5CGTA

Maltotriose complex of preconditioned cyclodextrin glycosyltransferase mutant
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVAAVKHMPLGWQKSWMSSIYAHKPVFTFGEWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 232
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cgtA01
2CKBB 2PYED 4HH9B 1TETH 3C60A 3GMOA 5DD6A 3Q1SL 2DL9A 3QP3A 1GOOA 1JWMB 4HPOH 4PEEA 5DD3H 1DQJB 1QLRB 4FS0A 1YNTA 3BKCH 4LU5L 1FH5L 5HY9B 5I1CH 1Z2KA 4M93C 2QPSA 4PRID 2CIIA 1FSKC 5JMOC 1EA9C 1BZ7B 1N8ZB 3SGDI 5JW4Q 3AY4A 3TN0A 2BVTA 2IQAB 4Y5YC 3S37H 3DC0A 4JPVL 3SOBL 4U6HB 4U0QB 1FO0H 2NSXA 3ROOB 2X41A 4LL9A 5EOCH 3O6KH 4HIJB 3DI2B 4HS6A 3MRRB 3QCUL 3TVMD 5HPMA 3TO4A 5A6JA 4C54A 1R6VA 3NZHH 4M48L 5ESAB 4KRUA 4M6ML 1J1OH 4IIQB 2VLRB 3PWJB 2AK4E 1LF1A 4XNXL 4YDVA 4P7OA 3N85H 1CN4A 4PBWD 3BPCA 3B5TA 3SO3B 1MY5A 3C6LA 2EABA 2GFTA 4LCIL 3UERA 5H35A 2WK2A 1VRXA 1KIRB 4UV4H 4KDTA 3WFBH 1JAKA 3HCVA 4ZE4A 3L3JB 1OARL 1TQSA 3MA9H 1F2QA 1T1ZA 2P5EB 3HG1D 1OP3K 1UADC 4M7JL 2AEIT 2HRLA 5FYLH 4JFEB 1XIWA 3JTTA 3V0AC 5JXEC 1CFQB 5I71C 4HMDA 2V2XA 4YDKL 1QR1A 2XVGA 4AZ5A 1IV8A 4CBPA 3HAEH 5HYJB 2VAJA 3LVEA 3LQAH 4FOMA 5HI5C 1YPZF 1CECA 4PG9A 1F4AA 1WDQA 1QSEA 2MOVA 4TTDC 1T7ZA 4ZS7H 4C55A 4A3HA 3O4LD 3MRKB 4TSAL 4WO4B 5E94A 5DJ0B 4AIOA 2VZTA 5TFSH 4I0PB 2WWKO 5DVNA 4LAQL 3PABA 4OF8A 5F7YC 3WN5B 1WTGT 3BVUA 3EYOB 3NPSC 3VMNA 4LOUD 5CP3H 1VBRA 5F9OH 4PJIE 1EAPA 4JANB 2ICES 4AD4A 2BXYA 4UOQA 1T7YA 4L4TE 5ABDE 1YJDC 3BDXA 4E41A 5JPMB 4GBXC 3EDFA 1FFOB 5I78A 4ZFOL 1UM6L 1IL1A 4CD6A 3MLYL 3NAAL 2Q86A 2Z8WC 1DWIM 3L9RB 3IDNB 3V95A 3SGKA 4EZMA 2FRGP 1UR9A 5C0BB 4WO4C 4EEEA 1U8OA 5GJTH 5BVJB 3GSWA 5DWUL 5I73B 4ACPA 5DTFB 1TZGH 2HWZH 3DNKA 3CZFB 4ZFGL 4Y1AD 5KZCD 1R8LA 1EJOH 5JBDA 1QRKA 3W9DA 3ZTNH 3CV5A 4Z7WB 3KE0A 1C5DA 5GS1A 2X44D 4L3CA 1RJCA 4MNHB 5KN5A 3AQUA 1XH1A 1RJZA 4G42A 3HRZA 4AD3A 1FNAA 1M7XA 1A1MA 4LCYA 2ESVE 5CHNB 1FFPA 4I18C 3OA5A 4RGMC 3IFLL 1MEXH 3CVHH 2PUQT 1A3QA 5CJQL 1G0DA 5DJ8A 3ULUF 2VX5A 3T0XA 3BC9A 1HIML 4PJCB 1LLOA 2NXYC 5FYLL 5FV2A 4MDIA 4NN6C 1I8KA 3OL2A 4WUUD 3CNKA 1G0YR 2CDGB 2FJHA 5CSZA 5E56A 2F54D 4KROD 4F7TA 4TSBH 2J5LB 4XBPB 5F6IB 1WDPA 1DBKL 1F97A 1WAWA 1QYGH 2ZG2A 1KCUH 4X83A 1U8IB 2YD7A 4NNXB 2RR3A 1B9ZA 4NZTH 1QSFE 2XQYK 4QKXB 4PJXB 5IG7B 4OLVL 5E9DE 2YK1H 1TZIA 2KZWA 1A4JB 4GBXD 3P11H 5L9DL 3KPNA 5DMJB 3UYRH 4HEME 4FA8A 1EUTA 2G3NA 4BQ3A 4EVNB 3CAFA 3MO4A 4KUCF 1F6AB 4MDOA 1CGTA 1YYML 4W8BA 4U1JA 3RJXA 2W65A 3QDMB 1EQPA 4UINL 1MY7A 4U1NB 4J1UA 3QRGL 1AD9B 1GORA 3AROA 4V27A 4JCMA 2J7BA 4I3GA 5DR5L 2WMPA 3MLYH 2NY5L 3NAAH 5E1HB 5B8CB 1OAXH 2G5RA 2VLJE 2MHAB 4PP2B 5DD5H 5ENWA 1UZ1A 1TQTA 4XXDA 4ODVH 4EDWL 5BROA 2PKDA 1ZXQA 4OCSL 4J4PC 4Z95L 1P5UA 3MRQB 1GGTA 3EO1B 4W7UA 1AO7D 2EICA 3GEWB 4P5MA 4WFFE 5B3JF 1E4NA 1GZQA 3KEHA 4N5EC 5FKAB 5E08L 5JXED 4CKQA 3MUY1 1CGXA 4PTTB 3QH3B 2XM1A 5C6WH 1MPAH 5TJWK 3LZFL 1W72B 3K2UL 3OF6D 3AIEA 2N56A 1M7IA 2YBTA 2VN7A 3FQWA 1QW8A 5EZIH 4JDTH 5IBUG 4U5KA 1RMFL 7FABH 4NRRA 4K3JH 5ABHA 4G8EA 1N2RB 3BT2H 5T1DH 2AVGA 4UOJA 4JY6A 5TQ0H 1AP2B 4ZUVA 3TV3H 4AIXA 2B0SL 1EEUA 1DTUA 1OL0A 3C08H 4AH2B 1WSST 4H1LB 5ALCH 4ZFMA 2MNUA 3UTPD 5FYJL 3VXTB 3VIHA 5LQBL 2GHWB 1JDDA 3SDDC 3QG6B 3SE9H 4XRCA 5I75B 2I9LB 4AEHH 4QTIL 2UY5A 2CLVB 4G80B 3GHBH 3RA7H 2BNRA 5IFTA 4FXKB 1AO7E 1REIA 2J88L 3TCXA 5EOTA 2WWMC 4HBCL 1UWXK 2AQ1A 1Q6GA 1HHKA 4NHUA 3FQRB 4P4RB 5FA3B 2DIAA 1PQZA 2A3AA 3ULUH 2NLJB 3O3UN 5F93C 2VC2H 1UWQA 2VXSL 5F3HB 4CN6A 1FZOA 4HP5A 2G3JA 4K7FA 3GXFA 4X0NA 3DX6B 5HI4D 1SY6H 3TBVA 5GZOD 1LMKA 3RMEA 3UTQA 2VNCA 1AGDB 