 3B1QA 4N09A 5BYFA 2I6AA 3RQ2A 2VTEA 4C5KA 5C3YA 1O5ZA 2HLZA 1LIOA 4XF6A 4X8FA 3RREA 3VAQA 3IE7A 2AWDA 1U2XA 4B8RA 1LIJA 4YWRA 4KANA 3ZL8A 3UQEA 4EUMA 3RU3A 3NL5A 1J6UA 2VTDA 1ESQA 1RFVA 2DCNA 3CQDA 3MBHA 4K8PA 2PKMA 3QA2A 1RK2A 1L2LA 1RFTA 4K8KA 1E0DA 4KBEA 3RQ6A 3KZHA 3NM3A 3RTCA 3UQ9A 2XJAA 3FHXA 3NL6A 1VK4A 3RU2A 4GM6A 3RSQA 2AM2A 1V1SA 2PKFA 3RTBA 2I6BA 4CVKA 2QCVA 2WTZA 1GG4A 3K9EA
chains in the Genus database with same CATH topology
1DGMA 1WYEA 3RTAA 3H49A 3RPHA 3RSFA 1LIKA 4S1MA 3PZSA 3KTNA 3KD6A 5BYDA 2HW1A 3PL2A 3NC9A 2I5BA 1TD2A 1LHPA 1UA4A 2C49A 5BYEA 1GQTA 3NBWA 2DDMA 4JKUA 3B1OA 3I3YA 2PKKA 4K8CA 3UQDA 4K9IA 3H74A 4EOHA 4KADA 2PKNA 2RBCA 3Q1YA 4K8TA 5C3ZA 2R3BA 1LIIA 2FV7A 3RT9A 3LHXA 4N08A 3QAIA 3UBOA 5CGEA 3RO4A 2YXUA 3OTXA 4WJMA 5EY7A 3HYOA 3RTDA 3GO7A 3RQ8A 1VI9A 3RSSA 1RKDA 4C5NA 2ABQA 3RQ2A 1JXIA 1TZ6A 1GC5A 3NM1A 2C4EA 4XDAA 5TRWA 2VARA 3W4SA 4E69A 4XF7A 2XTBA 3IN1A 1RKSA 3RTGA 2DDWA 3RQHA 1V1AA 4E8YA 3IBQA 4DC3A 3HJ6A 3Q92A 5CM5A 3KEUA 1V1BA 2AB8A 1EKQA 3FHYA 4YL5A 3RQ5A 1BX4A 5EYNA 5F11A 1ESJA 3JULA 1LHRA 1VM7A 3UQ6A 3RQXA 5F0ZA 2F02A 3B1NA 3IH0A 3NL2A 3RY7A 1RKAA 3LOOA 3NL3A 4JKSA 3RM5A 3ZS7A 4DU5A 3DZVA 2R3EA 4PVVA 4XCKA 4LBGA 5C41A 4K9CA 1JXHA 3LKIA 2NWHA 3RS8A 2A9YA 2AA0A 2AX3A 5C40A 4B8SA 3UMPA 4U7XA 5BYCA 4EN4A 1YGKA 4K93A 2YXTA 4LBXA 1EKKA 1YGJA 2AJPA 4S1IB 4S1IA 3GBUA 3NC2A 2JG1A 4LC4A 3B1RA 3EWMA 3RRFA 2JGVA 3B3LA 5B6AA 3RSGA 1UB0A 4E8ZA 5COJA 2AJRA 5TQIA 4O1GA 3RT7A 3UMOA 1YHJA 3GO6A 3BGKA 3N1CA 2AFBA 4LCAA 3RRBA 1V19A 4KALA 1TYYA 4O1LA 3LJSA 1TZ3A 2F7KA 2JG5A 3RRJA 3RS9A 4C5JA 3IQ0A 1RFUA 4E8WA 3RTEA 3B1PA 3RPZA 2HQQA 2Q5RA 3HICA 2A9ZA 3MBJA 3IKHA 1C3QA 2ABSA 3BF5A 2V78A 3NBVA 4S1HA 4UBEA 3VASA 4C5MA 4EBUA 4JJPA 3NCAA 4KAHA 3K5WA 4C5LA 3DRWA 4E84A 5CGAA 3RQQA 3HPDA 1KYHA 2DDOA 2QHPA 3B1QA 4N09A 5BYFA 2I6AA 5C3YA 4C5KA 2HLZA 1LIOA 4XF6A 4X8FA 3RREA 3VAQA 3IE7A 2AWDA 1U2XA 4B8RA 1LIJA 4YWRA 4KANA 4EUMA 3UQEA 3RU3A 3NL5A 3CQDA 1ESQA 1RFVA 2DCNA 3MBHA 4K8PA 3RQ6A 2PKMA 3QA2A 1RK2A 1RFTA 1L2LA 4K8KA 4KBEA 3UQ9A 3KZHA 3NM3A 3RTCA 4E3AA 3RU2A 3FHXA 3NL6A 1VK4A 4GM6A 3RSQA 1V1SA 