5CGTA

Maltotriose complex of preconditioned cyclodextrin glycosyltransferase mutant
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 232
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cgtA01
3FN9A 2XQBH 3QCVL 5D7SL 3STLB 4GG6A 4TVUA 5IFAH 3GB7B 1WZKA 2E3VA 4OUEA 1R7OA 4J4PA 4PRDB 2ZCKL 4UI2A 3UYRL 2R0LH 4GXUM 1F4AA 2NZ9D 1BVZA 4NT6A 2ARWA 4OIAA 5F7HA 5CJ8A 2C8NA 2NY2B 1C5DB 3OJDA 5LBSL 4JFUA 2FLBT 3CZKA 4XCFL 3GJFH 1NL0L 4J28A 4OJFH 1E0VA 3CDFA 5DRXB 1T0PB 3WIFA 1AR2A 2AJVL 4GSDH 5DQJA 5T1DL 1FOBA 2EXYC 4OFDA 2EKSB 4ODSL 4HGKC 4FFYL 5D1XA 3EJZD 3ZHDA 1V6YA 1VFBA 4YQXH 4OI8A 3WUZA 4NQEE 3AHXA 3T3ME 4H25B 4HPYL 3THDA 4P46C 3S4SA 4IIQA 3FQUB 1OM3H 3X14B 4MNQA 1H49A 3MLXL 4HJGA 1K8IA 5F6HJ 4LX4A 4AWEA 5I3DA 1IT9L 5JR1L 1HQRB 4M24A 4BFGA 1T03H 4LPVA 5DTFA 3RFZC 4L3CA 2JIXD 5I24A 1ISZA 2L7JA 4PTVA 1MREH 2NTSP 3QIUB 3TBSA 4C7GA 2FSEB 5GZND 1F42A 3KWXA 1S8DB 1WDPA 4AEHL 3L4XA 2EEBA 4M81A 3SKMB 1P4LB 1G9NH 3PV7A 2OK0L 4ODXB 4LPXA 2I9TA 1M05B 3QUZA 1LQ0A 4XH2A 3B4NA 1M7IA 4G6AC 3ZKMD 2OS7A 4C4KO 5IWLC 1KYOJ 4NYLB 4YHKL 5ILTH 2VDOH 4NCC1 1UWXH 5EU3A 1GAFH 4XPTL 1OSPL 2VL5B 1UEMA 2VDNH 2YN5A 5FIPA 5F6IC 2IWGA 2FJGA 1LWJA 3BUPA 1KOAA 1S7WA 3VI4E 3QR2A 4PREB 3E3QC 4WI9A 4FLSA 1RSFA 2F15A 4FFWD 5HHOA 2PWHA 3TO4B 1ZVSA 4HT1H 5CZXC 1R3IH 1VPOH 2J75A 4Z2KA 3BUBA 1KTRL 2FRGP 4E42A 5INDA 2VDLL 1BF8A 4WKFA 3ILPB 1YNLH 1BQUA 3AFBA 1RZFL 3FFDB 2WWMC 4NZTH 1BFNA 2BC4B 3NJ3A 4DQOL 2G9HA 3L3KA 3MUGA 1P6WA 3MUHL 4NQED 2P5EE 4N0YH 3IVKB 3Q1SL 1T0NA 1YECL 3EYOA 2WHLA 4P9MH 3TYGH 3AREB 4ZD3H 5A3ID 1QSED 1QSZA 3EDDA 3I3DA 4FQ2L 3EIFA 2X4UA 4XP1L 5F71A 1JGDB 4HUVB 5IFHL 3S98A 2HTLD 5I18L 5B21A 3JV6A 3O3UN 3TCLB 1QNPA 2R9HD 3ZJKA 4X6CE 4WY7H 2R1XB 1NLDL 2R29L 1QX1A 4MDOA 2A6DA 4JDZA 4W8BA 2JJWA 1VEOA 2HVJA 1RZ8B 4KJQD 4OF5A 3AVEA 5I71C 2CYGA 1ES0B 2Q76A 4AZGA 2VQTA 1UA6L 5TJWK 1L7TL 2GJZB 3TESA 4PSPA 3NA9L 4IOIA 5T3XE 2RAMA 1IGTA 2GTWA 4XGZA 5CGYC 2CH8A 5K9JH 3ARDB 1JWMB 1MCWM 3VFVA 3F7VB 2D03L 1DUZA 3KPSB 3NCYP 1OTTD 4F80A 1F00I 4Y4HD 4CN6A 1TMCB 4EUPH 1X7QA 3NN8B 4MB4A 1IEAA 1ZLWK 1KB3A 1KEML 1D2KA 5EUOE 3V8OA 4DK6A 4Z7OF 4WHDA 2R4RL 4ACPA 4E5XB 4JFFE 4NNXA 5A16A 3FQNB 1XIWA 1HHJA 3C8KB 3PZUA 5D4YA 5A1AA 1P7QD 4MB3A 2X2IA 2YHGA 1B0RA 1VKXA 4ATDA 5CCKL 1Q9WA 2NY6C 4Z77B 1G7HB 3LEYL 4M1GL 1UASA 3SDYL 1G6RH 1M03A 1TXKA 15C8L 1A3RL 3UTSD 5JIPA 2IBBA 4LLYA 1HILB 4UQAA 1Z9MA 4JAMB 4K9EH 2VXVL 5J7CC 3MREB 5GQBA 4NRRA 2Y07L 1D6VH 5EBMA 3S96B 5CG0A 2JIXA 1NC2B 4F3FA 4KXZH 3VGHA 1EMTL 3QG6B 4NP4H 5JHLH 5SWQB 3LRSB 3QO0A 4OCYL 2D7QA 4N1CA 4QKXB 5LG1A 4WJ5B 1DL7H 3S37L 4Q6IB 1OARL 3VXRA 1U3HD 5CKGA 2ZUTA 1EVUA 4U1SB 2VDOL 3FAXA 3T1FB 1LK2A 3O6FD 1CFNB 4OZIB 1KCRL 1V3KA 3QDGB 3WHE0 5LGKA 3TP4A 1B3WA 3HUJB 3HC4H 3L4WA 3PZNA 3IXTB 1OGGA 1MSPA 1DR9A 1PGRB 2J4WH 2W9DL 1YEIL 4JFZH 3FKUS 3TO4D 1CE1L 1VF8A 5E9DE 5DJXB 3MCLH 1MF2L 3QBTB 4LU5H 2VLJD 3RPIA 4XCEA 1A6AB 1F6FB 2WINA 3JWOL 4H5SA 4O58H 1MAMH 1E28B 4ZTOH 3QWOB 2YPLB 2IPKB 2ZJSH 5CD5C 1T3FB 1YJDC 1CD0A 5B3NA 2OLDA 3X13B 1S7SB 1ZU8A 2NY7L 4J4PD 2FX7H 3RY4A 2ZCHH 4DQOH 4ETQB 4H20L 1M7DA 4LQFL 5KSAA 5E24E 2QF8A 3KDMA 1GVIA 5A2FA 3TTSA 3WS6C 4PJAF 1QHPA 2IAMC 3MJ9A 2HT2C 3MGTB 1IM3B 3WQ8A 3WJJC 4JJHA 2V5RA 4MD0A 3W5MA 1CLZL 1Q9OB 5F8QC 4P2OA 1P4IL 2KQMA 1CLVA 3K0WA 4FQXB 5FO8B 5L6YH 5BVJB 1LNUA 4D0BB 3MRHB 1MLBA 1GJUA 3MRFB 3VIMA 1P2CB 4ACZA 4MXVE 2WVSA 5FL1A 4LEOB 1QFPA 4PRDA 1BJMA 4WI7A 3WXVL 2XIBA 2YDSA 3WMCA 3LV3A 5T33H 1R75A 4DEPC 4YHPA 2DDQL 2CLZA 1MRFH 1YN6B 3D3VA 2GITB 3BUQA 4K8RH 3K7UA 3MRKB 1KPVA 3K2UH 4XTRC 1QBMH 2CDFA 3VMOA 4WDIB 4KHTH 1KIPB 1TITA 2IBZY 5GS1C 3PGDB 3GJFB 3CDGA 1JFQH 5FK9B 3AHZA 5JIHA 3S88H 4KHXH 4CNIB 4Z0BH 3WIHA 3PL6D 4HUWA 5TDNA 1UKPA 1A7QL 3QPQC 3HZKB 1BWWA 2IQAB 3ECBA 5DEFA 1RUQH 5DD3H 5C9JA 3MRDB 3C5JB 4PD4K 1NCWH 2WNWA 2XI9A 4F9LC 4WI8A 1NKRA 5CQ1A 4LQ1A 2CR3A 4MJ5A 5DJAB 5E2WL 1B2YA 2BFVL 3KEHA 5GJTL 2ARJQ 3T2PA 4JN2A 5DJ2B 4LCCB 4YHNB 4LSQL 3O6KH 3KPOA 3P73B 3CU1A 4BZ1H 3L5JA 2DL9A 3S88L 4G8FB 4PJEB 5I5RA 5D7SH 5A8PA 2GJ6D 5C09B 4YHPB 3ALPA 3JTSB 4RAVA 4RRPG 4V1DA 4EI5C 1HKFA 3ZSSA 3S8WA 4JRXE 3MJ9H 1ITXA 1ITBB 3TNMB 4PRIE 1O7DC 3JWOC 3D85A 2MFNA 3KWWB 4Z7NF 1EMTH 2DMBA 4NP4L 2FATH 1QRNE 5I16B 4NIKB 1TVBA 3VXSA 5T1KD 1GW1A 3UG4A 1ZT7B 2V2WA 4QCEA 1KB9J 2B8OT 5HPOA 1O7AA 2H8PA 5SX4H 1PG7H 2DQJL 1YMHA 1TG7A 4OD3L 4K7PL 3PZOA 4XBGA 1CICA 3DYPA 3QRGL 3H8NA 4U1KA 4OIIL 3WN5C 4KZEL 4RBPH 5AZEH 2BHZA 1JPTL 3VXUD 3QEQD 2VDKH 3FT3B 3AHTA 1JNHA 1TPXB 3IFOB 4DVBB 1DBBL 4UOW0 5ISZE 3OLIA 1CQYA 2QKIA 4L4TE 1NDMA 1H0GA 1U93A 2BNRD 2Z1KA 2FD6H 5H37H 4F57H 1Z3GL 5T1MB 4ZOCA 5F6HI 1CDHA 2DTMH 4LXFA 3D39A 1CG9A 1I8LA 5CBAB 1FG2A 1ZVSB 1MRDH 3LSOA 3SDDA 1XGYH 5CEZH 3DRTB 4J12A 1JYWA 3DI3B 3WN6A 1HJXA 2AJ3B 3VFMA 3A23A 4NO5A 5KVDL 3BP5B 4H20H 4OLUL 5GJSL 1VFMA 2VLRE 4JFYA 4YK4C 4R4ND 4DN4H 2VQ1A 4FQHA 3BRFA 1Q72H 4N5UA 4X99B 2RFXB 1W2PA 4UAOB 3BUDA 2X4UB 1B4JH 4JZJA 1HSAA 2R4SH 4P2RA 4RFEA 5D2NC 3IF1A 3IFPA 2VH5H 1AH1A 5ABFA 3FRPA 5LXGL 1NSNL 5ITFB 