5CGTA

Maltotriose complex of preconditioned cyclodextrin glycosyltransferase mutant
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 232
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cgtA01
1OAQH 1KPVA 4GXVH 3R8QA 3STZA 2FSEA 3HZYB 2VH5L 5CP3A 5LQBH 4TTDD 4OGXH 5A2FA 2NX5D 1WZLA 2OCFD 4ZTOL 5F3BB 4U3AA 5FGBC 4R4BA 4W4NA 2IH1B 3CZJA 5I6SA 3BPLC 1NLBH 1WC7B 1GGBH 3LQZB 1GPOL 1T83C 1B2WL 1A3LH 2DQIH 1LD9A 2Z35B 4D6CA 5HDQH 1YEIH 5DC0A 2NT0A 3KDMA 1HKIA 1MCSA 3B2VL 4G8FB 3MYJB 2X4SA 3ZKMC 3O4LA 2ZXAA 3VGHA 5D2NE 1UM6L 2HLAA 2XRAH 5A2IH 3B3IB 5F97E 1Q6CA 3LPGA 4GQPH 3QFDA 3HZVA 1M7IB 3VXQB 1QRNA 3RX7A 4NZRL 4P2RB 1J7VR 3SKMA 4EUPH 1A6ZB 1NCUA 1KEML 3GSRB 4FMFA 3MLPA 2XYCA 1A47A 2WCSA 4PJBA 1GGUA 2XG4A 3V0WL 2R39A 4JFEB 3S97C 1LEKB 1UQSA 4ZXLA 5A2CA 4UTFA 4GH7B 4JKPL 5KAQG 4H8WC 4QHUB 3EJYD 1O7DC 4PP1D 3WNLA 3RPKA 3LZFL 3ARBC 3MGOB 3OXRA 1GOOA 1A6VL 2CQVA 2PI6A 3M8OL 1NANH 3AXLA 1G6RB 4YGAB 4D6IA 2ICWB 1EERB 3KPPA 3PHQB 5C0IB 2EDYA 3RFZC 4Y19B 4APQC 4JPKH 1VKXA 3CX5K 1TVDA 1W2KT 4HQQL 2VL4A 3RX8A 1GJUA 5HDBF 4H1LG 4AZBA 3CPLB 4S0TD 2FZ3A 1IEBB 3WIIH 2CCRA 3AVEA 1L7IL 1IGCH 1YUHB 3ROLA 2DYPA 1HHHA 1OD0A 5HPMB 2AJ3A 3WIHH 2AKRB 3Q6GL 2QR0B 2Y5TB 4OCXH 4QXWA 4BH7A 2FJFB 4OKVA 2AJZB 3D6GA 4NHUA 4NRXB 2BFVL 2BNQA 3K74B 3OXSA 5C71A 4TPRL 2Z8RA 8FABA 4HBCH 4K7PH 2Q6WB 3AB0C 3IKKA 4RNRA 4CVXA 2UY3A 5DJCB 4URTB 6TAAA 5C0RL 4FQHB 1C5DA 2HG5B 3LS4L 4HUXA 1DQDL 3SDCB 1AXIB 1F11B 1FIEA 1BGAA 5FKAB 2BSTB 5BOZG 3DX6A 3FFDA 4EK7A 1F00I 1E6OH 3RNKB 1JJUA 1AGCB 1GGYA 1G6RA 3SKJL 3AXLB 3K8KA 1KGUA 1G9NH 3MGOA 1JHLL 3WL9B 1QO3A 4LYRA 3UR8A 3O3AA 4AWEA 2VZUA 1YMMA 2WBJB 2DT3A 4TSCH 4LLQA 1YEKL 3AMLA 3Q2CA 4QRUA 4JFPA 5I2IB 3WSUA 1V0LA 4GQQA 1YEEH 1MRFL 2DLHA 5DEFB 3NZ8B 2AJSH 2QEJA 4M02A 1UB5B 4WUUE 3WXWL 1F4WH 1AQ0A 3QCUH 5BZDB 1P1ZB 4G43B 5INCA 1Q9LA 5ITFA 4PMUA 3MV8A 5KTEL 1ECEA 5CD5C 2J5LB 1I8LC 5B21A 1HWHB 3WHXA 4QRRD 1L6ZA 4MZ3A 5ACMA 5DQ9A 3DUUA 2XM2A 3MBEC 1D9KC 2BY3A 2Z35A 4N5EC 3POCA 1GC1H 3OKNB 2VURA 2C1OA 4YHZL 2F5AL 4RZCA 1S5IL 3HNVH 3WQ4A 4Z2GA 1I8IB 4BZ1L 1BF8A 3IANA 1WO2A 3VDCA 5CG0A 5FDWA 1CIDA 3MROA 5EFIB 4WV1C 4CAGA 1MFUA 5T1LD 4GXUM 3CMGA 5CIPA 2ATPB 3G6JB 4G9FD 3V4UL 3L3KA 4CUCA 2YEZA 4IOIA 3VFUB 1RP8A 1ZT7A 4LLQB 5EU7C 2YBRA 4NM4H 1YNKH 4YFLI 1S3KL 2YN5A 3TV3L 4YO0A 3NDZA 1IM9D 4NYLB 2P4AB 5ESVB 4HUKB 3NSMA 5DS8B 2OR7A 3B5GA 4LIQE 4AL8H 4BQ9A 3PWPE 1ULVA 3TYFA 4GW5B 5EC2B 3R1GL 4S2SB 4JFEE 3P4MA 3LSOB 2AV7B 1P4IL 4HUXB 5GGTH 4FQJH 5CSZB 1R75A 3U2SA 1SY6H 4RE2A 1A14L 1YDPB 4HWZA 4LCWA 3RBSA 3PZTA 2XKSA 1RY7B 3N1AA 5AYIA 4ELMF 3P4MB 4BCEA 3P30H 1T03H 5A2JH 2YZ8A 3RKDD 2CKBB 4ODSL 4U1IB 1QRND 3LQMA 4EOWH 4LAQH 1KXTA 5C09D 1OGTB 2ZUTA 4XZUA 3OL2A 1E70M 2DQDH 2BCKB 2CO7B 4UAOC 1QQDA 1N64H 2WBJA 3BMWA 4U1MB 3CNKA 3IFNH 1VBUA 2PXYC 5E1QA 3F7QA 4MA7H 4LFHG 3DVIA 1PBGA 1QEWA 2YBRB 5I0DA 4NC2B 4P5TA 4PJFE 4IOIB 4U0RC 2BVQA 4PTXA 3LDBB 2A73B 3OZ9L 4WEBL 5ESAA 4NZFA 2HP4A 4OZIA 1H49A 3VXRA 1CGVA 4V1DD 4Y4FC 3HPJB 1NEZG 1VGKA 1WAWA 1B3XA 2WKGA 4M8UA 4UU9A 4U6VL 3RP1A 4N8VA 2OYPA 1V3IA 4E0RA 4NRYB 3CFJA 2F7QA 4F9PC 4CVXB 3RGVB 4OF5A 3VIOA 1B2WH 1FO0B 2PO6A 3CUPA 4RGNE 4UT9H 5EUOA 1U8HA 1X5HA 3CGTA 3A67L 2WZIA 1QA9A 4P46A 3K2UH 3NIFE 5FL1A 3ZSSA 1OIFA 5K9OA 5A1AA 4UDTA 4ZO9A 4UT6L 1M7IA 3GSNB 3TT3L 2NY6C 2V2TB 3IXTB 1CN4A 2DL9A 3BP4B 3MLYH 5DGRA 5L8LB 3PL6C 1MH5A 1EBPA 4WNQA 5ILTH 2IBGA 1VA9A 4G7YL 1D5XB 3N9GH 4UOW0 2EBNA 1J0IA 1I1XA 3BD4A 4JR9L 4R2GB 3IRZA 4R0LB 2XY1A 1HQ4A 5AWNH 2DD8L 1OTSC 1QSFD 4HK0B 2DIBA 2J88H 2V3GA 2A83B 3EMZA 1F13A 3BVUA 1BQHB 3GSNH 4HH9A 3L1OH 4P3CL 1SVCP 1R5IA 1U91A 2Z0BA 2LU3A 3F5WB 3WF0A 1KG0B 2WHMA 3C08L 4LLYB 5HHOB 2YMXL 4OZHA 4M61B 5T3ZE 1Y6KR 3H9HA 1UD4A 4JPKL 4TTUA 4KRPC 5F96L 1DL7H 5FGSA 4EKJA 1MYRA 2B1HH 1PIGA 3MV8D 4BA8A 3UYOD 3GMOB 4OZFG 1O6IA 1AHWC 4FQQB 4GG8B 3GXPA 1DUZA 3DURB 1FORL 1GQIA 3WL0A 5CBEA 4HZLA 3BSGA 3VCLA 5IIEB 5I1EH 4NI3A 3LKRB 5ILTL 3K1KC 2FJFA 2JB6A 4OV5B 15C8H 3PGFH 2MCG1 3L6FB 4UQ3A 3ARTA 2GJXB 3HKFA 5LGJB 4Z7NF 3KG5A 5CP7B 4Q9QL 3A22A 4E5XB 3BESR 1BBJA 2DQFB 3WN6A 4LEOA 3H0TB 4N42A 1A2YB 1TCRA 2FZ3B 4CBPA 2VZTA 2OSWA 3ARRA 4CD4A 5E6IC 4X5WA 4Z7OF 1S7VB 1GZQB 1CFVL 3QXAA 4HIJB 1CE1H 3TNMB 5F3BA 3P0GB 3HE7D 3HC4H 5I73C 2C4XA 3QCVL 4FTVD 4G6ML 1JIBA 1ZHLA 1YPZB 1H9VA 3WFHB 4ZD3L 4K68A 1KPVB 5HVGB 2BSED 2R56L 3IDGB 5KOVC 2X2HA 1RPQA 4LRIC 3R0MA 5F7KC 3LMJL 3SKNB 3AOFA 2Z1KA 1XCTB 3H42H 2GK2A 1KCSH 1FNFA 1P4BH 3D39E 5HJ3A 2EYTB 5GGTL 1IQWH 3EDFA 4LYQA 1BGGA 2SEBB 5EUOE 1QNPA 3RWHB 4FTVA 4L9LA 4HC1H 4K94L 3WQVA 4DFHA 2WXDM 1DSFH 3V2AR 3VFSB 1MWAA 3H54A 5IFJB 3QUYB 3PXHA 5T1KD 3AROA 5CEYA 3L3IB 3E6FB 2P5EB 2CPUA 1AP2B 1H5BA 2Y07L 1U6AL 4FQ2L 4GG6F 4LKCB 4WEUD 1ETZA 3KLKA 1S3KH 4JVWA 1FL5A 5GRVK 5TDOA 4NQSB 2VXSL 4GRMB 4RFOL 1HH6A 5GZOC 4UV7H 5GRWA 1WWAX 2DI9A 3AIVA 4D6JA 4Z2JA 3HC0B 1X5LA 5ENWA 2NT1A 3LEYH 4L3AA 4AEHH 2G5BB 2AAVA 4GRWB 4JGJA 3BDYL 3QUKA 3BUPA 1UZ1A 4NO0A 4B53A 3LXAA 1NDGB 2I5YH 1PZ3A 5HYSA 5MEND 1RUKH 1CT8A 5IB4B 3CUHA 