2PKFA 3RTBA 2I6BA 2QCVA 3K9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGM A;  1WYE A;  3RTA A;  3H49 A;  3RPH A;  3RSF A;  1LIK A;  4S1M A;  3PZS A;  3KTN A;  3KD6 A;  5BYD A;  2HW1 A;  3PL2 A;  3NC9 A;  2I5B A;  1TD2 A;  1LHP A;  1UA4 A;  2C49 A;  5BYE A;  1GQT A;  3NBW A;  2DDM A;  4JKU A;  3B1O A;  3I3Y A;  2PKK A;  4K8C A;  3UQD A;  4K9I A;  3H74 A;  4EOH A;  4KAD A;  2PKN A;  2RBC A;  3Q1Y A;  4K8T A;  5C3Z A;  2R3B A;  1LII A;  2FV7 A;  3RT9 A;  3LHX A;  4N08 A;  3QAI A;  3UBO A;  5CGE A;  3RO4 A;  2YXU A;  3OTX A;  4WJM A;  5EY7 A;  3HYO A;  3RTD A;  3GO7 A;  3RQ8 A;  1VI9 A;  3RSS A;  1RKD A;  4C5N A;  2ABQ A;  3RQ2 A;  1JXI A;  1TZ6 A;  1GC5 A;  3NM1 A;  2C4E A;  4XDA A;  5TRW A;  2VAR A;  3W4S A;  4E69 A;  4XF7 A;  2XTB A;  3IN1 A;  1RKS A;  3RTG A;  2DDW A;  3RQH A;  1V1A A;  4E8Y A;  3IBQ A;  4DC3 A;  3Q92 A;  5CM5 A;  3KEU A;  1V1B A;  2AB8 A;  1EKQ A;  3FHY A;  4YL5 A;  3RQ5 A;  1BX4 A;  5EYN A;  5F11 A;  1ESJ A;  3JUL A;  1LHR A;  1VM7 A;  3UQ6 A;  3RQX A;  5F0Z A;  2F02 A;  3B1N A;  3IH0 A;  3NL2 A;  3RY7 A;  1RKA A;  3LOO A;  3NL3 A;  4JKS A;  3RM5 A;  3ZS7 A;  4DU5 A;  3DZV A;  2R3E A;  4PVV A;  4XCK A;  4LBG A;  5C41 A;  4K9C A;  1JXH A;  3LKI A;  2NWH A;  3RS8 A;  2A9Y A;  2AA0 A;  2AX3 A;  5C40 A;  4B8S A;  3UMP A;  4U7X A;  5BYC A;  4EN4 A;  1YGK A;  4K93 A;  2YXT A;  4LBX A;  1EKK A;  1YGJ A;  2AJP A;  4S1I B;  4S1I A;  3GBU A;  3NC2 A;  2JG1 A;  4LC4 A;  3B1R A;  3EWM A;  3RRF A;  2JGV A;  3B3L A;  5B6A A;  3RSG A;  1UB0 A;  4E8Z A;  5COJ A;  2AJR A;  5TQI A;  4O1G A;  3RT7 A;  3UMO A;  1YHJ A;  3GO6 A;  3BGK A;  3N1C A;  2AFB A;  4LCA A;  3RRB A;  1V19 A;  4KAL A;  1TYY A;  4O1L A;  3LJS A;  1TZ3 A;  2F7K A;  2JG5 A;  3RRJ A;  3RS9 A;  4C5J A;  3IQ0 A;  1RFU A;  4E8W A;  3RTE A;  3B1P A;  3RPZ A;  2HQQ A;  2Q5R A;  3HIC A;  2A9Z A;  3MBJ A;  3IKH A;  1C3Q A;  2ABS A;  3BF5 A;  2V78 A;  3NBV A;  4S1H A;  4UBE A;  3VAS A;  4C5M A;  4EBU A;  4JJP A;  3NCA A;  4KAH A;  3K5W A;  4C5L A;  3DRW A;  4E84 A;  5CGA A;  3RQQ A;  3HPD A;  1KYH A;  2DDO A;  2QHP A;  3B1Q A;  4N09 