1JYVA 4OV6F 5A2AA 2P8MB 2AJVH 3FHAA 1XIWD 3HS0B 2X41A 3VFRB 2I24N 4FQXD 4BFEA 1I7ZA 5E99H 1I9EA 5CJ5A 3GSNA 1ED3A 4UZGA 3ZKXC 4Z2JA 1FNGA 4XUYA 5DD0H 4UNVA 1K5NB 2NXYB 5A6AA 1S7XA 5JW4N 4RMUA 4I48B 3U7BA 4U1GC 1QI3A 2XNAA 5KJRL 2VSDA 1G7PA 1J8KA 5IFJA 3CFJB 1M71A 1A4KA 3T0BA 4XCNB 2DI7A 2NW3B 1GZPA 1ZSDB 4NHCH 1MJJA 2OJEA 3FL7A 1GPOH 5E56A 5JXEA 3GH5A 4FOMA 5FCSH 3CPLA 1J05A 1A6VH 3SGJA 4KVNL 5I17A 4MDJB 4Z7UF 4E5XA 3VWJD 3SUSA 4MA3B 1JVKA 5FF6B 5JDJA 2NW0A 4X98A 5DURD 2UY7A 1KELH 1Q9WB 4HF5L 4NN5C 3W81A 1FHDA 1OGAA 4ZS7H 1MCIA 2R2CA 1HXMA 4DO6A 3O2WH 3RL2A 3CZGA 4AZHA 1V02E 4D71A 3MO4A 1UWXK 3CXDH 5FM5O 3V6ZB 3F7YB 4XBPB 3UO1H 1RUPH 2FWOA 3VA2C 4GW1B 3N1PC 4OCSH 2WHJA 4B0MM 3GM0A 3P0VL 1YEDA 2GSJA 2BNQD 2W60A 1UKSA 4P99A 3KXFE 3RJDA 4CRPA 2J7BA 4IDLA 4AD0A 1A9BB 2DBLH 2H9GB 2APBA 3NFPB 3DGCR 4XC1L 2CO6B 1TJIL 4IUGA 1JWSA 3G5ZA 4HUMB 5IV2A 1KIQA 5JLZA 2V5DA 1QNOA 5EN2B 1U91B 5BCAA 4XMLL 1XF3A 5I8KL 3DVFA 4JY5L 2FNBA 3UJJL 3NIGE 5CUSL 5LQBH 3U9UA 3H2WA 3IK2A 1GL4B 3UTSB 1J1XH 3HZYB 1C7TA 4HJ0C 1I1XA 1FE8L 2ZUQB 4GW5B 1OCWL 1IFHL 1KTBA 4XNXL 1QBLL 3H9SD 1QRNA 3FQRB 5H94B 3VNZA 4E2OA 3NCEB 2F54B 2Y5EA 4A6YH 1R24A 3I50H 4HCRA 3D5OF 5D6CA 1FA2A 2GAZB 3E2HC 4HJ0D 1JPGA 1MRCH 4ZD3L 4X6DF 1PD6A 3UBXG 4U1HA 4CDHA 1JGLH 1OAUH 1YEJH 2HFEB 5E2UH 4D0CB 2DLHA 1OPGL 5EU6D 3P0GB 4QO1A 3UCRA 2EDTA 5EPMB 4NOBA 4PJ9C 3L7FB 4KKAD 2F58H 35C8L 3DX6A 3MXWL 4JRXB 5E95B 5LGJB 3O6AA 3GNPA 4WY7L 3JV0A 4KK5C 4EDWH 3OZPA 3RZCB 4F7EA 1VBUA 2VAAA 2YLAA 4XWOC 4BZ2L 12E8L 3E1F1 1RIHH 3W27A 4Y5VB 2H1PL 3G04A 5DS8B 3PHOB 1AHWB 2DIAA 1O7SA 1CQKA 3UZEA 3AYRA 3W82A 3BZ4A 2GQHA 2UZIH 1WIOA 3D9AL 3NIGF 3TEUA 3TA9A 3GBEA 1N3NA 3BD4A 4UILH 2WKLA 2JIWA 4XNQA 4NUJB 1OSZA 2IG2H 1LE5B 2V3FA 3L5HA 1BD2B 3TBTA 1NL0H 3MMWA 3S37H 2A9NL 4LHUG 2BSSA 2PWFA 5LA2A 3BGFB 5BVJA 1N8ZA 4JHAH 4ZUSB 4J3TA 3LEVH 4RNRB 5IT2L 1D3CA 1X4XA 4UNIA 2HFTA 1P4LA 4M7LT 1IGCH 1E70M 3WH9A 1E4XH 3WF2A 1QWNA 4PJ5A 3D3VB 2XQBL 5IFTA 4KKCC 4AEHH 5DD6B 5K93A 4JRYA 5DTFB 4QCFA 3AIBA 3EO9H 4DO5A 2HLAB 3S9DB 4M7JH 5F7DA 2Q1EA 3V4PH 4IMLA 4AISA 4Z9KB 3ILQD 5HVGB 3AQUA 3QR3A 4PY7A 5D9OA 4W6WB 1WBXB 2EH7H 4S2SB 5D8WA 3VRLF 2JCCB 1HHGA 1T03L 4KJYA 2FX7L 4ELMF 2X40A 2UYLB 3OHXA 2FEEL 3L7EB 4HUWB 1ODAA 2H2SD 2Z8RA 4PJ7A 1KIPA 2NX5B 1FIGL 4TQEH 2E7LC 1MJ7L 3DX8A 3I75B 3ULVD 4GRWH 4N5ED 4JLRA 3S36L 4ELKA 4YQXL 5SX4I 3APGA 5AYIA 5A40E 3O2DH 2GFBA 4UIKL 4JHOA 4GZJA 2C3HA 2O5XH 3RA7H 1XCTA 4ZFMA 1CFQA 4HBCL 3OXSA 2D22A 4XCCL 3EO0A 3V4PL 3UTZB 4OGZA 1UZ6F 4KI5F 5C71A 1N26A 1WCGA 3V0WL 2F54D 4GAGL 1T66C 2RCSL 1VJSA 4YDKH 1P6FA 4LHUA 5KVMC 3C87A 3GJFK 5EA0H 1AVAA 3HE7C 5IKCA 4JO3H 1ZGLB 4YZFE 2C4XA 4EKXA 2B7DT 2PO6C 2E9WA 4JZOB 3MGOA 3HUJF 3TJEL 3Q5TA 5DC0A 2AAVA 1QQDA 4Y2OA 5DGQA 3SHSA 3I02A 1EXPA 1KPRB 3DV6B 2CQVA 1JAEA 3DBXB 1VEPA 2X1QA 1UB6A 3CZFB 1EQCA 4JEGB 4D9LH 1S7VB 4U6YA 3ARDA 5IQ9A 4LPWA 5K59E 1CBVL 2XM2A 4BQ3A 4XC3H 4ZG1A 1TFVA 3RWGA 5IB1B 1X44A 1Z0NA 2BNQE 2YC1B 2BNRA 2MJWA 4Y19E 3CVIH 4GW4A 4JKPH 4JQXC 1SM3H 4AK1A 3HNTH 2Y72A 1BZ7B 4J23A 4M8QA 3WSQL 4F7CA 2ESVD 1M01A 2G5BA 4J6RL 3RVWC 2AXFB 3WL9A 4MPKA 3U4EA 2H8PB 1U8NA 2ZUNA 3RWHA 1QHZA 1JK8B 3P11L 1DLFH 2VUYA 4FNPA 1K4CB 4X0KA 3Q2CA 1A4JA 3RILA 3SDCB 1FYTB 1NFDE 1E6OL 3BAEH 4D1IA 5C0AE 1FO0A 4AENA 3IRPX 4U6VH 4K8RL 1T80A 4MWFA 1QRKA 4BSVA 1JHTB 1T1XA 2W67A 2YPKB 4U3XA 3WQ4A 1EGJH 3DX4A 3PABB 5C0GB 5C6TL 4CUCA 3DHMA 4NQVA 4PJ8A 1NWSA 4BH7B 2EO1A 3VXMD 3LSOB 2R69H 1CLYL 3CX5K 5AG9A 5ITFA 1PVHA 2AVGA 4DZBB 3GSOB 4LBEA 1CZ1A 1PEZA 3TVMC 3VFSB 1U0QA 1FCCA 3AY4A 3MREA 3FQNA 4K55A 1KIUA 3C6LB 3S3JA 1KJ3L 4M03A 2VQ1B 4FQHB 3KJ6H 1FFNB 3BGMB 4DKFH 1VFAB 4GW4B 5MENE 2MPAH 4JR9L 2ADIB 4D1JA 1BBDL 3EYUH 4UV7L 1U95A 4QT5A 2GUYA 3AZRA 3L5XH 3FO9B 2OP4H 3DUUA 5L7XH 3WL0A 1AMYA 2EDFA 4OFPA 1WBZA 3ZDYF 1JXKA 1PYWB 3RGHA 4M62H 4LNVA 1YA5A 1A6TA 3OGRA 3SGKA 2DYPB 3PJSA 4J7RA 1ZSDA 3GSRA 1II4E 3GI8H 5AAMA 4GAFB 4G7YH 3N13A 2VJXA 4XCFH 2P5WD 3WO4B 4OJFL 2DSUA 1HYSC 3S96A 2WPGA 3OX8A 4QHLA 1A3LH 3AUVA 4X5LA 5B38A 4GKLA 3MLRL 1NMBL 2GDVA 3CFBB 4RIRA 3PABA 5C0GA 3VXMB 2EYRB 4QGYA 1U3HA 4XPAL 2YK1L 4LCIH 5FYKL 2BVDA 2FJFA 1IKNC 3EYFA 2XACC 2NMSA 1S5HA 1RQ5A 4HGWB 4KXZI 5DMIH 3TO2A 4PMRA 2F54E 1EX0A 3VGEA 1LDPH 5BRZB 2DH2A 1RHHA 2N7AA 4LEXL 4UNTA 4M6OH 5DO2D 2OYLA 5HGBA 1EEYA 1RPKA 4Z0XA 1EXUB 2JJVA 5T1KB 2EKSA 5DRNA 3WE6B 5M95B 1FYHB 2WANA 2FYVA 3MLRH 5TDOA 5KEZA 1ZVHA 2WZPD 1EEUA 3W9EB 4E41E 1F97A 1GOHA 1L7TH 4PJXA 5ABGA 2W63A 1URLA 3TO4C 4AXNA 3OPZH 5C0CE 3HLAB 2J79A 2NR6D 5FIEA 3BSHA 4C56B 1OSEA 4HK0A 5I0DA 1E6JH 1QSFB 5KSUB 5SWSB 3MV7A 1YEFH 2Z8SA 1E4JA 1K85A 1KNOA 4UTBL 5ESAB 4U1NA 5F97E 3FQWA 4ELME 2F5AH 4FQXA 1A7OH 4N8VB 2HG5B 3VRLE 4MSWA 3RWJB 3BH4A 5IBLD 1CE1H 4W68A 4AMKL 3QCUH 2O92A 3UTSE 4FNQA 4P23B 4WWKB 1XSIA 2HAZA 1JFQL 5DDHA 5HDRA 4WJXA 5DJDA 3VIFA 4DO4A 1UM6L 4IRZL 3ZDXE 1KV3A 5HVHB 2DBLL 4ONOA 4PN2A 1QFWM 3T0EA 3V7AE 3JV5A 3BW9A 1WPCA 1HIML 4NC1E 1MRFL 5DRNB 3WE6A 3SDDD 1EHLH 1N8ZB 2X2JA 3KPQA 5BV7H 4JY5H 1BVLB 