2CQVA 5I1IH 4PMVA 2PXYB 4WW2B 3VFMB 2IJ0C 1NEZA 3IDYB 1M04A 4M1DL 2DBJA 1AGCA 3JWNC 4M61B 3SGDH 1ZAGA 3CMOH 3HG1E 3INUH 3U83A 1CU4L 2AJ3B 3EOAA 1FFNA 1HXKA 3A4WA 1LG2A 1UEYA 1OB1A 1OGAA 3QNXB 1JHTB 3GSNA 4BQ4A 1EEYB 5LBSL 3SIMA 4NBXB 4PRAB 4PREB 4PJ8D 1G1CA 5C6TL 5EFIB 1RZ7L 3IGAB 1UWGH 5LAXA 1TVNA 4S0SD 1QHOA 2NZ9C 2ZOKB 3CC5A 3WH5A 1TCRB 1DBKH 4CJ1A 3LQZB 2EPOA 2F74B 4UQ2B 1LDPH 1KGWA 5CPSA 2HYMA 3UZQA 4JG0H 3I6GA 1M7DA 2Y6SD 3KHOA 4U3XA 3VG0L 4J4PD 3ORJA 2CYGA 5GSVA 2X4SB 4P5TC 1FH9A 4QCFA 2DM3A 4XPAH 4S1DC 2VLKE 1U2YA 5MI0C 3N1FC 5CEXA 3FT3A 2Z91B 4L8SC 4KY1H 1Q72L 5FUCE 3DROA 4X9FA 3JSSA 3EFFA 2BOBA 2YHGA 4DKFH 4LLUB 1P6WA 1A7QH 2R2HB 3RVTD 4LBEA 3BKMH 3QHZH 3EYQC 1AGFB 1HQ4B 4NRYB 4Y1AE 5IQ7H 2W9LA 4YBLC 1YC8A 1ZLUK 1IM9A 4QLLA 3CH1A 2R15A 3O45B 4AL8H 5IHUL 4CVXA 3VTRA 5CXPA 2YUVA 1RZKC 3OKEB 4NRYA 4RWHA 4KHTH 4BUGA 2OWWA 1SJHA 4NCDA 1UB5B 4FQHA 1WEJL 3HI1B 1WFOA 1R0AH 2GJJA 1Q6EA 3BDBA 5FCZA 2DMBA 4NKQB 5HHXL 4PJAF 3DROB 3ARFA 1UM4H 4BZYA 3WELA 1JXJA 2EDHA 5CEXB 5KJRL 3KDMB 8A3HA 1UA7A 5T3ZE 4KZEL 3H3PL 2X4SA 1YMMB 4X80H 5I8EA 3RKDD 4AJ0A 1S7RA 3UTOA 4RMQA 4ZNEE 3I6GB 3TYFB 1C8YA 3TZVC 4YHOH 1XHGA 5K59E 3PGDB 4NO2A 3HUJE 3MODH 3PP3H 1OLZA 5IW3A 1MFDH 4OIIL 5EIQA 2JCCB 2VLME 3OSKA 3MNWA 3IJ7A 3BKJL 4PG2A 1OAZH 3UJIH 2EO7A 3KPMB 5FD0A 3RPKA 1EEYA 1QHPA 1R5WB 2D3LA 2V2TB 5T3ZH 4QY8A 3CMGA 4KKCC 4Z7VB 2WXDM 5D1QD 3B43A 3QIWD 2YPKA 4K7PH 3VSVA 3CDGB 2DSWA 1S3KH 5SWSB 3THDA 2AXFB 5C70A 5DJYB 2DQIL 4B15A 1NC4D 1IVLA 1FORL 2HTLD 2O5YH 2P7TA 4K7FB 1A7QL 4E5XA 3FRPG 1MVFA 3VIOA 4JG1L 2R0WH 5IQ7L 4GIAA 1HHKB 4P4RA 3N1QC 5HBBA 4HXBH 4APQD 5DD0L 5L0QB 4YXHH 1BJ1J 4JFHE 2ICCA 2AK1L 5IHRA 4R0LB 4ZODA 4NHCL 5IJKA 1UD5A 5FYJU 1G7QA 3MYJB 3ULSB 4UQEA 2J8FA 1GYAA 3QYCA 2OZ4A 4F8TA 1HWHB 1A9EB 3JV6B 2VLKB 3WH7A 4PY8I 3GMQB 5KSBF 2EH7H 1QNZL 1E6OL 1KT2B 3ULUD 4X6DA 1J8HE 5D4YA 3KJ4B 4YEEA 3B6SB 4HPOL 5EN2B 4ZUVB 2IMNA 3P40A 4G6ML 3RL1B 5I66B 1X5YA 2HT3C 1HP4A 4OF7A 5K9JL 2XWBA 1UM5H 3O6FD 3D85A 3WUWB 4WU5B 4X4ZA 4CDGC 3U7WH 1JTPA 5FDWB 3MZTA 3SDYH 3LPPA 4PV9A 4LHUG 1J0ZA 1HH9B 3HI6L 3IAPA 4PG2C 4Q6IA 1P1ZA 4QRQB 3BH4A 3QH3A 5C2BH 4JFPA 4GSDH 4GI9A 3TA3B 1BGXH 4ZS6C 3SJVA 4IRZH 4D9LL 3RI5K 3O9WC 1Z9MA 4ODWB 3W0WB 4JCLA 3EDJA 4JKPH 1V7NL 4A3YA 1KYOK 1X5FA 2H3NA 4LLQA 4YAQB 2OJEB 4P5MB 2NY4D 3S6TA 2R2EB 3IDGB 4Y2DD 1I1CA 5JMRA 3DMMD 1JNNH 2DYPB 4WI6A 5FXCH 3W81A 3MOAH 5ENWB 1XFPA 4NIKB 1A5FL 3V8OA 1F4HA 4AXNA 1KTDA 3CSYB 4NO0A 3MOQA 3VFWB 4OZ4B 2DSUA 1RPQA 1AD9A 1XGYL 3CZKA 2OYMA 3IDMB 2LVEA 1U42A 2AK4B 4XP6H 5D1ZC 3PZMA 1G7LB 4WW2C 2COQA 4BA0A 1ZBCA 1TQCB 3DO7B 5A6AA 3HC4L 4JG1H 3ZSTA 2DIBA 3E3QC 2R0WL 2XIDA 1KR1A 3CZ8A 4BFIB 4PJXA 4GO9A 4XZUB 4LSTH 2X4OB 1WAAA 2VKXA 5DFVC 4XNQB 4LVOC 5CD3A 1J12A 4JO4H 4XBPA 5DMYA 1RVFH 4XP4H 5HI4C 4WFFD 3NCEB 4FLQA 4NQDE 4JFOB 3GH5A 1JGIA 2X4PB 1LEIB 3BJ91 3DYMA 2R39A 4JDVA 3SGEH 1M71B 2FD6L 1S9KC 1U9KA 1FNEA 3LN5A 3CJJA 4FXGB 4JPIA 4PJ7A 1AIFA 2DQFB 4PMQA 4XNYH 5LCVH 3B9KA 5T1KD 1LP9E 3PWPB 2PNDA 3ARDB 3GSNH 1FFPB 4KTDH 1JRHI 2BHZA 4PB9H 4HIHA 1UD3A 4PJEF 4DK6A 4M43L 5I16B 4OCWL 4Z7UE 1SMAA 3QCTH 3HC0B 5LGJB 4RNRA 1OSZB 2HT4D 5J6GA 3JV4B 1ZJAA 4M6MH 3IJHB 3DETD 2FJFB 4JFUA 4W8AA 4KMQA 4D6DA 1KPVA 4MA1B 3QEQE 5EMYA 4Y19D 3ZLQC 4PJHB 5A69A 1GQIA 3HE6D 1TQWA 5DEZA 3U0WL 5HPOA 1UCTA 5E6IA 4UAOC 3VXUD 2B39A 2Q86B 5D1XD 4RAHA 5GJTL 3AU1A 2AV1A 5KANG 4JPWL 2C4XA 1OHQA 4N8CL 5CIPA 1LO2L 3ARGC 3NIGE 5IB1A 1OF2A 2HJLB 1OAUH 2BY0A 2Z8RA 3ZKXB 3BO8B 5IEHA 4MS8D 5GISH 4W84A 3GH4A 5HVHB 1GGCL 4JANA 1EAPB 3QI9D 1CZ8L 3WKNA 1XV8A 