A;  5BYF A;  2I6A A;  5C3Y A;  4C5K A;  2HLZ A;  1LIO A;  4XF6 A;  4X8F A;  3RRE A;  3VAQ A;  3IE7 A;  2AWD A;  1U2X A;  4B8R A;  1LIJ A;  4YWR A;  4KAN A;  4EUM A;  3UQE A;  3RU3 A;  3NL5 A;  3CQD A;  1ESQ A;  1RFV A;  2DCN A;  3MBH A;  4K8P A;  3RQ6 A;  2PKM A;  3QA2 A;  1RK2 A;  1RFT A;  1L2L A;  4K8K A;  4KBE A;  3UQ9 A;  3KZH A;  3NM3 A;  3RTC A;  4E3A A;  3RU2 A;  3FHX A;  3NL6 A;  1VK4 A;  4GM6 A;  3RSQ A;  1V1S A;  2PKF A;  3RTB A;  2I6B A;  2QCV A;  3K9E A; 
#chains in the Genus database with same CATH topology
 1DGM A;  1WYE A;  3RTA A;  2Y68 A;  3H49 A;  1GQQ A;  3RPH A;  1LIK A;  4S1M A;  3PZS A;  3KTN A;  3RSF A;  3KD6 A;  5BYD A;  2XPC A;  4C13 A;  2HW1 A;  3PL2 A;  3NC9 A;  2I5B A;  1TD2 A;  1LHP A;  1UA4 A;  2C49 A;  5BYE A;  2GCA A;  1GQT A;  3NBW A;  2DDM A;  4JKU A;  4BUC A;  3B1O A;  2X5O A;  3I3Y A;  2PKK A;  4K8C A;  3UQD A;  5A5E A;  4K9I A;  3H74 A;  4EOH A;  4E3A A;  4KAD A;  2PKN A;  5B6A A;  2Y67 A;  2RBC A;  3Q1Y A;  4K8T A;  4BUB A;  5C3Z A;  2R3B A;  2GC6 A;  2Y66 A;  3ZM6 A;  4C12 A;  1LII A;  2FV7 A;  3RT9 A;  3LHX A;  4ZIY A;  4N08 A;  1FGS A;  2JFF A;  3QAI A;  3UBO A;  5CGE A;  3RO4 A;  2YXU A;  3OTX A;  4WJM A;  5EY7 A;  3HYO A;  3RTD A;  3GO7 A;  3RQ8 A;  1VI9 A;  3RSS A;  1RKD A;  4C5N A;  2VOR A;  4QF5 A;  2ABQ A;  2F00 A;  2GC5 A;  1EEH A;  1JXI A;  1GC5 A;  1TZ6 A;  2JFG A;  3N2A A;  3NM1 A;  2C4E A;  4UAG A;  4XDA A;  1P31 A;  2VAR A;  5TRW A;  1JBV A;  3W4S A;  4E69 A;  4XF7 A;  2XTB A;  3IN1 A;  1RKS A;  3RTG A;  2DDW A;  4QDI A;  1V1A A;  3RQH A;  4CVM A;  2GCB A;  4E8Y A;  3IBQ A;  4DC3 A;  3HJ6 A;  3Q92 A;  5CM5 A;  3KEU A;  1V1B A;  2AB8 A;  1EKQ A;  3FHY A;  4YL5 A;  3RQ5 A;  1BX4 A;  3NRS A;  5EYN A;  4HV4 A;  5F11 A;  1ESJ A;  3JUL A;  3UAG A;  1LHR A;  1VM7 A;  2JFH A;  2Y1O A;  3UQ6 A;  3RQX A;  5F0Z A;  4CVL A;  2F02 A;  2UUO A;  3B1N A;  3IH0 A;  3NL2 A;  3RY7 A;  2VOS A;  1RKA A;  3LOO A;  3NL3 A;  4JKS A;  3RM5 A;  3ZS7 A;  4DU5 A;  3DZV A;  3LK7 A;  2R3E A;  4PVV A;  4XCK A;  4LBG A;  5C41 A;  4K9C A;  1JXH A;  3LKI A;  2NWH A;  5A5F A;  3RS8 A;  