1WWAX 4KC3B 1KXTA 2DH3A 3EKCA 3G6AA 2Y07H 1YECH 4NKOA 1JUFA 2BMKB 4LSUL 3WNLA 1UZ1A 3DVNB 2HT4C 3V8CA 5D4QA 3EHBC 3ULVH 2P7TB 1ISWA 1YEKL 3GH7A 4UV4H 2AK4A 2RHEA 2B1AL 4M5ZL 2VOTA 5TDPA 3T3PE 3CLWA 2ZUSA 3WKML 5JMRA 2FGZA 2KZ1B 2VC9A 4BH8A 4XVTL 2C1PB 1NBYA 5DT1L 4B7IA 1QBML 2C3XA 3LOWA 1PY9A 3RKPA 2IAND 1RZJL 1QPXA 2WW8A 2Y8KA 4U0RC 2NT0A 5E2WH 4BUGA 5BXPA 2FATL 2NSXA 3B5HA 1XZ0A 4OD2A 2QSVA 3TLRA 3L95B 4PLNC 1ZXQA 4R2GB 3DUSB 2IPTH 2JB6B 2GTZA 4OFYD 3F5KA 2CLRA 4HK3N 3I6LE 1P1ZB 1UGNA 1KC5H 2Q6WB 4OFYA 2XZAH 4WW2B 3WDIA 4BQBA 3GRWA 5IESH 3D2UA 2IALA 4HA3A 2F9BT 3RAJH 4TVSa 3OKYA 1QW9A 1WZ1H 3D4ZA 1P7KB 1AFVH 2YPVL 3FAWA 1RUML 4NHUB 3MJ7A 1GOKA 1XGQB 3QHTC 2NY4C 5F1IA 3IDJA 4Y4KC 1ZMYA 4JFWA 3U1SL 1B0WA 2KUTA 4F79A 4U1LB 1FNSL 1OTUD 2AK1H 3ZYZA 3DIFA 5EIIA 1NLDH 4Y19B 5CZKA 4OZFH 4GPNA 1ZGLM 1C8YA 2IMNA 1CFQB 5CJOL 1XGYL 5TQ2L 4XI5C 1WISA 2XGIA 3BSGA 3F5LA 1C8XA 1KCVL 2C1PA 4JHWH 1OAKH 4PUBH 4XI5D 3QNXA 2VLME 2X4NA 1D6VL 4OZGB 4JDVB 3UMTA 3ALWA 5HYJB 3S35H 3KR3L 5MERA 5CEYA 3I3EA 5D1QC 2WMGA 3RWDA 2E27L 3DX9A 1X5YA 4D8PA 1DWGM 4ZDHB 3RY5A 1H5BB 4X4MA 4JFEA 1N5YH 1NAMH 2AEWA 3WL9B 3EO1B 4GG6F 3KYOA 4OD3H 1QFWI 4XCYB 1TZIB 2X1XR 4GG8B 4UILL 1D5BA 2ZUXA 4HUNB 2E6JA 5JW4M 1E4IA 4TUOA 3BUYB 3BKML 4M8VA 3X11B 4KTEL 2MQ0A 1VBRA 1XCXA 2DIBA 4B3KA 5IHSA 3CHDA 2ZG2A 2XTLA 4ZAKB 3NPSB 5B3JF 2JKXA 2JE8A 3MCLL 1B6DA 1HDMA 5ACMA 4E41B 2WZHA 3RDTD 4MAZA 2BNQB 4OZFA 2WW5A 1KXQA 5ENWA 3LMYA 4GMTH 4L3ED 2N7BA 3CLFL 3MLPA 5D9MA 2DPEA 2P45B 3UJTL 5HDQL 3LS5H 3TT3L 2X9YA 5AD0B 4LGSB 1CXLA 3KPRD 3O8XD 4S1DC 2PUQT 1Q4NX 2YS4A 1MFCH 3MLUH 3MRNB 4AEEA 4FABL 4HH9B 3SUVA 1HKLH 2AERT 3SKNB 4LBEB 4KRPD 3DX9B 4HXBH 4PLOB 2FDBP 1UJTA 1NGYB 5F3BA 5ICZA 3FONB 5FUCE 2DT1A 1QSFD 2NXYC 4OGXH 3HAEG 4XWGH 4EZMA 2EEXA 4IHOA 1VB9A 4UQ3A 1E73M 5CZXD 1GCFA 5E99L 2AAAA 3BKJL 2F7OA 4JREC 2QQKL 3OKDA 4U1KB 4GMTL 2K7PA 1TJIH 3H0TA 3CUIA 1DBAH 1UR4A 5I19H 4NQTA 4DKEH 2IADA 4ML4A 3PZ9A 4BQ4A 1JGVL 4WTZA 4TYUA 5IFPA 3HG1D 5DT1H 1XF2A 3DC0A 1NDMB 2EQDA 3MFFB 5EZLB 1VJZA 5B8CA 3LXCA 3H3PH 3WFHA 3W4RA 5JOFB 3FOLB 3CH1A 1RZIB 1GJWA 3H55A 1HDMB 2Z8VC 4J3SA 1Y7VA 3ZYOA 3O9WB 2IPTL 4X7SH 4XPFH 5ACZB 3QXVA 8A3HA 1D5IL 2OMBA 3BH9B 3C9NA 3AXHA 2XWTB 4QRTB 5JPMB 3WF1A 3UPRB 1H3PL 4JO2H 2G41A 3PUCA 3ZE0E 4AYFA 2O61A 1JZ2A 5L8LB 2PNDA 3BQUA 2AXGA 2D9CA 2CIIB 1BSIA 2VRAA 5GZNC 1AXTL 2G75B 2AEPH 3O6FA 3RX8A 1DP0A 4X6CF 4GW5A 3RP1A 1PIFA 5EB8A 4L9LC 1J18A 1J1PL 4L8BA 2EDHA 5E2VH 1UC6A 3ARFD 1P4IH 3VRIB 3MMDA 25C8H 1OD7A 5E94A 4TUFA 1G9MH 4C56E 2YKLH 1ZA3B 3PGDA 5GS0H 1W0VA 4AG4L 3QHOA 5IB5A 1OOAA 4HMDA 4X9FA 1C8PA 2SEBA 3SQBA 1LE5A 2XWBB 4LKCA 2VISB 4GS7C 4RSVA 4PJXB 3ZE0F 1SM3L 5CJOH 5FO9A 5GGQL 1H3PH 1NWUA 4JO2L 3IU3A 4X80H 3W11C 3IDNA 1D6EB 1MXGA 2OSLB 3P9LA 4TULL 1NOWA 4FG6D 4HWEL 5FAAA 5D5MA 4NFBA 5B8CB 4YR6A 2OLHA 3SCTA 4EDXA 1UZ8A 2C5DC 1O6IA 2X4QA 1G94A 4WJ5A 1OTUC 3FNDA 5DO8A 4MZ3A 1OP3K 3O45B 2EH8L 4JE4B 1MCFA 1X6LA 2P44B 1XHGA 1ZHNB 1UZ4A 3BX7C 2R8SH 2C1OA 5KW9L 5BWFA 3NOIA 4M93B 2DYPD 2Y2WA 1QNRA 1CFNA 2W5FA 1D9KA 4JPVL 3P9WB 5KSBA 3D51A 5IHRA 2P47B 2FIKB 5DFTA 2VR4A 3L6FA 5F7MC 5L8KB 3O0RH 4G8IB 2WZEA 3MBEC 2WSPA 4G43A 3H42H 5A6SA 3VVGA 3FMGL 4TTUA 1A1MA 1CGTA 2ADJA 3HUJE 5IHLB 2E9LA 2JF7A 1PLGL 4LKXB 4HWEH 1HYSD 4YXKH 3S5ZA 1K6QL 4MJIA 3RVWD 4PJIA 3ABZA 4Z7VF 2FD6L 2Z92A 4LEXH 5E9DB 5C0ND 1T2XA 4DKFL 1G9HA 1CTOA 1K6AA 2EH8H 3BLBA 3ZL4L 1IVLA 3VPLA 1K2DA 2VDQL 4UQ9A 2EIEA 2B5IB 3MRGB 4JM2C 3IDNB 3H3BC 4HHAB 4BJLA 5GJSH 3V4VL 5DVMA 3OHXB 2ZUUA 5CHNB 1ESWA 1P69B 1WGOA 4K9EC 5D1ZA 4XNYH 1MCBA 3TOPA 3R8QA 5KOVC 3ZJ8A 5EOCJ 4AD5A 1CCZA 3RBSA 2NY3C 4WFEE 1TR1A 2XN9B 3UJJH 3SE3A 1MFAL 1A7RL 2J2ZA 4WGVB 2X1IA 1UCBH 4HC1H 5GSRB 1KXTB 1G6RL 5GS1A 2VDML 3M17A 2FECL 4XMPL 5ESQA 1V7NL 3MLTB 2XIIA 1FV1A 1OSPH 4UT7L 3RWEB 1TZGH 3QAZB 3SCQA 3LPPA 1EFXA 3WNKA 1JGEA 1P53A 1P1ZA 1S5IL 1DEEA 3KYKH 5CJBA 2IC2A 3DX6B 2VIRB 4I5BB 4K8RD 4FZEH 4KUCD 1JTPA 4Y0GA 3D2UD 5EU7E 1IZJA 1I7UB 4YEEA 2QTEA 3QSKB 4Q9BA 4DZ8A 1SQ2N 1RU9H 1XGTB 4P8VA 2O93L 3VXSD 4HWBA 4YDIH 4MTVA 5E7FA 1N3NB 1DQML 3RJXA 1XF5A 3HPJB 1ED3B 2BVQA 1J9YA 3QQ9D 3NABL 2Q86B 3O2DL 3WUWA 3CVHL 3DETC 3R06A 5C3TA 4I0PA 5BQ7B 1UJ3A 2EXWD 2YSSA 3M8OH 4M02A 4EUPB 1FL5A 3U6RA 2I60L 3EBAA 4OFIA 5IROC 3TYGL 4OUOA 2BX5A 3VGDA 4YHNA 2VR9A 4YK4B 4OF3A 4RNRA 4FZEL 5IIEA 1MHPL 1SVZA 4Y1AD 5TF1L 1JDAA 3KPNB 1IGMH 4NJAH 2VZ3A 4UIMB 3K74B 1TQBB 1E27B 4WLCA 1RZKH 4RGNE 1MW2A 3MRRB 3U4BH 1J10A 4JFXB 1TQTA 5DD6A 4FQJH 4GI9A 4BS0A 2HFFB 3GSXB 1DVFA 3VFTB 4X0KB 1OB1B 1OAQL 4YX2H 4JO1H 2VLRB 5D7KE 3HI5H 1AC6A 1MUJB 1CLOH 4I77L 5CP3A 4OLXL 3U7WH 5TQ0H 1C16B 2Y6SC 5DGRA 5HGHB 2CLVA 3D25A 5ID1A 5C70A 5CZVH 1RD6A 1F6LL 1CXHA 3TFKC 3UC0H 4DM2A 3QNXB 5MP6L 2JEQA 4UT9L 2NCMA 2WUBL 3OB0H 2EACA 3WH7A 4PJFE 3ZDYE 4N0CD 1AQDA 4U1IB 1BYBA 2HP4A 5C6TH 4N68A 4ONHB 5I66A 5CPSA 2VLLB 4OIFA 1YEGH 3UTTD 5J13C 4APQD 4QHLB 3QPQD 4OCRH 5I30H 2WHMA 3MRMA 1M04A 3DSNA 4CCDA 1XR9B 3KYOB 1TDQA 1YPZA 5E6IC 2FZ3B 5HJ3A 1R3IL 3HC0A 3U0TA 