4MA1C 4L5FL 1CGTA 1P2CB 4XPAL 1BIIB 2BOCB 2MPAH 1NDMB 1I3VA 4GKZA 2QLVB 4O51A 4U1NB 4EDXA 1XH1A 2HKFH 2GK1B 4ZODA 5E5MA 3QI9D 3QIBC 3MXVH 1HOCA 3MRQA 1R3KB 2NY6B 1L9NA 1A21A 2V2WA 1ZHNA 4X7FC 1PG7L 3MRBA 4IIQC 4WI8A 4MGXA 5DMGC 1XF4A 4L1HA 1KJ2L 3PP3H 2I9TB 1J8HE 1DQLH 2I26N 4P5KA 4P3WA 1CGSL 2PUQT 3ZOAA 2VLLA 3U46B 3P77B 5BJTB 2DN7A 3BRDA 2L7JA 3I50L 5C0CD 4PR5B 3RAJH 4XAWH 1T0MA 1JGUL 3BN9C 4P99A 2Q8AL 1GIGH 5C0BE 4AC1X 2FIKB 2E6JA 4HKJA 3SGJA 2VXUL 1MPAL 5E4EB 4Z5RA 4ODBD 5DD5H 4FP8H 3S4SB 3V52L 4XVSL 3PZ9A 4YHKL 1IGJB 4QRPE 3U7YL 1L0YA 2PW1B 4EXPX 5GS0L 4PY7A 2NLJA 1J0KA 1GJWA 4YUEH 2HLFD 1AXSB 1M7DB 5IT2L 3O4OC 1DEEA 2DDXA 4NQCE 1QOKA 3PP4H 5HPOA 3D39A 3HG1E 2X4UB 2QPSA 3V0VA 3LKOB 4QY8B 3VDBA 2XNAA 3LVEA 4YHYC 1UZ8A 2CIIA 4BJLA 1MAJA 2VSDA 1WFNA 4EBQL 1O7AA 3VIIA 1PYWA 4W85A 4IRZH 5DJAB 3EJPA 4FNTA 4H2CA 4OCXL 5FOBB 4LFHD 2ZJSL 4OUEA 4URIA 3EZJB 3QDMB 1KPRA 1CLYH 4JFXA 1YMHB 4I3RH 1LP9B 4JQVC 2HRPH 1NGQH 5CPQA 2GW5A 2EIZA 1IGYB 2XOTA 3NN8B 1HJSA 2F5BH 5I75C 3BSZH 3S96B 3L1OL 4P3CH 5I73B 3LIZL 3CTTA 5DD3H 5HHNA 1HXYA 1DQML 2LTQB 5CCKH 1ORQB 1DQDH 4KWUA 3THMH 1NC4D 4XNYL 2D3LA 5C0RH 5C2UB 4XZWA 4N8VG 1OD9A 4Y16A 5I8OL 1DQQA 3VA2C 1XF5A 2IQAB 3BAXA 3HRZA 3KPRA 3E2HC 3IS0X 1NAML 5BW7C 2ZG1A 1OD8A 1UB6B 3HAEA 2WIMA 3LN5B 1MCLA 2BOBB 2FJGA 1T04A 3L3DA 1YEJH 1IGFH 1NAMH 5I1EL 3VSUA 2Y4SA 1I1AC 5KANG 4A3HA 4N90D 1WT5C 1NGXB 5HOSA 1JF1B 3IU4L 4MQXD 5FB8A 3VD5A 1E4NA 4IIQA 1CDUA 4Y4KD 2HAZA 3BIKB 1B9ZA 1KGXA 5E56A 3H7LA 1BBDL 5ITBL 1V02A 2ZXQA 2XZCH 1ZMYA 4NDMB 3LS5L 4MXWH 4ODVL 1OTUD 4U1SA 2R4SL 4YXKL 3BZFB 4CDGC 2D0HA 4N0UA 4RGND 1DQMH 3QA3B 5F93C 3O41B 1G7JA 2EYRB 5E00A 3VFWB 3KHOA 1XFPA 2DLEA 3MLXH 4GAJL 2A3CA 5KVFH 1B6UA 1IAII 1QVOA 5C08E 1Q9OB 1W0WA 2YUXA 4Z7VE 4F7MB 2V38A 3DX4A 4O9HL 3T2OA 2WNWA 5TGBA 1QLRB 4HP5A 3KYKH 3MA7A 3UTSE 4KKBD 1JYNA 1BFVL 3MREA 3WFBH 3LKPA 1JNHA 1INDH 5LQBL 4PRHD 3HLAA 3GHEH 3KJ6H 1GOHA 3V6ZA 3E0GA 2HN7B 4YDIL 2NY1C 3VMPA 1G84A 1V3MA 3QQ9C 2EZ0C 3JWNC 4AISA 4KI5F 5IVXF 4DCQA 1I7RB 5EU6E 4GBXB 5LXGL 4KMLB 3KPOB 1OW0C 1QNZH 4M6AA 4PJDB 4X7SH 3SO3C 1T89C 1R0AH 1AY1L 1AQKH 5I19H 2OR8A 2GSGA 2D24A 1LO2L 1HVXA 4JFDE 1CLZH 3QXWA 4LNRA 5C0DA 3R0NA 3SE9H 4M7JH 3TN0A 1KN4L 4F80A 3H3PH 1RQ5A 4LPYA 3RVWC 3D4ZA 5IXEA 1YN6B 4JCLA 4HHAA 5E8EB 5EO1B 5IMMB 3RAJL 5HYQB 1DANT 4PGEB 5JLZA 1KTBA 4MJ6B 3LEVH 1KELL 5CP3H 2WAGA 4KJWC 4D9RD 1MCWW 4OAWB 3OJ2C 2BNRE 1OP3K 5DSCB 4AT6A 5BQ7B 3HMWL 5DD5L 1YNTA 3VGBA 3S4SG 3CLFL 1TTFA 1GQLA 1FNGA 3T0VA 3S6TA 2EEDA 1MI5B 5EU3A 2QF8A 1GOGA 4M1CC 3REWB 1US3A 4M80A 4YAQA 2WVVA 2XNAB 3KXFD 4M5ZH 2J74A 4IOFC 3U4EA 2C3XA 4JRWA 5GGRA 9CGTA 3S37X 4HHAB 4HEME 4JFTA 2VISA 4G7VH 4QHKJ 4M5YL 1VESA 5DWUH 1KJ3L 3KYOA 5T5FL 4AEHL 4YHLH 3IVKB 4JFYA 1MEXL 1J5OL 2VDML 4YXHL 4XHQA 1ZHBB 1U3YA 3PDGA 3NOIA 3VWKA 1X5AA 4GRWH 1QUNA 3EYSH 4H0IA 1DWGM 4AIZB 4EN3C 1W0YT 3IDXH 4WI4A 1GCFA 1P5UA 4H25B 4MNQB 3D52A 3IDXL 4NQTA 4U1HA 1CBVH 4RBPH 3V95A 1DLFH 2P24B 1MI5A 2Q8XA 3UTTE 1RZKH 1P7KB 5B3JE 3QZWB 4IS6B 1D5ZA 2IUZA 2PWFA 1EDGA 5E08L 2W0LA 1G9NL 1ZS8B 4QT5B 3NAAH 4RIRA 3GUTA 4V1DA 3SDDC 1MCIA 2I27N 4F7EB 4NKMB 3NAAL 3OKOA 4IJ3C 2GK1A 5LAXB 1E4WL 4NN6C 1JWMA 2Y6SC 1R3LA 2Q8AH 1KXQA 4WLCA 3O41A 4J3WA 4MNGB 3MRFB 1BVLB 4XPGL 3VG0H 1W9XA 2NY0D 5CGMA 1I7TB 3IVKA 3BJLA 5JZ7D 2EH7L 3MRGA 2BVYA 5DMYA 2G5BA 4JZJA 1O7VA 2G9HA 1HEZB 4WI3A 1V0NA 2Q3ZA 2VQ1B 2R15A 1W3HA 2Z92A 4L8SA 1SHMA 4O2EB 3PHOB 1J0HA 1HHIA 2BOBA 2FJGB 1XT5A 4AZCA 1JPGB 4Z77A 3OKDB 1T21A 3DXAD 1TZHA 5MEPA 4AD3A 1RJYA 2C0HA 5B38B 1A4JB 6A3HA 1TQCB 2DLFL 3OSKA 2DMBA 4OZ4A 4U0RB 5ETUA 4M6ML 4D0CB 4HS6B 4FXGA 5H2BB 1JVKA 5J3HD 1U3ZA 3IXAA 1M4KA 4MA8L 2XXMB 1AKJA 4IOSD 4G9FE 1ISWA 2F54D 3BRFA 2PTUA 4LLWB 1BBDH 1F3DJ 2VJXA 1HHJB 3DO7B 3CO4A 4HAGA 2G3MA 4I0PB 5IMMA 1AFVH 4HJ0D 1IGYA 4ZTPH 5MP6H 1DBMH 4AH2B 2W91A 4PCTA 1H3GA 1R0AL 1NL0L 4OD1H 1FO0L 4LNRB 5F3HB 3MOAH 2WC3A 2D31A 1EEUA 5FOBA 2GSGB 4OD1L 4PRPA 4IISA 2BJMH 3WFHA 4WVRA 1Z3GL 2IPTL 4NRZA 1T5WA 1UGNA 4ZO7A 1AO7E 3G08A 4OQ1A 4KJYA 2A9MH 1V0KA 3JV0A 1PW3A 1E72M 5HYJD 5DK0A 4XRCA 5E1HB 1KCRL 1PSKL 5DRXB 1UD3A 2GUYA 4EDWL 5JIIA 3ALGA 4NQUA 1HSAB 3JWOL 3UPAA 1RFDH 1RZKC 2XWBB 3BDXA 3HA0A 2XKUA 4JG1L 4PJ9C 4KRMB 3RWDA 4AK1A 4H8HA 1RFDL 2OWWA 1P7QA 5A40E 3QSKB 4JHWL 4KVNL 4U6XA 1ZVSB 2VAJA 3KPRB 3W38A 3L3GA 4PJAE 5DRNB 3DX1A 1FCGA 1W0VA 3OF6D 5A6SA 2VRQA 2OP4L 2QQLH 3U7WH 1KC5H 1VEMA 2GJPA 1NBYB 2VDNH 3LRSA 1Q9OA 1W0WB 5EO0A 1OP5H 3BWAA 4MDIB 1U8QB 4GG6E 3WD2A 1OAQL 1I8MB 3MZTA 4P9HH 1KCRH 4JZJC 4PUBH 2MTPA 1YMHA 3RVTC 3FQWB 4OZFA 3FN0L 4P9HL 1PG7W 1BWWA 3N12A 3WLWD 3KR3H 2Y7QB 1A3HA 2FB4H 3ULSB 4AYGA 1MELA 5A6MA 1R3IH 4RRPG 1QBLL 4UDUA 5DQJA 2VQ1A 4EOWL 2L4OA 3MRMB 4OUOA 1DBKH 1Z32X 3UO1L 3D3VA 4ZSOA 1FZOB 1IAMA 1CGWA 4Q6IA 5M94B 1LK2A 3BP4A 2IQAA 1CBVL 2K9UA 3VDAA 2D73A 1DLFL 1NGZB 2VLMD 4AYFA 4Q22A 2JTDA 3GBNH 4H8UA 4IRJA 2WHKA 1ONQB 4EI6A 4XMKL 5HD8C 4AMWA 3AM8C 4NQSA 4Y8AA 2QHAA 1RURH 3M7SA 1KIQA 5L2JA 1N59B 5HTSA 4UTAL 1MEXH 1MWAH 5KSBB 5BRPA 