2A9Y A;  2AA0 A;  2AX3 A;  5C40 A;  4B8S A;  3UMP A;  4U7X A;  5BYC A;  4EN4 A;  1YGK A;  3QCZ A;  4K93 A;  2YXT A;  4LBX A;  1EKK A;  1YGJ A;  2AJP A;  4S1I B;  4S1I A;  3GBU A;  3NC2 A;  1E8C A;  2JG1 A;  3B1R A;  3EWM A;  4LC4 A;  2JGV A;  3B3L A;  3RRF A;  3RSG A;  1W7K A;  1UB0 A;  4E8Z A;  1P3D A;  5COJ A;  2AJR A;  5TQI A;  4O1G A;  3RT7 A;  3UMO A;  1JBW A;  1YHJ A;  3GO6 A;  3BGK A;  3N1C A;  2AFB A;  4LCA A;  3RRB A;  1V19 A;  4KAL A;  1TYY A;  4O1L A;  1UAG A;  3LJS A;  1GQY A;  1TZ3 A;  2F7K A;  3HN7 A;  2JG5 A;  2UUP A;  3RRJ A;  3RS9 A;  3IQ0 A;  4C5J A;  1RFU A;  4E8W A;  3RTE A;  3B1P A;  3RPZ A;  2WJP A;  2HQQ A;  2Q5R A;  3HIC A;  2A9Z A;  3MBJ A;  3IKH A;  1C3Q A;  2ABS A;  3BF5 A;  2V78 A;  2UAG A;  3EAG A;  3NBV A;  4S1H A;  4UBE A;  3VAS A;  4C5M A;  4EBU A;  4JJP A;  3NCA A;  2AM1 A;  4KAH A;  3ZM5 A;  3K5W A;  4C5L A;  3DRW A;  1W78 A;  3PYZ A;  4E84 A;  5CGA A;  3RQQ A;  3HPD A;  1KYH A;  2DDO A;  2QHP A;  3B1Q A;  4N09 A;  5BYF A;  2I6A A;  3RQ2 A;  2VTE A;  4C5K A;  5C3Y A;  1O5Z A;  2HLZ A;  1LIO A;  4XF6 A;  4X8F A;  3RRE A;  3VAQ A;  3IE7 A;  2AWD A;  1U2X A;  4B8R A;  1LIJ A;  4YWR A;  4KAN A;  3ZL8 A;  3UQE A;  4EUM A;  3RU3 A;  3NL5 A;  1J6U A;  2VTD A;  1ESQ A;  1RFV A;  2DCN A;  3CQD A;  3MBH A;  4K8P A;  2PKM A;  3QA2 A;  1RK2 A;  1L2L A;  1RFT A;  4K8K A;  1E0D A;  4KBE A;  3RQ6 A;  3KZH A;  3NM3 A;  3RTC A;  3UQ9 A;  2XJA A;  3FHX A;  3NL6 A;  1VK4 A;  3RU2 A;  4GM6 A;  3RSQ A;  2AM2 A;  1V1S A;  2PKF A;  3RTB A;  2I6B A;  4CVK A;  2QCV A;  2WTZ A;  1GG4 A;  3K9E A; 
#chains in the Genus database with same CATH homology
 1DGM A;  1WYE A;  3RTA A;  3H49 A;  3RPH A;  3RSF A;  1LIK A;  4S1M A;  3PZS A;  3KTN A;  3KD6 A;  5BYD A;  2HW1 A;  3PL2 A;  3NC9 A;  2I5B A;  1TD2 A;  1LHP A;  1UA4 A;  2C49 A;  5BYE A;  1GQT A;  3NBW A;  2DDM A;  4JKU A;  3B1O A;  3I3Y A;  2PKK A;  4K8C A;  3UQD A;  4K9I A;  3H74 A;  4EOH A;  4KAD A;  2PKN A;  2RBC A;  3Q1Y A;  4K8T A;  5C3Z A;  2R3B A;  1LII A;  2FV7 A;  3RT9 A;  3LHX A;  4N08 A;  3QAI A;  3UBO A;  5CGE A;  3RO4 A;  2YXU A;  