4X83A 1RJZA 1WP6A 3FB5B 1KF9B 1INQA 4TUOB 3QDMA 1HINH 3SKMA 4ZNCD 1JI1A 2FR4B 4TN9A 4WCYH 1U8PB 4GMSL 1BP3B 4XPHH 4Y88A 3ZE1F 3OKOA 1U2CA 5IW1A 4L5FL 3VINA 6A3HA 1LL4A 2YUZA 2WWKT 3MLVL 3IKCB 3HI6H 4KMQA 4FFVC 5L2KD 3DURB 5DJCA 4NYLA 1WITA 2Y5TA 4JG0H 5A16B 5C8BB 3TV3H 1FBIL 1IAOA 1GOMA 3VFOB 3DX7B 1UA3A 3B9AA 2ZOLA 2E27H 2ITDB 4UQ3B 2R69L 4XXCC 1C16A 5IW3A 4JQVA 5JHDA 2UY6A 1M4KA 4K3HA 2Z0BA 5IVNA 2VQUA 1R5VA 4HIXL 5SWSE 3C09B 3QUXD 4QRPD 1FFRA 1E4LA 4C4KT 2APFA 3AXLA 2V7HA 2ZNWA 2R29H 4M6NH 4V2BA 3HI1B 1XGPA 1H5VA 1J8HA 3ELAT 4IJ3C 3LS4H 1WNOA 2IQ9L 4NPYA 2FLRT 1KJMB 1NAMB 3O3BB 1W9VA 5E8OB 5L7XL 1BD2E 4MNHA 2BK8A 5FOBA 5FM4A 2EDRA 1FBIH 2BY0A 1U8LB 2ADFL 5HJ3B 3RVUD 4DW2H 4XPBL 2DKMA 5BW7C 5TDOB 5C7XH 1I9IL 3ARXA 4ODBD 3KYNB 5FUOL 4X6DB 5HDQH 5CIPH 3KL0A 4XMKH 1UYWL 1GOQA 1UYQA 5BZWA 2B4CH 1TA3B 4MXWH 1O7VA 3AZSA 3L3HA 1FZJB 4OZ4A 3KJ4C 4XHQA 4NI3A 5FHBL 2R4RH 4IRJD 1IAKB 4XP6L 1MVUA 1MCSA 2DT3A 5BO1H 4PRBB 3F7YA 3C5ZB 3L4ZA 4R8WH 1Q1JH 3VFSA 1ZAGA 2I9LA 4FXGA 4MNGA 3QUYB 1E4XL 3N1MC 1DBMH 2VAJA 1V3HA 4KVCL 4YBQC 3TIDA 3LEYH 4P4RB 1BZQK 4PB0H 4L4OA 3BMWA 5LGHH 1GUVA 2FJHB 3RGVD 4YPGA 5I19L 5IP4A 1IM9B 4HAGA 1LO5B 5JLZB 3V52L 2NQCA 4AQOA 3MSPA 1I85C 4ODVL 4IS6A 3HCVA 4HFUL 1P84J 4DAGH 4MAVA 3AS1A 3WFCH 4Z7OE 5D8JL 2AJXH 1V3LA 4OLXH 2HT2D 1BAGA 4NCC2 3O45A 4XV0A 1YNKH 2HRLA 1WJ3A 4NGHH 5BS0D 3FB8B 2IUZA 2OMNA 5ANMB 4KTDH 2UY3A 3VU2A 1I1WA 5I2IB 5IMLA 1JHKL 4JHBA 1T21B 1IEBA 1R3KA 1A64A 1R24B 1HIMH 1W1VA 2Q8BH 4GO8A 2J78A 4Z7UB 4E8CA 2APVA 3AS3A 4KY1H 3WIIL 4CKQA 1E1FA 4RX4A 3ARGA 3X3GL 1EA9C 1M6OB 4JZOA 5C09E 2FX8L 5DVKA 1T1YA 3CSGA 3DO3A 4FLOA 5DD3L 4MJIB 1JPFA 3DROA 4PRIB 4D2NA 4DFHA 5I73C 3WN5A 1GYAA 5MI0B 3VILA 5FA4B 3WNNA 3HC3H 1KXHA 4G43B 2CDGB 3QDGE 4HIHB 1YNKL 3OLEA 2JTDA 5GRZA 2HJKA 5CHNA 5I9QB 5DUBB 3BP6B 1NBZA 5IVOA 3ROOA 1UG6A 2LV4A 1RZGA 2CBVA 1CFTB 1GOGA 1WTLA 2XFRA 1BMGA 2J8GA 1FZMB 4XTRD 4M4PA 3PF2A 4JG0L 2QADB 3C2SA 3BE1H 3RKDD 1REIA 4CU8A 4L8CA 3T0ED 1OCQA 3BESR 3FO1A 1W8NA 4GFTB 5FGCE 1I8MA 2GK2A 5C0AD 3L3GA 1JP5A 1E55A 5D2LA 2V9RA 4WK9A 3CZEA 3ROLA 3ULVF 4HIEA 2B1AH 4M5ZH 4RZCA 4XRCA 1I3RA 3CVIL 5D7LD 1SMDA 4O9HH 1FCGA 5D7LE 3KZSA 4IMKC 1JG9A 5I76A 3VJ6A 4ZEPA 3PE9A 2AEPL 1FO0B 1YMMD 3DO7B 4V1DB 1TVHA 1XCQB 1EIBA 3V5DB 5GGVY 5HHQB 3C8HA 4ZFZB 2OJZH 1WSST 1X5JA 2X4OA 4KQ3L 1WKYA 5D1QD 1U8JB 5FHAH 4Z5RA 5GS0L 4HTYA 1DQTA 4XPGH 3DROB 2FHFA 4JVWA 4XPBH 2A3BA 4R0LA 4S1QH 4TVPD 2RR3A 4PJ9D 5C0AA 3BPNC 5C7XL 3TTOA 3T77A 1JWMA 3VFVB 1HCVA 3EFDL 3P30L 1YNTA 3DX8B 3I75A 1UWSA 1IC7L 1J0HA 4NSKB 2BVQB 2P24B 4X8JB 3HMWH 3MQIA 5FHBH 2CKRA 3ARRA 4QT5B 1IL1B 1HOCA 4U3HA 1UWTA 2QSQA 5C07A 4MB5A 1JUFB 2BMKA 1PYWA 1V0LA 5EIVA 3QUML 2X05A 3WEXA 2GJ6B 1XD1A 1FNSH 5I1CH 4M48L 4OSUH 5GGTH 5DMKA 4OUUB 4PJGA 4TOYH 2NZ9C 1EFXD 4NQCB 3RZWA 4XX6A 1DVFB 3MOAH 1VENA 4X6BA 5CWSB 1HJVA 4K3GA 2CERA 2CRMA 2AGJL 4X0VA 4HGMA 3LS5L 3TT3H 2F7RA 5E2TH 2DQEL 2HFFA 1MRCL 3Q1SH 4D0BA 4PGEB 1OIFA 4OT1H 1B0GA 4L3CB 3KPPB 3ZKND 3L3IA 2BCKB 5SV3A 1NC4D 4TRPH 2H32B 4OB5L 2ESCA 5C9KA 1K6QH 2BY2A 2X5PA 2QL1A 2CDEA 5AWNL 1T83C 1R7AA 1RIVH 2HT3D 4KRNA 2X4SA 5I1LA 3W0WB 3BYTA 1RU9L 5I1CL 3HNVL 3SCWA 1JZ4A 1YJDH 3TA3B 4R6UA 1TQCB 3FZUD 3AIWA 4C7DA 3MRCB 4I4WB 2CD0A 3BIKA 3SQOH 1ZBCA 3MRMB 4ZAKC 4EK7A 2IALB 1H0IA 2HJLA 3S5YA 3E3QE 2OBGA 4ZNEA 4D6FA 2NPLX 2MQ3A 1W1TA 4RE3A 2P43B 3MRBB 1U8NB 4RDQG 3MNVB 4NKMB 3VXRD 2EPKX 2O5ZH 3HJEA 1CGSH 1S9WA 3PHAA 5EZJA 3A6CH 3MO1A 3IVKA 4HX1B 2XG5A 3CXDL 1Z3GH 4PJCF 1IAOB 1IMHC 2F7PA 3C09C 1DJSA 2Q3ZA 1XH2A 1TZGL 1HKJA 1IKFL 2BVOB 4D6JA 4OZIF 5FUZL 5JA9A 3SURA 1FZKA 5F1OB 4LIQL 1X5FA 2DKSA 2R1XA 2BRQA 1W0WA 5C2BH 5C8JA 1MFUA 4LOUD 4KZDH 3STZB 4HOXA 1RUKL 4HPOH 4HEPG 3RWDB 2KPNA 3QWRA 4M29A 4XBPA 3GGWA 2X4SB 2X6MA 2D3NA 5L9DH 1ZGLP 4PJAB 1LEIB 1QVOB 4UCFA 4D94A 3DWTA 3MA7A 5AUMB 5KVFL 1LEKB 3QUYD 1QLFA 4QWWD 2XPGA 1L0XA 4XNXH 1AO7A 1L4IA 1W32A 4ZXBB 1E3XA 4XHJD 2C3VA 4QRRE 2LU7A 2X4PA 4LVOC 4ODTL 4JDZB 1E4KA 1MY7A 4HBCH 5JUVA 4HMCA 4LKCB 4J4PC 4PJCB 2F53A 2LABA 1LGVA 4POYA 1A6TB 1RY7B 2EIZA 4HDIB 4AZ7A 5CD3A 5F96L 3OXRA 2K3TA 4HWBH 4OTXL 5DK0B 1CR9L 4AL8L 1NGQH 2HN7A 2YFOA 1NEZG 4MNHB 3U9PH 5KW9H 4OQTH 3V6FA 3HC4L 5J1TC 2EXYD 4LRIC 3BHBB 1T1WA 1FPTL 2BVOA 2WB5A 5FYLE 4FZ8H 4K3DH 3CLFH 3RX5A 1OAYL 3BAJA 3VXQB 1FNLA 3W6LA 1AXTH 2Z31A 3KYNA 1EV2E 1I7ZB 4XB3A 3M7SA 3GSVB 4JN1H 4AH2B 5KS9A 2WMKA 2WBJD 1DCLA 5LVEA 1B1YA 4NN6C 3AM8C 1MLCB 3QUYA 2F53D 4NO2A 4M80A 4G8GD 4LIQE 5HI5C 3MFGB 2A6IA 4YIQA 5D96C 1KCSL 3LHPH 2Q6WA 3QDMD 1BFOA 4OGYL 3G5XB 5TFSL 3H0TB 1U36A 1NGPL 1MJJB 2WBKA 3U2SA 1A1OA 3QA3B 1AY1H 3HS0A 3VFRA 4YHZH 4KDTA 3C6LC 3VRJA 1OWRM 1UQZA 4PRHA 4I18A 5EZIH 1ZWIA 2P5WA 1NC4B 3SCPA 4F66A 3QUKA 1N82A 4HW6A 2CMRL 3S35L 3HFML 2YUXA 1AGEB 3SDAB 1GGIH 5BZDB 4G9FE 1A7BA 3D0VA 1HHKB 1WTGT 3W0WD 1T7YA 2YD9A 2UY4A 1IFHH 1UVQA 5E6IB 2OYPA 1QHOA 3FQWB 5DWUH 5CD5D 3OLDA 2NY0D 3WD4A 5ESAA 3EYUL 4NWUL 1AP2B 2D31B 2CXGA 1V6VA 4QOKE 1KENH 4Z95H 1ZA6A 4MMZC 4Q9RH 4X9GA 3RVXD 1NANI 1BFTA 1FH8A 