5CGTA

Maltotriose complex of preconditioned cyclodextrin glycosyltransferase mutant
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 232
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cgtA01
2YPVL 2J8HA 2NX5B 3FB8B 3ZKXC 5L9DH 3DHUA 4WWKB 2ADFH 4CCCA 3UTTB 4NQSA 1MUJB 5DD1H 3BO8A 3T65B 5FIPA 2QMKA 1LWHA 3UYRH 2XJ7A 4LAJH 3E8UL 2IQAA 4POUB 3A3HA 3UZQA 4U1GB 1QLRA 4P8XA 3D52A 5BRZB 1CD0A 3G6JA 5DMIL 3HI6L 1QFPA 2OXHA 1PBYA 5EU4B 2YMXH 2LVEA 2XT1B 1IAIM 3DO7B 2XA3A 2E7HA 5E1AB 1DHKA 3VFNB 2VNCA 3AOFA 4G3YH 3RVTD 1T66D 2AJVL 1V02E 1YJDC 1MCHA 2E9WA 3FKUS 3O6LH 5BW7C 4RFEB 4ZTPH 5FYKH 4L9LA 5D4YA 2NY7H 1OD9A 3JTSA 2HVKB 1AGFB 3W39A 5CSYA 1KIPA 3PWPB 2IAMD 4U6TA 4AEIL 2JF7A 1U95B 4Y7EA 2Z91B 2JCCE 1RZFL 4NOFA 1HIZA 5IEKB 1JAKA 5DRNA 5IFPA 4Z95L 4HZLB 3U0TB 1OGGA 1OM0A 2JJSA 3DWTA 2YK1L 2CBUA 3VVGA 2JB5H 1W3HA 1QVOB 3N06B 4OZGA 4EXKA 1E4WL 4KMQA 3T3ME 3CHCA 3CLEL 4P3WA 2HTLC 4LEOA 5IGXH 4F58L 5T1KD 3VXUA 3MSGA 2XZAH 2BS9A 2AK1L 4PRPD 2YRZA 3SDAB 5CD5D 4X9YA 2WQ8A 4QKXB 1ACYH 3MRLA 1J86A 5JBEA 4Q9BA 1EO5A 4S2SA 3SUVA 1L7IL 5ID0A 1BEYL 3M07A 4QT5A 3RTQB 4Y19E 1UB6A 1H5BC 3TO4A 3WO4C 4L8DA 3M7SA 2A3HA 3MBEA 3EJRA 1CR9H 1KJ2B 4RA3A 4P2RE 1CFQB 4X6BB 3FFDA 4JHBA 3HE7A 3KPSA 4WUKL 1XIWB 5B3JF 3LN5B 1BIIA 2OZ4H 1DQJA 4PRPE 5F8RC 4JO2H 4XPTH 2Z1KA 1CICC 3EYQC 5L9DL 1QBLH 5CQ1A 4NWUH 8FABA 5TE4H 1FFRA 2FX7H 1CDHA 4WIWA 1EHLL 1BBDL 2ED8A 5F7EH 4WEMB 3CDYA 5BVPH 4GJTB 3W11C 2AJSH 3C08H 4M4PA 1QKZL 1T6VN 2CIIB 1FE8L 1QVOA 3LRGA 1BZ9B 3P9LA 4X6EB 5C7XL 4J4PD 1UG6A 2YSSB 4W89A 5DJXB 4NHUA 1AHWA 3WYRA 1VIWA 1CF8H 1Q9KA 4HEPG 3RIFK 1CGVA 4R0LC 3G5XB 2O61B 2HFGH 4XNUH 4GW1A 4FFYL 4DQOH 1QFWI 2R4SH 1AP2A 4UQEA 1T1WA 5BS0E 2H1PH 2NY0D 3WLBB 3N85H 3ZOAA 4AD5A 1JGVH 5DEGB 4CN6A 4XCEB 3T0VA 1G9NH 3ARBC 4Q6IC 1NM9A 1A7PH 1C8QA 1B0GB 5LBSL 5CLWA 1A3LL 3GI9H 5IM7B 1D5ZA 1KPUB 3KPTA 4YIQA 5KVGL 4PIRF 4NNPL 3GMRA 4BSWB 2WZIA 5GGRB 4IHOB 5IIEA 3GMRB 2ZUTA 4GG6B 3EZ8A 3NA9L 2BNRD 2QLVB 1A7OH 1ERNA 3KPRD 1D5BA 4KTDL 1HL8A 3ARFA 2YL9A 3LQZB 3JWNC 4PRPB 3DXAB 1VGKA 4U2YA 3SDAD 2XHYA 4PUBL 4F9PA 3P0YH 5H37H 4KMTH 3G5VB 1E6OH 4KGLA 2ED7A 1P6WA 1F97A 4U1KB 4G8EA 1TZGH 1A0QH 3QDJE 2D7PA 2ZSWB 3IDXH 3MUJA 5DC9B 2ZOLB 2BNQB 3C2AL 4N1EA 2UY7A 3BGAA 2J5LC 3P40A 2CHOA 3LN4A 4KQ4H 3TONA 9CGTA 1KLGB 1JRHL 5BQ7B 3ZYZA 3G6LA 4JKPH 3GB7A 2WLZA 4P8VA 4PYSA 2VDQL 3MGOB 4YXHL 3F7VB 3MGOA 1I3RB 5T1LA 4S1QL 1HH6B 4I77L 4YDLB 4L3CA 3UPRA 2JCCA 2ZUUA 2NY2D 4HWBL 3OL2A 1V7ML 3WE6A 1IGML 4X4MA 1S7UA 5LGHH 1J0IA 1CU4H 3ROLA 3VKKA 4B15A 1QFUH 1BG9A 4YNYA 2QSCH 4NZCA 3BQUC 3GBMH 2AJSL 3SOBL 3DHMA 4HSQA 1M7DA 4NI3A 1QRKA 3BKCH 3WXWL 2R56H 1XSIA 5JBDA 1WDQA 3N1GC 1VGEL 2MJWA 3C60C 3MYJB 3FXYA 2AJ3B 1UJ3B 3VFUA 3IYLW 3DARA 4Z6AT 2B0SL 2DYPB 4ZFOA 3MMEB 3TF7C 2CDGB 3OAYH 2VH5H 2WW5A 4GXPA 1OY3B 2O9OA 1NJ9A 2AV7A 4JO2L 3OTTA 4NQEA 5FO9B 5E5MA 3D3AA 2VDRL 4Y2DB 5DD6A 3RM8A 4WTZG 1GW1A 2E6QA 3GMOA 3N15A 2EEBA 4LOUD 4PB9L 1L4IA 1N6VA 2QQQA 2WWKO 1W2PA 1PG7W 4MJIB 4OLEA 1EHXA 2AJXH 4DWHA 4IMLA 3KXFD 2A38A 3NABL 1X5FA 4M4RA 5JHDD 3QNZA 2C3WA 2D73A 2CUHA 1MHCA 4QRSA 1UD8A 5FEBA 3F58H 1CBVL 1BHGA 1FVCB 2PW1A 3BIAX 4MD0A 5CHNA 1M71B 3VI3F 3ZM8A 4RFNB 2VZTA 1KSRA 4PJGB 4KKCD 5DFTA 2XN9D 3SCMA 3A6OA 3VXOB 4LSVH 3RO8A 2IH1A 2APFA 1VEPA 5KEZA 3TP4A 1YC7A 1Q94B 2VLKE 4K3HA 2JIEA 1U2HA 4ZPVA 2KPNA 2YRLA 2VDPH 3UEZA 7TAAA 5ESAB 2ZPKH 1NBVL 4GRLA 1K8DA 2ZG1A 3L3HB 5HI3D 5T3ZE 4Z78A 2XVKA 4PLJC 2YL5A 4OGXH 1ZK9A 1Z3GH 4YHML 2W65A 1FFPA 3S37H 5A2IH 3HNSH 4RIRB 2XWEA 4ZFOB 2BY0A 4TTDD 4K23L 2EDTA 5DQDH 1YN6A 3LKSA 4G8FB 1YEEL 2OZ4L 1W9PA 5GISH 3EYOB 4TSBL 2XPGA 4NFBA 4LIQE 1AQ0A 3LRSA 4PRIB 1HXYA 1U42A 4F9PC 2D03H 3EOBB 4LPTA 2WINB 3GMNB 3N1FC 1E4XH 1NBYB 4LLVA 1U41A 1B3XA 3T04D 1NBYA 1D9KC 2F19L 3ARGB 3W29A 4IRJD 5HDQH 2APXA 5D7IB 3D4YA 4YHOL 5A3ID 5I1DA 1S9VA 1NGYA 1EEZA 4UT6L 1C5BL 1Z9SA 2NY3C 3GMMA 4IMLB 2W0KA 1DQQA 2WMPA 4KRLB 2WWMC 4QEGA 1QG3A 2R8SH 5HGDA 1W32A 4WW2B 2XICA 3OR7B 3P9MB 4M3JA 5KSAA 1W91A 4O02L 3ZDZE 3S6TA 3BUTA 3IF1A 4JFQA 1S3KL 4HUUA 1S7XB 5TDPB 4YN5A 1I9IH 3HS0A 4FZEH 3VWKA 3SEPA 1RUAH 3QHTC 3HB3D 4HKXA 4R7NA 2X5PA 5GRJH 4JL2A 5SWZE 4XWGL 1HYRC 2IQ9L 4ZQKB 1LGVA 4JHWH 1N82A 1TQCC 3OAZH 3BUIA 2GK2A 2DWEB 3MV7A 4XVUC 1DQTA 4X0KA 4XP4H 3PHOA 4UBDD 4JPWH 1DL7H 4RX4A 4M7KH 3BVUA 1NUNB 1E5NA 1FO0H 3VG0L 1G6RA 2UZXB 1TJIL 5FXCH 5J4MA 2CK0H 8CGTA 2MSPA 5E2VH 4LYPA 4H25A 4Z9KB 2LU4A 2UY2A 4I4WA 3UCQA 3ZT6A 1JJUA 3MUY1 5KVDL 2P8LA 1GGBH 3MGAA 1VDGA 4S10A 3SBWC 3KR3L 5JO5B 5GZNC 4YQXH 3SDAA 4L4TA 5DZNA 5DMYA 2F1BA 1FL3A 2QHRL 3BP6A 2Y4SA 5KAQF 1JV5B 1CDJA 5DJZB 5DO2C 1T21A 5M7QA 1GONA 4YUEL 4WW1A 5IEHA 5B4MD 2IADA 1S7RB 2ADIB 1B0WA 3IFOA 4LLAA 3C5ZC 5I23A 5E5RB 4GLRI 1RUMH 3CK0L 2FD6H 4KXZI 3C6LC 1JI1A 5D9NA 1SVCP 1AY1H 3NPZB 3OAYK 1A8JH 2XA8H 3VIFA 3GHEH 4G42B 4IRSA 2I9TA 1G01A 4C4KT 4KK9C 1QHOA 5HHPB 1GSMA 2AXGB 3M6DA 1VB9A 2O5YL 5EIIA 1I3UA 4IRJB 5HGHB 3GZAA 1CD1A 4YZFE 2F19H 5CXPA 2A6KB 4D9QE 3X14B 4JIEA 3U0WH 1LQSR 4RQQA 3BZ4B 3MMWA 2IPUK 