5LA2A 2R1YA 1XH3A 3DETC 3S37X 3WDRA 4JM2D 4AD0A 2YL6A 3WD1A 1MREL 2QR0A 1QA9A 5BS0E 1QR4A 3D51A 2FZ3A 1GPFA 1J11A 3DUSA 1G6RA 1G7IB 4K7PX 5H94A 3VX0A 2YL9A 4NXKA 3O11B 1PZ5A 3W6MA 3ULVC 3IF1A 4G7YL 1H3WM 4FTVA 1XGZA 1HP5A 4V2XA 5ILTH 3O6FA 4OV5A 3AI0A 5A2IH 2J8HA 3J8F7 3V8CA 4KK9D 1LE5B 2EPKX 3RJQB 4PJCE 4MXQC 4YHPB 4M7ZB 3CK0H 1O5DT 2L4OA 1CFQA 4WWKD 1QR1B 1FAKT 1HYSD 1PD6A 3TCLA 1A1OA 2CBJA 1A0QL 2ITDA 1AFVL 3CSGA 4XHJC 3L4ZA 1QUNA 1QPKA 4KTDL 1F02I 1URLA 3L95A 3N06B 3GB7A 4WNQB 5H35B 5GS1C 3CXDL 3O6LL 5TF1L 1Y0LA 2H32A 1EJOL 4RMUA 3AZSA 1MHPH 4ETQB 2W0FB 4DVRL 1GGIH 3C87A 5JIWA 4HIEB 2YWZA 2JIXB 3DI3B 3Q6GL 4PRBA 1OINA 3RVUC 4UQCA 4MD4B 3QRGH 1TJIL 3WUBA 3ROOA 4LEOA 1Y18B 1GQLA 5DR5H 2Z31C 1D9KB 2Q3AA 3U7BA 1SJXA 2LU7A 1FL3A 4NKMB 5J06A 3O2DL 1PS3A 2CIIB 4HKZA 2R2CA 1NGZB 5FM8A 3GTNA 1ZE3C 1E5JA 2FGLA 4PB0L 1F3DH 5ANMB 3T3PF 3PWUB 2OL3H 3ZKNC 1LQSR 1G7JA 1YY9C 2GFBB 3BGFB 1WICA 2BV9A 1T04A 4G7VL 1L7IL 3EDEA 5T1LA 2FD6H 4OUOA 1JYNA 2XTKA 4YBLB 1NFIB 4OSUH 3W9EA 1UQSA 3GBMH 1MYRA 1DANT 5IIEB 4S10A 3SKNB 2YK1L 1ZANH 2H2PC 3LPWA 4TUFA 3DX9A 3KYOA 2ENYA 1NFKA 4I0PC 4IS6A 4YBQD 1HVXA 3WEXB 3WQ4A 1MCPL 1N3NB 1YEKL 2JJSC 4FQCH 4IPLA 4NKIL 2VZSA 3U4EA 1I8LA 2JJWA 5E5MA 4PJXF 5EOQL 4BJLA 5AY7A 2EKSA 1NMAH 3HZKA 4CMMA 3SCOA 4IOIB 1BLIA 3PL6D 3LD8C 3CFKB 2VRKA 4DOHE 4X8JB 4HWEH 2J7FA 1ODAA 2C1OA 1KGCD 3ARFD 4ODVL 3HNSH 3LZFH 5IBUB 1C3FA 4M6NH 2RGMA 4Z95H 3ILQD 2XWTB 3O9WB 3ZTJH 4CVZA 4JPWH 4NRZB 4ZSOB 2X42A 1CU4H 3VXMD 1YPZA 1YN7B 1G94A 3VXRB 3SGEI 4LVNB 2VH5H 4LLYA 1QKZL 1CE1H 1KJVA 1KBGL 4H8UA 2B4CL 3TM6A 3NZ8B 1AR2A 1TIUA 3VH8B 1LL4A 3CMOL 1LWRA 1FHDA 5A3ID 1CF8H 1HQRA 3B2VL 2DQUH 1IGIH 3GSQB 4NQSB 2YDRA 2J1KA 1NBZB 1KB5L 2HJKA 2EKJA 1VGKA 2X2YA 1IAOA 2EDQA 3E0GA 1TQBB 2VB5A 2OQJB 2YR3A 4O4YH 5ALCL 4HBCH 3T0WA 3VG0H 5C0IB 1XGPA 3C9NA 3CXHK 5E2WH 3OXRB 1ZGLA 2V7NA 3OAYK 4M93B 3ULUL 4XPAL 4IDJL 3FTGA 1A3RH 4Z5RA 1I3VA 3GJFA 3I2CH 4S3JA 1DEEA 3PWVB 4HV8B 2E7MA 3BAEL 3GXPA 1ZSDB 2WZIA 3BH8A 3GBML 1UB6B 2IANA 3CPLB 4OD2B 3G5YA 1Q9WA 2XA3A 3KXFA 1D5IH 3V6ZB 3L3GA 5KAQG 4PY8J 1YY8A 5M17A 1C5CH 1ZANL 5C0EB 1FZJA 4DZBA 2O9OA 2YPLD 4K8RD 5ICXA 1X5LA 4NPYA 5BXFB 3SE4C 1CT8B 1MCPH 2E9MA 4R2GD 4R7DA 2Q76A 1ODZA 2DQEH 1YJDH 3DXAD 2AXGA 4NKIH 4HT1H 3LEYL 5LBSH 5IR1B 4EANA 5FM5M 7CGTA 4E0RA 1T1YA 2R9HC 5ERWB 4P7NA 2GSGB 4NFCA 4APQA 2QSTA 4GAJH 2CDFB 1C08A 1F3JA 2HFEB 2J8UA 3WIJA 5FOOA 2AJZB 3VXQB 5JLZB 4YFLI 1U8QB 3DDGA 4LARL 3PWNB 5IB3A 3QHTC 4XVUC 3PBGA 2X4TA 4X80L 1RZGA 4Q58C 1A14H 2GK1B 1CLZL 5C0JB 2FO4B 5DQ9A 2IBZY 3H9SE 2NW0A 5HGAA 1US3A 3C6SB 3KS0J 4G7VH 1UWRA 1BAFL 3T8XB 5A2FA 5A6BD 3LSOA 3MRBB 5FF6B 5C08A 1IGCL 5IFAH 4MYWB 1FO0B 3WO4C 2NPLX 2Y5TA 2DQCL 5EIIA 3D2UB 3RX7A 2WZEA 4ELMA 2XM2A 1UKTA 4B3KA 1ULVA 1ZKAA 4PJAB 2XZAL 3RIAF 3MROB 3NBNA 3OZOA 1GL4B 3REWA 4NQCD 4NC0B 1Q0XH 1SZNA 3RPMA 4L5FH 4FQ2L 3HMCA 1JWSB 2R1XB 4JVWA 3LH2H 4ZO8A 2F1BA 1SVZA 3RL2B 4FXLA 4TUJB 2JJTC 3VXMA 3DX4A 1HE7A 4K07A 1PJ9A 4DTGH 1IMHC 2C3WA 4TUJA 1Z9SA 5TDOB 3EMCA 3ZYZA 3CHCA 5HHXH 4JREB 3RGVD 4BZ2L 5D8WA 1UG6A 4OF0A 3ME0A 1IGFL 5AEAA 1Z6JT 2DWEA 3QPXH 4Y16D 3WFBL 4EIZC 2XZQH 3GMNB 4P9ML 3MCG1 1FN4B 3QDME 3MA9L 1XCQB 4LHQB 4YDIH 3D18B 4NJAH 5DD0H 1MJJA 3CFCL 1ONQA 2GUYA 2QL1A 4ZFZA 1E4LA 3CFBB 4P9HL 1JZ4A 4PJ9D 2PW2B 1SYVA 3FAWA 1MH5A 3STZA 1IM9D 3BKJH 1R24A 2NY6D 4M4PA 4YHGA 5C0JA 4RIRA 1B0IA 1RZGB 2XTJD 1KB5H 4Y88A 3BE1L 1W0YT 1IC5L 3VXNA 3VNZA 4WI2A 4YXHL 2DM4A 3O6MH 1A6VL 4G8GE 5BMFL 2JIEA 3VXQA 1OP9A 5B4MD 2WVVB 4Z2GA 4EUPH 3T2OA 2YDQA 1DWGM 2HFEA 4PP1D 1CL7I 2C3XA 