3MRIA 5HGAA 4ELMB 5EBLB 3P77B 1QKZH 4JPIB 2Z91B 2W9LA 3HE6A 3MLXH 2ZXAA 4WEUD 5T3XL 1R85A 5IHZA 4ZTPL 5JOPD 3MYJB 3GK8H 1C92A 2Z35B 1WC7B 3RNQB 2DQUL 1TTFA 2OX5A 5CSZA 5D2LE 4CJ0A 5LGHL 3FT3A 3DHPA 3FXYA 3ZR5A 4E4PA 1I9JL 2VCAA 3FQTA 4EUPA 4JFQB 3QHNA 3K46A 3C6SB 1VFBB 4U1MA 4NN5B 4JFZL 5KSAB 1UZ6E 1D6EA 4KI5E 1V08A 4I3SH 1SYSA 4KI5D 1DANT 3NABH 2VLRD 1V0MA 1JRHI 2ICES 1MFCL 1E6PA 1A9BA 1GHFL 1GGYA 4YFLI 3UTOA 2XIDA 3V6BR 3U46B 5HI5D 1VCAA 2XFXA 2WXDM 1WIPA 4PFEA 2TAAA 1QFOA 3P4MB 1PZ3A 1OB1A 3QZWG 3RJYA 1ZT1B 1CL7H 2MCPH 1JZ8A 5IT2H 1G1CA 5C08A 2AEQL 3F7RA 3V6OC 4G80B 3RZCD 3LV3B 2ICWI 1FO0H 2HVKB 4CW1A 2WVTA 4NQDE 3RZCA 4WFFE 3MRKA 4JGUA 5C0AB 3IJ8A 3D3AA 1UR0A 2V5YA 3P0YL 3G04B 3RM4A 1FLRH 1J11A 1MFEH 5F1NB 4KV5F 3P4OB 3AOFA 3FMGH 3QQ3A 5AYUH 1GHFH 3A0OA 3VH8G 5CSUA 3P40A 4QHNB 4GKNA 3BAKA 3QOKA 4PB0L 1HWGB 2NW2B 4WDIA 5JBDA 4D9RE 2DT2A 1AGFB 3PGFH 3CNKA 2PBGA 3N9GL 2A2QT 3C5SB 4HIIA 4S1RL 4C59B 3U9PL 3PGCB 1D5ZA 3GSQA 4WHYH 4WWKC 3HE7A 2NNAA 1CS6A 1YQVL 3QI9C 4WI6A 3KPOB 5JXEC 1UWIA 5CEXB 3W39A 1GZPB 2PW2B 2GJPA 4QWWC 4NQCA 3TT1L 3UTPD 2DQFB 1EEZB 3DVGB 1MWAA 3JVGA 3G5YB 4B3LA 2ZOKB 2QLVB 2XQYK 4PGZA 4R90H 1DQDH 4E9LA 1AD0B 2XUCA 1MHEB 1UQSA 4E0RB 3WEMA 4UFIA 1NUNB 2BCKA 3ULVC 4MA8H 2V7NB 3IJYB 3T2NL 2G9HB 5HVFB 3GSNH 2VX7A 4WEMB 3HTLX 3QZWB 4TPRL 4WVRA 1T22B 2X42A 3L3OA 5IEKA 3N1FC 2YRLA 4YHYB 4P5MB 2QV2A 3RY6C 3U0PB 4ATWA 4X6BB 2CKSA 1HK6A 4A2LA 3H7LA 3A5VA 2V9QA 4R3SA 5EFFA 1T6VN 3TT1H 3WS3B 4DZBA 1LO0H 4HUVA 2NR6C 3T3PF 4LHJB 4GLRH 2BDNH 4X9BA 4X6DE 1U8QB 2QV4A 5D7IE 3IYLW 3CUPA 4XXDB 2YBUA 3CK0H 4FLQA 2R23A 2NY6B 4UBDC 1G7IB 2LQRA 3VXPA 1OGAE 3BWAA 4CKVX 1U91A 1U93B 4I0CC 3PGCA 4UDTA 3WFLA 4WFHD 1QO3B 1BGXL 3G5VB 2M26A 2XWEA 4WU5B 5F7LB 2EXOA 4O2CA 4QCIB 3CZ8A 1EHAA 5BV7L 4NO0D 2R0LL 2XRAL 1J7VR 4MAYB 3VFNB 4PMOA 5FOOA 4XBGB 3FZUC 1TJGL 1A3HA 3VTRA 2CHOA 2PTUA 4AEIH 1Y6NR 4U2YA 1K4DA 3ZDXF 3P11H 1VESA 4P2CG 3LXBA 5IB4B 1I1YB 1V5JA 2QMKA 5FECB 3ALFA 1K8DA 3MI6A 2I26N 3OAUL 5DHXB 4UINL 4UOQA 3C5ZD 3RWIB 4IRSD 2WCAA 1HEZB 5B3JE 3AIUA 4TTDC 5FV2A 5IQ9B 2EADA 2EC9T 4JM4L 3LN4A 2ZSWA 4MLIA 4D3CL 3G6MA 3BGAA 1BQLL 2PYEA 5F1KC 5I1JH 4GINA 1KFWA 1AR1D 5ANME 5CLWA 1SZNA 1AO7D 3GXFA 4MYWB 4M8QB 4GBXB 4E8DA 4P2OC 1RVFH 1UWUA 4P4KC 2C26A 2HA1A 1KCLA 2WMFA 5FA3B 1YEHL 2XPGB 5FV1L 5C0JB 2D4DA 5JHDD 4NWTH 1IQWH 4GQRA 3ARFB 2DQTL 4JHWL 1QVOA 1FYTA 4LAQH 1TUXA 2XA8L 3G6JA 4H0IA 2VH5L 5I6SA 5HHXL 1A7OL 2D0GA 3AICA 1GGBH 1J1XL 3SE3C 5INDB 2HT4D 1JF1A 4I48A 4PLKD 4DFIA 1OT1A 5MENB 1DLHB 2FH6A 5BVPH 2ZUQC 3IDMB 2VZSA 3L3KB 3V0VA 1SBBA 4H88H 1NEZA 4WV1C 4L4VD 1NWTA 2O61B 3SY0B 3QDGA 4P23D 3C8DA 2HT3C 4S11A 2FHCA 4DGVL 4L8DA 4HUUB 1WBYB 3RWFB 3KPSD 2MANA 1GVYA 4NO2B 3H53A 4JKLA 3OGVA 2PETA 4RQQB 3OR6A 5A8MA 4XNYL 2D0FA 3BFOA 1I1FB 3CVHA 2HJKB 5BO1L 1C5BH 3HNSL 1CTNA 5DHVH 2JIEA 1W0VB 1M53A 4DM1A 5J3HC 4TUJA 3NGBB 4NZTL 2PO6B 4MCYA 3RHWK 4B53A 3IFNH 3OBAA 3RGVC 5I15H 2ZX6A 2XG9A 2DQJH 4GKSA 1XCTB 4V1DE 3BW9B 2J7EA 5ECUA 2LTQB 5EUOF 3B9KB 2BVEA 3QEQE 1RZKL 4KTEH 3POCA 4P3CL 1A7PL 3U79A 1CECA 2P5WE 4EI5A 5IMMA 5FDYA 4ODVH 3IDIA 3VWKC 1IM3A 4ZXBD 4NXSA 2APTA 4EDXB 3PHQB 4HV8A 3S3SA 1U8IA 1LLOA 4PGDA 2CRIA 1WBZB 3EZJB 3KLAB 4V27A 2EE9A 3QO1B 1LL6A 3MRIB 4Q6YA 3L6FB 1B31A 4AD1A 1A7QH 4HLZH 5KSBB 1NFIB 3F12A 5E4EB 4GT7A 1SBSH 3MRRA 4TX8A 1F13A 2VAAB 4ZE5A 5J3HD 1QRNB 5H94A 2H2PD 1ZVYA 2F5AL 5CGMA 2DF3A 1EDQA 3IDYC 1JJUA 4JGMA 4TTDD 2HJFA 5B38B 5IHBA 3ZLQC 5JUEH 1I7TA 4YHMH 4CMMB 4NO3A 3U30B 4OD2B 1TTGA 5LXGH 2WUCH 1NSNH 1LK3L 4KRUA 1QSFE 4H8WH 4PGCB 2YD3A 2OZ4H 1MCNA 3V5DA 1P5VA 3GMLB 3S6TA 4NKDB 1N59B 1CD9B 3T0AA 1FYTE 1NFDB 4ZMAT 1UENA 3MLVH 5EZIL 5FB8B 3OKNA 1VPOL 5JQ6L 1A0QH 2AP2A 1K4CA 1AHWA 5JDSA 5J4MA 2HKHH 3WFDL 5LWYH 5I1KL 3WD2A 1BD2A 3TBTB 3SJVE 5D1XD 1XR9A 1ORQA 3DIFB 4QHKJ 4Y7MA 3SGDI 1Y0LB 2GIYA 3ARUA 4M9PA 4M1DL 4POUB 4RE2A 1DE4A 3TA3D 5EOQL 5I23A 4YGVA 1IL1A 2PYEE 1HF6A 3KLKA 3SPVA 2P1YA 4HS3B 1SY6A 3HUJA 2GVYA 2F5BL 3NBNA 3AY4C 3QRGH 4K71B 4F9LA 3RZCC 5J11C 1FN4A 5D1ZD 4C54A 3O3AB 1NEUA 1UEYA 5DJ0B 5C0NC 4HQQH 3RM9A 4HZLA 1EBPA 2Q8XA 3NPZB 4D6GA 3KJ4B 3EYVA 1YUHA 5MEQB 1KULA 3QT2A 3VM7A 1NMAL 4H5SB 5SV4A 3CX2A 2AXHA 1QOXA 5F9WB 3NZ8A 1FIEA 3MRLB 3TIEB 1T3FA 1XD0A 1I7UA 1HI6A 3RVUC 3PTQA 3SDCD 2OZ4A 2OSWA 4YNYA 4IRSC 1CLXA 5TH2B 5EH1A 2LTQC 5IROA 3MJ8A 1U2HA 3MNVA 4NKMA 2NNAB 1TZIA 1MREL 4LARH 4WI5A 4G7VH 3PL6A 5IMKB 2B4CL 5J1SC 5TE6L 1FNHA 2CPCA 5HSFA 2NY5C 3BSZH 3I2CH 3W0WA 1OM0A 2FYYB 5TDPB 3L3JA 2WK2A 3T4AA 3FQUA 3LCYA 4YXHL 3X14A 4NZRH 3QIBC 3BIKB 4WFGE 4MJ2A 2J7LA 5IM7B 3DXAD 3LQMA 3AS2A 4OCWL 4CN4A 3ET9F 2FEEI 4X6EB 1MW3A 3O4OB 3U4AA 4TOYL 4LYQA 3RVXC 1MW0A 2PF6A 3G6AB 2XXMB 5ECJE 2VERN 5IXEA 1NGWA 1IKNA 3B6SA 2MTPA 4W5ZA 3MX0A 3QZWA 3GJEA 3BP5A 4JFXA 4A6YL 4JIEA 3L95A 2O5XL 4WUUE 2R2EB 4W8LA 1BFSA 3RIFK 2EE6A 1V0NA 2C4FT 4X4ME 4RGNB 4ONGL 5EU3B 3QXTA 3TNNB 4JPKL 1QNSA 2CUHA 4KK6D 5CEZD 5CMAB 5E5UB 3HG3A 4M1GH 3C5ZA 5ID1B 3WQ5A 1D5XB 3KPMB 5EWIH 2GJ6E 2NLJA 4PJDE 4UDTB 1RZFH 