3VMNA 2V7HA 3MRFB 3HKFA 5TFSL 2CH8A 3HG4A 2AXHA 1A9EA 3S37L 1TJHH 2GSJA 5D7JA 5E8NB 1A64A 2Q3ZA 1GGIH 2GDUA 4GPNA 5I1EH 1MH5B 3D2UB 2WIIB 1M7XA 3BGMA 5EA0L 5ETUB 1U8QA 4P3CL 4ENED 1ZGLB 4LVOC 2AXJA 3CZKA 3AREC 1XH3B 3F7YB 1RUPH 1XGQA 5C0EA 1ZL1A 1SJEB 4LIQL 3MV9B 3QEQE 4P5KB 5D2LE 2P48B 4YHKL 1LO2H 1OAQH 4OLWL 3BCFA 5DSCA 1E72M 1WCGA 1A4JA 3BZEB 3AMCA 2IG2L 5TH2A 1N0XH 3WLBA 1HE7A 4CNIB 3IKKA 3O11B 5D9PA 4H8WC 5D2LF 4P23A 4CVUA 4X9FA 4WUUD 4IOIB 2HKFL 4JRXB 1HJXA 5TE7H 3QDGA 3S3JA 4UQBA 4U5KA 7FABL 1PEWA 5CZKA 1RK1A 3FB7A 1BFSA 4AM0A 4NZRH 3C9NA 1NAKL 4B16A 4U6XB 4ZS6D 4Y5XB 4ATDA 3TYFA 1HXMA 1IRAY 4QTIL 4G7YH 1ZBCA 3U7YH 3WDRA 4PGEB 2H32H 1CLYL 3WF2A 4XNZC 2BVOA 4MPKA 1MIEL 1OGAE 3RDTD 1MIMH 1J8HE 4UZSA 3GSOB 1G9EA 1HWWA 4UV7L 3S96A 5FOJA 4NHCH 5IBTH 5E7BA 5I1AA 2CLVA 4PJDF 1YEFH 4AIZB 3SURA 4EKJA 1X5ZA 3RY5A 1SVZA 2WUCL 2XIDA 5I6SA 2CRMA 3C60B 4KKNA 3S97C 1R0AL 4ODXA 1RMFH 5F96H 3SKUD 4LAQH 1RULL 5FKAA 4NT6A 2VSCA 5KAQG 1U36A 3RJDA 2F7PA 4CD6A 3O0RH 4LQFL 2NMSA 2ORBH 4OLXH 1UZ4A 2CYGA 4IDJL 5EFIB 2DM4A 3HZVB 4I5BB 2D9CA 3HR5B 1G6VK 2VQUA 3I9GH 2V3FA 2YZ8A 3SE3C 4PJHE 1AO7B 1BQHA 1IAKA 1W72B 2E9JA 1Q1JH 2VSDA 1NKRA 2QSTA 3PWLB 2Q8XA 3TPUB 3PWLA 2YDRA 1HIMH 1OTTD 4E41B 1T1ZB 1U8OB 3QFJD 1RH9A 3C2AH 4G9DA 5FYJE 2NY4C 3RL2B 4NXKA 3QUKB 3WXVH 1R3KA 1UYWH 4XP6H 4YHZH 2H32A 1FVEA 1KQZA 3BIKB 4JN1H 4Q9CA 25C8H 2BSSB 2BVOB 2VCAA 1GVYA 1BF2A 1RY7B 5GGQL 3WMBA 4AD3A 4R4FL 3VFSA 5SWSB 3SGKA 2Z35A 5D1QC 3WH8A 2CKBB 3IDYC 2NTFA 3CFDB 3DMMB 3ZLQC 3CV5A 1G9MH 1KN4L 2RIKA 1MRFH 1YMMA 2OL3H 3AFLA 4KZDL 1FG2B 2Q3AA 4YGVB 3T3PF 4FQ1L 5I0DA 2F7QA 5I9QB 4MS8C 3NZHL 3QQ4A 4WU7B 1AC0A 4F3FA 1JP5A 2IH1B 4UV4L 4AMKL 1IAII 2BRRL 2IMMA 1H0DA 1EGZA 1FP5A 1FBIH 2DWDB 2XTJB 4TOQA 2C8NA 4O9HH 4HQQL 4MZ3A 4Q7NA 5LVEA 1H11A 1MCIA 2RAMA 5JLZB 2HFGL 4X5XA 5HYIA 3TN0C 3H9ZA 4HMDA 1K8IB 1AGEA 4OZFA 4JR9L 3PIQA 1QI2A 4L9DA 4Z77B 5ICXB 4WW2F 1J87A 5HTSA 2ZUXA 4TOYL 4BYHA 5JUEL 5IVXA 1EAJA 43C9B 4XGZA 2DIAA 2RBLA 3MLZH 2PR4L 1HINL 4KGJA 1V0MA 4EVNA 1F4YH 1FIGH 1UA7A 3SKNB 3WUEA 3ARGA 5FHAL 5IW1A 3CFDA 1YEIL 4LDLB 3KAAA 3GSRA 4KWUA 1DQQB 4ZOEA 5HGBA 4PJGE 2DLIA 5EC1B 3K1DA 5HY9B 3UDWA 4BQ9A 1PYWB 2Z92B 1C7TA 4UU9A 3HAEA 1XF2B 2YA0A 4DO4A 3IAQA 2R39A 4X6FB 5KSUB 1MAJA 2PXYB 2AOSA 2ZUNA 4JM2A 2NNAA 1JYWA 4IMKA 1C5CL 4ODUA 1EVUA 3DDGA 1UUQA 7A3HA 4AEFA 1VADB 3R8QA 3HMWH 2VX7A 3PHQA 1KN2H 3QQ3A 1Q0YH 2Y06L 3SCMC 1FZJA 2XTJE 2EEAA 1QFWM 4HKXB 3WKMH 2AKRA 1UXWA 5IQ7H 1KCSH 4PGDA 3PV6A 1MQKL 3WEMA 3FJTA 2YRPA 5HGGS 3VTRA 1XD1A 1BFTA 4BZYA 5TJWK 4PRHD 2P24A 5HHME 4CMHC 1FYTE 1OARL 4NQCB 3UJTH 3R0NA 3LQAL 3Q1SL 3WIIH 4XUYA 4ZO6A 4NF7A 2DICA 1A14L 5E94B 5T5FH 2P8MB 1FFNB 3H9SA 2R0WH 2EACA 4NYLA 3ZE1E 1WZLA 4YHPA 2WC3A 4XWOC 3O3EB 2X4UA 3S34L 3RWHA 2QSQA 2NXZD 3EJZD 4Q6IA 2VWEC 1YQ2A 3ARFD 3EDKA 3QUXB 2VXSL 4WJ5B 5JO5A 2I25N 5FO8B 2A73A 3EOYG 4CU8A 3RUGB 5ITBH 5FO8A 4DK6A 1QLFB 3VIOA 3HJEA 1MCKA 1VEOA 1YEHH 1G7JB 1U3HA 5I73C 3PJSA 3P11H 4WW1B 5IEHB 2ARJA 1IT9H 1YNTA 3QIUD 1QO3A 1WB0A 5CBEA 3KEHA 1FNSH 5D1XB 4X98A 5D1QD 4YXKH 5C08E 4OD2A 6TAAA 3MOQA 2MANA 5FOBB 1MF2L 1ZBWA 2YEZA 1G7LB 4K3EL 1N6QL 2JELH 3KL0A 1I7UB 3WL9A 3MBEB 3VUPA 4YHEA 4ODSH 4HUWA 1H3PL 1ZLWK 5JORA 3BZFA 1W8OA 2HVKA 5ID1A 3VDBA 2R2BA 3FO1A 3G04A 3ZO9A 1E15A 1F13A 4HD9A 4EN3A 1JNJA 3I3BA 2ARJQ 5HPMB 1VJSA 1X3DA 1KIUA 5DK0A 2CK2A 3QZWG 1J9CT 4P2QB 2FLBT 4PS4L 4K7PH 4KHTL 1SBBA 1YQVL 2DN7A 3IXAB 1E6XM 5F44A 3NFNB 4UNVA 2IMNA 1T1XB 2ZOKB 4HF5H 2JF1A 5L88L 2OR8A 3TTSA 1IVLA 2J8GA 1MI5A 1FBIL 1MHEB 2ED9A 5D2LB 3SCNA 2RHEA 3S4SG 1WWCA 3VI3E 2BX5A 4NHUB 5DJYA 4FQQA 5GGQH 4KDTC 1WIUA 2RCSH 5DJXA 25C8L 1P1ZB 4ZFFA 4RMUA 4WTXA 4OZIA 3ARXA 1FA2A 1OOAA 5TE6H 3BUYA 2XN9E 3QZWB 4AT6A 1FGVL 2BOBB 4IPLA 1FLRH 3IDGA 4IS6B 1KLUA 3GSNA 1KN4H 3A6BH 3B83A 1SYVB 1DJSA 3BIBX 1G6RL 2NW2A 3KWXA 4P5MA 1GOMA 5I76A 4EUPH 1NAML 5IK3A 4XP5L 4L3AA 1SEBA 1PKQB 2A6KA 2X8RA 1RZKC 3GMLA 2FGLA 3JVGC 4WHDA 3BH4A 3L5WA 4N5EC 2UY3A 3O0RL 5HVHB 1MFDL 5EUKB 5DUBB 5LWYL 5T1KA 3VSUA 1TTFA 5MP6H 4CRPA 4KJPC 2WUCH 1IM9A 5E8PA 2WVTA 1KPRA 3VWJC 1NCTA 3TWCL 5FAAA 1A7NH 1EBPA 2BNQA 3UYPA 4BQ4A 1MCPL 4UTAH 4DWSA 4UT9L 2HH0H 1HHHA 4U2ZA 5IHUL 1KPVB 1OTTC 3T4YA 4F37K 1FDLL 2X89A 2VQ1B 3QIBA 1NAMB 4H8VA 3ULUH 2CXKA 3C6LB 3VGAC 1U9KA 2FEDC 5TE7L 1SY6L 2RFXA 5HHQA 1FHLA 1MQPA 4L4VD 4EUPA 3AXXA 4R2GC 1G9NC 4ESKA 3S36L 4GMTL 3FZUC 4LU5H 4N8VB 3C9NB 4RWHA 4ELME 5TF1H 1CLYH 1AXSA 1FNEA 2CPCA 1OAQL 1AXSB 5GS0C 5T1LD 4GG6A 1X5KA 5EZLB 3EJYD 1I8MB 3GMQB 4JFZL 4HJJL 3VFUB 5FUZH 3OKKA 1ZKAA 5BZDA 3DUHA 4KPHH 1GAFL 4JGMA 4PTUB 4ZOBA 2V3GA 4KZEH 4MB4A 4HUVB 4AZCA 3IJ9A 5DEFB 4PTWA 3CMOL 1W9DM 5MENE 1R3KB 2JIXA 4PJXE 3VXTB 3TH2T 3IJYB 2IAND 4DKFL 4Y2DA 3W9EA 5FYLL 2GSIB 3GDBA 4FN0A 3RWIB 3DUSA 2DQHL 5BVJA 1IM3A 3DUSB 4XMLL 5H8DA 3D50A 3SCSA 2OP4H 5D5ME 4OLVL 4ZXBB 2X42A 3BSZH 2VXVL 5L8JB 2V5DA 1KEMH 2F18A 1FSKB 1MHCB 1CE1H 4QRSB 3V4UL 4F37F 3QNZB 3PWUB 3RNKB 3C5SA 2X4PA 3BH9A 5TPWL 3SE4A 2V5SA 2J88H 5C6WH 5HHQB 2DQFB 3QPXH 