1C08B 1VERA 3DV6B 4LPVA 1VACA 3QRFM 3B9DA 4JFFE 4KPHH 2Q87A 2G75B 3VDCA 3MREB 5ISZD 5IR1A 3LPFA 4R7DB 5SWSD 4M02A 4TVSa 1OSPH 2UWEE 3MUAA 3S5YA 3ZMRA 3ECBA 4NPYB 4NZRL 2IG2L 2OR9H 3S8WA 4DZBB 5DK2A 3ZJ8A 1TTFA 1C5CL 5A94A 1FNLA 1MHEB 2YKLH 4JKKA 1Q9WB 2XOTA 1TLKA 4AZ6A 1PSKH 4JR9H 1D5XA 4MA7L 2DH3A 2XNAA 1BGXL 3EGSB 1T4KA 3C8KA 3L3DA 3PWVA 3HLAA 1I75A 3RWCB 1GHFH 5HHPB 1HXMA 3L7FB 2XTJE 1OPGH 1XF3B 5EB9A 3ZDZF 4LSPH 4LCUB 1DE4A 5E7FA 3D87B 2FH6A 3RGVB 1PX8A 3RIKA 1J8HA 2BNQD 1U8NB 3U6RB 4KQ4H 4O02L 3W39B 3Q5TA 4QT5B 5IVOA 3CGTA 3HC4H 4XPTH 1GJWA 3F62A 3HG5A 4F7PA 4ORZC 2YWYA 1VENA 2EDFA 1QWUA 1NBZA 2M2DA 2OXGA 3AB0C 4N90D 1MLCB 3RVVC 1E6ZA 1RUKH 3BZEA 3GMMB 3PHQA 3U9PL 3KLKA 1AC0A 1QOXA 1L0XA 3WF4A 2Z1SA 1MIEH 4FFWD 2VDRL 3FN0L 5I19L 2AABH 4GKLA 3ELAT 1IGCH 3IXTA 4PJBE 1H5BC 3HR5A 3VFRB 5BW7A 3LD8B 4DK3A 1OWQA 1YZZA 1F90H 2R4SL 3L5WA 3MRJB 1ED3B 2XZAH 5KEZA 1MCHA 3OX8B 4HFWB 2XWTA 3O9WA 4WUKL 4OCYL 3IRPX 4DZ8A 1QBML 1KOAA 1BD2B 4JO3H 5D7IA 3AICA 1I9RL 4Y8AA 4W68A 2EDBA 3GSNL 3B9KD 5T1KA 3N1AA 5L7XL 1X4YA 4GSDL 5JQHC 4IRJB 1WC7B 3M17A 4AENB 1NBVL 4Y5VB 2KQMA 1E4XI 4IOIA 4OCWH 1DN0A 1V7NH 2EYSA 3WHE1 3OJVC 3FOLB 4GG6E 1E6XM 1PX3A 2VXTL 4DFHA 4RSVA 4NQED 4KK8D 4OCXH 3DHJA 3IFNL 4AD5A 1XSIA 3FZUD 1W2PA 1P7KA 1R5IB 2ICEB 2FX7H 1IGJA 3RUGF 3A4XA 4WKFA 1BOGA 3S34L 4NUJB 2ZG3A 3PZOA 3CBWA 3WY3A 1OY3B 3VFUB 4JR9L 5EBAA 1OGTA 5ADOH 3TBTA 1R3IL 4D0BA 1BF2A 3L4XA 3Q3GB 5KOMC 3ARGB 1F4WL 2J77A 4DQOH 3K2MC 1I85A 5HTSA 1X9QA 1BIIB 1YDPB 4PJ7E 2BC4A 1GGCH 1XF4A 5HVGB 1ZT7B 2YA0A 4WV1A 3G9VA 5B4MC 1K9FA 4ZAKA 2WSPA 1V0KA 1KJ3L 4XWGL 2HKFH 4JO4L 5JZ7D 5C07B 3VA6A 1MQKH 4NDMB 1GAFL 4X4YA 4MB1A 2A3HA 3RCNA 3HMWL 1QACA 1C1EH 3DUUB 3VIGA 4MDJA 4PTUA 4R96A 5I19H 2YFNA 1CZ8H 1WZKA 4PCTA 4HK3N 1EH9A 1OCWH 4PS4L 3X11A 2DLHA 4GRWE 4FRWA 3UTSB 4L8CB 3IFPB 2D31A 4LKXB 2W0FA 1MFCL 5CJOL 1JNDA 3QSKB 2J2ZA 2VERN 4YIQA 1F90L 2R4SH 4B9YA 1RIVL 3QQ3B 1BLNA 5E8NA 2QQKH 3G9AB 1J05B 2VKWA 4WGWB 2UY4A 2FIRT 1QBMH 2X4NB 2HVJA 4JE4B 2P8PB 1SVCP 4HGWB 4X7FC 4YK4C 2BDNL 1A7OH 3FZUC 4ONOA 1G9HA 2QEJA 4Y19A 5JW3L 4LIQH 4Z7NF 3E2HB 1GHFL 3BD3A 3L6FB 3L3KA 5TF1H 1H11A 4NC1E 4ZDHB 2ZUVA 4LSPL 3NCCB 3P9LB 4MA3B 5I2UA 1AFVH 1HHJB 1AI1L 3THML 4NBZB 5JUEL 1BVLA 4M6AA 4F57H 2ZCKL 2GQHA 4KJWD 4AMCA 1E4JA 2A77H 1CG9A 2FX8H 3OHXB 5IK3B 3A22A 5BS0B 1MREH 2EEAA 2FZ3B 4BQBA 1JPTL 5KVFL 2P5WA 4I3SH 1FGNL 1W1YA 3BUIA 5ID1B 4TTDD 5J9PB 3MGOA 2D23A 2QQQA 1MCOL 4U7MA 4X0KB 1R34A 5DRXA 4YDJB 5E8PA 1C8XA 2BCKB 1I1FA 5DJDB 5HGDB 2WHJA 3EMQA 3AMGA 3BRGC 3QEGH 2FB4L 4PGDA 3L3IB 1R3JA 4NQVB 4GZEA 4FMKA 4HUUB 4Q9QL 1G7MA 5HDLA 1UKSA 2KUTA 2JK5B 3T2NL 3H7BA 4U0RB 4WWKB 4H1LG 1D9KC 3AU1B 2CETA 3BYYA 2YZ8A 1A6PA 3PWPE 5A6SA 2HKFL 5E6IB 3QOKA 4DFIA 1QFUL 1FLRL 3HMWH 1KIQA 4PJ8A 4ZUSB 5TDNA 1D5BB 4KV5E 3FQTB 4QDMA 1GJIA 4ZG1A 2BHYA 4QCEA 2ARJA 4DVBA 3VU2A 3CHFA 5I74C 3TIEB 2JIXD 5IB2B 4D0CA 3KL0A 5DJ2B 5BXSA 1WISA 4MB4A 3PHSA 5BS0D 1JIBA 1IM3B 1J1PH 4LSRH 3U9UB 4KK5D 2VXQL 1KPUB 3LN4B 5JW3H 1HF6A 4PYGA 3RJDA 4MQXC 4DJMA 4DQOL 3D0VA 4C7GA 2X4PA 3HMXH 3WDHA 2VZOA 1B0GA 4MDPA 5L0QC 4N9GB 5FCUL 3JV5A 4OJYA 4CD4A 5J6HB 1AXSA 4XNQA 5SWZD 3LRLA 4OSUL 5HDBE 3A23A 1RZJL 4QHLB 1UENA 3PJSA 3IFLH 4PR5A 3WV0A 1RK0B 1UH3A 1VKXB 1KELL 1YEIL 3EMZA 1C1EL 1G9NL 3G6JB 1I1AC 1NH6A 1G7LA 1IC7L 1OCWL 1XGUB 4TUKL 2DF3A 5I0ZA 4UDUA 3EYVB 4UNIA 4ODUB 2WYSA 5C2UB 4PGJA 4LHUB 5DFVD 4PGCA 4G6JH 4BSWB 2ESVA 1INEL 2UZIL 1QPPA 4S2SB 3AIBA 1T20A 1KTDB 1CBVL 3FB7A 4KRPC 4OGXH 3BQUB 3MBED 3LPGA 3RGHA 3T0AA 1S3KL 1I7ZB 3SQOH 5KS9E 3UYRL 2J12B 