1J1OH 2AK4D 2EIDA 5IB1A 2J5LC 4HFWB 4X4ZA 2Y9RT 2R39A 4NQCE 4Z6AT 2JF1A 1XT5A 5E1QA 1NWRA 3PBGA 1QWUA 4E42B 4LIQH 5EUOA 3ZE2E 4NQDD 1R3LB 3IJ7A 3MV8E 3SJVA 1SJVA 2VZOA 4ZS7L 1IQDB 4PJFB 2DJUA 3ULUD 4HULB 2E8ZA 2FZ3A 5JOFA 1OD9A 4OCXH 2CK2A 2HLFC 3MACH 1P4BL 5MHSE 1CGSL 4Y2DB 5ISZB 4MXQD 1BLIA 2J47A 2XA3A 3V5HA 3RPKA 4PCSA 5FYJH 4XNUL 1NBQA 2B0SH 1I1AD 4W5UA 4N8VA 4JY6B 3CX5J 1TLKA 2BSTB 2XKNB 1U58B 2QQLH 1MNUL 3DHUA 4CN1A 4FNUA 4WUUB 2J4WL 4GRLC 4R4FH 4U6TA 2VZ1A 1B0GB 4M7LH 1ULVA 4OJYA 4UDUA 1UHVA 4WNQA 4U31A 3OJMB 3C08L 4X6CA 5HVHC 3EO1A 3DRQB 2QHLA 2F8XC 1NARA 1HKKA 3NFSH 1QP1A 3DV4A 3E6FB 1VIWA 3CHFA 2X70B 4G9FB 3AHYA 5DT5A 3QNZB 1KCUH 3MLZH 5IB5B 4G6JH 1T0NB 5HI3D 4RAUB 3E6HB 1FDLH 3BN3B 3VRJB 4BH7A 4ZE4A 1YY9C 5MHSD 2PXYD 3F7VA 1WAAF 3LMJH 4HKBB 4HWNA 4KK9D 3HI1A 5GRJL 1BD2D 4RISH 3Q6FA 3D39E 5T3XD 3OF6A 1R5WB 2H26A 5ISZD 3SCMB 1ZS8A 3T0DA 1OAXH 2VXUH 4OQ1A 3GO1H 4KRPB 4FF5A 3GMOA 1TENA 5BXTA 1CF8L 1HHKA 2H6PB 3C08H 3PTMA 1FL6A 1Q9LA 3MRJA 2HMID 4Y2DA 1B4JL 3PWLA 5F96H 3L3GB 3KJ6L 4RFOL 2EYRA 3O4OC 4IPNB 4S1QL 3V0VB 2P5WB 5I1AB 3MV9E 1U58A 1MELA 4PJAE 5E00B 1CFBA 3AIRA 4TNWF 5I76B 3ZKXB 3AM8A 4OLVH 4OM1L 1A14L 4HA1A 5ENWB 4D3CH 4W70A 3D39D 1EDTA 5I30L 4IRSB 4G9FA 5EDXA 1RK1A 3HZMB 3VMNA 5LGJA 1YC7A 2E0PA 4LF3A 3VO0A 5EU6A 3TO2B 1EHNA 2V2XB 3W9EA 2UWEF 5KSBE 1DQJA 3RPMA 4TSBH 3CC5B 2JIXB 3VXTB 4WI4A 2YJQA 3ZHKA 4ELMA 2F74A 2MCG1 1EEYB 1RULH 2YL6A 1YNTB 1MIMH 1NCAH 3ULUL 3I6LD 5TE7H 2Z35A 1NGPH 4XMPH 1RHHB 4GQPH 4Q6IA 3QG7L 4TUJB 3BH9A 1JD7A 3SCSA 1N5AB 3ZTNL 4F15C 2H6PA 3GIZL 3BAWA 1BPVA 4X7TA 4ODTH 4BFIA 4NDMB 4N8CH 4FS0A 3CUHA 2LFGA 3MPCA 5E08L 2UVFA 4L3EA 1OM3L 2HVKA 5C0CD 5BVPL 2WMJA 4PJXE 3QOMA 1XF2B 1OWWA 2DQHL 2WMIA 1QBAA 3IDIB 2YIHA 4NQEA 4R7DB 2WNGA 1PZUB 4AL8H 1F2QA 1A6WL 3LRSA 8FABA 1EAJA 2E3ZA 3WUWG 4CJ1A 4NZCA 3HB3D 1XCWA 4KUCF 1FAIL 4I0KA 3TN0D 1D5MA 1HZHL 4C56A 1T5XA 3KAAA 1VSCA 3T1FA 4L4PA 4ZFOA 1T1YB 1JFXA 3S4SG 3JSSA 2XGBA 1IGJB 5L2KB 5IMOA 4WRLA 3M8OL 5F9OL 4CVUA 4HOZA 4OQTA 1E6JL 4GAGH 3UTTA 5IB3B 4OGAC 2H2PC 4YIQB 5T5FL 1W2KT 3VRIA 2GJXB 1INEL 1FP5A 3ROOB 1KT2B 2WVUA 1RUMH 2Q8AL 3LZFH 5FYKE 2GY7B 1C1EL 1KEGL 3OGCA 1AGFA 2XZQH 2XY1A 3BVTA 5ACLA 1EDGA 2BRRL 1AY1L 5DJYA 1QYGL 2V7NA 4NKOB 2YD6A 1UXWB 4Z18A 2VX6A 5EO9A 1T0OA 4N90D 5JBEA 4NM4L 2RGLA 4XB7A 3OKEB 4UOZA 2IFGA 1B3YA 4DN3H 3N9GH 4NKIH 1CBVH 1MFAH 2R1WB 2JF6A 2IH3B 2JEPA 3DVGA 2GAZA 4HC1L 4P2OD 3A3HA 4BZ2H 1XYFA 1UXSA 4XXCA 4OAWA 5A6KA 1AIFA 4JFDB 4WW2F 3WY3A 4XP6H 5EG6C 1JMZA 2J5LB 3JTTB 4Y5XB 3UTQB 5KTEH 3LKRB 5JW4R 3M6DA 5AZ2H 3QP3A 1GORA 5F88A 2R15A 1S5IH 1XGRB 1KXVC 3P9MB 1AKJB 4L4TA 3L4YA 3BP4B 5E4IA 1G7MB 3QI9A 2XFFA 3O6KL 4GJTB 1A1MB 2ADJB 4Y16B 4UTAL 1LG2A 3WF0A 1NGQL 1E43A 5HHPB 3O41B 5AUMA 2BNRB 4Z7QE 3L4VA 4IDJH 2JB6A 1I4FA 3V5KB 1FC1A 3GMMA 4Y1AE 4BQ6A 4YGAB 1L9MA 3TZVD 3MJ9L 4HKZB 5FECA 1BLNB 4ONFL 3TJHC 4LLMB 3ARDC 3MNWA 2EDBA 4M7KH 3NCCB 4CD7A 3X12A 5FYJU 4EDWL 2XSBA 3U0TB 4OUUA 3RUGF 2OTWA 2PCPB 1FFOB 4EVNA 2VE6A 4RA0C 4X7FC 3QIUC 1N4XH 1QUNA 1HP5A 3MRDA 1PG7W 2GY5A 4N0UA 2XN1A 3AREA 2AW2A 2IH3A 3JWDC 1LO4L 3IDYB 1KWKA 2ADGA 5DO2C 4PGEA 3X3GH 1F6AA 3LHPL 3MUGB 2R2EA 5ESVA 1SJEB 1V02A 3LN5B 5B22A 4OI7A 5JUEL 1HH9B 4Z7WE 4BA0A 2BC4A 4IMLB 2ITDA 4HXBL 5HDOA 3QISA 1N0LA 3T65B 3P4OA 4P9HH 5D7KD 5DUMH 3W53A 1L0QA 2KKQA 4MXVF 2GJZA 4U4BA 5E08H 2Q86A 3S34L 3PDOB 1ODUA 1A3QA 4OF0A 2OWWA 2DN7A 4KK8C 4YDJB 5CFHA 2KZWA 5D2NA 4HLZG 3MRCA 2O26U 3WBAA 2EDEA 3ZE2F 1XGPB 3LDBC 4N1EA 1J8HB 2HJLB 3BRGC 1GGCH 1I4FB 3QAZC 4LSSL 2YZ8A 4I18C 5I8KH 2AOSA 4EN3B 5DYOA 3VUPA 4OZFB 5F70A 5L0QB 4PJDF 5MENA 1D9KC 3R8BB 1GQJA 1GOWA 3P3YA 5A3IC 5K9KB 4CD5A 3MCKA 1NANH 2Y23A 3MCG1 3DLQR 4YUEL 1FH9A 4DGYH 5KSAC 1UH4A 1LDPL 2WWDA 2W92A 5IVXB 4I0PB 4UDUB 5BQ7A 2FH8A 2WCSA 2YPLE 2IAMA 3BKMH 3D0LB 3JZ7A 1QSEE 2EDJA 5ESVB 3D25B 5EC2A 3RQ3A 4PJIB 3VFGH 5I75C 5GGSY 5C0RH 4JCMA 3RI5F 4GG6E 3EBVA 1C1EH 4I3SL 2BSRA 3M1BB 1GZJA 1ODZA 1ADQL 4JB9L 4DWHA 1ZJAA 4L4VA 1ZLUK 1WO2A 4MQTB 5DC9B 3P77A 5K59F 5JZ7C 4QOKA 1KTDA 5DEZA 1WBYA 2YXFA 3RWFA 4O4YL 1FNEB 1WQVT 4ONHA 3UP1A 2VLLA 1BIHA 3MRGA 5DVOA 5IMMB 4IRJA 1IT0A 4JO3L 1UKOA 5EZOH 4K7FA 2QR0B 4WHTA 1U3HC 4G8GA 3C6LD 5E6YA 1R5WA 2XZAL 3BO8A 1ZLSH 3MA9H 3T08A 4QRSB 4H1LH 5H2BB 3AB0B 1X9QA 5J8OA 1HKLL 3V7MA 4R4BA 4MCYB 4U1SA 3UPRA 3VD4A 4YXLL 5C2UB 4QAWA 7FABH 1EGJL 1ZKAA 3W2DL 2JALA 1JK8A 1MIEL 2BHYA 4LRIA 3NIYA 4HWZA 4HDIA 4LSVL 5HD8C 3VD5A 1ITCA 1U8OA 1AXSA 3I6KB 2OR8A 3Q5OA 3WIHH 4Z7VE 1DN0A 1ZHLB 1HQ4A 3F5JA 3W24A 1OY3B 3ARVA 4IRZH 3ETBF 2IFFH 1QBBA 1R0AH 1Q8MA 2YPLD 1FORH 3O6LH 4MA3A 2IPUG 2GUOA 4YN5A 2A38A 4M7LL 5EOCH 4A6YB 1ERNA 3GBMH 3W29A 3ZQ9A 1RJYB 1UOKA 1OW0A 4YFLF 2W07A 3QB7C 4QRPA 5ALCH 1MY5A 4QY8B 1UT9A 5EO1B 1CNVA 1S7SA 2ZSWB 4RMQA 1B6UA 1GRWA 1WWWX 3QO1A 1V0KA 3WH8A 4YHOH 4LSUH 3SKOB 4QRQA 1C5DA 4JM4H 5A6BD 5IOPA 2G75A 3O6FB 4EKJA 3L3DB 1D5IH 3C6LA 3GXTA 3ZSTA 1B90A 4CD6A 4LCWD 1KUMA 2E7BA 1HJQA 4F8XA 4WKAA 1DBML 3N1GC 4JO4H 2LE9A 1BFOB 4WEBH 1SFSA 1R0AL 1BAFH 