1MPAH 5B3NA 2ZUNA 4KDTA 2ALWA 4NM8L 2WW5A 3UTTD 2AK1L 4M3KB 3BKJH 3LQAC 1K4DA 3LPOA 1MNUL 1UWRA 1TJHL 3VXRB 3SIMA 2HJFA 3RWHA 1AO7A 2ADFL 2FATH 4V27A 5J11B 3OA5A 1EHAA 2CKBH 5JHDA 3SUVA 2AXGA 4PJXB 2HT3C 3QIWD 4XH2A 5C0AD 1DVFD 3GNMH 1BPLB 1CEOA 3OLGA 4TVPL 5FL0A 3VFNA 2PTTB 2VT0A 4ZFOL 1T6WA 3EAKA 5HHOD 5KG9A 3WUBA 4XZUB 4C83A 4JY5H 2D7NA 3VXOB 5FCZA 4XVUD 1ZBKA 1TENA 1ZVYA 3BAIA 1T89A 3QXAB 4HIJA 4ZS6D 5HVWA 5JNYB 3EO1B 1KACB 2DWDA 2XPGB 3FCTA 5I74C 2FIKA 4ODTL 3HMXH 2WMIB 1UACH 3V4VL 1I9IH 2PO6D 4LCIL 3HC0A 5GGQL 3IFPB 3SE8H 3U4EB 3QHFL 3KXFE 5KVDH 4GG6B 1D5IL 4RGOH 4GW4A 1BVKB 3NPSC 5C0NC 4S1SH 3MCLH 4FA8A 1P69B 4P7OA 3G6LA 5AY7A 1QFWH 2HFFA 1T22A 4OF7A 3QEQD 4LSVH 2AXFB 5DSCA 3DUSB 3AIWA 5A8PA 3DHPA 3WE6B 4PP2B 2AQ3A 3R06B 2MOVA 2UZYB 1PY9A 4FTVB 4FQXC 1UWGH 4MAYD 2W67A 3QULA 5DZNA 1FOBA 3NJ3A 3RL1A 3VFUA 1INQA 2L0DA 3GNOA 4HOZA 3QCTH 2V9TA 3FRUA 2CJUH 3BQUD 3O2WL 15C8L 3HMXL 3LKQB 5HI5D 3A23A 2KQNA 4LPTA 4UBDC 5IM7B 3H2WA 4EVNA 1UXSB 4DZBB 2PR4L 5I74B 1TTGA 3ZSTA 1HYSD 2IBZY 2QQLL 1K4CA 3U7WL 4E42A 1YQ2A 3ULVC 1UH4A 2YBUA 1EV2E 5CEXB 2OYLA 5IG7A 3QUYD 3TVMA 5T1KB 4C4KO 4ZD3H 2UZXB 4U7MA 4C57C 4PG2A 1HXMA 2OSLA 5KSAD 5IMLA 1DBAL 5F96H 1KN2H 2F8XC 1PVHA 1EXUB 5IB2A 4XNZB 5JW5B 4BELD 3TFKD 1SZNA 1LE5B 1G0CA 1JNHB 1FPTL 1T7ZA 3JWOH 3BHBA 5FDYA 5KSUA 4ZFGL 1U2YA 3DNKA 1OVZA 1K9FA 1IM9A 3HNVL 1BREA 1U8HB 2ZUSA 3DURA 4XNQA 1QBLH 4ORGA 1C90A 5HJ3B 4LCWD 4LSQL 4OM1L 3VO0A 2X4PB 3CX2A 3MGTB 2X6MA 4P3DA 4CW1B 3X14A 2Y07H 5MENB 4M1DH 4IHOA 1OAKH 3FRUB 4G6KH 1AGFB 1EO7A 3GGWA 4N1EA 2D23A 2R8SL 2YWZA 1MF2L 4AMKH 5E0CA 3RL1B 2E0PA 3OTTA 4WO4D 5FD0A 1OAZL 5I17A 2PYED 4YBHA 3GM0A 4YBLC 5JW4N 5ESAB 1WDQA 4JO2L 4KK5C 2NY6D 2MANA 3ZL4H 4DWSB 2KH2B 3OX8A 3P40A 3QUZD 5F7DB 2X9YA 3QUXB 3TCLB 3V0AC 1A7OL 3RY6C 4HUVB 1IM3A 1WIOA 4MX7B 1JZ2A 2ZSWB 1T04B 2YPVH 3L3DB 5J89A 2NMSA 1UVQB 4I77L 3STLA 4U1IA 4EEEA 1KWKA 1AGBB 4WW1B 4XXCC 3WJLA 4PY8J 1KYOK 4YJZL 1R3IL 3LZFH 2XUCA 4XPFL 3BUDA 1BAFL 4I0KA 4FQQA 4G6JH 3BP6A 4H1LA 2QSQA 3RRQA 2VDPH 1VSCA 3IDNA 1BG4A 4YDLB 2GCYA 1FLRL 3VXOA 1YEHH 2KUTA 1RH9A 2VI0A 1MJ8L 3S36H 3QIWA 5C0AA 2Q8BH 1XSIA 1KR1A 4WFGE 3UXFA 4MPKA 2ZG2A 3MSDA 2VZVA 4R2GC 4JFDB 5CWSB 3MO4A 5ADPH 3WH9A 1JK8A 4K8RL 3KLHD 2Y1VA 3UJTL 3Q3GA 1HT6A 2K7PA 1NGQL 4X80H 2WHJA 1YNLL 3KLDA 4TVSa 1K4DB 3HG4A 5J7CC 4LSDA 1W72L 4PJ9B 4ZPTB 1LO5B 3U0WL 3JZ7A 1X5YA 5E6ID 3SO5A 1U8NA 1EH9A 3IDJA 1ZLVH 2VDQL 4WCYH 2HT4C 3OLDA 1FH8A 2JCCF 1N82A 3GXMA 4P2RD 1JP5A 4IRJB 2J12B 3WXVH 4LDEB 3P2TA 2E9WA 25C8H 1MJ7L 1EFXA 4F7CB 3MYJA 3MJ6A 3KS0J 1QLEL 3QDGE 4D94A 5DLMH 4DO4A 5A69A 4NPYB 2RBLA 5FO8B 5D1QC 2WYSA 4JQXA 3V0WH 3P77A 5BJTA 3U46A 3O2WH 1KBGH 2CIPA 3RJDA 4Y5XA 1V7NL 4Y8DC 1QSEE 1F58H 2VXQL 2GT9B 5J12C 1BX2B 4XV0A 2XWJA 3W26A 3FB5A 1IAIH 5CINL 4Y19D 2IALA 2E8YA 1UA6L 1OLLA 4H26A 4OCRH 4PJ7F 5GGVL 1J8HD 4PG2C 1Y0LA 3CK0L 3RVUC 4IEFB 4OF8A 3IJ8A 4KGLA 2DKSA 4K2UL 3WN5A 1WBYA 2HWZL 3ZDYE 1R46A 5GRZA 1RZKL 2VQTA 4UI2A 4AW7A 2NY4B 2R9HD 1M03A 2H45A 3EDDA 1D5MA 3VX0A 4P4KC 1AGEA 4LCYA 3AC0A 2E9IA 1I3UA 3II1A 2EYSA 5IJKA 3QR3A 2FBOJ 4W6XB 1MLBA 1XCXA 3NA4A 5DJDB 4BFEA 4P8XA 5I16B 3VINA 4HMDA 4N8CH 4KJQC 2FEDC 3L3GB 4ML4A 3PZVA 1UD6A 1FRGL 3VTRA 3VXUB 3WFDL 3I6GA 1VACB 1FL5B 3QT2A 4XMLH 4JPWL 4NRXA 3H7BA 4P23C 4R0LC 1A22B 5FYJH 3BLBA 5GRVL 2XV6B 3DROA 5F44A 3VXMD 5BZDA 3IDYB 2PCPB 5F7HA 1K6AA 4YPGB 4QCEA 4HX1A 4FK9A 1PQZA 1A6UH 3BAWA 1BFOB 3MFFB 5DJXB 2FGZA 3MRPA 3VXNA 2DWEA 4YR6B 2XFRA 3O3BB 3SCNA 4U3CA 2WBJD 3IJSA 3TTYA 1PJ9A 1CDYA 3GDBA 4KMTL 3L7FA 4RMVA 4RX4A 1KSRA 5IFHL 2EDJA 3GI9H 3QQNA 3MBXH 5FDWB 2R1YB 2HYMA 4R9HA 1ZTXL 1MJUH 3WL9A 4U1KB 2X4RA 3CVHH 3VH8A 2YFOA 5T3XH 5H35B 2NX5A 4WKHA 3EGSB 3O6FA 3DC0A 2ZE0A 1ZSDB 2RHEA 5EU7E 4HIEA 4P46D 3QDGB 1K5NA 3D85B 4PG9A 5E9DE 5SWZD 3PNWB 4Y2DD 3BUIA 1VEOA 2EDFA 1BBJB 2IFFL 5ICXB 5CPTA 2JALA 3LRHA 4OGAC 1Q1JH 4K3JH 2C4FT 1KN4H 2LE9A 4ZOAA 2VKWA 1VCAA 5JIKA 4RL3A 1MQKL 4ELME 1PX4A 1AIFA 3KXFB 4XHJC 3SJVE 1FC2D 2P49B 4EAMA 4WWKA 2HISA 2QKIB 6CGTA 2A3EA 3SEPA 5I78A 2ZSWA 4P9ML 1XH3A 4N0CD 4R6UA 5HGHA 3QWOA 5FM5O 4ONFH 1T80A 2M8XA 5JPMB 2AK1H 2XN9E 4JKPH 2AK4D 2A77L 3HMWH 4GW1B 4JJ5B 4NKIH 1MFCH 1KG0A 1RMFL 3LRGA 5JHDE 4GAGH 1J8KA 1JWSA 3CFDA 3D25A 4XPTL 4Q2ZA 5I17B 1J1OH 4ZOCA 1KT2B 4L4TA 3RZCD 5E2VL 1AGFA 3GGWB 3CSYA 2O5ZL 3O9WC 5LWYL 5JHLL 4Y2OA 4TULH 3TO2A 1QI3A 1E4XH 4I2XB 4WSKA 3AYSA 3KGRA 1D5XA 4NJ9L 4R7DB 4Y4HD 4Y89A 4WTXA 1MW1A 4YE4H 1MH5B 5TDPA 4HCRL 4X80L 1TQSA 1A7OH 1J0JA 1EDQA 3S35L 1FG2B 1E28B 4TRPH 2FB4L 3KXFA 3SKMB 3QI9A 5D7JC 1QRNB 2CK2A 3RCNA 4QOKD 1EAPB 2XWTB 4LIQH 4M48H 3U36B 2G75B 2D4FA 4RGNC 3GSNL 1WZMA 4WV1B 5M3WA 4EI5C 5A43C 3S36X 1IEBA 3L5WA 5FGCE 1C16B 2VLRA 1LWRA 3L2LA 2UVEA 4JM2C 3F7PC 2WLYA 4KQ3L 5EUKA 4PJEF 3MBEB 2J8UE 4JE4B 3T0AA 5C9JA 3HJEA 4UQ9A 1KXVA 1JPSL 3SBWA 3OAUH 5JW4R 2L7UA 3T65B 3MCKA 3VD4A 4Q2ZB 4OZIB 3GSQB 1Z5LA 1E15A 1MAML 2BVQB 3W24A 5DJYA 2NY1D 3RGVD 4LLDB 4QRRA 1WCGA 5I1LB 4JY6A 4QKXB 1JHTB 3BISA 2YIHA 2APWA 4XX6A 4XWGH 