1RZGA 2ZWZA 4JZNB 4P23D 3IAGC 1C5CH 4H1LA 3H55A 3HI5L 2J8FA 1D6EA 2PWGA 1CFVH 1UR1A 2FIKA 3UC0L 3KPOB 4PMRA 4WEUD 1FNEB 2DM7A 5E8EB 3WJLC 5I18L 1AY1L 3UZVB 3GMPA 2ICWJ 2NXYB 1BLNA 4L4VA 2VURA 1HOCA 2J7DA 1E4IA 3G6AB 5F97E 5L2KB 1EFXB 1OAYH 3OHXB 4PRWA 5KS9E 2J7HA 4TVPH 3BPLC 5E1HB 1CLVA 1RU9H 5FO7B 5IR1A 4M1DL 3RU8L 4QRTB 3C5ZA 1FYHB 3REWA 3CXHJ 1YA5A 4PREA 3S36X 4WFFD 4MAUH 3H42L 4IDLA 4L4JA 2NY5H 4X7CC 4HOWA 1HCVA 1E70M 2BNQD 3FOLA 2CNCA 1BZ7A 5IMMA 5FYJH 3FTGA 4UTBH 1RUML 2VLKD 2DQJH 5C0AE 4HPHA 4WI5A 3MFFB 3QG6B 4OD3H 3QG6A 3T77B 3FQWB 3VFRA 2G60L 2VOTA 2VXTL 3HG5A 3OKNA 4Q9RH 1RFDL 4OB5H 1JHLL 5BOPA 4JHWL 5CHNB 4JQXA 3M46A 3O4OC 4CL7A 1IKFL 3O3DB 3O6FC 2J79A 2J4GA 3NCCB 2DKSA 1YPZA 4MNQD 1W9UA 2ZUYA 1HHIB 4UINL 2J1KA 3J7HA 4ZSOE 3TJEH 2ICWI 2YN3A 3TVMC 4FNQA 1MJ8L 3KLKA 4X8JA 5IVXB 4JQVC 3QQ3B 4DJMA 2ZP0T 5I24A 2Z91A 1PVHA 3BEWA 5FV2A 3CSBA 1RZKH 3FQUA 4J3VA 4PV8A 5L2KA 4P7OA 1R7AA 3FB5A 1BG4A 1ZTXH 3V8OA 5I8CB 4LKXB 2EH8L 3VGDA 1NL0H 5C0BB 2VRAA 2VLKB 3TV8A 4P46D 3SJVA 5C07B 5CSZB 3TIEA 2ZNXA 5EC1A 5JIKA 4NC1C 3UTTA 4MAYB 5D96C 3VGEA 3MODL 3MV8D 3B5GA 1GJIA 4FQXA 4JRYB 3DVIA 2X4NA 3QUXA 4LSRH 3MGTB 3FHQA 4GAJL 3IU4L 5J11C 1N8ZA 1OLLA 5DQDL 1R3HA 1BF8A 2CUIA 3SQOH 1ZA3A 5C9JA 1S7RA 1D7FA 4RGMC 1GUVA 1I7RB 1HZHL 3MV8E 3X13A 1J8HB 3VRIA 3CFBA 3ZJ8A 1C5BH 3ZTJH 2ERJB 3IDYB 3OXSB 4QHLB 1RJYA 1FZJB 4D6FA 2YPLD 2JK5B 5DXWA 3B2VH 4GMSL 3S37X 2JK5A 3P4OA 3QULB 4P46A 3SJVD 3VH8A 1DEDA 4TVPE 5J1AB 1N3NA 4KQ3H 3WENA 2ESVD 5ILTH 3T2NL 1XF3B 4MA3B 1RIUL 3CXDL 4FFWD 4NQXA 1IAIH 4DGYL 1QR1A 4NQXB 1JPFB 4PJHB 5GJTL 2ZX7A 5D2NE 2NY0C 4JFPB 4BZ2H 2ZWLT 2ZCHH 4Z7NF 5DA0B 4Q22A 2X4RA 3QFJA 1L0QA 1E4KC 3OKEB 3BVXA 3BSGA 3F5LA 1NBVH 4WY7L 2ARWA 1YYLL 1UZ1A 2R1YA 3WH9A 4Y0GA 1CG9B 4F2MB 3QRFM 4U1IA 1CLCA 4OZGB 4PJBA 4Y4KA 2A6JB 5BOZG 4Y4KB 3F12A 1YEGL 1ODZA 4X6DF 2QR0B 3NFNA 4I8DA 1KJ3L 2VR9A 1I1FB 4AISA 1JYXA 4LLYA 5K9KB 1LO3H 1DBJL 3P0VL 1R3HB 1AKJA 3LQMA 2EADA 2IANA 4FQPA 4S2SB 1KELH 2L7UA 4D1JA 3BDYH 1L0YA 3GBEA 1WBZB 2NY4D 3MTRA 2Z93A 5J12B 2VZ1A 1T5WB 3MLVH 4FQ2H 4U3XA 4V28A 3X12B 1W72H 5IFAH 3VXNB 4MADA 4OUEA 2MHAB 2V7NB 4DWSD 4MA7L 3GBML 1MOEA 1MHPL 4HUWB 2PF0A 1XIWA 1NGQL 4G42A 4L4PA 1NPUA 1CFQA 3QEQD 4X6BA 5K93A 1MQQA 2IAMA 3NCMA 4EN3B 1U3ZA 4HWUA 1TQUA 4MCZA 4PMQA 1U8KB 4BA8A 3SGKC 4MCZB 3MUHL 1WNOA 1IGIH 1VFBB 4N42A 5DJ6A 5KN5A 3MMUA 4M93C 3FQNB 1G5AA 3NBNA 3AB0B 1BVNP 2O5ZL 2PW2A 4AM0B 1FIEA 1G0CA 1MY7A 5E9DE 1NSNL 1N26A 1TJHL 3RI5K 3CFKB 5DJDA 2V2WA 2CCRA 3LEXA 3QO0B 4XP1L 1QPKA 3KPQB 1ZVSA 4XMKH 1W9BM 1DBMH 4FF5A 1QRNE 5IP4A 1H9VA 5HNNA 1YNKL 2WVVA 4N5UA 3AY4A 4XB3A 1DBML 2VC9A 3IDUA 3Q6GL 1S46A 1TUXA 4XP1H 5GS1B 1SYTA 4U6VH 1WP6A 3S3PA 3VIMA 3BLKA 3QEQB 4W7UA 1I8LC 2EICA 1UEYA 1XGUA 4G8GA 4G8GB 4AH2A 2V3EA 4D72A 4Y19D 1S9XA 2V5YA 1OAZL 1P69B 3HI1B 4M6NH 5EG6C 3WN5B 5I15L 3HC3H 4U1HA 1S5HB 1VERA 2J5LB 2QQLH 2V7NA 4PJ5B 4QOKB 4G6ML 4N9GA 5C9KA 3SDXA 5I17B 3QEGL 2VUOA 4YBQC 1QQDB 3O11A 3CDFA 1I9JH 4PJCB 4OV5A 3HC3L 4LCWA 1NGPL 1R5VB 4NZTH 1X5YA 1MWAB 3AS3A 1SMOA 3PABA 4G9FA 4WI7A 5ABHA 4JPVH 3L3DA 1B2WL 2VKWA 3UETA 1QLEL 1QNZL 4UUJA 4UUJB 4RE3A 4GINA 3M8OL 1F45A 3HMXL 5T3XH 4O2EB 3NA9H 5FO9A 2EDQA 2XZZA 4IM4A 5CD3A 4CVZB 4NNPH 3OA5A 3BIKA 2H2PC 1MJ8H 2ITCA 4PGBB 2R0ZH 5DWUH 4NQTA 5IMOA 3QCVH 2VLRA 1IC4H 1UASA 5CSBA 1X7QA 2XI9A 3KJ4B 4MJIA 2ZXBA 4AYFA 3D3VA 3ZHDA 4WKHA 4U6HA 4CAGA 3N85L 1NSNH 4L3EE 4N0RA 2F54E 3RVWC 5I71B 4JRYE 5IFJB 4PJ9D 4X9HA 5A8MA 1OIFA 1UD5A 3IDNA 1MRCL 4N1CA 2UUDH 1ZT1A 2AAVA 2DQFA 1IGIL 3S35X 4DGYH 3ARZA 3E0GA 1C8PA 1N4XL 3RKDD 4QXGH 3MA7A 3P11L 2DSKA 2BVTA 2A6DB 4S1SL 2ESCA 5F88B 3KPOA 1PJ9A 3RWJB 2R1WA 2D7MA 1K5NB 1I9EA 4QLLA 4RWYL 4M7LT 3JV6B 3B8SA 4EXPX 3TPUA 3O2LA 3BX7C 5C09D 1GJWA 3HG1A 5FGCE 1I8KA 5DQ9A 3PWPE 5ICZA 1I1AD 4C7GA 3JUZA 4LASL 5FOOA 1DBJH 4NZUL 3QIUA 3VU2A 1E4MM 2W5FA 4XNYH 3ZL4L 2D31A 2P4AB 1KG0A 5DURD 5IB2A 3QDMA 1KGCD 5JHLL 1DSFL 4D94A 2OR9L 3V4PL 4W6XB 4JHOA 3RVTC 3NIGE 3B2UC 3QT2A 4WEBL 4K23H 5IW1B 4LASH 2EJ1A 1AI1L 4X4YB 1CZ8L 2E27L 4NRYB 5DJAB 1YYLH 4UILH 3RPIA 1OVZA 4H8UA 2OWXA 3TBSA 1UQYA 1NL0L 4APQD 5K59F 3NACL 1XGRB 3AM8A 4FQXD 5I75B 3D85D 5DJCA 4HS3B 2XG5A 5A2KH 1KN2L 3STLB 4BQ3A 2G9HA 1OM3L 5HHOE 5IJKC 2Q87A 4AEIH 3BN9D 3NOIA 1OTUC 5C07E 3O45B 1F6AA 2MNUA 3BW9B 4I18A 5EULV 3TCLB 4JFYA 2ZUSA 4M93B 4N8PA 3WJJA 3BD3A 1HHIA 3EDJA 4D0CA 4R8WL 1F8TH 3VJ6A 5EBGA 1WZKA 43CAB 2XM2A 3GMPB 4MDJA 1JPTL 3MI6A 3D0VB 2A3AA 3UX9B 2XYCA 3QB7C 1VENA 4R90H 1S7SB 1T1YB 5BYWA 5HJ3B 1OPGH 4M80A 1INEH 2K9UA 5ICZB 3F7PC 4LL9A 4LMQI 3WD3A 1WBYB 4Z2KA 1B6DA 2MPAH 5MHSD 2V9TA 1DEEA 3L3GA 3IU4H 5L8LB 1GCFA 5FYJL 3BGFB 4H25B 4WTZA 5C8JA 5H2BB 5C08D 1GHSA 4ZTPL 4Z0XA 4KJYA 4TSCH 3ULVC 2DF3A 2FHBA 1JN6B 1Q9LB 1U2CA 3JSSA 3SDDC 1S9VB 3BJLA 4J6RL 3MKKA 1JV5A 1HI6A 1RU9L 5JOFA 2FHFA 3TBWA 4ZD3H 2AEIT 2OTUA 4TVPL 5E09A 3OKNB 4UNIA 1OSPH 1JHTB 5CMAA 2A73B 4FHBD 3VX1A 1NANI 1VJZA 2FRGP 1ROWA 5B3JE 5E03A 1LP9F 2X1OA 4QLJA 2OZ4A 1QD0A 3BDBA 3RZCA 4RDQG 5EBWA 2E9IA 