3OTX A;  4WJM A;  5EY7 A;  3HYO A;  3RTD A;  3GO7 A;  3RQ8 A;  1VI9 A;  3RSS A;  1RKD A;  4C5N A;  2ABQ A;  3RQ2 A;  1JXI A;  1TZ6 A;  1GC5 A;  3NM1 A;  2C4E A;  4XDA A;  5TRW A;  2VAR A;  3W4S A;  4E69 A;  4XF7 A;  2XTB A;  3IN1 A;  1RKS A;  3RTG A;  2DDW A;  3RQH A;  1V1A A;  4E8Y A;  3IBQ A;  4DC3 A;  3HJ6 A;  3Q92 A;  5CM5 A;  3KEU A;  1V1B A;  2AB8 A;  1EKQ A;  3FHY A;  4YL5 A;  3RQ5 A;  1BX4 A;  5EYN A;  5F11 A;  1ESJ A;  3JUL A;  1LHR A;  1VM7 A;  3UQ6 A;  3RQX A;  5F0Z A;  2F02 A;  3B1N A;  3IH0 A;  3NL2 A;  3RY7 A;  1RKA A;  3LOO A;  3NL3 A;  4JKS A;  3RM5 A;  3ZS7 A;  4DU5 A;  3DZV A;  2R3E A;  4PVV A;  4XCK A;  4LBG A;  5C41 A;  4K9C A;  1JXH A;  3LKI A;  2NWH A;  3RS8 A;  2A9Y A;  2AA0 A;  2AX3 A;  5C40 A;  4B8S A;  3UMP A;  4U7X A;  5BYC A;  4EN4 A;  1YGK A;  4K93 A;  2YXT A;  4LBX A;  1EKK A;  1YGJ A;  2AJP A;  4S1I B;  4S1I A;  3GBU A;  3NC2 A;  2JG1 A;  4LC4 A;  3B1R A;  3EWM A;  3RRF A;  2JGV A;  3B3L A;  5B6A A;  3RSG A;  1UB0 A;  4E8Z A;  5COJ A;  2AJR A;  5TQI A;  4O1G A;  3RT7 A;  3UMO A;  1YHJ A;  3GO6 A;  3BGK A;  3N1C A;  2AFB A;  4LCA A;  3RRB A;  1V19 A;  4KAL A;  1TYY A;  4O1L A;  3LJS A;  1TZ3 A;  2F7K A;  2JG5 A;  3RRJ A;  3RS9 A;  4C5J A;  3IQ0 A;  1RFU A;  4E8W A;  3RTE A;  3B1P A;  3RPZ A;  2HQQ A;  2Q5R A;  3HIC A;  2A9Z A;  3MBJ A;  3IKH A;  1C3Q A;  2ABS A;  3BF5 A;  2V78 A;  3NBV A;  4S1H A;  4UBE A;  3VAS A;  4C5M A;  4EBU A;  4JJP A;  3NCA A;  4KAH A;  3K5W A;  4C5L A;  3DRW A;  4E84 A;  5CGA A;  3RQQ A;  3HPD A;  1KYH A;  2DDO A;  2QHP A;  3B1Q A;  4N09 A;  5BYF A;  2I6A A;  5C3Y A;  4C5K A;  2HLZ A;  1LIO A;  4XF6 A;  4X8F A;  3RRE A;  3VAQ A;  3IE7 A;  2AWD A;  1U2X A;  4B8R A;  1LIJ A;  4YWR A;  4KAN A;  4EUM A;  3UQE A;  3RU3 A;  3NL5 A;  3CQD A;  1ESQ A;  1RFV A;  2DCN A;  3MBH A;  4K8P A;  3RQ6 A;  2PKM A;  3QA2 A;  1RK2 A;  1RFT A;  1L2L A;  4K8K A;  4KBE A;  3UQ9 A;  3KZH A;  3NM3 A;  3RTC A;  4E3A A;  3RU2 A;  3FHX A;  3NL6 A;  1VK4 A;  4GM6 A;  3RSQ A;  1V1S A;  2PKF A;  3RTB A;  2I6B A;  2QCV A;  3K9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...