3GO1L 4Y2DB 3LKPB 2ADJA 5H2BB 4CJ0A 4WDIB 1WBZA 4GG8A 3VIFA 5DRZA 4EJ1C 2F19L 2WVSA 2VX6A 2P24A 4WTXA 1T2XA 3P4NB 1ZHBA 4ZEPA 1VF8A 3WUWA 4GAJL 4GFTB 2WC4A 2H2PD 2YXFA 3M1BB 2FECL 4BZ1L 1U3HA 1EBPA 3PGCA 4UU9A 1T0PB 2W91A 2RAMA 3WY1A 3B6SA 1M4KA 4FFZL 2K7QA 1MNUL 5BV7C 2ZX7A 2B20A 3KLSA 1MRFL 5F1IB 4PMDA 2XA8L 3TYGL 1K4CB 1J0JA 4UNVA 3ZKMD 3U2SB 5MP6L 1KTRL 4JZ5A 4LGRB 2V3DA 4OZIB 4M7KH 1YY9D 4LHUD 4S1RL 2OMNA 5INCA 3TPKA 4JHOA 3HE7C 2BVQA 1ADQL 1CXLA 2VDML 5IMMB 1LG1A 2ZUUA 3A67H 3S5LG 4HZAA 3T1FA 2XVLA 4LX4A 1LQ0A 1CLZH 4F7CB 1MHHB 2FGZA 1WZMA 4P2CG 3AMCA 3BQUD 5F8RC 2N4IA 3SE8L 2CJUL 4N0YL 3BXWA 1YEIH 1PLGL 1KIPB 2DQCH 3DX1A 1CXKA 3QA3B 4P5TB 4B5EA 5DJYA 2XPKA 4DGVH 1FV1B 2W60B 1T5XA 1E6SM 4PMXA 1H3UA 4QTIH 1INEH 2UZIH 5DHYB 3U0PA 2A6IA 4TTGA 2EC8A 3LS5L 4WK9A 2ZSVA 2NTFA 4P2RB 1U6AH 4Y4FC 4JPKL 1SMOA 1S7VB 4KTEH 2G60H 4OM1L 4WEMB 3U0PB 4BH8A 3KPOB 5FUOH 1G9MC 2VXSH 2XFRA 1CLYH 4Y5XA 4P9MH 3NCYS 4NWUH 1XGYH 3T0ED 3I75B 5EG6C 2UY7A 4XNUH 1S7VA 4GKSA 5F96L 3SN6N 3QB7C 2IAND 3HMXL 5C3TA 2JCCA 1EDTA 2IBGA 4KK9C 2YL5A 2EYTB 3BQUC 1HKFA 3DVGB 2A83A 5EU3A 2IPTH 3PGDA 4NO2B 4B50A 3F8UB 4XAWH 4O5LL 5JIKA 1JF1B 2P42B 4GRLC 4TOYL 2X9XA 1KCVH 4K3GA 5T3XH 2DIJA 2PTTA 3NCJL 1A3HA 1DEDA 5T1LD 5JOFB 2ZCLH 4QTHA 15C8L 1MRFH 3QUXC 1EERB 2VJXA 3BIAX 3EYSL 4KRTA 1RZ7H 3T1FB 1IAII 5IMMA 4PRPE 2OSYA 1V0MA 5D8ZA 4NQCA 4Z2HA 1J10A 4JHAH 3OKEA 3H8NA 1Q0XL 5M5DA 5FEBA 1NGWB 4LRNL 1IM9B 3QQ9C 3U2SA 3BPNB 3OGVA 3MV7D 4RMVA 4UI2A 4P4KA 5ICYA 1KB3A 3SQOL 1JFHA 5KSAD 3OR6A 3S7GA 2R2HA 5J12B 4POZC 3S88L 1A6UH 2RHEA 2WBJA 4PTVA 3RI5F 2CRYA 2UWEF 4QRPD 2ADJB 1SQ2N 4OZGE 4P5TD 1MAKA 4HK0A 3NSNA 3FT3B 3QHZL 2F61A 2P24B 5GSVB 3CUIA 4HK3J 3MCKB 5DC4B 1PSKL 5H2BA 3B9AA 1UA6H 1MF2L 4K55A 4JFHD 1MFAH 1JFQH 3B8YA 1I1YB 1MNUH 1B0WA 2WUBH 4XGZA 4PGCB 5I5RA 2ZOKA 3CC5B 2V17L 3BQUA 4Z7OE 2D3VA 5EUOA 2PO6B 2MPAL 3FB7B 3NSXA 3G6JA 3ZKND 3HNVH 5EU4A 3H3PH 4PR5B 4LHUA 3B9EA 2ZKHL 3PJSB 2QADB 3ARRA 4UMGA 5DHVB 1MVYA 1FFNB 4WUKH 4M61A 4BS0A 1AXSB 5EZJB 4PGBB 5E70A 2APTA 1G7HB 3RZCA 3WMSA 3L5JA 4YHIB 4N9GA 3SOBH 4QRRE 3UTQB 3TBVB 1CICA 1DBAL 3CK0L 5I75C 4KKBC 5E2UH 2UY3A 4ALAL 4PN2A 3D39B 3MBXH 2HFFB 5HPCA 2NLJA 4O2FA 3SDXE 2J8UE 5FYKU 5C0GB 3VXSE 1QSZA 4EI5C 1PIFA 1J5OH 1QFWI 2NY3D 4PBXA 3TIEA 5FB8B 5IV2A 4K9EC 5FHAL 3SCPA 3FB6B 1CXFA 3CCHB 4OCMC 2JALA 1H0DB 3QIUD 1NCWL 2EDLA 2BRRL 4KK5C 5T3ZD 2YA2A 1CL7L 3BAYA 3HTLX 4AH2A 5IB2A 3D25B 3OKMA 1QRND 5DJ6A 2DIEA 4UV7H 3MRHA 2LV4A 2VCAA 1GOWA 4JQXA 3E6FA 5C0BD 1D5MB 3LS4H 3F7RA 5IOPB 4KH2A 1RFDH 1XIWC 4QLRA 1N2RA 2FX9L 3DHUA 1RJLB 2A6KB 1B4RA 4UDTB 3S3JA 1M7IB 2JK5A 4UFIA 2X10A 2EXWC 4NHCH 4H41A 1MFDL 2IFGA 3QJFA 1H15B 2V5SA 5I73C 4IDLA 3MV8B 5IT2H 2N7BA 1JPSL 4GZJA 4I3RH 1YEJL 5E8PB 2VDOL 3VRLF 4TSAH 3PZVA 3MGOB 2YN3A 3FQXA 4XPFH 5D6DA 3L3IA 3U7AA 4PD4J 4KK6C 2MHAA 3S37L 1E4MM 1JJUA 4D6FA 4W5ZA 3RZCC 4KJYA 2IFFL 4Q2ZB 4YDJA 5TE4L 4X0KA 2CHOA 3RRQA 5J9PA 1E6NA 1UCBH 3QDMA 1YMHB 5ID1A 3FB8B 3WQVA 5GJSL 4U1JB 1NSNH 4HF5L 1IKFL 1B6DA 2C4FU 2HTLC 4NT6B 4LEXH 4J27A 1DBAH 5BS0A 2D9QB 4XTRC 3L3KB 3L6FA 5EU7E 1DUYA 5ID0A 3SGKC 1I8MA 4L9DA 4LCIH 4H8HA 4X6CA 1NCNA 1TZIB 2FX7L 1PFCA 1N0XH 3GMLA 2M8XA 5D9NA 5IG7A 3BX7C 2IPUK 4XP1H 5CEZD 4KXZH 3QUML 4MWFB 2OYLA 1U8IA 1XZ0A 1I85C 1PW3A 4CMHB 5I1HH 4UQ9A 1TZGL 4NKDA 3WKZA 4PRNA 3MLSH 4F7TB 2JCCF 2FJHB 2CDGA 4NRXB 1IGYA 4LKXA 4OFKA 4LPCA 4KI5D 2CXGA 4K3DL 4KKNA 4F37K 2AP2A 1MCOH 1LDSA 3X11B 4MDIB 1U8KB 4LVEA 3OB0K 4YH6A 5C0AE 3ARDC 5E8NB 4BM7A 4P2QB 1KXTB 4F57L 4XWGH 4YIQB 3GSVA 3TFKC 4CU6A 4POUB 1NOFA 