5C0FA 2HH0L 4RGOH 3ZKNC 4ERSL 1MWAL 4F15C 5GQBA 3S35H 5ADPL 1KQYA 4HU0A 2WMFA 4MNLA 1F3RB 3SCQA 35C8H 2HRPL 1CVRA 3EO1B 4GAYB 2ICWB 4ZUVA 1NUGA 2O5XH 3AM8C 3VD3A 3L4WA 3OKYA 1FL5A 4PJEB 5CEZH 1H8OA 4W4NA 5CP7B 3GSVA 5ALBL 3MX0A 5DT1H 4DTGL 4Q9RL 3SDDD 2J88L 1INQA 3BHBA 3VWJA 2DMCA 4OZ4B 3WFDH 4PJFF 1JNHA 2OJZL 5JORB 1HH9A 1ULVA 5D8JL 2X4OA 3B6SA 3QJHA 2DTML 5EZOL 3DUUB 3EO0B 4WWKD 3RBSA 2VLLA 1NMBH 4XC1L 5IEKA 1K6QL 4QHMB 1KCUL 1S7QA 3VFWB 1JF1B 1FFNA 3MRGB 1Z9OA 2J2ZA 5HVWA 1Q9LA 4NIKB 4J1UB 1NGXB 5DJZA 5C0AD 3IGAB 3Q5OA 2GT9B 3KPRE 1SEQH 2OQJB 4PV9B 4U3CA 2EYTB 1JHTA 4QT5B 5CMAB 1MFNA 2QL1A 4G6KH 1I1AC 3VXRA 1ITBB 2CMRH 3LIZH 2X1QA 5SX4I 5LGKA 3WBDA 1BREA 5E9DB 4M1GH 2UVFA 5D7SL 2J7LA 5CSGA 4NOBA 5E6ID 1CGTA 3FFDB 5EBWB 2YD7A 5EZJB 1MCOH 3LS5H 4DVRH 5JA8B 1CFVL 1X5LA 2CHNA 4KV5E 4ONGL 5I15H 2X2IA 5DVNA 2IAMB 4RA0C 4FLSA 3MROB 4JKLA 5C09E 1EEQA 3JV0A 3LPGA 5DFVC 1ZHKB 2QJDA 1EDTA 4CDGC 3WJJC 4FTVD 1Y6MR 2R4SL 5ESVA 2EDNA 1JWMB 5TPWH 3QH3B 3BHBB 3VWJB 5F7WC 3IS0X 3WF3A 4UV7H 3WSQL 4RE2A 5I8KL 1AH1A 1T04A 3MBED 3L9RA 1QKZH 2AEPH 4B0MM 1WDSA 3AXIA 5D7JC 4X4XB 3PL6B 3UPCA 1RUKH 5C1MB 1X5GA 4BQ6A 3PZTA 3ZKMC 3DX0A 3AZTA 1T2XA 2X70B 1NUDA 4O58H 4JFWA 5A2BA 3NIFE 4AC1X 4D9QD 2GEEA 1RZ7H 1CL7L 2R29H 1F58L 4ZNCD 3HE6A 4CJ0A 3NCYP 5HHNA 2OLDA 4Q9QH 1S9XB 5ILTL 1QSEB 3ILPA 4POYA 4WUKH 1NANH 1QSEA 4R7DA 1UKOA 1B4JH 3QHNA 5JXED 2E3ZA 5BCAA 1KXQA 4X6DE 3ZSTA 1CI5A 2ITDA 2KZ1B 3RWEA 4PTMA 4OGYL 5HYJA 2NW2B 5D7LE 3NN8B 1ZJAA 4JHAL 4TULL 2Y6SD 4FQXC 5C2BL 1AQKH 4X80L 1BJMA 4D0DA 3VO0A 3Q1SH 3VCLB 1B0RA 3C5ZD 1TFHA 1RUKL 5F6HI 2ATKB 3CLEH 1TCRA 4BKLB 3VILA 3ZE2F 4P9ML 3WNOA 1AQMA 1OGBA 3C5JB 3MZGB 1FH8A 3BKYH 3MV01 4ZXBC 3V5HA 3JUYA 4AZCB 3HR6A 2MQ0A 3B4NA 4Q2ZA 5I1CL 2Z8SA 1KCRH 2DTMH 4JO4L 5I1LB 3W38A 3ZT7A 2DAVA 3AJ7A 3EDEA 5AWNL 1KPRB 3FMGL 3NIDE 4BZ2L 5C70A 3H9SD 4ETYA 4GKOA 4KI1A 5KSAD 1PQZA 2JF6A 3KPNB 2VE6B 2NY0B 4K7PL 4KHTH 4P48A 5IMOB 3UG5A 4JFFA 4MCYA 3SE4C 1T5XA 4HIIB 5DLMH 3REVB 3O6AA 4XVSH 3SDCD 1CICD 3T4YB 1MFDH 4ZFZA 4DVBA 3WH7A 3GHEL 3W28A 3WLWD 4JDVA 1WZ1H 2AJYL 3LN9A 3EZJB 2X05A 2IPKB 2HFTA 4FXKB 1YY9C 3B3IB 3D69A 1FPTH 3HZVA 1LG2A 5GGVH 1FRGH 2XWBB 3MYJA 4H1LB 2BNRE 4HIHA 3HI6H 2ILLA 4YO0A 4FMKA 5KG9A 3U0PB 1T1ZA 3QHFH 5DQJB 1D5IL 2LAAA 1YUHA 4XXDB 5A2AA 4X9GA 5K33A 4Y5YC 1BGXH 1GC1C 4YHGA 3HRZA 1F02I 4NBZB 4J3XA 4DUXA 1MCQA 1JBJA 4N0UB 2OTWB 2PXYC 3VIHA 2VDML 4NQUA 3W0KA 4WHYH 5E8OA 4ZSOB 4NX0A 1UH3A 2PTTA 3S4SA 1AE6L 2P46B 4W88A 1TMQA 1ZTXL 1GOOA 1IAOB 1MAKA 1T7VA 1DL7L 3ALWA 4OFYA 4KRPD 1EOMA 3REWB 1YQVH 4WFED 4S11A 4KK5C 4HQQH 5IFJA 1HSBA 1P7QB 3SY0A 2YUXA 2AJYH 1MW0A 1YPZF 2C3HA 5ECJE 2YKLH 1OB1A 4X0VA 5D1ZC 4XXCC 5BRZA 4Z7OE 4UINH 5GRJL 4EE9A 4OJFL 4TPRH 1T03H 4GIAA 2NX5E 3TCLA 3DYOA 3DC0A 1VFAB 1KIQB 1WEJH 2GJRA 1H3PH 3U48A 1E55A 3KPMA 32C2B 4FFZL 2EDKA 2OL3L 4JAWA 5A95A 3HPLA 1QNRA 5E99H 1EDQA 4XNMB 1TZ7A 1JFXA 1BFNA 1J12A 2R8SL 4I0PD 2YIHA 2DBJA 2VXVH 2XSBA 4JO4H 1UCBH 2C9AA 3JTSB 4R7NB 5JW4Q 3NFSL 1W9VA 3RVWD 5EU3A 4K3JL 5J1SC 1Y6KR 5KSBF 1YEHL 2Q86A 2V5MA 1IV8A 1W2KT 5A8NA 4QCIA 1HKFA 3D0VA 2EKSB 1U2YA 3OGRA 2JE8A 3H42H 4EN3D 4NQCA 1XRVA 1X5JA 4NP4H 1XGZA 3EDDA 4WTWA 4AY0A 4PB0H 2J75A 3GFUA 1KTBA 1S7VA 4PMXA 3BESR 3QJFB 5IR1B 1H41A 5I5RA 1DEEB 4B9ZA 2DD8L 1F42A 1FFOB 1GAFH 4OM0L 3AIRA 4LYRA 4WWKA 5LXGH 1DWAM 3QWOA 4HS3A 5HI3C 3WIIL 4PB0L 2J74A 5FUOH 2X1PA 3MGTA 1XF2A 1FN4A 3CH1B 2WMGA 1OQOA 4JFFD 4L9LC 2UY4A 4QTHA 2AJZB 2GDVA 3IJHA 1WBXA 1BPVA 5F1SA 3UBXB 3LRKA 1RK0A 3H9HA 3QDHA 4ZS7L 1M53A 1EVTC 4PN2A 1T21B 4WJXA 4F57L 3GXDA 3O8XD 5GS1C 2NY4B 1OF2B 4ACYA 1INDH 2NR6C 2J8OA 1G84A 1CL7H 2FYYB 3EO1A 5EPMA 3V4UH 4I18C 2VITA 1QEWA 5MEQB 4H0IA 4LCIH 1G0YR 1TQTA 1GIGH 3QULA 3P4OB 1VFMA 2R1XB 2UV3A 4QHKJ 2BRRH 1I1WA 5BMFL 2VCCA 3W0WE 2OI9B 4EUPG 2UVEA 4XVJH 1UKSA 1AGCB 5C0CA 4WEBH 1R3LB 1JPSL 3BP4A 1QR1B 3RIFF 3EYFA 1A7NL 1KGWA 3O3BA 1GPOH 1ZWIA 4KJQC 5E94A 3QQ9C 2OW6A 1ORSA 1AQKL 2IGFH 3CFCH 3TN0A 2V38A 5HBBA 3MYZA 3O2WH 2QQKH 4HJJH 2ESVB 3DDFA 1RJLB 4HKJA 4I0CC 3WNNA 3VM5A 3CH9A 3WUFA 1CLZL 1KOAA 2R23B 3Q5YA 1WQVT 2CPUA 3UR7A 3WIFB 1P1ZA 5CIPH 4ZFFB 3V7AE 5D7KD 1Q9KB 4IRSD 4UOJA 1TLKA 1WCBB 3LKQA 2IAMC 1E6PA 5J3HC 5ISZE 1WPCA 3QEGH 3M17B 1TZHA 5LGHL 3TT1L 4PJ9B 4GRWB 1V0LA 5C71A 1BX2B 1PZ5A 3THCA 3QXDA 3TO4B 4Z7UE 3RTQA 3CZ8A 2EPKX 5EIIB 1FVDA 2R4RL 4LBEB 1I7UA 5JHDE 4QHKI 1ADQA 3LZFH 2O93L 4AENB 1OCWL 3KYNB 3W0WD 2C1OA 2R2BB 1UWEH 3G04B 3L5WB 1KCUH 1E71M 4XPFL 4OF7A 4IHOA 5IIEB 5FB8A 2F8QA 3SCOA 2GJXB 1MCPH 3OJDB 1ZHKA 1IC4L 2AGJL 4M6MH 4OQTL 2YLAA 4TN9A 1EEYA 2W91A 1LD9B 1N7MH 4KZDH 1SBSH 1MRFL 2IBBA 5DJDB 4RX4D 3M8OH 3MRJA 5AWNH 4HT1L 3P0YL 3MRHB 3FO9A 4X6EA 4OGAD 3BPNB 2YJQA 5HYFA 3AFBA 2PKDA 4XI5D 4YDVA 1QRNB 3MOBL 2HJLB 3EDFA 4JN1L 3MRNB 1S78D 3Q48A 5D7JB 5E8NA 1L9NA 3X11A 4PJ8D 3ROOB 2VKXA 4MSWA 4FFWC 2D0HA 1T1WB 3T0EB 4G6AD 4AIOA 1NAMA 3IDMB 1NGQH 4HUNB 3DX8A 3KYKL 2ZSVB 2XKNB 4UBDC 1CTNA 1D6VH 3EGSB 4AD4A 1YY8B 4X99B 1E43A 4H26A 5JIIA 4TTUA 4MJ4A 1WITA 3EMCA 3DTXA 