3H7BA 1A3LL 1ACZA 1OLLA 2ITCB 1L6XA 3FOMB 2OI9C 1Y18B 2XZCH 2ED8A 1NC2D 2OL3A 2X7LB 5FO8A 2IXUA 3OA5A 4PJEE 3TCXA 1TTUA 2HKFL 4PGCA 5DT7A 2ARJB 1IC4L 3WYRA 3N06B 2IEPA 1OF2B 2GT9B 3X3FH 3GM8A 1EOKA 3MBXL 5HVWA 3HG5A 3GSRB 2CKBL 4K94L 2WUCL 4OBRA 4FFZL 3LRKA 1A7RH 3VD3A 1E56A 1GGBL 2QEJA 5KN5B 4YHGA 3S34H 1JI2A 4LRNH 4D0CA 2VTFA 5GISL 2ICEA 2MPAL 3EOYG 1RAMA 3GH4A 2QPUA 4MQXD 1YEIH 3BPCA 1BOYA 4G6FB 4BH8B 2DSZA 5HYJE 2YUVA 5M7QA 3ECQA 4TX6A 4Q9QL 3VXUA 5FYLH 4Y89A 4CNIA 3TF7C 4QHKI 1KGXA 1JRHH 1GJIA 4U49A 2A1WL 3OF6D 4DN4L 4H8WC 1Q0XH 5IMOB 2W66A 3ARGD 4Z7WB 1MCRA 5DI8A 3WS3A 1T89C 3GJFA 4RWHA 1TQVA 2Y4SA 4OIBA 2BNUA 3HCVB 5GXBB 4JRYD 2GJRA 4Z7UE 3SE8L 1IGIH 2FYYA 2GJXA 3L3JB 4ISVB 4WW2A 3VIKA 3H7BB 4FRWA 1WF5A 1AQKL 5TGBA 3GO1L 3GI9L 2VRKA 1DEDA 4G7VL 4UINH 5BV7C 5HY9B 1H09A 1EFQA 2OXHA 2ZICA 5DEFB 3TIDB 1CU4H 1CWYA 4EIGB 4OGAD 2DIJA 5EOTA 3VX0A 4HIJB 2GJ6A 4XHJC 4DVRL 1A1NB 2NXZB 3U46A 4F8TA 3V2AR 4PJDB 1C5CH 5AYBA 4IS6B 1T5WB 1UR9A 1UM5L 2NY4D 2BERA 2DQIL 2DSKA 2KDGA 3BPLC 1KCSH 3DTXA 2C7UA 3DXAA 4GSDL 5T1DH 2XRAH 3BZFA 3J7HA 3HB3C 4Z7QF 5HYJD 3VE0B 1HHGB 1GIGH 1J5OL 5H37G 1V6UA 3BP4A 3SGKC 1BF2A 1UADC 4JDVA 5HYJA 43CAA 2YRZA 1DSFL 1V7MH 1XGRA 2CDEB 1YYLL 3CFEA 1UB5B 2IPKA 3QFJD 2VDRL 2F58L 35C8H 3D3VD 3MXWH 3QQ3B 3FB6B 4ALAH 4H04A 1JGDA 3ZT6A 4JLRB 4ELKB 2RQ8A 4X8XA 1UWGH 5KOMC 1F3JA 5MP6H 1GCYA 3SJVB 4RAHA 5L88L 4HKZA 1NCAL 3ULUH 3HE7B 2AJZA 1D5ZB 3BT2L 1NFDA 1JAKA 4FMFA 3KYMB 1KEGH 3DETD 2XZQL 4YDLC 4BQCA 3UESA 1C90A 4DGVH 4RRPA 4OCMC 2NLJB 4PMNA 3N11A 2NTFA 4PP1C 4QRRB 3EO0B 4F9PC 5BS0A 2EJ1A 1VADB 4QRUB 1PPIA 1RVFL 1ZANH 4PTUA 1KB9K 5GRUL 4J2XA 1ZOXA 3QUMH 1EVTC 1ACYL 4XWGL 1V6WA 5IBTL 3RL1B 4AYGA 3EJUA 4X7DC 4HS3A 4R2GD 4R97B 5DQDH 1QZ1A 4GXVH 1IQWL 2DLTA 3SDDC 4NJ9L 5KVFH 2V3EA 2Z1SA 5A6BA 1NEZB 3RWCA 1A22B 3AXXA 3L3OB 1DBAL 2YD5A 3DNKA 3NIDF 4WIQA 4UIMA 4N9GB 4OT1L 4YDJA 1W9UA 1UQYA 2QSCH 3A6BH 3ZKNC 1VEMA 1NUFA 3NZ8B 1I1FA 3WD0A 4XH2B 5E4EC 1LD9B 4OZGE 3RGVA 1WFTA 2EO9A 4GH7B 5IBLC 3Q6GL 1A6ZA 1FDLL 3PWNA 3W11D 5IBTH 4U7KA 1QO3A 2FO4A 1R86A 3M45A 4FQLL 4AD2A 4UR9A 3DGGA 3RDKA 2VZUA 4LARL 2VCBA 1A4JB 4LPTA 1NBVL 3FB8A 4MCZB 2PN5A 2DQDL 4NXKA 1VADA 4WSJA 4BZYA 2ATKB 4JQVC 1FZOA 1RMFL 5I17B 3EYPA 5LBSH 2Y5TB 4MDIB 3QRFM 2YKLL 1K4DB 3MLSH 4QXTB 3UC0L 4JFHD 3CXHK 2CCRA 1HXMB 1TVDA 3RL2B 4H8WL 4HU0A 3UR7A 3RBGA 5IFJB 1MW1A 3QGVA 2P46B 1BVKB 2VKWA 5DD1L 3NSMA 4OZIA 2CRZA 4NQXB 2GEEA 2FR4A 4FQIL 1WZLA 5INCA 1RJLA 1US3A 4D6DA 3LRHA 3S3PA 3TN0B 3KLHD 1O0VA 4OM1H 4D6CA 3CPLB 3OKMB 4MA1C 4O00A 1MCKA 2P5EA 4K8RC 3CZSA 3WQ6A 4JFPA 5CMAA 3IFLH 2W9EH 5B39B 4QOKB 4GS7B 1I7TB 1NCTA 4LSDA 4D8PB 4EANA 5I1KH 3WNOA 3TPUB 5DVLA 3VFUA 2ZXBA 3FO9A 1K9EA 1HIZA 3LKNB 4Y4FB 1BJ1H 4HUXB 4OCLC 5HHNA 3BQUD 3GKWL 1UACH 4NRXB 4WFGD 2XTKA 1KCVH 4QXUH 2ZWLT 2BP3A 4KH2A 4G9FD 1P7QA 2RBLA 4LVEA 4PUBL 2D7TH 3I6KA 4OLVL 3LQAC 3P2TA 1T7WA 5IBUG 5JIWA 3OX8B 4M7KL 2WMIB 3VXTA 4XRCB 3EYQC 5J9PB 1FZOB 1PX3A 5FKPA 2FB4H 5HPMA 3V6OA 1LG1A 5FO7A 1LK3H 2P5ED 1KYOK 3U83A 1YZZA 5D9SB 3R1GH 1SVCP 4IEFB 4QRPB 4RBPK 5ABDE 3PZTA 1I1AB 4NQXA 4XBEL 3W26A 3BT2H 4PJAA 1T4KA 1I85A 1LEIA 1FZJA 4OZ4B 3G9VA 2D31A 1IJ9A 1CD8A 4MQSB 1W0YT 4NN7C 4B5EA 4JFED 1B4RA 3UO1L 1KLFA 1CXEA 3OL2A 3D52A 3PHOA 4NQDB 4OCSL 3IDUA 3F7QA 4U3CA 2O5YH 4PRBA 1TJGH 4FQXC 3WV0A 1PDKA 1FZKB 5IHUL 1AGDB 2OR9H 3CHCA 5E9DA 2XVLA 1MVUB 1MH5B 3BJLA 3STZA 3RCNA 2G2RB 3V4UH 3GMPA 3TGXA 5CZVL 1UCBL 4XNMA 4BKLB 3PN8A 4D9LL 1IC5L 4Z0XB 3DJ9A 4RGOL 4YNYB 4EQ3A 4RFNC 3FOMA 4TTGA 3B9KA 3NIFF 5E5MA 3SCMA 3JVGC 5DFVD 3VD9A 5D6DC 5C0BA 5JTWA 1UWEH 2OP4L 5JIIA 1DQQB 3DMMB 3QG7H 1T21A 4G8EB 4M61A 4DCQB 5I1HL 1YEGL 3QI9D 2YZ1A 4P7NA 3QEQB 1BX2B 3QO0B 4JFTA 4P7QA 1BQHA 1OQOA 3PWLB 3ZTJG 3F65A 2DM3A 1TZHB 3MV8D 1RIUH 5A2CA 3MJGX 1WCQA 5F93C 4IJ3B 1OSZB 4PUDA 2WC4A 1UM6H 1WUNT 2F53B 2K7QA 4YBQD 1U92B 5T1LD 4X9IA 3B6SB 3UZVB 3CXHJ 1QNQA 4ZPVB 4MSWB 1NPUA 4O2EB 3MODL 4NFDA 5F7WC 1YQ2A 4XB8A 3B83A 5HI3C 3V6FB 4F58H 3EMCA 2Y06H 5KSUA 3EOTL 4NO3B 4NSBA 1RK1B 3HZMA 4Y4FD 1I8IB 1D9KD 1ZHBA 4H7VA 1ZT7A 4JZJC 5KSVB 1FYTD 1AQ0A 1HT6A 3JTTA 1E4NA 5DQ9B 3P30H 1BZ9A 3EFDH 4J3VA 5DRZA 2EE2A 5ELIA 1BREA 2BOBA 3GMLA 1FJ1A 3NDZA 4LFHG 2C7FA 3SGEH 4NZFA 5FB8A 4OLYH 5A6MA 1FFOA 4D6HA 5EZJB 2YDQA 1FVEA 1EO8H 4PJDA 3HA0A 4RGMB 1CPUA 1QR1B 3E2HB 4I3GA 1FFPA 4MS8C 1F58H 2FECI 2ESVB 4J3WA 2MOVA 4HIJA 3O41A 3QDJD 3U9UB 1BQHB 3QHZH 3I6GB 3VGFA 2W9EL 4V28A 2FGWL 4G6FD 3P4LA 5D2LB 5JO5B 4WF7A 4LLVB 2AJUH 1T5WA 1Z9SA 5J1AB 1MFDH 3D85D 4K7PY 1MLBB 5I8OL 4WHYG 2CUMA 3FO1B 5DHYB 1BQHG 1E5NA 2F18A 3SDYH 2I5YL 1R33A 1JPTH 1JDCA 1UYWH 3BZFB 2AEQH 2CHNA 3IGAB 3K81A 3ZYIA 1CFVH 3UYRH 3KLLA 1HYRC 3D0VB 5DMGD 3VDHA 1N0XH 1QNZL 4Y16C 1U30A 1JWUA 4P2QB 4PP1D 5E5RB 4ZFZA 1IC1A 3I02B 1UB5A 4HKJB 5AZ2L 3PL6C 3VSTA 4MAUL 2FO1A 1I9RL 1S9KC 3EAKA 3DV4B 3T8XA 1UR2A 3TZVC 3PWUA 1R3JA 3IFNL 4GMSH 5I15L 4K3EL 1ZK9A 1MFDL 4NCDA 3SQOL 2APXA 4IISA 2P8PA 4OI9A 5IUSA 3GI9H 2GK1B 3GRWH 1T2JA 5BMFH 2KBGA 2J8UA 1ZEAL 3A22A 4W89A 4JAWA 