2X6MA 1NJ9B 2Z35A 3T4YA 1S9VB 5CHNA 4I48B 2D03H 2GEEA 3GJFK 4KVNH 1KCUL 4IIQC 3M8OL 1HINH 3EJYD 3O0RH 1E4XL 3G6DL 1UR0A 4QRRA 1XF4B 2C7UB 1MQQA 2OWXA 4PS4H 1FLRH 1K3IA 1MRDH 3F65A 4Z7WA 1HSAA 3EAKA 4IDJH 2X4RA 4K8RH 5SWSE 3KPSE 3CZFA 1ES0B 3SDXA 3FL7A 2H32H 2E5EA 5DTFA 5ISZE 1CICD 5BVJA 4LSUL 2BC4B 2VXVH 3MRIA 2WZHA 1H3XA 5C0BA 3AJ7A 4OIFA 5BQ7B 4EN3C 4D94A 4OFDA 1IC4L 3PUCA 3IVKA 2XKSA 3Q3GA 4X4ME 2HWZL 1IL1B 1OAXL 5DD5L 1S7XA 3C8DA 4OZHE 4U6YA 1UCBL 2BVUA 4ENED 2O9PA 5GRVL 1JBJA 3ILPA 2JCCE 2DQDH 1LGVA 4IMLB 4AG4L 5JDSB 3S3SA 1TJGL 5F88B 3UP1A 4CNIA 3WD5H 4CCEA 2ZCKH 3O3BB 4J4PA 1ZK9A 2A3EA 2OTUB 2DI9A 3ZTJG 1V05A 3PQYE 4L4VA 1DSFH 3D0LA 3RILA 5DJ0A 4HFWA 1DN0B 2YZ1A 3LQMA 3MLPA 3A47A 1KTKE 1XCWA 4L8DB 4OLYH 5I1JL 4KROB 5GGRA 1C16B 1IEBB 4I77H 4ZAKD 3HG2A 2ZUXA 1ED3A 5FYJH 1K9DA 4YLQT 2R0KL 1YN6A 3BUQA 5T1DL 3HCVB 1R5VB 3VFRA 1TPXB 5I77A 4UUJB 4Y1AB 5KZCB 4AZCB 3V52H 1TA3A 3W39A 4BELD 4ZXOA 1E4XH 2Y4SA 5A2CA 3BGMB 1TVHB 1J1PL 3H9SB 4LSRL 1CVSC 5F6HJ 3V5KB 5ESAA 1VFAB 4GRWF 3BEWA 3QDMD 2F54B 3VE0B 2MJWA 4PJIF 1NWSA 4ZUWB 3UYOD 3AIQA 5AAWA 3O2VL 3DX7A 1D5XB 5EOCJ 1J9CT 2QSCH 4XP1L 5BO1H 1DE4B 3VA2C 1BWMA 3QUMH 4LCUA 1WFUA 1IC4H 3V9FA 2RCSH 4XP5H 4YWGH 5KG9A 3VFNB 3MRMA 1KCRL 1R3LB 5HY9A 3RWCA 3HLAB 4JLRA 3ECBB 1T4KB 4PUBH 5MEQB 1AD0B 2XNAB 5AYIA 5F70A 4DVRH 2UY2A 1LD9B 4X9YA 4ODTH 5C0AA 5C0CE 4Z6AT 3SBWA 4AG4H 1G9NH 3SDAC 1CK0L 2NW3B 5FK9A 1JNJA 3EDDA 5AUMA 1RUAL 4ZTPL 4HTYA 1JN6A 1VGEL 5AC4A 3FFCA 4KI5F 7FABL 2DLTA 4UBDD 4POYA 1RURH 2H8PB 3IJYA 3WLWD 2WKGA 4FLOA 4BZ1H 4NZFA 3WUEA 3P73B 4MZ2A 5D7LD 3GH7A 5HNNA 3WUWG 3TNNA 4AIEA 2G75A 3F4VA 1ADQH 3VXNB 1CDUA 4OKDA 2KBGA 4JG0L 1VB9A 1PKQB 2XA8H 3G6DH 2D2OA 3DV6A 3X3FH 1YQVL 3EBAA 4CW1B 4IPNB 1U2HA 5KS9A 5DJXB 1IILE 3B9VA 4QRRD 2XUCA 3IETB 1PZUB 1L0YA 3O8XC 3GO1H 3BFOA 4WW2F 5CFHA 1NC2A 3MZGB 3QIWA 3RHWF 1QWNA 5GS2H 2VI0A 2WMIA 2ITCB 3ALPA 4CADB 2ATPA 3HZMB 4R2GB 5IROC 2R0KH 1LO5B 4G6AC 4WHYH 2IG2H 2OR9L 5FYLD 1KTCA 3TTYA 2R56L 1EOMA 5D7JD 1SYVB 4OT1L 2WMJA 1MXDA 3SE8H 4ZFZB 4JL1A 2BNUA 2LVCA 1GOFA 3LS5H 2OL3A 4IBLT 1KLFA 4I4WA 4NN7C 3ZT5A 3AGVA 1HI6A 5FYKH 3E6HB 4DUWA 5IHUH 2OW7A 4OBSA 3UXFA 5A2AA 3GMNA 2WNGA 1E6RA 3Q6GH 2D7NA 3UPAA 3FB5B 2DGAA 4PRHE 2YD1A 4HJGB 1N5AB 3KHQA 5F44A 4ZXBD 1JWSA 3LOWA 4XP9H 4OTXL 3SKOA 1JUFA 3WJJC 4BFBD 2PWHA 4N8VG 4W6XB 4WHCA 1KB5B 3Q6FB 1VIWA 3WD2A 1DWFM 4A6YH 3NFPB 3AXHA 2J4GA 3GDBA 1D6EA 3SDAA 3BMWA 4TNVK 4AY0A 1EHAA 1HI6B 3RZWA 5INDB 5KTEH 2IAMB 4M7KL 8FABB 4PCSA 3MLRH 4XI5D 3SDCC 4X7TA 5GZND 1QNRA 3T8XA 4OIIH 2G9HB 4QXGL 5GRWA 2VDMH 4O5LH 4E42A 3SCWA 5I0DA 3QIUB 3UJIL 3EJSA 2A6JB 2VSDA 4I2XB 2ATPB 2XZZA 3VXRD 1E6PA 2ITCA 4OD3L 2C0HA 4XNMA 1ITBB 2X4TB 1KENL 2PTVA 4GW5A 4JY5H 1FO0A 3PWNA 3MODL 2ZCLL 3BZ4B 1DQDH 2NX5A 3MANA 1AR1D 1IAIL 3EJZD 1R3KA 2FO4A 2HG5A 3ARZA 5E2WL 4E41E 2GK1A 1PKQA 1NBVH 1A8JH 1P6FA 3QEQD 4YFDB 4KAQL 4WEBL 3SDXF 5CLWA 2J7CA 5I2IA 5ESVB 4LMQI 3VRLE 4PMOA 1UH4A 1V6WA 1QBAA 1S5IH 1T7WA 3OKYA 1U8QA 4LK4A 4JHAL 4TVDA 4S1QL 5FIPA 5E9DB 2B1AL 4U1KB 2J8UB 2HLFD 5K9QG 1MCEA 3WIHL 5LYRA 2CDFA 4J3SA 5FOBB 3FFCB 1TDQA 2YBRB 4R7NA 5ISZB 4ONHB 3FY1A 3QIUC 1DWJM 3UJJH 3KXFB 2WBGA 4M5ZH 5C0AB 3GRWA 1NMCB 2CKSA 4OD2A 5CSUA 2GUOB 1LD9A 3R8BB 3I02A 2WVUA 2MWCA 4AIZA 1KUMA 3NCJH 5MEQA 5BXFA 4JLRB 3U7VA 3CX5J 3GJFB 3NFNB 3MRMB 1T03H 3EOTH 2B4CH 5JW5A 1GHRA 3S4SG 2HFTA 4XAWL 3C60C 2DJUA 2WIIA 2FHBA 3V5DA 1UB6A 2H2SD 3BH8B 3NABL 1EXUB 3B2VH 1B30A 2AAVA 1DEEB 3O4LA 1S9WB 4PRIA 1ACYL 1MJ8H 2OYKA 3BEWB 3NA9L 2ZKHH 3ARVA 1HKMA 4UILH 1U8MB 3X3FL 1DQMH 3CDFA 5JHDB 