3KDMB 1WC7B 4FQIH 4I3GA 4NO0D 4FLQA 2DQUL 3BEVB 5D96B 5FF6A 4CVXA 1JFQH 4W8AA 4BJLA 4KVNL 3VFPB 1N0XL 4NSKB 1UR9A 4N8VG 5IESL 2VLMD 4GRMA 1K3IA 3RI5F 1NCCH 2BSED 2X2YA 1JD9A 2J62A 4RMRA 2VWEE 4PJCA 4OM1H 5GGUA 5GGSA 3I6KB 3BAYA 1NLDL 5HHVH 5GS2H 4NCDA 5EC2A 3PWVB 4B50A 3NCFB 5E0QA 4BFIB 4NRZA 3L5IA 1JGEB 1S7WB 3H0TB 3IU3B 5FHBH 4NRZB 1NUFA 1CIDA 3RUGE 4LP5A 5C8BB 3UTPE 3LQAH 2TAAA 4HV8B 3MLUL 3C5JA 4HA1A 4OCRH 4OCNC 3W9EB 5DFWH 1MIML 2YSSA 5INDA 5TFSH 4AZHA 5HHMD 5SWSA 5C08B 2VAAB 4LHQB 3V7AG 2KH2B 4PRBB 4WFEE 5I8KH 3ARPA 1R87A 1YEJH 4OLZH 2ZX8A 1Z0MA 2H2SD 1HVXA 1A3QA 5F6IC 1I3GH 2EQDA 1Q0YL 1RZJL 4M00A 4OFKA 5HVFB 3C60A 1BSIA 1U58B 4EIZC 2D3VA 2YZ1A 5HYJB 1FVCA 2PW1B 1NWRA 3WN5A 4HDIA 5EU7E 4ZTOL 4GQQA 4P5TB 1HZHH 1SMDA 4P4KA 5E2TH 1IT0A 1FH5L 2DBLL 5J6GA 3FCTB 2DQTL 3DRTB 3B3IA 4FXKA 4GRMB 4Z7WA 5C0DB 3R1GH 3O6KL 5IW6A 3V4PH 4GT7A 5JUVA 1BM3H 4KRNA 3IJSB 5C0RL 1PX8A 4ODTL 4EIGB 3GMQA 1PZ3A 3ARQA 3TIDA 3QI9B 5SX4H 3BAEH 3QDGD 3HZKB 2A0LC 5FGBA 3WQ4A 1CICA 3QHZH 3BC9A 1GGIL 5DGRA 2EXWC 4OGXL 5IV2A 1N2RB 3PWPD 4LRNL 4XZUA 3TH4T 2VLRB 3QHMA 1TVHA 5HDBF 2VMFA 2Y6SC 3SKNA 4DEPB 4KC3B 1CGXA 2E7LC 2W1NA 5I1DB 2YUZA 4K3DL 4QRPB 3SUWA 4HXBL 5GRYA 1RD6A 3TJEL 4KROC 4KI5E 1FO0L 3QNXA 3ARDD 1FV1A 3CX5K 3LKPB 4HH9B 2Z4QA 5ALBH 5DT1L 4DEPC 4L3CB 4P9HC 3UPRB 1VBRA 1A6WH 4Z8FL 2YD1A 5F9DC 3TA3C 4QP0A 35C8L 4UILL 1KXTB 1K8IA 1WEJL 1WV7T 1IGTB 4FG6D 4GBXD 2CERA 3STZA 4RZCA 4OD3L 5DMIH 4PJIA 3UG3A 1A9BA 4UTBL 1B3YA 3QCVL 2Q86B 2FH8A 4JKMA 1RUAL 3WNPA 1DSFH 4AJ0A 3D85B 2OK0H 2FD6L 4XNYL 3V6OE 4HKZA 3ZL4H 2G3MA 3HHRB 1UXSB 3MODH 2NY5L 1NP2A 3CUPA 4Z7VA 2GCYA 3FB5B 4ENEC 1CQYA 3FRPG 3SDYH 2CEQA 5ANME 2EYRB 4JPVL 3EYOA 4UT6H 3S2CA 5DS8B 1XGPB 2Y23A 4YHOH 1V3HA 2PR4H 3MLZL 2J7BA 4C56D 2NY6B 4ZYKB 1I3VA 1TVHB 1D3CA 3GBLA 1BGXL 2CIKB 2XFXB 3FFCB 4J2XA 1I8IB 3V6FB 4ODHL 1KBKA 3NAAL 1YEEH 3KYMA 1H49A 1OT2A 3PDDA 1UM6L 3TBSB 5CPSA 5HHOB 3F4VA 4QRRE 4ODUB 4MNQE 5JZ7C 3A6CL 4PJIF 1H4PA 1J9YA 1EERB 3I9GL 1R3IL 5CGMA 4PJ7F 1V6UA 4JKPL 2VDPL 3BZDA 1FSKC 2A9MH 2Y25A 4JG0L 5BROA 3RZCB 5BXFA 2R69H 5I2IA 4P46B 5I2IB 4UT7L 1P2CB 2DQJL 2JFEX 2ZUQC 3OGOE 1BQHG 4JZOB 5DJ2A 4G43A 1G1YA 1SHMA 5F7LB 5JNYB 3WF1A 4POZC 3AHVA 1GRWA 4UQ2A 1X1NA 5I71C 1UZ8B 2HT2C 4GG8B 4AW7A 1YEFL 4NWTL 5SWQA 2WWMD 4OCYH 1GNXA 2P8MA 3NACH 4P4RA 3QJHB 4NHCL 3KJ4C 4C59B 1XH0A 1HH9B 1J1OL 3MLSL 4K8RH 4ELMF 3POCA 1KB5H 1Z0NA 2ADGB 2H45A 1GOHA 4Q6IB 1J0HA 1G9MC 3VW3L 3WN6A 1A7RL 4QTIH 2F61A 3EYUH 4IUGA 1JF1A 4F7TA 5IB3A 3EBVA 2VIRB 4M6OH 2JEPA 3RDKA 2DT0A 1SJXA 4CD7A 2D7TH 2WMJA 4BH8A 3BD4A 4ODWA 3GSWB 2XRAH 3GKWH 4B7LA 1MVYA 4WGWB 5KSAB 4JFUA 4XVUD 3WHE0 1Z3GL 3C6SB 3CPLB 4Y5YA 1K3ZA 4KUCF 3PQYD 5DTFA 2XN0A 4L3EB 5FOBA 3IETB 5K59E 1EJOH 1A4KA 4GKZA 3VWKB 1EEUA 5FGRA 2VC2H 2LVCA 3JWOH 3UG4A 1E0XA 1LO3L 3B9KB 4O2FA 3WUWA 4PJ9A 1M01A 5IHBA 4KUCD 3O4LE 2EDBA 3LN5A 4MJ5B 4OLZL 3VFTA 1ZV5A 3WFBH 1R0AH 3ET9F 1JTPA 3IDJA 3AIWA 4W86A 4FQCH 1C8XA 4HBQA 1NMAH 5T5NF 3FFCD 4MJ6B 3JWOL 3W5MA 5GJSH 3CUFA 1UQSB 5F7EL 2X4RB 3D39E 3QEUB 4DKFH 1R5IA 1DZBA 3A0OA 5C0IA 1A22B 1MNUH 3TBYB 3O41B 3LEXB 3QO0A 1SQ2N 3CAFA 2P5ED 2VLJB 4KU1A 2BHUA 2XQBH 4HUXA 1HEZB 4GXVL 2IBZX 3WH5A 4QHNA 4G7YL 1MCLA 1CGSL 3TBTA 1DN2A 4YDVB 3QUXD 3BSHA 4LPXA 1W3JA 1U8IB 4HTYA 5F1NA 3DX6B 3IDXL 3GJEA 1RPQA 2DLTA 1E3ZA 4HS8L 2DEPA 5MERA 1XEDA 1KTCA 2X4QB 4BF7A 4CADB 4P2RD 3WL1A 3AYRA 3TLRA 1Z2KA 1RAMA 4J7RA 1RIVH 2MHAA 4D6CA 1E4NA 4Z7VF 5MEND 3VXMA 2I27N 1KJ3H 1JZ6A 4MAVA 3TEUA 5DMJB 1Y18B 1D5ZB 5ELIA 1FG9C 2QSCL 5DSCB 3N04A 1A02N 2PYEA 4PG9A 3L4ZA 1EA9C 3RWCA 3W25A 4PJEE 1E5JA 3V95A 5DUBA 1U8HB 1EFXD 5HI5D 3RUGF 4QLKA 1B3JA 4IRJA 4RBPK 1OAZH 3BPNC 4M6NL 3FT4B 3RNQB 1TVPA 3HG2A 4FNPA 1HNGA 1JZ2A 1MCSA 3B9EA 1KXHA 3LDBB 1IQWL 4JFEA 5FL1A 3MSPA 2BOCB 1UWXH 3TYFB 3DX2A 4U6VL 5E8PB 3MJGX 2IH3A 1ZE3C 2VLJA 2FBJL 4PGBA 1RIUH 3CXDH 3MRFA 4YZFF 1A6VL 4UQ3B 3MV8B 2VR5A 2XXCB 4P2OD 1IE5A 3UTZA 4JFTA 3W27A 2AGJH 4M6ML 5EZOH 5HPOA 2GJ6A 1A0QL 3T0EE 4UQ9A 3PG2A 3OKMB 4CW1B 5AG8A 2OSWA 3D3VB 2FSEA 5EO0B 1V3MA 5MERB 3GXNA 4HLZH 1CFSA 1UKPA 3KPNA 2R2HB 3LS4L 1J0JA 1I3RA 3SIMA 5HSFA 1BVZA 3MJ8B 3AXHA 5I1KH 5C0EB 5FIEA 3RX8A 4JFHE 3RGHA 1MWAH 2L7JA 2YXMA 3MRCB 4PLKC 1TMCB 2WUBL 4MD5A 2F53D 1A6AB 4QXUH 2YPLB 4QYOA 3NAAH 3ZKXB 4LDOB 4N9GB 1LO4L 1ZOXA 1I85C 4G80A 4OLYL 2IF7A 1A1NB 1KLFA 2N7AA 3LKNB 4D9RD 1A1NA 2UY5A 4P2QE 2EZ0D 4LDEB 1C16A 4L8CA 3PTKA 4MNJA 3ZIZA 1S78C 3QAZC 1CDYA 4YO0B 4NBXB 2HLAA 5HYEA 4F66A 3MO1B 4WU5B 4HF5L 3KR3H 5K9OB 5D71H 3V52L 1UWRA 4O2EA 1I1CA 4JFEB 5EU6A 2R0WL 4TNWF 4TSCL 1U8JA 4A6YL 1BQSA 4PGEA 1MFEL 1MVUB 5E7FA 1MVUA 1YEGH 5DHYA 3NZ8B 1GOIA 3V5HB 2YXFA 2GSIA 2VRKA 2A3EA 1FGNL 4K8RC 1EO8L 4JPWL 5F3HB 3KXFE 4QNPF 4QRTA 5ISZD 2CIPA 2WZPD 1EHLH 3L5JA 1ZGLM 2BC4A 4PD4K 4W4OC 3RNKA 1RHHA 3LEYH 4ONHB 4LLWA 5EBMB 4LLWB 4NQDB 2GUOB 2BVYA 2W9EL 4HOXA 4EQ3A 5ANMB 3D51A 4NC2B 1INDL 5C0RH 1P7KB 4OLVH 5DK2A 2YR3A 3U7VA 5C0BD 2FIKB 2DQHH 2X4PB 3BH9B 5DK2B 5KS9B 4OOUA 5FDYA 2J7EA 3CFEB 3RA7H 4MDJB 