4ZFGH 3QDJA 3VG9C 1EHLL 1FVEB 3VA6A 3REVA 4U33A 4LCCC 3W5NA 1NCNA 4KROC 3T77B 2CLRB 2ENSA 1G9MC 3VGGA 5CILH 2Y1VA 3QDJE 3CIQA 4MJ5B 5DJAA 1MWAL 2O5YL 4Y19A 4KMTL 4DUVA 4MHHG 3ZO0A 4NRZA 1TCRA 1U8KB 5JPNA 1J0YA 3N0PB 3U4EB 3VI4F 4LPUA 4N90E 3M17B 4NNPH 5F1IB 1DWJM 3S97C 4PYSA 4PD4J 3CFIC 4RAVB 5BRZE 4UAOC 2R1YA 4H26A 2WBJA 4YE4L 3WD5H 3AFLA 3GSNL 2YPKA 3A67L 5ABEA 4QHUB 2YBRB 5A3HA 3GMNA 3T09A 2VX5A 4URIA 1CGUA 4AENB 3MANA 4NQVB 2CO7B 4Z7VB 4FTVE 4ZO9A 3B2VH 5F89B 2WBGA 3T0VA 2X1PA 3V6ZA 4HKXA 1CD1B 2WWMD 4R9HA 3FQXA 1PIGA 2IH1B 2XOTA 5GGSB 4M7ZC 3FN0H 3TBWB 1GHSA 1MCOL 3MV11 4RMSA 1YDPB 4MVBC 2NX5A 5C0CB 2DQHH 3CSPA 3SBWC 5DEGA 4HFWA 2E9BA 3MROB 5CEZL 1VFOA 5EB9A 3W9DB 5T33L 3GMRB 4JJ5A 3TJHD 3RAJL 1BFVH 5DRXA 1CFSB 1LDSA 3ARGC 2ZXDA 4ZSOA 3LIZL 4NNYA 5ADPL 3G6JF 5HHMB 1XYZA 1ZANL 3OB8A 1F2XK 1SJHB 3WH6A 4GAJL 2NY5H 1WK0A 1BJ1J 2F19L 2R2BB 1ORSB 5HDBE 4EJ1C 4PJ7E 5EU7C 1ZBKA 3EYSH 4PMQA 4J3OC 4ODXA 3I9GL 5I1DB 1NQ6A 3TPKA 2W65B 4KVCH 2VVNA 1HHJB 1RULL 2PTVA 3C8KA 4LASL 3OKMA 1BVKA 4RCAA 2VUOA 4AW7A 1FPTH 3PNWB 3JWNC 3PWVA 5EORH 1BTCA 5FYKD 3OLGA 4IOFD 1F90H 3NTCL 4ZFFA 1OAKL 2J88L 2C3GA 4MJIE 5F7EH 5CAYB 1JGVH 3DMMD 3IJYA 4XT1C 1S78D 3KYAA 1KJVB 4FMVA 2ICWA 1LO3H 4X7CC 4KRTA 1GPFA 2G3IA 2D73A 4PIRF 4Q58C 4HKXB 2XVPA 5AEAA 1CXIA 3MBEB 1W0WB 1FE8H 4P23C 2AJUL 4P5TA 4P9HL 5DUML 1H3XA 2F19H 3NZHH 4JFOA 2VDNL 3WSUA 2Z31D 4HZAA 1WZMA 3G08B 5I74B 4FQLH 5DEGB 4FQ1L 3K2MC 3Q3GB 5EUKA 1LE9B 3VG9B 5IVXE 4YBLC 1AO7B 3UAJD 4LYRA 4GRWE 3O2VH 1MOEA 1E4WH 1KB5L 3QCTL 1BJ8A 3U7YL 3T0EE 3A6OA 1MIEH 4NRXA 1ETZA 5D2NE 5DSCA 1HJSA 1I3UA 1LILA 3MKKA 1DBJH 3BQUB 2I07A 5GGTL 1KPUA 4U6XA 4CD4A 3MOAL 3RWJA 5CEZE 3O3EA 4UT7H 4PG2A 3WFHB 4HIXH 4JFDE 3QHMA 4LLDA 2ZE0A 4PMUA 1ONQA 3MOQA 4PJ5B 2X4TA 3V0AC 4JCLA 1JYNA 1FH5L 2VDPL 5IB4A 4P9ML 3KS0J 4NKQB 1ZT4B 5DJZA 4FQ2H 4LDEB 3MR9A 4GKNB 3FJTA 5MI0C 2G2RA 4IOFC 4HZ6A 2DT0A 3SCOA 3WHE1 4NO0B 4L4VB 1EO7A 3F6LA 4KFZC 2YFNA 1KWGA 3EDKA 3MBEA 4QRPE 3KR3H 3EYOB 4M7ZB 4PG9A 1BOGB 5C0FA 3IU4H 1ZWIB 2GDUA 4PV8A 1BQSA 1Z32X 3B3IB 1DN2A 2DQGH 4Y1AB 2EICA 4HZ7A 4DOHB 3TBVB 5E8NA 1BAFL 5D6DA 3VFPA 3G5XA 1KN2L 4LVNB 3G6DL 4GIAA 3HR5A 3KHQA 1IEAB 4R2GC 1CIUA 1RPQA 3FO0L 5FYJD 3UJIL 1MXDA 3MRHA 1A7PH 3MRFA 4RDQF 1U8LA 3QUXA 1X1NA 1UKQA 1UVQB 4L3AA 3SEPA 1W72B 3GKZA 2CR6A 4LDOB 4LLMA 1TZHA 4JM2A 5DHVA 1HXJA 1PEWA 3T4YA 3PZQA 3GUTA 4U3AA 3SDAA 1C5CL 1KEMH 1TE1A 4EVNB 4PRAB 2ZX5A 4O2EA 4XZBA 4C57C 3PQYA 4G8EA 3FN0L 5HGAB 1MCOH 3WLWD 3Q5YA 4HWUA 4IIQB 3FFCE 5ICYA 3LS4L 1FORL 3F6IA 3S35X 1JYXA 1JGIA 1W9DM 3IFLL 1RZ7H 3JWOH 4LLYB 1G9NL 5DQ9A 4NO0A 1W72L 3NA4A 3GYCA 1AHWC 2FJGB 2A3EA 4JPIA 4P57A 5FK9A 4AC1X 3CFCH 3T65A 5CGYD 3OR7A 1WVZA 5CINH 4YAQB 1PW3A 4G6JL 4OSUL 4ZPVA 4CVWA 3PGFL 5HD8D 1W8OA 1NGXB 3H9HA 2IQAA 5I1IH 2EPLX 1KG0B 4XP4L 5IVZA 4P59L 2M8XA 3EOAA 2L0DA 4AZ5A 1KTCA 3TJEH 2YC1A 5EORL 43C9B 2J7CA 5E2TL 5CP3H 3WF4A 1M7IB 3BDYH 4RWYH 1QFUH 5DRWB 3JV4B 3ILPA 2J88H 2ILLA 2XZCL 4ETYA 3RRQA 1I1YA 4N42A 2IANE 4H1LA 4Z8FL 3OQ3B 5ALBH 1EH9A 5FCZA 4L8SA 4XPHL 4DKAA 5BXRA 5CKAA 1YY9D 5FGCB 5HI4D 3OKEA 5HHME 1BECA 2EYSB 1HEZA 2WWKO 2VCCA 1CVSC 2QLYA 5DJXA 2WLZA 1QSFA 1UFUA 4OZGA 5GGRY 5DC4B 3BKYL 1ZV5A 1KXVA 2DDQH 3MV9D 1AQHA 4LLAA 3L5WB 1Q38A 3STLA 2W0KA 4GG6B 3BZDA 3NCMA 4AIZA 5C07D 3HPLA 3OB0K 3BVUA 4J3XA 3UG3A 1G1YA 3LXAA 3VIIA 2VITB 4GUPA 5L2JB 3CFKA 3ULSB 2FGLA 4MX7B 2OYMA 5DUPH 2ENYA 4Z7WA 2R56L 5D1QA 5IF0A 1CL7L 2P8LB 1KBBA 2NY7H 2DGAA 1KGUA 1EJOH 2J12B 5ILTL 5ITBH 4W7WA 2EDQA 5DQJB 2RJMA 2W4XA 5FYJL 3WNMA 1TQBC 3IDXH 4NM8L 3ULUF 1W1YA 2PW1A 1UWEL 1WDSA 1E6SM 2ADIA 2DD8H 4OKVB 4P2QD 3D18A 4F9PA 3X13A 3WY2A 2W61A 1AQKH 2V2TB 4K2UL 1W9PA 2IANB 1QACA 3AIQA 2BNRE 1FL5B 4JPWL 2A6JB 2APWA 3MZTA 3D39B 5EOTB 3MSDA 5FCUL 3BEVB 4LPYA 3X12B 2Q7NA 1TNNA 4NBZB 1XF4A 5D7JA 5HYFA 4JHZA 1G7JA 4YBLB 3OSKA 4KMLB 4ZAKA 5F9OH 5JPNB 3ZT5A 5DZOA 3REVB 5A6JA 3MGTA 3SOBH 3TN0A 1EGZA 3WJLA 4QHUA 2WQRA 4PB9H 4B9ZA 4DUWA 1TVNA 1UJ3B 2YSSB 3W0KA 1LP9B 2AQ3A 2AV1B 2PYFA 3TTYA 1MUJA 5CLTA 4P7LA 1NJ9A 1ZTXH 1LL7A 1NBYB 1YC8A 3VIOA 4A6YA 4MZ2A 4PJBF 2Y06L 2ATPA 2RB8A 5FDWB 1QRND 4EUPG 4JZJB 3WEZA 4Z7VA 1A02N 3CMJA 2IXVA 5I6XC 3FB6A 4JVUA 4GRMB 5INCB 2GI7A 1T7VA 4O9HL 2CJUH 1JZ5A 3T4AB 4ZUVB 2EC9U 1S7XB 4YFEA 1YYML 1BM3H 1LEKA 4JL2A 1OP9A 1KBGH 3OMZA 2P24A 5IGXL 2VDKL 3WLBA 5I1EH 4OOUA 4ZXBA 4UOW1 2DM2A 3PHQA 4D72A 2DJ4A 2YK1H 4W7VA 2OL3B 2Q20A 1KBKA 4PTTB 4AT6B 4BK4A 4BSWB 1PQZB 5TDNB 4Q97A 4P5KB 3KLAA 3QXWA 1OF2A 2GT9A 3BEWA 3O2DA 4K23L 4OZHE 4W81A 1W91A 4P7RA 1PBGA 4P8WA 5HYIA 4PGBB 3IXAB 1RZIA 2VLJA 1GC1L 1P4BH 2EH7L 4WUUD 3WO3B 4MLSA 3EDFA 5BRZD 3VW3L 3W25A 3UETA 4H88L 1BGXH 1HTYA 5GS2D 2VABB 2IAMB 3LY6A 3TYFB 4B15A 3NACH 2A9ML 2X1WL 3QPXH 3P4NB 3THML 2YKKA 2HKFH 4FXLA 2CBIA 1QNZH 4CU7A 2YPLA 2AXGB 5I1EL 2AJSH 1MFBH 2FHBA 4BKLA 3HNSH 1M1SA 1N6VA 1WDQA 3KPRA 3O8XA 2WSKA 2IGFH 3BPLB 1KTDB 2ADFH 3QDGD 4P23A 5TQ0L 4QTIL 4S1SL 5E94B 5EC1B 4EE9A 4DW2L 2H32H 3N15A 1QR4A 4DVBA 1A9EB 4BF7A 1UG9A 3UYPA 1FLTX <