1TA3B 1IAOB 1WZ1H 3MLRL 4FNPA 4F15B 3I6LE 5E6ID 3VXUA 4ZFOA 1R5VA 5I8CB 3OKLA 1X6LA 1B0RA 4RFOL 1YN6B 5T3ZL 4FLSA 5EFFA 3VW3L 3JTSB 1NAKH 4P7LA 2IALA 2RGLA 1EGJH 2W1NA 3F7PC 4NRZA 4RZCA 5IDIA 4KMTL 1P9MA 2WBJC 5HBFA 3VH8A 1G5AA 5JW4M 2IEPA 5A3HA 2X1IA 5IBTL 2A74A 4LLYB 1UJTA 2YD5A 4CU8A 3S88H 4YHYB 1HK6A 2FYYA 4HC1A 1BGGA 3VCLB 1P69B 1EAJA 4CVZB 5FFLA 5A2KH 2DRUA 4WGVB 2Q8BH 2F53B 4J23A 4JJHA 1OP5H 3II1A 1ZHLB 3GNRA 4PBVC 3X12B 1GCFA 3HMXA 2ADGB 4HXBL 3O3BA 1UA6L 1I9JL 4M1CC 4ORGA 4OLZH 4M24A 3HZKB 4DOHB 4EKXA 4YHZH 1GZPA 2EJ1A 1JPTH 5KVFH 2YD9A 4IM4A 3TJEL 3IS1X 2OTWA 3MBEC 4HWZB 2W4XA 3CFCH 1H3PH 4HKBA 4S1SL 3KYOB 4KQ3L 1EO5A 5FO9B 2C9AA 1WT5A 5HHMB 1A7NH 1D3CA 1GGUA 3HA0A 4PLJD 3IVKB 2AEWA 2GAZA 2NNAB 1RIUL 3E1F1 5BQ7A 4JY4A 5TF0A 1CE6A 1OW0C 4PJFF 5E2UL 5ANMA 1NFIA 2CMRL 4I3RL 2FX9H 3UAJD 5K9KB 4X6CF 3SDXB 1UWTA 5IB5B 2Y25A 3JWDC 4M8VA 4H8WC 1JWUB 5D7IF 3K8MA 4OZFA 4RX4D 2HLAB 3RP1A 3VGDA 2BJMH 4HKZB 4RGMB 2D4DA 4TNWK 1E56A 1FH7A 2E0PA 2WMGA 2CLRA 1K9TA 4ETQA 4UNUA 4WW1B 3GSVB 1G6VK 1IGML 4R4BA 3VDAA 3MV11 3VWKD 5E6YA 3L95B 3UBXG 1U8KA 3UTSD 4ODXA 2KZ1B 4JHWH 3RVUD 4ONFH 3IKCA 2YUWA 2CUHA 5GRJH 3H9HA 3TCLB 4JZJA 5IM7B 3ET9F 2F8VA 4YPJA 2CDEA 3OR7B 3U36B 1AHWA 4I5BB 5E7BA 1TTUA 1XZ0B 4RA3A 2H9GA 5C07D 3QEQA 4MNGE 2I27N 1JV5B 1B4JH 3U46B 1G7PA 4XCYB 1OAQL 5FCUH 2W9DL 3O4LE 1A1OB 4UFJA 1DDHB 3SHSA 3MV8D 4R4ND 4XHJD 1IC5H 4J3XA 4OLZL 4XPTL 4GAGH 1U93B 4RDQF 2CNCA 4OGZA 4AYSA 5I1LB 5KANI 2A1WH 3DUSB 4HZLA 5H94B 1YPZE 2HVKB 1IARB 5EU5B 5IP4A 1YMHA 4U4BA 5HXMA 4FTVB 3BGFC 5IT2L 1R33A 5TE4H 4PFEA 1BQHB 1WZ1L 2VMFA 1YEJH 5F89A 3ALGA 5IHLB 1IC7H 2CBVA 5ILTL 3Q1SH 1BP3B 1G7IA 1G6RB 4LSQL 4UB0L 3RWFA 3RO8A 2QF8A 4XPFL 3AAZA 4G43B 4K8RL 4LLVB 4G8FA 5CIPB 4C83B 2DBLL 2CPUA 3TN0C 4R97C 2R1YB 1JGVH 3GGWB 5BRZE 1JGUH 4LSUH 4FQ1L 2B2XL 1E0XA 3BO8A 1E71M 5FHBH 5I71B 3QIBB 5DJCB 3QJFB 5CJ5A 2FGWH 2GK0A 1BVNP 4GQRA 2D20A 2JTDA 1KYOJ 3WFZA 4D9QD 4C59B 4WLCA 3ULUE 3MUJA 5EBWB 4XV0A 4UNTA 5JIPA 5AZEH 3S96A 4ZOBA 5IOPA 1BJ1H 1J1OL 1D5MA 1OAKL 2VXTH 3JV4A 5M94B 1EV2E 2ORBL 4P2OD 1FVDB 4QRPB 4Y2OA 1KJMB 5HDRA 3IFNH 1NBYA 1C90A 1TJIH 3OKMB 1JZ3A 5I1HL 3LRSA 2WCAA 1TFVA 3BSHA 3QFJA 1OTTC 3MLSL 4ELKA 3ARDA 3K8KA 3S34H 4KZDH 1OSZA 3KPRA 4ZPVA 3QUYC 5GRJL 4KKBD 4UIMA 5C0NC 4JPIB 4FXGA 2Z31A 1CGUA 2OTPA 1FNEB 2DJSA 5I16A 2F7RA 8CGTA 1NAMB 1YQ2A 1B3VA 4OI7A 4FQXA 5C0GA 3B9KB 4S1RH 2J8UF 2DQFA 3C5JB 3FO2A 2FEEI 5DA0B 4P2QD 5E4IA 1FYTA 3LN5B 2PWFA 3MO1B 4KVNL 5I1CL 1M71A 1J8HD 2VXVL 1UYQA 4JM4L 3MR9A 4U6VH 2CIKB 3B8SA 1NARA 5SWZE 4YQXH 5SWZB 3O3EB 5J57B 4M62H 3WNKA 1FZKB 2AK4A 3L4UA 1CGSL 3WFHA 4P23D 5HYEA 4BFIA 3ALFA 1BFSA 3ZE1E 3PDDA 3ABZA 3RVXD 4WY7H 5EO0B 1JGVL 1RD6A 5E24E 3GHEL 4HKXA 5GS0L 4AMKL 2FCBA 2E7HA 1EZVY 4YO0A 4L4VE 3GM8A 3MA7B 4R6UA 3RWGA 4FQJL 5FHBL 3BW9B 2OLHA 3WH8A 3BUYA 4LMQE 1W9DM 1NP0A 5D1ZD 2WANA 5DRNB 1T0OA 3JZ7A 3D3VE 1XR8B 5B38A 1TTGA 1P84J 4F7EA 4X5WB 2Q8XA 4UR9A 3N1PC 4MAZA 3VPLA 1OTTD 1N64H 4N9OB 1QSEE 1B4JL 2Q7YB 4JFPB 1GCYA 1E72M 1CE1L 3N1GC 1F11A 3O2DH 4H0HB 1HH9A 4Q6IB 1FDLH 3DURA 1U95B 3F7QA 4JO1L 3OGOE 4OUUA 4HULB 2DQUL 4HC1H 5JNYB 1HXYB 4QYOB 5E0QA 1T5WB 3CX2A 3DXAB 1CIUA 5I66A 3VIIA 1B3ZA 3OR6B 3H6JA 15C8H 3BIKA 1QI4A 1KBGH 5IMKA 3ZJ6A 4LASH 1H5BB 2XWBB 1JRHH 1A9BB 2FB4H 1ETZA 5AYUL 5DHXB 1S7TA 5D7KD 3ULSA 1G7QB 3MYJA 5EN2A 5C09D 3LDBC 2JJUA 4R0LA 1RK1A 4NQCB 1UM6H 1A4KA 2PW1B 3O2VH 1A47A 2X2IA 3WQ6A 2VITA 2VLKA 3JV6A 3QXVA 1SM3H 1ZV5A 1UVQA 1WPCA 2H41A 5A8PA 5L2KA 1FP8A 4RGNC 4OT1H 2VISA 5HJ3A 3N12A 1I3RB 1NMAL 4HIIB 3HR6A 5TH2A 