4LCWD 1ZANH 4PRIE 4AG4L 1JXJA 2WAHA 2N4IA 2DJUA 3C8KA 4JRYD 4ONFH 1TNNA 2YD3A 1ZLSH 3SCWA 2FDBP 4IEFB 4PGDB 1ZHNB 5F1KC 3U0PA 4PJIB 4ATWA 5DYOB 4V1DD 4PB9H 3KLAA 3OXRB 4JN2A 4F8TA 1DFBL 3C5ZB 2D03L 4F9LC 1HHJA 2IPUG 1MI5D 3G6AA 1YEJL 4MNHB 2H9GA 3E8UH 2V5RA 4JCLA 5C86A 3KVQA 5ITFA 2DQTH 2RR3A 4R3SA 4LKXA 4MJ2A 2WHLA 2B0SH 1XYFA 1V03A 5I0ZA 1XGRA 4EDWL 3K74B 1B2YA 1UWTA 3TT3L 3QPXL 1OWRM 5LAXB 4JRWA 4YHIA 2EIZB 1UG9A 1FC2D 1YNLH 3BO8B 4XCFL 4HXAH 4YHIB 5BWFA 4FNLH 2MKWA 2PWFA 1A47A 2NT1A 3BWAA 3I3EA 3HAEG 4O9HL 3BYYA 1IGTA 3G6JB 1J11A 2LU7A 1ADQH 5DRZA 2HN7B 3CZJA 3KYOB 2NXZB 3VFNA 5T1MB 1CFTA 1CDGA 1IEBB 5ENWA 4PTTB 1UR0A 1BVLB 2VI0A 4PBXA 3A4WA 3FT3B 4UFHA 3VIKA 4YXHH 4QXTB 2DQUH 3VSTA 2CKSA 2WSPA 3D18A 4OZ4A 1NEZG 1MCEA 1XIWD 2B1HL 1UXWB 3LVEA 4N9OB 3L2MA 4URTB 3MJ7A 4WHTA 1JZ5A 5FHAH 1FCCA 2YKKA 1FNAA 4KKAC 1M1SA 3S88H 4Z0XB 1UD2A 5HBFA 2H9GB 3WDPP 1E6JH 3X17A 3NVQA 4EVNB 3WFEL 5CWSB 2CIKA 3FFCA 2P5EE 5DRNB 5A2LH 2UUDK 2AS5M 1DLHB 1E6OL 4XCNA 3WXVL 3TZVA 1AJ7H 3K2MC 1EJ6A 1RJLA 4APQA 1YMHB 3HC0A 3OLEA 3D5OF 4LCYA 1JYNA 4F2MA 4I4WB 1PYWA 2Z92A 5IDIA 3TBWB 3L3IA 3LSOA 2VZOA 5GS0D 4JFDB 1YZZA 1I7ZB 3AREB 1H3TA 3T3PE 3K4AA 1S9WA 1TTUA 4WDIA 2FB4L 3UXFA 4LXFA 2WB5A 1NBQA 2I24N 4MWFB 1JDCA 3DX4A 4HWEH 4MMZC 1A7PL 4EZMA 3UC0H 1KTDB 5JW5A 1KLUB 1CFTB 5E1AA 1YNTB 4WFHD 3ZHKA 4FABL 1B1YA 2YOCA 4XPFH 3Q5TA 4I77H 4PFEA 5EIVA 2ZXAA 1EO7A 3N9GH 2W4XA 1JGLH 2VERN 1OWWA 8A3HA 5F96L 5J0BA 3MRKA 1RMFL 5HYJD 4XX1G 1MREL 2VITB 4DCQB 3WMCA 3I75B 1UZ8A 4NM8L 4RMQA 4UCFA 4KRUA 1A1MB 5JOPE 4PJ7E 1UFUA 4EANA 2BNRB 5KOMC 2AXGA 2JIXD 3L4TA 2C7UA 1XF5A 3CD4A 5DJ6B 5KN5B 4R97B 2DMKA 5DJ0B 3MMDA 4LKCA 5KVEH 2WZHA 4M9OA 1HX0A 4KMTL 5CEYB 5HHXL 3CPUA 2VIRA 2HT4D 3Q3GA 4YHPB 2ZOKA 1FO0A 3GSWA 3QUMB 2O5ZH 4R97C 1RHFA 4JY6B 4POZD 3WY4A 3L1OL 1QBLL 2Y7QB 3RWFA 2EYTA 3UTTD 3WIFA 4YFDB 1FNSL 5DTFB 2E4TA 1QFWL 5DDHB 2WYSA 2GHWB 3GJEB 1Z6JT 2VABA 1A3LH 3GO1H 5LBSH 3I6GB 3MCKB 1JDAA 2IG2H 4PRHA 2VZSA 3E2HC 2Q8AL 3BJ91 3WUBA 1QO3B 4OZHA 2VYRE 4H26B 3L3KB 4A2LA 5IVOA 4OJYA 1JK8B 4KJQD 3THMH 3QXDB 2BVQA 5HHPA 1XGQB 3JUGA 5KSBA 2YFOA 4KV5F 1G7LA 2YEZB 4J3SA 4ELKA 4IISA 1XAUA 2HKHH 1M6OA 1KELL 4P2OC 1XFPA 3W2DH 1ACYL 4N0CD 5JBFA 4ZE4A 4JDZB 1EXUA 4PJ8C 1T0PB 3MRBA 2X0HA 5B4MC 2WCSA 1QBBA 3F5WA 1HILA 4Z7NE 4P2YA 4S0TD 4KK6D 1IGCH 3QIWD 3SE8L 2DL9A 2V7HB 1CZ1A 5JOEA 2Z31D 4I2XE 1MWAA 1IILE 1M05B 2AMGA 4PJAB 3U9UA 3U9UB 3QHOA 2YD6A 3NUKA 3CCHA 4M5YL 3CTTA 5FYKU 3GXFA 2HWZH 5MI0C 2NZIA 1U8MA 4M02A 4ZXOA 1N59A 1JNEA 3FO9B 3CUHA 3D5HA 4FZ8L 4NWUL 3WDIA 4NM4H 1ZGLA 3QXUA 5LCVH 4L1HA 3LKRA 1PG7X 3RCNA 1IT9L 4HWZB 5ICYA 5DUMH 4F57H 2E7CA 4TSAL 2ZUWA 1ZEAH 3V6BR 1KPVA 4ZODA 5BRZD 3B2VL 4GMSH 3U30C 4X6CA 4QXWA 5KZCD 1EGJL 5BXSA 2VB5A 1VACA 3NFSH 5DMKB 4PTVA 1C1EL 3N18A 3NIYA 4ELKB 5GZOD 3ARWA 4DGIH 2BXZA 3MA9L 4H8HA 2AEQH 1L7TL 5ADOH 5HDBE 4WU5A 1LP9E 4QRUA 3RZCD 3IJ8A 4QAWA 4BSWA 4DOHB 4RAVB 3CZNA 3M1BB 1K5NA 1J0ZA 3MXVH 2AJ3A 3OMZA 1KV3A 4GQ9L 1TITA 4OF0A 3RGVB 2CLRB 4OCWL 4OUUB 3UTZB 1U8OA 3QAZB 2C1PA 1WWBX 3WIHH 3CIQA 3OPZH 4Q2ZB 4R0LB 4RGNB 5IQ7L 2NTSP 3OLIA 2CLVB 3VG0H 3BAJA 1NJ9B 2AV7B 3CO4A 3DMMA 1PQZB 3HB3C 4MXQC 1XCQA 2NLJA 5BV7L 4PCSA 1CXKA 3NZ8A 2NY6D 4J23A 2F9BT 3LQAC 5I1HH 4MNGE 1KNOB 4LHUA 1KNOA 3VRLE 2J77A 4HK3J 4W70A 3KJ6H 1SJHA 1UKTA 4YBLB 1U3HD 1L9MA 2OBGA 3OJ2C 1O7AA 1GOQA 1DQDL 4DKAA 1IC7H 3BGFC 2EDLA 3QP3A 3OAUL 3U46B 4ZNEA 3MREB 3VIJA 1AD9A 3FN9A 5GS2D 1C16B 5DMKA 4G5ZH 5F9JA 1AO7A 1IAKB 3IB4A 4F3FB 4FQLL 1R33A 4V1DE 1OSPL 3RM4A 3SCMB 2GITB 2A6DA 1NDMB 1ZLWH 5KG9B 1HQRA 3PNWB 1WAAE 1N6UA 5EU3B 1LEKB 3C09C 4HAGA 1NCDH 1AC6A 1VAHA 4TVCA 1GGCH 1OAKH 1HINH 4HG4K 4D6DA 1FVEB 4LRIC 4X5XB 4XAKE 5I3DA 5D1QB 1F4AA 1HOCB 4C56E 4PJFB 3MCLL 1JGIA 3MLTB 1DQLH 2Z35B 1J05B 4MNQB 4Z7VB 3ZDZF 3ZR5A 4GZIA 3WMSA 2PTTB 2FATL 1K4CB 1G7HB 4ZENA 2J4WH 4FMFA 4DW2H 1PLGH 4AIUA 5GRVK 3TBVB 1OAYL 1LL7A 1NFDF 4HW6A 4LLVB 2W60B 2A77L 3MBXL 5T5FL 3T1FA 1KCRL 2A83A 3CH1A 1HQ4B 4ZFMA 3LY6A 5JR1L 1EH9A 4PJXF 3X3FL 4TUJB 4PSPA 4KTEH 4XHJD 4BQBA 3KYMB 4BK4A 1KJMB 1TZIA 4UDTA 1E0VA 1AKJD 2PC8A 3ZKSD 3HI5H 4HPOL 2XFYA 3W9DB 2CDFB 2B1AL 4JQXC 1IMHC 3L5XL 3ZSSA 4PJFE 1ZLUK 5D5MF 1JL8A 4FOMA 1S5IH 3IFPB 3QIBC 2NNAB 5EBLA 1A6ZB 2R2EA 4P5TD 1D6EB 4NQVB 5MHSE 5IB4B 3MLYL 4XC3L 4ACZA 4YBHA 2WVSA 1UGNA 1DE4B 4WVRA 4RE4A 4I1NB 5ESAA 4C56A 2FZ3A 1G7PA 3UTOA 3AC0A 2EBNA 1E4XL 3EHBD 3MQIA 1OGAD 2E9MA 1KGCE 1XHGA 1WAAA 1LJYA 4AD1A 3ULUE 4BUGA 4YHNB 1BQLL 1Q9OA 4AQOA 3H9SB 4N90E 2DMBA 3U7WH 5FK9A 3BP7A 1O7VA 3L1OH 4V1DA 2VN4A 3V2AR 4APQB 2XFFA 3DJ9A 4HKJB 1VFFA 1I85A 3RRQA 3UP1A 2WNWA 5CGYC 4I0KA 3BVTA 3AQUA 3CZGA 1BFVL 3RWDA 5A6MA 3U5YA 4YBQD 3WUWG 2IQAB 3L3IB 3T4AA 1NC2A 1N8ZB 1E1FA 1BZ7B 3G6DH 5IMMB 2JALA 2YS4A 2PXYA 3KPPA 1ZB5A 3ZMRA 1W0WB 4HZ6A 4GKNA 3PJSB 3DNKA 3P4NB 3UBXA 2PCPB 2FO1A 3PGDA 4DFIA 4PTTA 3LSOB 3BKJH 1U93B 2J78A 3H3KA 1MRDH 4QHLA 4LLUB 4D6GA 5MEQA 2F53E 3PHSA 1GJUA 3P73B 3WUWB 1FDLH 3GNML 3BT2L 3GNPA 1MFBL 1AD0A 2E6JA 2XRAL 3ARTA 1KB5A 