2DLTA 3BUYA 4GXUN 1JBJA 2ZOLB 4KJPC 2X4OB 3F12B 4IMKC 4PRNA 2QKIA 3GIVB 1SBBA 3ARVA 4CVWA 2K7QA 4QP0A 3AAZA 3BOVA 2ZUQC 4H8VA 4I0PD 4PLKC 4C56E 5HYQA 4F33A 3WSQH 1J05B 5DFVC 3CC5B 1PAMA 2FCBA 4PJ7B 4PJDF 3OAYH 4Z7NE 3O4OB 5F21B 4F9JA 3NPZB 4DKEL 3MLZL 4UV4H 3RWIB 4HWEH 4P2OB 3SUTA 4KMTH 1WQVT 4ZFGH 4AIEA 4W87A 3H3KA 3UJJL 4UR9A 4J28A 2XIBA 3MNWA 1ZSDA 4F58L 2K3TA 2IQ9H 2WMFA 4ZAKA 2NNAB 1EHLH 5BV7H 4X7TA 5IEHB 1FGNL 4TSBL 3HFML 4WKAA 3O8XD 5DJ0B 1ODAA 2FWOA 4L4OA 2VZSA 3QJHB 2UY2A 5JQ6H 1BGXL 3PZUA 2YL9A 4P48A 1CDCA 3B83A 2EICA 2HVMA 2B7DT 4XWOD 4ISVB 3EDEA 1MVFA 1YMMD 1LJYA 3ZJ7A 3BPCA 3FFCB 5FGCB 1E56A 1CVRA 2P7TA 3EBAA 3ZDXE 3KWWB 4WTWA 4R90L 3FB6A 4NQEA 3SGKA 3ZDZE 4P8VA 3VILA 3GI9L 4F7PB 1MLCB 2ZX9A 4M6NH 3IK2A 4QCIB 3O2VH 3WY3A 3AIQA 2O9TA 4LGXA 1T83A 4Z0XB 3I6GB 1JZ4A 3ARBB 1V3LA 1HJUA 1DP0A 5JXAL 4XPFH 2WINA 3HE7B 5JXAH 2G5RA 2IH3A 2J8UA 4MS8D 5DO8A 4C54A 3L4ZA 4WUUD 5D9OA 3ZE0F 3I85A 4IRJC 1NGXA 3FTGA 2VLKD 3HUJE 3AFLA 3N1GC 5DEFA 1FL3B 2WCAA 1BD2D 1WBZA 3GK8L 2R2EA 1Z2KA 3PP3K 1KJ2H 3I3BA 4ETYA 4RQQA 1P6FA 2W60B 1ED3A 1A6TA 3ULVE 4TUOA 1XF5B 3SQBA 1A9BB 2O5XH 4GKSB 1MREL 2GJ6E 4KDTC 4LSRL 1RIUH 1P4IH 3Q3GB 4ZFFB 1TLKA 3WFCH 2HMIC 3M46A 5CWSA 3R1GH 1P84J 4YX2L 1KPUB 3RM8A 1ZK9A 5EBGA 2AAAA 1RZGA 2CIKB 4RBPK 2ENSA 4G6AD 4JKLA 1GJIA 4OLYL 1XZ0B 4I3SH 5JPNB 3WF4A 4JM2A 2AGJL 3WS3A 5DJZA 4KI1A 1R34A 1M05A 5AAMA 1EJOL 3NFNB 4TVDA 3MNZA 1FL6B 2BY2A 3QWRA 1EHNA 3SCWA 3ULUD 1YHTA 1I9RL 4MQTB 1XHGA 1LO2H 1NBZB 4LBEA 1JGIA 3GKWH 3LKOA 4QY8A 4X9YA 4PEEA 2HJKA 4UV7L 1NLDH 4U6XB 4OSUH 2Y36L 3U6RB 2FGWH 2Y5TA 4JKMA 1TZIA 4M7LT 2ORBH 1WBZB 4HLJA 3G04A 3V7AG 2UYLA 5IMOB 3IDUA 4OI9A 5DGQA 5J3HC 2C7UA 2IG2H 4PJIA 1XGPA 2J7EA 4AZ8A 3KPLB 2VRJA 3EYPA 4HUMB 2A74B 3ARPA 4HZ7A 4Z5RB 2IPUK 3FJTA 1HKLL 4OBRA 4KJYB 3KPPB 1ITXA 3G08B 1NP0A 4HJ0C 1S7TB 4YWGH 4OFYA 3DV4A 2YJQA 1U8LB 2DTMH 5CGYC 2DSWA 1G6RL 1NWUA 3RL2A 1KB5L 4XVJL 3LPPA 3JUGA 4QHUA 4UT7L 3OGRA 3VSTA 5D6DC 5KN5A 2VR5A 1XZ0A 4Z95L 1E6PA 4AM0A 3VM7A 1CXEA 3O6FC 3MRCB 3C60A 2GCYB 4Y0GA 2W07A 4M93C 1MCWM 2DQTH 2V2WB 3WIIL 4LK4A 2YR3A 1NC2B 5ALCH 1QKZL 2NY5L 2YK1L 3SCRA 5ID1B 4NQCD 2Y8VA 1D2KA 1PX3A 4FG6C 1ZANH 2ILLA 3A6CH 1GYAA 2J7LA 4EZMA 5CQ1A 3QJHA 5FKPB 5KVGL 5IMLB 1OSZA 5I18L 4Q58C 3HZ3A 3RHWF 3WKMH 3LS4H 3PWNB 1OB0A 3ARXA 3U7YH 4FNLL 2AI0L 1IL1A 4UTBH 1MHCA 1IGML 1QRKA 3SPVB 5IOPA 4HIIA 2WWMD 3W9DB 1RJZA 3PGCB 4LVNB 5C70A 5BMFL 3L5XH 1D9KA 2X1QA 1HI6B 3FO2A 5FGBA 4LARH 5FM5M 1E6JL 1T1XA 3OG6B 4NN5C 3SKOA 1AQMA 3OZOA 1CFTA 2J79A 4GSDH 3UETA 3S7GA 1IGCL 4LKCA 4QCIA 3MMDA 1JWMB 3RJXA 2NX5E 4HW6A 3L3IA 3WEOA 1HIZA 2Y8KA 3LS5H 4MXWL 4ODVH 1QNRA 2UY6A 4XI5C 4HGKC 4OCSL 1IFHL 3RDTB 3QNXB 2XTKA 1F58L 2WQ8A 2PB1A 1KCUH 3AISA 3S88H 4UAOB 5I1JH 3DGGA 5KVEL 2XM1A 1BZ7A 2RFXA 5DD6A 2BNRD 3A6BH 3B2UC 4LSPH 4BSWB 1MIML 5A16B 1LE5A 1MW2A 1IGMH 4YQXH 3SKNA 4F7TB 4EI5B 2R1XA 2YPKA 4MNQA 3T0EE 3IF1A 4KZDL 3GMQB 4Z7WA 5HVFB 1SMDA 5BRZB 3MNVA 1T0NB 3BXNA 4F9PA 1FZMA 1JGVH 1MCDA 4XX1E 4W89A 1R6VA 3DETD 1A4KA 4CD5A 1WISA 4DVRH 3QDAA 5HHQA 4O00A 5D8WA 2W9EL 4B50A 5DC4B 2GUOB 4ACPA 5IVXA 4DWSD 4PV8A 3I6LD 3WO3B 2GEEA 1ADQL 4N9OB 3MRIA 3QUXD 3VFNB 3VXPA 3OWEA 2IPKA 5LGHL 3GSOB 2DQIL 3KPSE 5CJOL 3L4VA 1W9DM 4MJ2A 5M03A 1NGPH 1HKMA 4YBQC 1E40A 5FYKE 2NXZC 5HGBB 1FDLL 1J1OL 3MRNA 2YBTA 1LDPH 4RFNC 2WVVB 1RUML 2ZOLA 5L8JB 1S7UB 1TVBA 1FGVL 5IMKA 1DVFC 2AVGA 4QNPE 1DFBL 1YZZA 1C08A 4W4OC 3QP3A 3S36L 4AL8L 3NA9H 3T77B 2AW2A 5F7MC 1CD1A 3SDXE 3I2CH 5IBLC 3CVIH 3W27A 4JG0L 1JRHI 4Z7QF 2VIRA 4JAWA 2LU4A 4ZS6C 2W92A 1WITA 2WM0A 5C08D 1TQUA 4L5FH 2IAMC 1OGBA 4PTUA 5ID0B 3NIFF 2PO6C 2I5YL 4WU5B 5SV3A 5C2BH 2X41A 1BQSA 1J88A 1T6VN 3O11B 5F1IB 3A21A 5FYJD 4N9GB 4IDLA 4HWBH 4B5EA 2V9QA 3WUGA 3GHBL 1ISZA 3MLRH 2J78A 5TF0A 3LQAL 1GGTA 5DUML 1IC4H 4Q0XH 4GXPA 3NCJH 5DJ6B 1ODZA 3F5JA 25C8L 3CD4A 5LCVH 4BM7A 5HHVH 3RIAK 1XD1A 5I15L 1B0WA 3GSXB 1HDMB 5I15H 3Q6GH 1KJ3H 4PRDB 5ICXA 2EDOA 4X83A 4PJXF 3VIHA 2B31A 5ACZA 4QLJA 3WCYA 2VC2L 1MCJA 4N1HB 3NSXA 2FD6H 2COQA 2Z8WC 5AYUH 4LHJB 2G60L 2VE6A 3ARDD 4G6FD 3ZJ6A 3WJJA 3MLSL 1TMCB 5D2LB 5SWQB 1HYSC 5AYUL 1ZBCA 1A0QH 1DBKL 2BDNL 1FNSH 4C7GA 3IT8D 1JGEB 3ARQA 3IGAA 3ULUH 5KSAC 4YNYA 1QFUL 4P5TB 1E6OL 5E08H 3ARFD 5MI0C 4NO3B 3G5VB 3BP7A 4QXGL 4XMKH 2CDEB 5HGDA 3D18A 4FFYL 1YY9D 4KK9C 1U8JA 4QOKA 2R2HA 3KPSA 3R8BB 1OM3H 4L4JA 2GY7B 4K07A 5BS0A 4YDKH 4N90E 4GRWE 2ITCB 2OQJB 4QHNB 1FFOA 1U0QA 1XSKA 3BVNA 2EDHA 3EYUL 3GI8L 1CD0A 1EXPA 1J10A 1LO0H 4UT9L 5K9QI 1BLIA 1OGAB 1NGWA 1FVCA 5J9PA 5T1LA 3TBYB 4R27A 4I9WE 2DOCA 4PGBB 2XQBH 2D7QA 2W0KA 1DN0B 1MCNA 3SQOL 4NO2A 4K2UH 4UINH 3V6OE 3IAPA 3ZTJG 3VG9C 5GZOD 1NOWA 3FNDA 4HQQH 1NFKA 4B7LA 3BAYA 4W84A 1DEDA 1R3HA 3MRDA 4UFLA 4D9LL 5HHPB 35C8H 2DM4A 3D9AH 1XAUA 3EYVA 1HIMH 1T1WB 3MTRA 3QH3A 3IKCA 2IQ9L 2EIEA 3DWTA 4YHPB 5JXEC 1TZHB 4RQQB 5E09A 2PXYA 2UWEA 5I8CA 3S88L 1EEYB 4GRWF 3ZE0E 3WFZA 3DSFH 1IGIH 3IJYB 5BYWA 2FDMA 1MCEA 5L7XL 2G9HB 5KVFL 4JQIL 4HGWA 1LL7A 3DROB 3D18B 1EEZA 3PDOB 4NO5A 1CDJA 