5CGLA

Fic protein from neisseria meningitidis (nmfic) mutant e102r in dimeric form
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
177
structure length
161
Chain Sequence
SIDEQSLHNARRLFESGDIDRIEVGTTAGLQQIHRYLFGGLYDFAGQIRLKEALVKIEQMPERTFEEIIAKYVRMNIAHPFLEGNGRSTRIWLDLVLKKNLKKVVNWQNVSKTLYLQAMERSPVNDLELRFLLKDNLTDDVDNREIIFKGIEQSYYYEGYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intrinsic regulation of FIC-domain AMP-transferases by oligomerization and automodification.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
molecule keywords Adenosine monophosphate-protein transferase NmFic
total genus 61
structure length 161
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 5cglA00
3LETA 3N3UA 3S6AA 2JK8A 5EU0A 4U07A 3SE5A 2G03A 4NPSA 5JFZA 4PY3A 4U0UA 5CMTA 3ZCBA 4N67A 5CGLA 2VZAA 4M16A 4XI8A 3SN9A 4WGJA 4X2CA 3ZLMA 4U0ZA 3CUCA 5JFFA 4U04A 2F6SA 4ITRA 2VY3A 4X2DA 4LU4A 5CKLA 4U0SA 5JJ6A 4X2EA 3ZC7A 3SHGA 5JJ7A
chains in the Genus database with same CATH superfamily
3LETA 3N3UA 3S6AA 2JK8A 1NH1A 2NUDA 5EU0A 4U07A 3SE5A 2G03A 2NUNA 4NPSA 5JFZA 4PY3A 4U0UA 5CMTA 3ZCBA 4N67A 5CGLA 2VZAA 4M16A 4XI8A 3SN9A 4WGJA 4X2CA 3ZLMA 4U0ZA 3CUCA 5JFFA 4U04A 2F6SA 4ITRA 2VY3A 4X2DA 4LU4A 5CKLA 4U0SA 5JJ6A 4X2EA 3ZC7A 3SHGA 5JJ7A
chains in the Genus database with same CATH topology
3LETA 3N3UA 3S6AA 2JK8A 5EU0A 4U07A 3SE5A 2G03A 4NPSA 5JFZA 4PY3A 4U0UA 5CMTA 3ZCBA 4N67A 5CGLA 2VZAA 4M16A 4XI8A 3SN9A 4WGJA 4X2CA 3ZLMA 4U0ZA 3CUCA 5JFFA 4U04A 2F6SA 4ITRA 2VY3A 4X2DA 4LU4A 5CKLA 4U0SA 5JJ6A 4X2EA 3ZC7A 3SHGA 5JJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LET A;  3N3U A;  3S6A A;  2JK8 A;  5EU0 A;  4U07 A;  3SE5 A;  2G03 A;  4NPS A;  5JFZ A;  4PY3 A;  4U0U A;  5CMT A;  3ZCB A;  4N67 A;  5CGL A;  2VZA A;  4M16 A;  4XI8 A;  3SN9 A;  4WGJ A;  4X2C A;  3ZLM A;  4U0Z A;  3CUC A;  5JFF A;  4U04 A;  2F6S A;  4ITR A;  2VY3 A;  4X2D A;  4LU4 A;  5CKL A;  4U0S A;  5JJ6 A;  4X2E A;  3ZC7 A;  3SHG A;  5JJ7 A; 
#chains in the Genus database with same CATH topology
 3LET A;  3N3U A;  3S6A A;  2JK8 A;  1NH1 A;  2NUD A;  5EU0 A;  4U07 A;  3SE5 A;  2G03 A;  2NUN A;  4NPS A;  5JFZ A;  4PY3 A;  4U0U A;  5CMT A;  3ZCB A;  4N67 A;  5CGL A;  2VZA A;  4M16 A;  4XI8 A;  3SN9 A;  4WGJ A;  4X2C A;  3ZLM A;  4U0Z A;  3CUC A;  5JFF A;  4U04 A;  2F6S A;  4ITR A;  2VY3 A;  4X2D A;  4LU4 A;  5CKL A;  4U0S A;  5JJ6 A;  4X2E A;  3ZC7 A;  3SHG A;  5JJ7 A; 
#chains in the Genus database with same CATH homology
 3LET A;  3N3U A;  3S6A A;  2JK8 A;  5EU0 A;  4U07 A;  3SE5 A;  2G03 A;  4NPS A;  5JFZ A;  4PY3 A;  4U0U A;  5CMT A;  3ZCB A;  4N67 A;  5CGL A;  2VZA A;  4M16 A;  4XI8 A;  3SN9 A;  4WGJ A;  4X2C A;  3ZLM A;  4U0Z A;  3CUC A;  5JFF A;  4U04 A;  2F6S A;  4ITR A;  2VY3 A;  4X2D A;  4LU4 A;  5CKL A;  4U0S A;  5JJ6 A;  4X2E A;  3ZC7 A;  3SHG A;  5JJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...