2QTEA 1DUZA 3QNYB 5J9PB 3GGWB 2XNAB 3RWGA 3VXPA 1PS3A 5DJ0A 2DQGL 1Z32X 4JFPA 1S8DA 1LP9B 1KCLA 3FOMB 3K80A 4HJGA 2DDQH 4ZUWA 3INUL 3QSKB 7FABH 3VD9A 3B5TA 4HA3A 1BP3B 3MRJB 3QPQD 4JY5L 4JY4B 1LLOA 4A6YA 1D9KA 1BZ9A 1FC1A 4PJBB 1J01A 4YH6A 3F7RA 1ODUA 4PV9A 2EXYC 1T2QL 3CMGA 1KENH 4QRRD 3X11B 1FORL 1LO2L 3BUYB 1LF1A 4DZ8A 1TZHB 3AU1B 5TDOB 2VDNH 2EH7L 3S5YA 5CJQH 4EI5B 5GIRB 4Y5VA 1U8PB 4AWEA 4Y5VB 3SKMA 3H7BB 3MV9A 5CIPA 1PIFA 4LSSL 1TDQA 2J8UF 2M1KA 4OF5A 1SEBB 2NY6C 1UWUA 4HKBA 2ZCKL 3E1F1 3U1SL 3DBXA 4TUOA 4MJ5A 4KI5C 1C93A 1PFCA 5EUKA 2BHZA 4XC1H 2HLFD 1M7IA 4FQJL 4I2XA 2VRJA 2GY7B 1F3JA 1LO5B 4HWEL 1OP5H 1H15B 3SCPA 2CO6B 2FJGB 3VWKD 4IOIA 5AAWA 2V3DA 1R47A 1A7BA 1TCMA 5T1DH 4CKQA 4YXLL 5L88H 1KF9B 4O2CA 1S7WA 3WFDL 4HIEA 4PLNC 4G8EB 1IEAA 2IH3B 3PWJB 4HIEB 2DL2A 4PBVC 2BMKA 4LK4A 1QFHA 2O5YH 1OAXL 1UR4A 1HSAB 5KSBE 3P77B 1CLXA 5TE4L 4EI5D 2G5RA 3TBTB 2NSXA 4LQ1A 3MCLH 5HHNB 1H5BA 1ZT7B 3T2OA 5EU5A 1IM9B 2QQNH 4PRHE 2XTKA 4EJ1C 4JLRA 1XD0A 5KANI 3CSPA 4N8CH 5FA4A 3GM8A 3ROOA 3K7UA 4U6HB 2IALA 3Q2CA 4HWNA 2QKIB 1PZ2A 1CK0H 4M9PA 4MX7B 5H35B 2HFFA 4NUJB 2P5WA 1BJ1J 1AR2A 2JELL 5E6YA 4J8RB 1TFVA 1JMZA 3EAKA 5DA4A 2FX9L 1INEL 1U3JA 2ZCLH 2HKFH 4X99A 4WFGD 1XYZA 2BCKB 3BUPA 2EDEA 5IHRA 4WWKC 1PKQA 3U36A 3QIBB 2RQ8A 3N0PB 3VGHA 3BVVA 1OAUL 4NN5C 1FZMB 2PYEB 4PG9B 4PG2A 4XNUL 5ITBL 2YBTA 1RI8A 3P0VH 3L5HA 3MO4A 3T0XA 5L7XL 4LF3B 2WMHA 1BQHB 1W72A 3QCUH 4XHQA 1UKQA 1R5VA 1RUPL 4D9RE 4HIHB 3QUZD 5JIHA 3RGVA 2D20A 3N1PC 3DXAA 2J6EA 5BV7H 3SKJL 4WV1B 1MW3A 3FN3A 1F90L 4W4OA 2JB5L 1ACZA 2OLHA 2OL3B 3VIPA 3MNVA 1G7QA 2J8UA 4N0UA 1GORA 3LKRB 3WIHL 2ZCHL 1GZJA 3WDJA 4TNVF 3BAEL 5IG7B 4P7NA 3WNMA 3HFML 5CUSL 1N5YL 2VZ3A 4GUPA 2CKBA 5F7NC 4ODTH 4GRWE 4N5ED 3E2HB 2OR9H 2RGMA 1JRHI 4O51A 1N0LA 2P44B 1I4FB 1TENA 5T1LB 5ADOL 1VBUA 2FCBA 3W81A 2AEQL 3F7VA 4ZUUA 5GNZA 3VFVB 1T5XB 4HIIA 2OSYA 5FKAB 4W68A 1JDDA 5EBMA 3WE6B 1DR9A 1FNHA 4ONFL 4RWYH 2YA1A 3O6ML 3VDCA 2C3XA 4WHYG 1KXVC 3OJVC 1Q94A 3KLLA 4XCCL 5FD0A 1KJVB 4JJ5A 1KJVA 3HR5A 4JJ5B 4LMQE 1C08B 5CPQA 4X5WB 1BJ1H 1K8DB 1LHZA 2XWJA 1K9EA 2OTWA 1G1CA 2FEEL 1E4WH 3OHXA 2UWEF 2VLME 3H3PH 3MMEA 1J10A 5MI0B 5GS3A 4YHYC 4UFJA 4UI2A 1REIA 2JIXB 3GH5A 4XPGH 1G7HA 4UFLA 3WLWC 4G8FA 5M17A 4GZJA 1XGPA 3BCDA 4DZBA 2GFTA 1VGEH 1EPFA 3MNVB 5IB2B 3NTCL 3WL0A 4MNHA 4JM2C 2ENSA 3SE8H 3H9YA 4NNXB 1EXPA 4BA0A 4XBGB 2EC9U 2BY3A 2HT2D 3AICA 2Y9RT 1O7SA 4AQ1B 4M7KL 1QW9A 5AZEL 3T0EC 5GSVA 4PRID 3FONA 4HS6B 3VFMB 3S5ZA 4NNYB 5J56B 3NSMA 3JWDL 5CS7A 2LU3A 4ONOA 5EO9A 3ELAT 1NGPH 4OFYD 5IW3A 5D7IE 1D6VL 3DO7A 3VX0A 5IUSA 4XBEH 2HA1A 5CJQL 3D39D 3UTSB 2EH7H 1L0PA 2VDNL 1HKJA 4YR6B 1S9YB 4RRPG 4HKZB 2YWZA 1CVSC 3FQRA 4GW4B 4G6MH 1TZGL 2QQLL 1U3HC 5IB4A 1JWUA 4MAUL 1PPIA 4HZ7A 4APQC 1WBYA 4KVCL 3VA6A 2X4OB 4R26L 2PO6B 1Q0XH 1CXFA 1CDCA 5GGRY 2A9NL 3OWEA 4EAMA 3BP7B 4MA1C 3U57A 5E8DH 2B31A 4PRIA 4NZTL 2HVMA 3BUQA 5JDSB 2GTZA 4OGZA 1AXTL 5A40E 3UJIH 2UWEE 3INUH 4GW5A 1BAFL 1GGUA 1ZWIB 3DX3A 1A21A 4RNRA 3I2CH 4N0YL 4LX4A 4RNRB 1WFNA 4XCNB 4OQTH 1FFOA 5CFHA 1FNLA 3OAZK 4XMKL 4PRAB 4UNTA 2GT9A 3VXQB 5HY9A 1G9NL 3C60D 3C8DA 1Q6FA 3RWDB 4ZO8A 3P9MA 4UZUA 4N0UE 3EYQD 2X4NB 1B88A 4HLZG 4AL8H 4WDIB 3MR9A 2A0LD 4IDJH 4YFLI 3IJHB 1IGFL 3QI9C 1UVQB 3KXFA 1IC5L 3N1MC 1GHFL 3LCYA 5A16B 4RFEA 3ZJ6A 4ACZB 2PCPA 3QPQC 3NSXA 4P9HL 1N5AB 1SZNA 3PGFL 4M5ZL 1E6NA 5DI8A 4JKKA 3FQUB 4AIEA 4MJ6A 3VXPB 1CBVH 4NZFA 5CP7A 5EU6E 1AXTH 4Y4HA 4M1RA 3UAJC 4LVNC 1ZA6B 4P4RB 1PX4A 4OT1H 4YDLC 5EZIH 4Z0BH 3VGAB 2R9HC 4NQED 3DIFA 4V1DB 4XZBA 1U95A 5C6TH 1UH4A 3ALGA 4A6YB 1P4IH 3O2DA 4P2QA 5E6ZA 3BI9X 2DDQL 1XR8B 2P5WE 1GZQA 1ONQB 3MV11 2F58L 5F1NB 3BMWA 4JREC 2OYMA 4U7SA 3T0AA 5D1XD 4NQCD 1JPGA 1HI6B 4UAOC 4CADA 2Y7QA 1MAML 1JPGB 3RWFB 4D0BA 3PGDB 4F7CA 3CLFL 4R4ND 3CSYB 1MNUL 2E7LA 4XC3H 1L7IH 2CBIA 2B4CH 5DHVA 5FGBC 2I9LB 4PJ8A 5DK3A 5DMGC 4U6YA 3SOBH 3PP4H 1E3XA 4KJWD 2PXYD 1IAIL 1CF8L 2IBZY 3CX5J 4PJAE 5EO1A 2C1OB 1AIFA 3B2UD 2NW3A 3RBGA 1T5WA 4W6WB 3RVXD 3IDJB 5KSBB 1BD2E 2APTA 1WC7A 3OKLB 4HPYH 3FQNA 2VC2L 1TE1A 3V79C 3GSVB 1UQSA 4KK5D 3QDGB 5CINL 2NYYC 1J18A 1R8LA 5J3HD 5ID1B 3VFPA 3EJUA 4JG1H 6FABH 3DO3A 1JVKA 3V6ZA 4WO4B 3O9NA 3HCVA 4HBCL 4XNQA 5E70A 8FABB 3PTQA 1JRHH 5A6KA 4RGMB 2OMNA 1EQPA 4LKCB 5L6YL 2BNUB 4OF8A 2CKNA 3II1A 2GTWA 4ODHH 4M43L 1E9LA 3NFPA 4FP8L 2X89D 1DQLL 4ZFOL 5MEPB 3Q3GB 4N0CC 3U0WL 3VXME 5E6IA 4MSWB 1MJJB 1EZVX 2IANB 2F5BH 3BGMB 1ZT4A 4MX7A 2H41A 1RURL 3JV4B 2CGRH 2JTDA 3FRUA 4U1NB 1FZKB 5E8DL 5CSUA 5LA0A 2HJKB 4XP5H 4G3YL 3HE6B 3ZDXE 2EH8H 1FH9A 2CKRA 3KWWB 2NYYD 1U8PA 1RUQL 4HC1L 2CDEA 3OX8A 3NCJH 1H3GA 2CDEB 2FWOB 3OX8B 2V2TA 3PZNA 3P4LA 3RA7L 4F8XA 2KUTA 4JVWA 4ZUTB 3LPOA 1FNGB 1YJDH 3VDHA 1WVZA 4GAJH 3CC1A 2BHYA 4NSKA 1QQDA 1U58A 2PWHA 2DJSA 5FCUH 1AGBA 4EUPB 4OBSA 4PJDE 1AGBB 5B39B 1CDBA 1FP8A 3PDGA 5KVMC 1VHPA 3TO2B 4X4ZA 1CGWA 4F33A 2J3SA 1IKFH 3SDCA 4LOUC 3V5KB 4E41A 4YPGA 2FGWH 1A6WL 3HUJE 1JHLH 2Y8VA 4NGHL 3W82A 2IJ0C 3D39A 2VISA 3ARDC 4YDIH 2BOCA 5IHZB 1D5BB 1Q72L 