1XGUB 3BZ4A 3N13A 3AXXA 4V2XA 4WK9A 2YMXH 1E5JA 3T0EC 5TDNB 2PW1A 3K4ZA 1B0RA 1P53A 3D0VA 2YWYA 5HHMB 4NRZB 1IGJA 3ARGA 4WFFD 4EDWH 3ETBF 5J1SC 4RFEA 5D9NA 4UILH 3JTSA 4QLRA 1G1CA 1W1TA 4WW2F 4X4MA 1C8PA 3P4NB 1I7ZA 5D2LA 1WEJH 2EC9U 3BP5A 5T3XL 1I9EA 1NMBL 3D0LB 4IJ3B 1D5ZB 2APVA 3QZWA 4IS6A 4RMTA 3EOTL 5DMJB 5JR1L 5EBWB 2AV1A 1OINA 2WW8A 1DZBA 3EOTH 3AXIA 5I2IA 2OJEB 3FOMB 4OM1H 1V6UA 3H3BC 4DN4L 2H6PB 1AR1D 1NANI 2W66A 3KLSA 4Z2LA 5ESQA 3K4DA 2HT4D 4PRDA 1FGVH 1MUJA 4JQVA 3V5HA 4LLMA 1MVUB 1TQVA 5HYJB 2XIDA 2C1PB 2PETA 2UWEF 1U92A 4FFVD 1N0XL 1CXIA 1K9DA 4XNMA 4O4YH 1OTTC 2AQ2A 3VGDA 4GKLA 3UPCA 5GSVB 4JO1H 3HMCA 3QB7C 3EIFA 2D3VA 1K8DA 4QHKI 3DX6B 4Z8FL 1DWIM 4YDJA 3NIGF 1RK0B 3P4LA 5BVJB 5BXPA 3HS0B 3GJFA 2E4TA 2ZKHH 2EXWD 4WY7H 1F6LL 3KL0A 2ZWLT 4N9GA 1ITCA 1EMTH 1KTDB 1TA3A 4UNVA 2YPVL 4U6VH 2Q6WA 1GGBL 5JTWA 3FT2A 2VLKA 3AREB 5EH1A 4U6YA 2M2DA 4GINA 3QG7L 3DMMB 5D8JL 4AMXA 1NQ6A 4UFMA 3BGAA 4WW2A 4A3YA 1NBVH 1UVQA 2X42A 4JVPA 2N4IA 4XP1L 2O61A 3UTZB 3DX0A 4R7NB 1XCQB 1HILA 4QXUH 2R69L 4PJBF 4UZSA 1H5BB 4K7PX 4P2QE 1FZKA 2BK8A 4LAJH 2VDKH 5IKCA 3F4VA 4XCCL 4KI5D 4DWSA 4JVUA 7FABH 4P4KD 2I60H 1HH9A 1TJIH 3K4AA 1FNEA 2B0SL 5F9WC 1F45A 2F7OA 3RDTC 2UUDK 4WIWA 3WUFA 1DR9A 3ZKXB 3KPQA 1C8QA 1A14H 3DJ9A 4D9RE 1UR9A 1JPTH 1V7NH 3M17A 4OM0H 4CMMA 2ZUUA 3GZKA 5E94B 1R24A 3GBMH 4WUKL 3W0WB 1UQSB 4DN3L 4OQTL 4P23D 4PJGE 5I1KL 1ZHLB 3EYSL 2EPKX 4ODXA 2KZ1B 2O5YH 1CTNA 2DSVA 1H3PL 1OQOA 3MA9H 1CD8A 5L2KD 1BYBA 1VEPA 1WICA 3WXVL 3MRJB 1KULA 3QDJD 4PD4J 1I1AA 1NARA 3T2QA 1X5FA 2WWKO 4HBQA 4NC1E 4OLXL 3U1SH 1IGFL 3DX8A 4WW1A 3TONA 2HN7A 3PWLB 3FO1A 2V5MA 4M7KH 5HYEA 1OCWL 2MCPL 2Q76A 3UTTB 5IG7B 1A3RL 3VH8G 1PDKA 4OV5A 3MV8E 2MQCA 4I2XA 3C6LA 4G3YH 3ZE2F 1EFXD 5GIRA 3SOBH 4PGZA 3HI6H 3FOLA 3IDYC 3FQRA 3L4UA 3DECA 3A3HA 1K8IB 3MZGB 1W3LA 3S37L 3EYOA 3KE0A 1CU4H 3FW6A 1CFVH 5GHWH 4X0KB 3HE6D 1MCPH 5E8EA 1JNEA 1AMYA 2QJDA 43CAB 4AJ0A 2Q86B 3ULVL 3CU1A 1R5IB 3W11D 4PRBA 4AIXA 5D7SL 5JPMA 3O3UN 2H1PL 4M81A 1R8LA 3WE6A 3QWOB 1NMAH 2VCAA 3CH8A 3PGCA 1UR1A 4UFJA 4HUNB 1JF1A 3WIFB 2Z31B 4KKLC 1PEWA 3QEHB 4QGYA 4N0CC 2WZHA 4KJWD 1BQLH 4DW2H 4LRNH 1G0DA 4D6EA 2XPKA 2DDQL 3FO1B 2RCSH 2OZ4L 3HAEH 2OYKA 1ZT4A 4HFUL 1RJLB 1SJEA 3DX8B 1K85A 3W5NA 2CDGB 3ARGD 5ID1A 3QEQB 1ZAGA 5DC9B 3P11L 3X17A 4YGVA 1HKFA 5GGVH 3MXWL 1MCCA 2B39A 3AMKA 5J12B 5J13B 2GITA 1Z6JT 4UIMA 4B9YA 3TO4D 1JL8A 1I85A 4WUUB 3VFPA 5DR5L 4WHDA 2DRUA 4KZDH 2EKSB 4TNWF 4FFZL 3E8UL 1BD2B 4JDZA 4J4PC 3TBSA 5IHUH 2HTKD 1JPST 4XH2B 4AEFA 3TBVA 2CMRL 5T1MA 5D1XD 1JUFB 4PJIF 4F8XA 4EUPB 1EMTL 5CUSH 3ET9F 4KZEH 2FE0A 4M1RA 4KHXL 5D7JD 5DQDH 4PJFA 5H37H 5I1CL 1HKJA 1NC4A 1EDTA 3JWDH 3BIKA 5JOEA 1JWUA 3BPNB 2R4SH 2HA1A 1I9JL 4JM2D 3L4TA 3MLRL 4P5TC 4ZNEA 1I7UA 3MJ8B 2J6EA 3GK8H 4R7NA 5BVPL 1ZT1A 1N0XH 3PV7A 4MCZB 3CUJA 3SE9L 1G0XA 2F53B 3F65A 1QRNE 2NSXA 1A7PH 3C09B 3FMGH 3LEYL 5CKAA 1R86A 1BM3H 1IC7H 3DV6B 2A9ML 1INEH 4NNYB 1KENH 7FABL 4Y4FA 5D2LF 4LGRB 1RV6X 2XPGA 3K1DA 2FX7H 4PJ5A 2W0PA 1MQPA 1VFAA 2A6IB 4L8CA 5EC1B 5KG9B 3TV8A 3WIJA 2C7FA 4M43L 4X6DA 4LIQL 4M48L 2OLHA 2JB5L 5C0CE 3TBWB 4XP1H 1S9WB 3S9DB 3L2MA 3FQNA 2FHFA 4GMTL 4WFHD 2VDQH 4WCYL 4A2LA 3S35X 4PJFB 5E7BA 2CIIB 4M1GH 5DFVD 4PJDE 1ZT7B 5LA2A 2UY7A 3PL6A 3ZLQC 2ESVA 3P0VL 2FECI 3WO4B 3OAUL 1BM3L 1IC7L 5FO8A 4PJ8B 4X6CE 5EO0B 4QHLA 3SE3A 1FNHA 3GMPA 1JFQL 3FRPA 1XGRA 3SDXB 4ZQKA 3VPLA 3KJ4B 3J8F7 2MSPA 4AXNA 2WV3A 1XIWA 4NZTL 3LKSB 1A1MA 2IXUA 4M7LH 1X4YA 4QTIH 4M6OH 5IVNA 2DM7A 1FP5A 3KZSA 3VFOA 3WD5H 2JB5H 4DGYL 3IDJB 4YHKH 3ESVF 4IM4A 1TVHA 3CZ8A 3F58H 4X5XB 5KZCD 1LNUB 3FB8A 1MLCA 4V2BA 1Q9KB 4NKOB 3V4PH 4R97B 4D6FA 1T7XA 1AD9B 1QBML 1SJHB 1MCQA 2D7PA 2EKJA 4BA0A 3MRMA 1AD0A 2I9TA 1F4XL 1N6QH 1DWJM 2GTWA 2Z31A 3MRBB 1ZHNB 5I66A 3JV4A 4WTZA 3VM5A 1S9XB 4UFHA 1H3TA 35C8L 4TNVK 2JEPA 1KF9B 4JFDA 5F1SA 3QPXL 1I4FA 1BQLL 2XSBA 3ILQC 4JRXA 4YDKL 4PJ9D 2C3GA 4MA8H 2Z4QA 4D0DA 3RBGA 3MC0A 2FWOB 1NAMB 5T3ZD 4MD0B 1HXJA 1QSEB 1RJCA 3QHFH 3WH8A 4ZNEE 3TH4T 1HQRA 3POHA 2PF6A 1BMGA 1J9YA 2BVTA 3FO0L 3DSFL 3QG6A 1A1NB 1KNOB 2J88L 2OTUB 2W38A 3VD3A 3O45B 3QUKB 4QWWD 4IRJD 3DHUA 5FF6B 5KS9F 1MW0A 3TZVD 2CR3A 1YJDH 3SCMA 5J9PB 1FVCB 4HCRA 1MHEB 4YHIA 4AENA 2BNRB 1N6UA 1JPGA 2MFNA 4B9ZA 1CDGA 1PKQB 4PJ5E 5BW7A 2WUCH 3T08A 4PLNC 5L9DL 5IHUL 3O3EA 2FH6A 4QXGH 3RVTD 3RWDB 5HYIA 2ED8A 1HKKA 4Y5YC 1F3DH 1MHEA 1FH5L 2QADB 3KPSB 4YHYB 5BZWB 1CDHA 1MHHA 3TT1L 1BZ9A 4KHTH 2Y24A 4CADA 2ICES 3QISA 3EOBA 4F9LC 2OTUA 4S1QL 5CEZL 5IESH 2BP3A 2EE9A 4LHUB 2GJ6B 3RWEA 1Q0XH 1U8OB 1EVTC 4HUUA 4XMLL 2Q20A 3B9DA 5HY9A 1I8KA 1EJ6A 3MCKB 3F6LA 1BQHA 3QCUL 3QIUB 1XR8A 3O2DH 3OHXB 1MRCH 3LRLA 4HK0A 3HG3A 3JXAA 2FHBA 3MBEA 1MHPL 4KXZH 4NGHH 1E4KA 3TNMA 1IQWL 4WGVB 3N11A 4FXGB 5H2BA 1I1RA 4C55A 4MQ7B 3ZMRA 3HR5A 2FL5A 5DUBB 1Q9KA 4NN5B 4WV1A 4JHWH 3U36A 5I8EA 1JTPA 3K81A 5D1QB 3VXMB 2QADC 3L6FA 1G9NC 4OFKA 2VVSA 2V5SA 2FX9L 1W91A 2AK4A 3O4LB 3U82B 3UYPA 1C12B 4QRTB 1RUMH 4QHLB 1Z3GH 3GFUA 3WNPA 3DRQA 4NOFA 2Q86A 1I7TA 2A3HA 2H3NB 1CFNA 4JG0H 3KPQB 3MRFA 3DTXB 1G01A 2Y5EA 1U91B 1R3LB 1RURL 3F5WA 1YPZE 3NCYP 4OLZL 2NY3B 4HKBA 3HU7A 4OD2A 1YN7B 1U8PA 2EO9A 5IHZA 1G7LA 5HI3D 4LVHC 3U4AA 4PLOB 1ERNA 4FXKA 4CVZB 4MB1A 5ACLA 4BSJA 3IAQA 3EMQA 5I1KH 4O02L 1QQDB 3FN3A 2YDSA 3FT3B 2OBGA 4FQ1L 3TTOA 1MFEL 4P2QD 3H8NA 3UO1H 1W72B 1YEIL 2X8RA 3CUIA 3O2LA 2ZSVA 5BWFA 4WWKD 1CL7I 4PMRA 3BKML 1MCOL 3QQ3A 4OCMC 5BO1L 5GRJH 2DWDB 1S7RA 2JLLA 5A8QA 1W1YA 3FL7A 3FO9B 1M6OA 1N7MH 5E99H 1L9MA 2ZOKA 2WWKT 3CVIL 3X12A 3OZ9H 4Z7WF 2DIAA 2VO5A 3WD3A 1N2RB 4JFYB 5DK3A 5BVJA 5TDNA 2H8PA 1I7UB 2HH0L 3AHXA 2B5IB 3VG0L 2XY2A 2D3NA 5DA4A 3EYQC 1I85C 3N1FC 4ZFOB 2N56A 3TGXA 1E4KC 2PWDA 4RISL 2VX7A 4YPJA 4ODSH 3UDWC 5I1DA 5IQ9A 5KW9L 2PYFA 3I9GH 1S8DA 5D1ZB 1U8KA 3BZEA 1DWAM 5B4MC 1T3FA 3CHEA 2J1KA 3OG4B 4HIHA 1DL7L 4QRSB 5GNYA 5GZNC 2VCCA 1OGAD 3ZYJA 5JXEA 4WWID 3NFSL 4OB5H 1W9PA 3T1WA 1QYGL 2W63A 3MRDB 1U3HC 2BHUA 2WKLA 2MQ0A 5T3XE 2VDLH 1HZHH 2ZCKL 5FYLE 5C08A 3V7AE 4ZUUB 4LL9A 5EDXA 1X44A 5JLZB 3H7BB 2H26B 1UQZA 4RAVA 1B4RA 5ABFB 5BXFB 3TBYA 3T3MF 3CZLA 3A6OA 3I6LE 3MV7D 5E03A 5I24A 3S98A 3HCVB 1Q9LB 4PV9A 1FFQA 4NFBA 3HS0A 3T0XA 2NXZD 4R8WL 1CTOA 1FFNA 3DUHA 4NQXB 2GJRA 1H8OA 1MQ8A 1X5IA 3D3VE 4XBEH 1H0IA 1CI5A 1GONA 1ZE3C 3QUZC 2Y7QA 5HDLA 1CCZA 1CR9L 1OAXL 2GAZB 4WEMB 2DLFH 4CKVX 1T1WA 4XVTH 2PW2B 3C8KA 4OF6A 4F66A 1T2JA 1G5AA 2HRPL 3P73A 5DD0H 3VW3L 4AZ5A 5CIPB 7TAAA 2PR4H 4LSUH 4Z2HA 1L7TH 2RCSL 1IQDA 5JHDD 3HG2A 3SJVB 5TGBB 4FMKA 2EIDA 4HXAH 5E6IA 2FR4B 4KK6C 5F6IB 5T1LB 2P5EE 3V8CA 3CDFA 4G9FB 4K23L 4H04A 1C7SA 2XVNA 1GRWA 4JFZL 1WFTA 4RFEB 1MRCL 5E00B 3VFWA 1NL0H 3N1QC 2AERT 1JZ5A 1N5AB 3RIFK 5K59E 4ZUWB 4I9WD 4J6RH 4CMHB 1N8ZA 4A6YB 2BRRH 4FQIL 4TUFA 4NHUB 3ZDYF 1EUUA 4NQDA 3GSVB 3PZGA 1CE6A 2A9NL 1ZLWH 2YFNA 2X4TB 1JHLH 3WLBB 3VIPA 3UBXA 3KLHC 4RWYL 4XXCA 5D7LE 3WJLC 1YUHA 2B1AH 2UY5A 1HE7A 3ZR5A 4L9LC 1V6YA 2EH8L 2XYLA 5DFWH 3AZTA 1HXKA 2CD0A 2F7PA 1FYHB 2YKKA 2JIEA 3TN0D 1FRGH 4JM4H 2CYGA 5DEGB 3CFIC 2R29L 5EU4A 5AUMB 1P4LA 1TNNA 1LDPL 5EN2B 1WDSA 4KV5F 1FL6A 3DO7A 4O58L 5EPMB 3CCHA 1IGTB 5AYQA 3QEGL 3H3PL 5IHBA 2CLVB 2UUDH 1Q9WB 2QQKL 1HHKB 5D4QA 4MNKA 2YOCA 3HNTL 2EABA 4QRQB 3SDYL 1NGWB 2O5XL 3EHBD 2CBJA 3FHAA 1RZGB 1A6ZA 3NIDF 4LCWE 1OARH 3BP6B 5IDIA 3BDYH 1KPUA 4IRSA 1HSBA 4OM0L 1BP3B 3PHOA 4Y4KA 2F74B 4QRPA 5IW6A 1Q94A 4AQ1B 3PZMA 3LB6C 4I1NB 5FYKD 5F1NA 5SX4I 1C7TA 2VLKB 3AREA 1N0LA 5C2BL 3LXBA 5ISZA 2AEPL 2CEQA 3FQTA 1SBSL 1UD5A 3PDDA 2VN4A 3KDMB 4OIIL 2Z9TA 4XNUH 1KLFA 4NO3A 3BIAX 1LD9B 4PBVC 4GKNA 4P23B 1NCWH 1HJWA 3TH2T 3BCFA 2J8UB 5DHVB 3EW3B 3UJIL 1JPFB 4L8DA 1UD2A 5DI8B 4LYPA 2H41A 4XGZB 3AM8A 3OLEA 1MVUA 1JPTL 2V9RA 2Y9RT 4OGYH 4X9GA 2E7LA 3VXTA 2ZCHH 2PC8A 1JFQH 1NFIB 1MY7A 2YPKB 1ADQA 1TR1A 5TF1L 2J7DA 4XNQB 1N3NB 2VABA 5I76B 1MNUH 4ELKA 5GGRY 4BSVA 4GS7B 4UTBL 3ILPA 5AAWA 3QUMB 3P4OA 1CK0L 3KPRE 5KW9H 2EYTA 5DYOA 1BWMA 5D96B 2QMJA 1JE6A 1KFAH 5HI4C 3JTSB 3AIBA 1CGXA 3VFMB 3SUUA 3PP4L 2VL5B 5EZLB 5D7IA 2C8NA 3NIYA 4LCCB 2G2RB 4Y88A 5K9JH 1HTYA 1BJ1J 1RK1B 4KKNA 5F72S 2ATKA 1KIPB 4U7SA 1KJMB 3TVMD 1QKZH 4QAWA 3QEUB 1KEMH 4PRPE 4RCAA 2EPMX 3PDOA 1HNFA 4OFYD 4M62L 3DX3A 3QAZC 4UOQA 2E9JA 1A2YA 4GKNB 4P23A 2DQHH 2RJMA 4EIGB 4PTUB 5ID0A 2HVJA 3QEUA 2XN2A 5EORH 4F7TA 1AR1C 3IDIA 1MVYA 4KPHL 1TQBC 3WF3A 4NZUL 1G7PA 4OUUA 3RWJB 4FLSA 4R3SA 2JJTA 2XJ7A 1QZ1A 2XIIA 3WMCA 1RZ7L 4ELMB 5A2LH 3X13A 3BVXA 1YNTB 4HZLB 4ESKA 1HSBB 1U2CA 5T1DL 3L5JA 5J11C 4GI9A 4BUHA 1B3YA 1R3HB 4XHJD 3ILPB 4L9LB 4S3KA 4LARL 4APQB 2OXHA 5EU5A 4ELKB 3UTSD 2AXHA 5DO2D 1CDBA 4AM0B 1DN0A 4W70A 2GFBB 2YSSA 3ULVF 4G7YH 1IKFH 5CUSL 3BEVB 1CFTB 2VCBA 2AXJA 4D0BA 4JR9H 3T8XB 3N1PC 4X0VA 4TUKL 2OSYA 4NNPL 4LSQH 3NCOA 1KCUL 4D9QD 2JJVA 1A7RL 3IFPA 2BFVH 1AGDA 1NCDL 3SCOA 3BEWA 5I1JL 5KVEH 5EN2A 2WMIA 3VIGA 1TETL 1QD0A 5AUMA 3FAWA 5FHAH 4FLQA 1HK6A 3AZSA 3UROR 4ENEC 1IL1B 4UIKL 1UM5L 1S7VA 3PWNA 3ZHDA 3CIVA 4HU0A 2YN3A 4KK8D 4WJ5A 4W7WA 3O9WD 5BRZA 3PJSB 5D9SA 3RVXD 3BUQA 4Z7WB 2AJVH 3DRTA 2G75A 3QXDB 4U7KA 1WPCA 3ZYIA 4EI5A 3HNTH 3LXCA 3CFBA 3EO9L 4HDIA 5CILL 4W8LA 4HA1A 5I30H 5DD1H 4WF7A 3BX7C 3AS2A 3MREB 4YHOL 5CGTA 3RDTD 4KROB 3D69B 2B4CL 4DW2L 3QWQB 1S7QB 3H53A 4XPAH 3RGVA 3MRKB 3MNZB 1E5NA 2R29H 4FXLA 4EI5D 3A4XA 3ZT5A 5L2JB 5D7IE 4IUGA 2EECA 5DJ2B 1U3JA 3O9WA 1IQDB 4XP9L 5BRZD 1R5WB 4J3UA 1LP9E 2NTFA 4Z6AT 4Q7NA 1CYGA 1W3KA 3NMEA 3TIDA 1MCOH 1GHSA 1HDMA 1V6WA 3HPLA 2ICWI 4NJ9H 2I60L 3CDCA 3SPVA 5IOPB 4NGHL 3FQUA 1CXKA 4JFFB 5EA0H 3VIFA 4D8PA 4LOUC 5F7EL 4KXZI 4D8PB 2IADA 1BTCA 3UEZA 1BD2E 5L2KE 1I3RA 4MA3A 1FJ1A 1FN4A 3D2UA 5C1MB 2B8OT 1DQQB 2Y23A 5KOMC 2XWEA 3FQUB 4GAGL 4JM4L 4G8IA 3LKNB 2BVOB 2CGRL 5EZJA 5TQ2L 4UDTB 4TTGA 4AD0A 1DDHB 3VRJA 5AD0A 3WY1A 2ARJA 1MFAH 5I1AB 3NDYA 4JRYD 4LPWA 3MRCA 1YC8A 5DJZB 3BEVA 5FO9A 1TFVA 3W11C 4O2CA 1YEFH 1NWRA 5KZCB 4PB9L 2CLVA 4BZ2L 5F9AC 1UKSA 4B7IA 5C08B 4UZUA 5ADOH 1KPRB 2NX5B 1NBYA 3W81A 3WQ6A 3QNZB 3E6HB 3KWWA 4IDJL 4NFCA 3L4WA 4FZ8H 3S34H 1EOKA 5CJBA 4TUOB 3UCQA 5SX5H 4ONGL 1JRHH 4NUGH 