4PJ9C 4PY8I 3UEQA 5T1KB 3PABB 4G9FB 3L9RB 4M7LL 2C1PB 1BJ8A 4UB0H 4OUUA 2QADC 2VAAA 5K9QG 4I9WD 2OCFD 1SM3L 5MEPA 4KK9D 3OF6D 2WK2A 1OD7A 4LGSB 5FM5M 4OD1L 4XPBL 4OQTA 2AJVH 2HFFB 4PRDB 5DD6B 1G7MB 3BPOC 1RFDH 4OB5L 5TDNA 5JA9A 3ZZ1A 1ZT1B 2G60H 3SDAC 3LH2L 4O4YL 2FE0A 1FAIL 1P4BH 3VIGA 2XWTB 4FQLH 4GRWH 4NC1E 2XWTA 4Z2JA 1FJ1B 2V6HA 3O81A 4FQHB 3MACL 1FNGA 4LGXA 3HA0A 4NKOA 5J6GB 4KKLD 2RFXB 3MU7A 2C4FU 3QUXC 5L8KB 1V6XA 2EO9A 2WCAA 4K9EH 1T7ZA 3D69B 2CITA 1KCVH 3RAJH 3IJSA 4CD5A 1FZOA 3KJ6L 4TVDA 3AIBA 3HPJB 4M1DH 3RU8H 2PI6A 3NCOA 4FNSA 5I1HL 2NY3D 1EUUA 2P1YA 4Y16A 5GS0H 1SM3H 1XMWA 2P5WD 4PJFA 1XGYH 5D1QA 3BSZL 2ALWA 2Y5TA 1HYSC 1UWXK 4MAYC 3TTQA 1OHQA 4CMHB 3UTQA 2CRYA 2RGSA 3HZKA 3EOAB 2F74A 2PBOA 3OZ9H 4C7FA 5I1LA 4KKLC 2Q8BH 1OSZA 5J06A 2EDFA 2JJSC 4EOWL 1BYAA 3EFFA 2Y2WA 1IQWH 1Z5LA 1I4FA 3MLUH 4PMOA 2YN5A 3P3YA 1HXYB 3S3SA 3WFCL 1HJUA 3BP5B 4MXVE 3HC4H 4KZEL 4UNUA 1QBMH 4QRRA 3BWAB 1CXLA 4KPHL 1B0IA 4NQDA 5I1IH 4LSUL 4EDXA 5EOCJ 5DJCB 32C2A 4K07A 1NCCL 1FORH 3TESA 2GYSA 2BDNH 3GJFK 3GO1L 1J8KA 3MRIA 3KLDA 2W65B 1HNYA 4BM7A 4M61B 2CKBH 3ZT5A 1US2A 3TA9A 1ISVA 2JJUA 1R24A 4Z7VE 1WJ3A 3KLAB 43C9A 4D2NA 1NFKA 4AMXA 3ZDYE 2HWZL 1TTGA 4NN7C 5H2BA 3MLTA 2MFNA 1JWUB 1B9ZA 4GG8A 2PETA 5CWSA 3PDOB 5DD1L 5E8OB 1U91B 1QX1A 4DM2A 3BRFA 2ADFL 4WFHE 2VH5L 4U1GC 5D7IA 4LFHG 4YHNA 1X5XA 3I3DA 3U5UA 3BPLB 4LPYA 3KG5A 4GS7B 4MA1B 4P8WA 3SY0B 1FP9A 4GO9A 5HDLA 1NC2B 3AISA 1SBSL 3POHA 5GGVY 3BMVA 1X4XA 3KLHD 2XZCL 4R27A 3MFFA 3WFBL 1CU4L 3GJFB 3MJ6A 1JZ4A 5L2JA 4K94C 1C90A 5D5MB 3VGGA 5A16A 3ZE0E 4ONGH 1MCJA 4X98B 3VMOA 2VDLL 4XH2B 1S9YA 4FXLA 1IGFH 5CGYD 4G6JL 4H0HB 4XNZB 4QNPE 2F54D 2FB4H 3AROA 1A6ZA 2R2EB 3DURB 4PJXB 3ARBA 3S7GA 3W39B 2AK4B 3RMEA 5B39G 3FQTB 5E9AA 3U7WL 2R1XA 1IKNA 3PV6B 3CUGA 4Z5RB 4Q6YA 5E00A 2C7UB 4Q0XH 5D7LD 3LXBA 3IDIA 3F5KA 1R3LA 3ULVE 1H2JA 4Z7WE 2DQDH 1J5OH 4P7QA 3HRPA 3TZVC 3P0GB 3LV3B 4ISVB 1LG1A 2DS4A 4Y89A 1J1OH 3T8XA 4LCCB 2ESVA 5B22A 3TZVB 1NARA 3RWHB 4O5LL 1JXKA 4U0RB 3QUMA 3GHBH 4MAYA 4IM8A 2ICEB 2IADB 1UD4A 4FQQB 1OGAB 5D1ZA 1EZVY 4ZPTB 4NRRA 4EQ2A 4HULB 4Z7UF 1GL4B 5CJOH 2H3NB 3AMGA 4LVHC 1S9WB 1QNOA 4TNWK 4HMEA 4KAQH 1QA9A 5D6DA 3CZSA 4K2UL 3SUSA 5EO1B 1QOXA 2C3VA 1PZ5B 3CGTA 3MLXH 5F7KC 5BMFH 4EI5A 2J8UE 1MY5A 1PGRB 3PE9A 3IXTA 3NH7L 4ZAKC 2XV6B 2G75B 3IXTB 3D87B 2WXDM 2EKJA 2P45B 1Y18A 1WWAX 5A6SA 1MXGA 4YXKL 4UTFA 1HHGB 1KB5B 2A3BA 3VM7A 4LVEA 4P49A 1DBAL 2NXYD 3CVHA 1CQKA 1XF5B 1ECEA 3KGRA 4X4XA 1NMCB 3Q0HA 1RK1B 3FB7B 4FTVA 1WT5A 5BS0B 1EGJA 1W9XA 2X2JA 2PWEA 3VGFA 1PKQE 3GSUA 2ZE0A 1K9TA 1A3RL 2JJWA 4L5FH 4XMPL 3S34H 2WANA 5IOPB 3GIVB 4KVCH 5A6BD 1W1TA 4LHUG 1UWSA 4NUGH 1YYMH 4FA8A 1F4WH 3WV0A 3NFPB 4HIXH 2ZX6A 5ICYB 1MFVA 3L4XA 5D7IF 2GKIA 4LLYB 5K9KA 5I74C 1BGAA 5GS1A 5FUCC 1CWYA 3AYSA 4FTVE 1RP9A 4ZXLA 3HNVH 1AP2B 1YEKH 3ZO0A 4XCCH 1ISYA 4NUJA 3GXPA 3OV6A 3TH3T 4KRPB 2DI8A 4P7RA 4NKMB 3HI1A 1V6WA 1MXDA 2JCCB 4NKMA 1V7NH 4UIMB 2I26N 3BUBA 4H20L 2X41A 4HCRH 3JWDH 1WF5A 5DUPH 3MRPB 4N90D 2EIBA 4LSUH 1OM3H 2C0HA 1B0GA 2CQVA 1V3KA 1RVFH 1OGTB 4QGYA 1BWWA 1T80A 4JVUA 1OP3K 3MJ9A 3F5WB 4JQIH 5GGRA 1M7DB 4TRPL 4NJ9L 1VFBA 4XAWH 2GSGB 3UJTL 3VD7A 1E4KA 2W9DL 3AHXA 4MDOA 5ACMA 5IWLC 3HFMH 3CC5A 1EHAA 1KIRB 1ISZA 1NC4B 5FKPA 2CD0A 3DRQA 1QSFD 5FECA 2VX4A 1I1AB 1JUFB 3L3JA 2WHKA 4U1KA 3CCHB 3LRHA 5I1AB 3WH6A 1R85A 2ZNWA 4CW1A 5KW9L 3K3QA 3MV9E 3P9LB 4OTXL 3P30L 1H1NA 3TA3A 1LEIA 1KGUA 5A1AA 2G3JA 2AW2A 5AUMA 3TN0D 2LV4A 5BVJB 1E4JA 3OG6B 3RQ3A 5EDXA 2ESVE 4GUPB 2W0FB 4MMXC 2NY7L 4MYWB 2Y8KA 5D72H 2ZKHH 3IVKA 3DX8B 2OSLB 5C0CD 3JWOC 4N0FA 2E5EA 2ITDB 3MBEC 3SGDI 1NCDL 3QDMD 4WRLA 2HG5B 1Z9LA 4XCEA 5F1IA 3QHFL 1GOKA 4WUUB 5GSRA 1IM9D 2EEDA 4ZDHA 4X5LA 3TC9A 3LMJL 4LHUD 4KKBC 2VZVA 4RMSA 4F8QA 1F4WL 2H6PA 5F88A 2QPUA 1TQCB 3ILQD 5JIWA 2FO4A 3ARUA 4DKEL 4D0DB 1G0XA 3N12A 5BXRA 5DQJA 1FPTL 1D2KA 4EI6B 1FIGL 4EI5C 5E8EA 1CK0L 4E42B 4G8GD 4HFUL 3KL5A 4UDUB 4AMKH 4Z78B 4JGUA 2X7LA 1CNVA 2FDMA 1HL9A 4MXWH 1EFXA 1P84J 2JB6A 3IS1X 4PP1C 4PRNA 4OSUH 3ALPA 2PYED 5I19H 4NQEB 2GJJA 4ODVH 3WF0A 1BGGA 2DH2A 4U0QB 1RVFL 1LO0H 4KHXL 4XGZB 1EHNA 4PD4J 4H88H 4ZAKB 4XBPB 1WUNT 3V52H 1CFNB 1EFQA 4YGVA 4NGHH 1DWJM 2GK1A 1CGYA 1QLEH 1QNZH 1IM3B 3EOAA 2G2RB 3NH7H 4H20H 4RFOL 5CLTA 3S4SB 2VTFA 1PG7H 1IZJA 2W0FA 2VDKH 4FS0A 4XWGH 1CTOA 5IESH 3DETC 1VA9A 3IVKB 5D9OA 5DR5H 5F9OL 3LKPA 1A2YB 3U1SH 1BBJA 3BAWA 1P5VA 3EOTL 5HD8D 4JZNA 5LQBL 1WSST 5GSRB 1R5WB 4PY8J 4HIXL 1F6AB 2EDWA 4GAGL 5EFDA 4F7EB 3E6HA 4KUZH 2XIBA 4RZCB 4CJ1A 3KYKH 5HHOD 1RUQH 4HC1H 3STZB 3KYAA 1ODAA 3VJ6B 3NIGF 1C1EH 2AP2A 3V5DA 3HRZB 3RDTA 1T3FB 5A2FA 1SMAA 2DOCA 3L6FB 3SGEI 3GM0A 5D1XC 3CSGA 3LAFA 3EYSL 2DQCH 1AFVL 3DECA 5F7MC 1J5OL 4ZO7A 4XHJC 5C92A 3HG1B 3ARED 1MFUA 3BN9C 5BO1L 2ZZUT 5BXPA 2P49B 2DB8A 4NQDE 1ITCA 2CR3A 3O2DL 5LCVL 2GTZB 4XV0A 4JFHD 5D9MA 1LDSA 5HGBB 4FZ8H 3HNSL 2GVYA 5J13C 5CBAA 1N7ML 4JG1L 6FABL 1II4E 4IOFC 4GRLC 5CBAB 3BN3B 4GW5B 2W63A 4KTYA 3N9GL 2ATPA 3FAXA 1Y0LA 3BKYL 1DBKL 1TPXC 1PW3A <