3RWJA 3VGEA 3GIZL 4HKZB 4XAKD 4NM8H 4K7PL 4W93A 1H3UA 1CICC 2C7UB 5MHSE 2BS9A 4OD3L 1G7QB 2GJJA 2UYLB 3OJVC 4YFDB 4EKXA 4X7EC 4NCC1 1PQZB 3HG1D 3WD5L 5MEOA 4WHYH 5CD3A 1ZEAH 1AHWB 4NQCA 2O5YL 1AVAA 3TT3H 1B0GB 3CHDA 2YRPA 4MJ5A 4X9IA 4LVOC 3RNQB 1NCNA 4JLRB 1MIEH 5GGTA 4U49A 5D1XC 3C5ZC 3F7RA 4QGTA 3AY4A 3EKCA 2W0FB 2MNUA 1MAMH 1QFWM 4S2SA 3KPNA 3SJVA 1PEZA 1F2XK 3GMRA 1OAYH 1AR2A 1JDCA 4JPWH 1JNLH 2PN5A 5MEQA 5E4IA 4P5TD 3MO1A 3WKML 1UM5H 1BOGA 1U8IA 5GJSH 3X13B 4DWHA 4LHUD 1JHTA 2GJ6D 1A9BA 4PTVA 4B3LA 1TITA 1HNGA 2W62A 4Q9CA 4FXKB 4CVZA 3Q5TA 4QYOB 1BQUA 1DTUA 2IGFL 3FXYA 3CDGA 3EJZD 4HWEL 4ZO8A 1S8DB 4P49A 4OB5L 4K9EH 3MROB 5EFIA 1BOYA 2VX5A 3Q6FB 1X5KA 4LVHB 4HPYL 3RVVC 2J7BA 1F11A 1IKFL 3TJEL 4ALAL 5DMKA 5BV7B 2B4CH 2IH3B 4U2YA 3I6KA 4H7VA 1OF2B 2BNUB 3PQYD 5EZOL 3BIBX 4N68A 5GQBA 3SGDH 1XMWA 1N2RA 4OOUA 1IFHH 5C0BB 4QF1B 3T09A 5ABFA 1LEIB 2VZOA 2ZOKB 1W1PA 1U41A 3L7EB 4OKVB 1ACYH 4OCRL 1R47A 5CEYB 4GBXD 5IGXL 1OAZH 4XCEA 3WDJA 3W0KA 1JNNH 2IANE 3QQ3B 3FB6B 3C9NB 4XMPL 5HPMA 4UIKH 4P59L 3DX7A 3QUMA 3IGUA 3QPQC 4ZPTA 1WDRA 4JY6B 1XV8A 2P24A 2W59A 5HVHC 1M53A 4OIFA 3RJQB 3BZEB 1U8KB 3E2HB 3TJHC 4P0DA 4LDLB 1NFIA 4XP4L 4H25A 2IPUG 4WJXA 2BSSB 4GO6B 1NUGA 1U8LA 4YC2B 1KYOJ 4N0FB 3V4UH 3QXUA 8A3HA 5E2TL 3PWUA 2WZPD 3DV4B 1S7XB 1U8PB 3GSWB 5C07E 4OCSH 1F3JB 2EDWA 3AMGA 1CGYA 4MXQD 3KNBB 1H41A 3DSNA 3V5KA 2JE8A 3BO8A 5FEBA 4LEOB 4S3JA 1QW8A 5IMOA 1MI5D 3LDBC 3FO9A 4FQHA 5CZXD 4E5XA 1H2JA 3GSRA 2IFFH 3QBTB 4P2RA 4H5SB 4P2QB 3WNOA 2JJWA 5FYLH 2E6PA 5KSBE 1BPVA 3NGBC 2WMPA 1FG2A 1V03A 2AJZA 1HP4A 3H9YA 4QFUA 3MLUH 3EJTA 4A6YA 4G42B 1RIUL 4ONFL 1WV7T 3WY2A 1GW1A 3GHEL 4UNUA 5I8EB 4L3ED 4ZOEA 2BNRA 4ONGH 2DICA 3MV7A 2EDLA 4TUJA 4YHIB 2H2PD 3H9SE 1MFCL 1RMFH 5BQ7A 3SCMB 4HC1A 3SDCC 1IMHC 1ZWIB 4M1DL 4QWWC 1UWQA 4LVNC 1OT2A 4U4BA 2F54E 3K2UL 3TZVC 2YZ1A 4JB9H 1HJQA 4JFVA 5EPMA 4UT7H 1PFCA 3N50A 1YEFL 3W9EB 1NAMA 5JOFA 4U1GB 2H3NA 5FUOH 1I9RH 4MNQD 5C9JB 5CD5D 3C5ZB 1WKYA 3I50H 5C0DB 5IFAL 2D7TH 4YE4L 3VFVA 5LWYH 1MQKH 1WBXA 4XAWL 3UESA 1C12A 4QRTA 3MI6A 1D9KD 3O6AA 2YDRA 5A3ID 3UP1A 4YDVB 3ZDXF 5FHBL 1BFOA 3MFFA 1U8MB 4HS8L 4RGMB 4WDIB 1ISVA 3UBXG 2JCCA 3C9NA 5E6ZA 1JV5A 3OPZL 4NQXA 4N1CA 1JXJA 2RIKA 3CXHK 5E8OA 3DYOA 1RAMA 3MYZA 1CE6B 3JV6B 3INUL 1L6XA 4NKOA 1BVZA 1E28A 4JY4B 1KLUA 3JTTB 1GOQA 2GVYA 3O3EB 2HKFL 4M4PA 3MRLB 4KRPB 2NY0B 2E8ZA 1S9KC 4DN3H 1OOAA 3QUZA 4HIEB 4M00A 4XNUL 5JW4M 3AYRA 5JDJA 4KRNA 4OFVA 3EGSA 2UZIH 2PYEA 5IJVB 3CSPA 5IFAH 5IM7A 1KT2A 4G7VL 4V1DE 3HUJF 1E3XA 4GQ9H 5C07A 3BH9A 2CITA 3UAJD 1TJIL 2I25N 1C1EH 2A6JB 4HIHB 1KBGL 1IAOA 3AS3A 3BMVA 3TA9A 1WAAF 4MD0A 5CSUA 1U42A 4U1SB 3OZPA 2GJ6A 4UUJA 3VFTB 4TPRH 3L5IA 3E1F1 5AC5A 5GGUB 2DMCA 2WHLA 1ZU8A 2WVUA 5MEQB 2R2BB 3DBXA 3DVGB 2R0KL 3QDJB 3FB5B 4F2MB 1CDIA 1HINH 2GT9A 2XZAH 3RDKA 5IW3A 3DMMC 4F3FB 2V5CA 2WSPA 1X7QB 4GAYA 2G3NA 2CNCA 1QSFA 2I24N 2NW2B 3PHAA 4FABL 2PXYD 2OW7A 1PKQA 2O9OA 2E6QA 3HRZB 5CEZD 4GSDL 3IETB 5AZ2L 1ZLWK 5E9DA 4LQ1A 4JLRA 4GRLB 5KJRL 1ISXA 1G7IA 1EFXB 1QSFB 4IRSD 2BVUA 2X70A 4HXBL 3P9MA 5IB3A 2IAMD 2FBJL 1YA5A 5ABDE 3VD9A 1FIGH 1FV1B 1UM4L 4AYSA 3TESA 3BE1H 2AMGA 3HE6B 3HNSH 2YHGA 3MJ8A 3ALPA 4HOXA 3NUKA 1LP9A 2VXTL 1T66C 2J8HA 3U9PL 4UUJB 2ID5A 3VFTA 4XP9H 4EXKA 4MVBD 2CLRB 32C2B 3AHYA 5LA0A 2VDNL 2KDGA 3B43A 4WWKC 2E9MA 4G8EA 2OJZL 3PZIA 2X1WL 4FFWC 4G8EB 5D9MA 4Z0BH 5DJXA 1K3IA 3QFJA 3L3JB 4DEPB 5BS0D 1I8IA 4U05A 3TBVB 2R56H 1KB3A 4QTHA 1FORH 4RZCB 3BC9A 4R26L 1OP3H 2EJ1A 4YEFA 1MCKA 5LBSL 1ND0A 5C0EA 1GH7A 3CFCH 1GAFL 3EZ8A 4L4TE 2IEPA 5KSAA 3VFOB 1FV1A 3S5LA 4BFIA 5EC1A 3MX0A 3VXSD 1JD7A 4KHTL 4Q6IC 3WFEH 2XZCL 4F79A 3MR9A 5TE6H 3ARDC 4M03A 5AD0B 2X70B 4NQDD 1UKPA 3TA3D 1MLBB 3T1FA 1VAHA 4XPTH 3QEQA 5A94A 1J0ZA 1I75A 4PUEA 5I6XB 5C6TH 4JREB 5E9DB 1T0MB 2XN0A 5EBLA 3WQ8A 4AIUA 2VN7A 4PR5A 1NCWL 5C0AE 1Q6FA 3AY4C 4X6CB 1HCFX 3PWPB 2XVLA 3CVHB 2X1XR 1QFHA 3PL6B 4JFPB 5A6BA 4GO8A 3ARFC 3TNNB 2VLJE 3U5UA 3GMNB 3LV3A 1EO5A 2V3DA 3B8YA 2XKNA 5FCUH 1C93A 4I18B 1U3HD 1SM3L 4JEGB 3C6SA 4KDWA 2P5WE 4FZ8L 1G7LB 4KKAC 4GOSA 3WJJC 5I77A 2P5ED 5C7XH 1T0OA 3DTXA 1BAFH 2DKUA 4QHMA 5T1MB 3QHTC 3PF2A 3JWDL 4UQAA 3U0WH 1E27B 1MAKA 2DQJH 4EIZC 4JRXD 1UXWB 3BH9B 4L4VB 4OF3A 2AJYL 5SWSE 4XBGA 2ADGB 2XRAL 1AY1H 2Z8SA 4WTZG 2DJUA 4WFFE 1MF2H 1Q8MA 4JZOB 1MFAL 3RWCA 5GIRB 1E6RA 3GO1L 2DT1A 4YIQA 3V5DA 2DIEA 1B90A 4NP4H 2O5ZH 3G5XB 1CZ8H 2F53A 2CRZA 5TDOB 4FFYH 2MJWA 2XTJE 1HHHB 2VUOA 5IB2B 1TJGH 1AP2A 4XCNB 1MCBA 3JV6A 2J8GA 1HSAA 1TQWA 2VZ3A 2VDOL 3TVMB 4FP8L 1YYML 1D6VL 4BK4A 1R3JA 3WENA 4ZXBC 3BSZL 5FV1L 3CH1A 2F7RA 2WUBH 5CXPA 1A1NA 1FE8H 1F3JA 4OCYH 4ZYKB 1A5FH 1S5HA 3OXRB 5EULV 3B2VH 1XCTA 5E94A 3TCXA 4CJ1A 2F1BA 2JF6A 2ARJQ 1A64A 5C0CB 1G6RH 5JOFB 5E8DL 4ORGB 3ROOB 1NMAL 4PS4H 5JDSA 3D5OF 1NAKL 2CBUA 3M1BA 1NCBH 2EDRA 4KKCC 4X5LA 3ME0A 3WDQA 5ERWA 3VRIA 2HKHL 1ZWIA 3IU4H 2LVCA 5EO9A 3DX9B 4HS6A 4K7FA 1A1OA 3WHE0 1QW9A 2PCPA 1WZKA 5BZWA 1A4JA 3QEQE 4MAYB 1J1XH 5DVMA 2DQFA 5TFSL 3U0PB 1JF5A 3KAAA 2H32B 3QFDB 3THDA 3L7EA 1CL7L 1RUQH 1S7SA 4QF1A 2ZPKH 1F4HA 1X6LA 4M8QA 4GW4B 3LKSA 5F1OB 5I8OH 5AEAA 2OMNA 3TCLA 3VA6A 5DT1H 1FFPA 5K9KA 3VX1A 3UC0L 1HEZA 3LQZA 3MCLL 1P6WA 2V17L 1DUZB 3BLPX 1II4E 3ULUE 4WI9A 3SGKC 2IH1A 1OTTD 5A2KH 1A02N 4HS3A 3DIFB 5ANMB 2CDFA 2A6KB 2WB5A 3U1SL 1KJMA 1A6PA 3SDAB 1J01A 4DKFL 43CAA 1FVDB 5EMYA 1ZLSL 3MOQA 3BJ91 4KTEH 3TO4A 2HFGH 2DLIA 5DQDL 1S7XA 5CLTA 1NUFA 4WIQA 1DSFL 3QO1A 3OKYA 4MD4B 4RGMC 3MLWH 1MRFH 5A3HA 3VJ6B 1IZKA 4TQEL 1DLHA 1DQJA 4W68A 4H20H 3VRLF 3KPNB 1T5XA 5DUPL 2BZDA 5T3ZL 1CG9B 1I3GH 5EZIL 1BVKA 5INDB 4KUZH 3MUZ1 3HI1B 4YHMH 4GT7A 5DR5H 2EXYC 5KS9B 1P84K 3PV6B 3RY6A 4HIXH 1TVHB 4ZOBA 5JIWA 4QXTB 3UTSA 5I0ZA 4XCEB 3KPSD 4P4RA 4HUWA 4PRIA 5IB5B 1EO8H 3OR7A 3GB7A 4ODHL 5TQ0L 4H8WL 4ODXB 5MERB 4HGMA 3FONA 4M6NL 3S5LB 4BFIB 2J4WH 4PJGB 3CX5J 3KPTA 4I8DA 1QI0A 5EWIL 3QUMH 4PP1C 2VISB 4QOKE 1IEAA 4WRLA 4ERSL 3GJEA 2B20A 3FT4A 4NT6A 4R4FL 3UCRA 3RO8A 4HXAL 4K23H 4LSPL 3S3JA 2Y2WA 1CLZL 2LTQC 2BSRA 3IYLW 5FUCE 3SCQA 3IRPX 1EVUA 2XGIA 1YMME 1KC5L 4MHHI 5HNNA 1DQTA 4O9HH 3L9RA 4OV6F 1KENL 2W4XA 2VYRE 5DT7A 4M5YH 3FMGL 3MO1B 1I8MA 5A2BA 4JPVH 3DXAA 2B4CC 1BECA 1FLTX 4WUUA 1C8YA 1TDQA 2N7BA 2V6HA 1U9KA 2C3VA 1LF1A 4FQLL 3DMMA 1LQ0A 1J18A 1T1YB 2IAMA 4H1LB 3FT2B 1ZGLP 4XPBH 1OTUC 3CZSA 3D5HA 1KUMA 1NUDA 2AS5M 1RPKA 2A77H 1FJ1B 3D2UB 3S5LG 3F58L 2YC1A 3NSNA 4D2NA 3HE6C 4Y5VA 1QBMH 4YHNB 5DDHB 4ZUVA 3NABH 4OIIH 4ATWA 3BKMH 3QHOA 1A6AA 2R69H 4HK3N 4P2OC 4U3XA 3HG1B 1LVEA 2X89A 1RSFA 1K9TA 3AS1A 1UADC 4PRHE 3QDJA 4F2MA 5CZKA 5DS8A 4HWUA 1U92B 4Y5XC 3B5TA 4J3SA 3GMMA 5DO2C 2XTJC 3GSVA 3B8SA 5D5MB 3TIDB 2ZCKH 3CSGA 1E73M 3WDPP 5ALCL 3UBXI 1ZGLA 3N9KA 3LKPB 3HR6A 4ZUWA 2J4GA 4BQ2A 3QQ9D 2EZ0D 3P0YL 2D03L 4ZFZA 2EADA 3EYOB 3CFKA 3F7YA 4L4PA 3ARGC 3EYUH 3GI8H 5D71L 4GZJA 4C56B 2P1YA 2NXYC 4R8WH 2V5RA 3H9ZA 5DURB 4C56A 5SWQA 1QSFE 1S9VA 2P43B 2QQQA 5FV2A 1G9HA 3A5VA 1JYXA 2DSZA 3SCPA 5F8QC 3KL5A 3D69A 4P4KA 4ZFZB 5KSBF 4NO2B 3EJJX 4MYWB 3RVXC 1CXFA 5GS0C 1J8HB 5AZEL 2Q76B 3UTTA 4OZ4B 1ZA6A 4BKLB 4YDLC 1KCLA 3G5YA 2GK0B 3PWLA 4J4PD 5I1AA 4X8JA 4WHTA 2QQNL 4PLJD 4XCFH 2EPLX 3D9AL 2VDLL 1ZT4B 1FG9C 1DDHA 3GSXA 3OKDA 1P1ZA 2WWCA 4AMCA 3Q5YA 4ZSOB 1WCBB 4PUDA 2NY4D 2QL1A 4NBYB 2FBJH 3EJQA 3HI6L 1CLYL 3OGCB 4YDVA 1NSNL 4G3YL 1JGLL 5A8MA 2R2HB 1PG7X 4YXKH 4D1IA 3TPKA 5F8RC 4D6DA 2ZIDA 3PQYB 1XH0A 5DD3L 4LMQI 4HZ6A 1KQZA 1E71M 1UJ3C 2AJUH 5C0BD 1FP8A 3VXRE 1VPOH 3O8XA 3I75A 4H88H 3V6FB 4CDHA 5FUZH 2F15A 1KV3A 1NFDA 3LEXA 3GH4A 4NKMA 1VHPA 2VIRB 4MXVE 5IKCB 5DRZB 4S0SD 1FNLA 1OSEA 4JM2F 1GPFA 1C1EL 1UKTA 2VOTA 3C6LB 3MV7B 4TUJB 5DRNA 3QDMA 4F57H 5BOPA 4FNUA 3PWJB 2VLJD 1C08B 1C8XA 5ICYB 1XCQA 3DOSA 4L3EA 5DJAA 2OL3B 2VERN 4LNVA 1L4IA 8FABB 2DL2A 2CRMA 4WW2B 1X5XA 1H15A 2E3VA 3MRNB 2HVJB 5K9QG 1DWHM 3V0VB 1I1YA 3LIZH 4UQ2A 5ELIA 5HHXH 5IEKA 4UQDA 4JN1L 4DO6A 3WFLA 5HGGS 1Q0YH 4PPTA 1RUAL 2P8LB 1F6AB 1KIRA 4TQEH 5GHWL 1A6UL 1LLOA 3MPCA 5IQ7L 5DK0B 4K3JL 1B88A 1KN2L 4WU7B 3UZEA 2YXFA 1FYTD 3CMOL 2LV4A 5ABEA 3EFFA 5MERA 4R26H 1RK0A 4L4TD 5GISH 2VL5A 1F4YL 5JW3L 3BGFC 3Q0HA 3CXHJ 4CMMB 3G6JE 2DS4A 2F54B 4HPYH 3V6OC 4W5UA 1AXTL 3U7VA 4PJXA 4MXVF 1F42A 1O7SA 1UH3A 2Y6SD 5IFHH 4B16A 3B9AA 2VE6B 2PWGA 1KJ2B 4YAQB 1W72A 2Z31C 5T33H 3QIBA 4MDJB 1C92A 1NCTA 4J2XA 2VXVL 4J8RA 2BY1A 4Z7VF 4J8RB 3WEXB 3ALXA 3PWJA 1F2QA 3ZT6A 1BGXH 4PJBE 3G6MA 1PGRB 3VXTB 3OGSA 4TYUA 5JIPA 2G3IA 1R3KA 3L9RB 5IQ7H 4XP5H 2OR9H 5M95B 3VXQA 3DGCR 3RTQD 5DRWB 3KYNA 1VGEH 4AG4L 1AQHA 2ZXDA 1NEUA 1LEIA 5H37G 2ICEA 3RZWA 3C5ZD 3SDAA 4WU7A 1ZL1A 4NO0B 3LEVL 2GSIB 3PQYA 1FZOA 1D9KB 1JTTA 2Q7NA 3O6LL 3D3VB 4JDVA 1B4JH 1BYAA 4WU5A 4G6JL 1YECH 5F1NB 3RGHA 2ZUQB 4XPBL 1AJ7H 1RUPL 1LE9A 1NGPL 2ED7A 1KXVC 1UEYA 4X7CC 4NNXB 3BKYL 2EC9T 3WF2A 2BXZA 5BS0E 2V2XB 2AJYH 1X5JA 4CU8A 4DVBA 5JW4Q 4Z18A 4KRPD 4WGWB 1ZXQA 4KC3B 4TVPH 1P7KA 1R7AA 1ZA6B 2F61A 5EO9B 4LPVA 4J1UB 5F9JA 3DGGB 3CH9A 3MBED 4YBLB 3AGVA 3G5ZA 4LLVA 4MQSB 1JAKA 3VGAB 4E2OA 3RZCA 4NQVA 4PGJA 5TE7L 3BSHA 1LK3L 2FD6L 3ZYOA 5AWNL 4A6YL 1XR8B 1NSNH 3QIUA 2DSUA 4OGZA 2PTVA 3RL2B 2ZX5A 3PIQB 4AZIA 3CLFH 4MJIE 3NZHH 4OI8A 1MW3A 4EN3A 3ZQ9A 2XFYA 4NSBA 4ZYKA 1UA3A 1VERA 4PMOA 2WMHA 2CDFB 1EZVX 2A74A 1FLRH 1OB1B 1A4KB 1WVZA 5FUZL 3IDMA 5LG1A 4GAFB 2X05A 4U2ZA 5I6XC 2ERJC 4ATDA 1NM9A 2G3JA 4RDQF 1UENA 2DQTL 4AIOA 1V5JA 3D48R 1C5CL 3NFSH 1FH9A 5LGJA 3MFGB 1G7MA 4YNYB 1OSZB 4IRZL 2HJKB 4XC3L 5F3HA 3V5DB 1UG6A 4PMQA 4LRNL 2WMGA 2H32A 4GRLD 1CFQB 1YNLH 4XC3H 4MAYA 4AEEA 1V05A 3WBAA 4AH2A 4RMRA 1PY4A 4I3GA 5BRQA 2CO6B 5J6GA 3MLWL 2YLLA 2XA3A 4QO1A 1T1YA 2IAMB 3UTQB 4MJID 4FNLH 1XGTA 1RU9L 3O45A 1HXYB 2A0LD 4YK4B 1JGDB 4MB4A 4MNQE 3T0EA 5A8NA 1E55A 3CZFB 5HHOA 3I75B 4QHMB 3O8XB 1ZEAL 1BFTA 4J3XA 1JZ3A 2W65B 1Q9WA 2ADIB 5CFHA 2IPTH 5C0CA 5TH2A 3OKLB 5CJ5A 4I18C 1QFUH 3OR6B 4C7DA 2PWEA 4UINL 3B9KC 3OV6A 4KI5E 3IS1X 5IVXE 2QSCL 3DPBA 3OLIA 4G8IB 1UT9A 1GORA 3PGDA 4KRTA 5EB8A 5LBSH 3MUGA 3WIHL 1MSPA 2OZ4H 4P9HC 4X6CA 3S3PA 1AD9A 2H2PC 4MB5A 2LFGA 5EBLB 3MRGB 1Q6EA 5FYJE 5ECJE <