4YHML 3OKDB 2J7LA 1UOKA 5CBAA 4OGAC 4G8IA 2ICWB 1CFBA 1XF2A 1KWKA 5BJTB 4PLKC 4WY7L 5EU3B 3BXNA 2RCSL 4OAWB 2A83B 4KKLD 2AJYL 4AYFA 3SBWC 3QUXB 1GQJA 1RSFA 4ZD3L 1OD8A 4XBEL 4Z7VA 3PG2A 5D7KE 2V2TA 1JPGA 2Q1EA 4TOQA 2ZUMA 5CJQH 5GGVY 1JK8A 3G5XB 2BSSB 1OD0A 1R5WA 5IVXF 3KPOA 4L9LC 3CDGA 2V17H 1LK2B 3RY6A 1J87A 4MNJA 1VESA 3LRGA 4FNQA 1Q6FA 1V0NA 1NC4A 5HOSA 3MNWB 4GOSA 2D9CA 4Q9RL 1CF8L 2PF0A 4NKOB 4WHTB 3HU7A 1A64A 4PLOB 4P7QA 1PGRB 4TYUA 1U8JA 3OJDA 3MGAA 2A38A 4FQIL 1S7RB 3V6OA 3MKKA 3W28A 1YQVH 3EZJB 4OLXL 1KENH 3D39E 1PKOA 4OGAD 3HPJB 3STLA 4WFHD 2WMFA 4QF1B 4H8VA 2IQ9L 3KDMA 4N0CD 1EFXB 2HMIC 4YC2B 1ISXA 4P2RD 5CZVL 3LKSB 3IXAA 3EO0A 1A21A 3BAEH 1WIPA 3OKNB 4L4JA 2OYPA 1FQ9C 4QCIA 2AXHA 2IAMC 1RUMH 3HI1A 4WEBH 1YMMA 3RIAK 2YBUA 4XVJH 3WHE0 2WSKA 2YD3A 1UB5A 4FQHB 4OD3H 1EEZA 3SE9L 1S5IL 5F97E 2W61A 4IRSA 5IMLB 1Q4NX 1QX1A 1VADB 4LVHC 1P4LB 4U1MB 5INCB 3WF1A 2YUZA 3HI5H 3GHEH 1MIML 4HS3B 1BYCA 4CDHA 1EZVX 5D7IE 1W0WB 1IAIH 1U8LB 1MLBB 3WBDA 5GGRY 1K4CA 1OSEA 5F8QC 1SJHB 4HPYH 4Y89A 1JXKA 3UDWA 1MFVA 2BVOB 2DN7A 2WZPD 4YHMH 2FYVA 4GH7B 1IT0A 3PZGA 3ARUA 5DFWH 3TT1H 3VO0A 2P48B 2FLRT 4NWTL 2ZICA 4OTXH 4RFNB 1P4LA 2G2RA 4ZXBC 4IRSB 5IMLA 4KK8C 3ZT7A 5E2JA 1OT1A 1CVRA 5D93C 4QCIB 5DRZB 3NABH 1NGPL 3SUSA 1H09A 1GC1C 3EO0B 1T0MA 3D52A 3NDZA 3LKPA 3RVTC 1ZMYA 1NOWA 2F74A 4FQLH 4LQFH 4DO4A 3X3GL 4QRSB 1KELH 5IFAL 1J18A 1QOKA 1TITA 5BMFH 1X5GA 1CEOA 4LASL 1KGUA 5BXPA 2MQ0A 1V3MA 5E4EB 5EU6A 3L5XH 4EE9A 4A2LA 2E3VA 3UG5A 4UQ2A 3FNDA 3T77B 2OP4L 5IF0A 5D96C 1I4FA 5CMAB 4OJFL 4WHTA 4BKLA 3QNXA 2X2JA 4HS8H 3V7AG 1YEFH 3O8XD 1ISYA 1DWAM 4ODUA 1R86A 1U30A 2NZ9D 3S97C 1E27B 3LH2L 1TVPA 1Y6MR 5KSBE 1HKLH 2NZIA 5I18L 2ZXQA 4JZOB 3VFVB 1P53A 4KY1L 1OGAB 1MCFA 4IMKC 3NOIA 3WIIH 2ARJQ 4G6KL 3WNMA 2X4UB 3H9SD 4LLMB 2AJ3A 3EOAB 2H6PB 4PMUA 2ZNXA 1RUML 1CD0A 1FZOB 5J6HA 1NEZB 3TTOA 3ZSSA 4Y16B 5IESH 1NUDA 3FO1A 3QUKB 4G8IB 5CIPH 1YEGL 4ISVB 1HDMB 3U1SH 3NCMA 1LP9B 3MV9D 1YC7A 1CZ1A 5TH2B 4IJ3C 1TE1A 4HIIA 5GZOC 1AC6A 1MJ8L 2I9LA 1Y7VA 4D1JA 1QSED 4FNRA 1MJ7L 3TYGH 1AXTH 5J4MA 5L2KB 3VNYA 3U9UA 3FQRA 5TQ2L 3KWWA 2P4AB 1H3PL 1U8HB 1NGQL 4HMEA 2YLLA 1KLGB 1UM4L 1HJSA 3ZDZE 1JMZA 2JF7A 5C7XH 2WWMD 3QHNA 4KVCH 4G6FD 2ZG1A 4XRCB 3RQ3A 5A40E 1K6AA 5D2NB 1CD9B 3MMEB 4LP5A 3SEPA 5KW9L 4W70A 4HDIA 3RY4A 3A0OA 3IS0X 3VXTA 1H5BA 3HFMH 1OVZA 2NY2D 3WLBB 2FEDC 4NCC1 3FQWB 3MJ9H 2IH3B 5E03A 3JUYA 4PP1C 1AP2A 1DZBA 4N5ED 1W3KA 3MLZL 4F3FB 4DO6A 1NEUA 6CGTA 5DD3L 5FKAA 3HUJB 1JTTA 4OUUB 2NXZC 1BD2E 4P3DA 4WWKA 3WHXB 4D1IA 3EO1A 1W72A 1G7MB 4TN9A 3GIZH 5DEFB 3GKZA 3HI5L 1F2XK 3FQUB 1MCDA 4XXDB 1HSBB 4PP2A 5B8CA 5B21A 3OPZL 3SKMA 1E6JL 3LY6A 1S7SB 2XICA 1E4KC 4X5WA 5I3DA 2GDUA 3WH6A 3DRQA 4LDEB 4NQUA 1HNYA 2R8SH 5DT7A 2ZUWA 4C4KT 1KCLA 4G6KH 4OZFG 1TG7A 4X5XB 4K94C 1FE8H 3I85A 3OHXA 4FNLL 4AQOA 4NO5A 2VDLL 5FIEA 4W87A 1BVLB 1V3IA 5D70H 1T2QL 2W65B 5I1KL 3CIVA 1GC1H 4GO8A 5F7EL 1WAAF 3I3BA 4TOYH 2NY0C 3WFHB 1F6AA 1FZKA 4ZDHA 4Q7DA 4MD5B 1U8PA 4RGNB 4B7LA 5MEPA 4LQFL 4P46B 5EH1A 2X40A 1XH2A 2A2QT 4ZQKA 4DKAA 4OZGA 2QQNL 1E3ZA 1C7TA 2CIKA 2C26A 3MR9B 2X4NA 4NNXA 3IAQA 5GRYA 4BA8A 2W9DH 5LXGL 3U82B 2VO5A 1FYTB 2EH7L 3U48A 2OP4H 1Z5LA 3FCTA 3T0DA 4W88A 2VL5B 4FQXB 4LRNH 2GCYB 3MLWH 3MQIA 4WTZA 1RIVH 4IRJD 3BN9C 2GI7A 4P59L 2PWDA 3CLWA 4PTUB 2Z31B 5JHDE 4HA1A 5GNYA 4NXSA 2XWJB 4L3CB 2Z1KA 3I84A 3KPRB 4ZPVB 5DJ8B 1W9VA 4DWSC 2EIZB 3OQ3B 3DVIA 1C5DB 1MWAB 3C5SB 5DJAA 2AEQH 4ELKB 4EN3D 3QFJB 1J8KA 4LCYB 4U1IA 1C12A 5DT1L 2DSVA 2XJ7A 1CTOA 4J3TA 4ACYA 2DLGA 1EGZA 5BYWA 3WS6C 3HRZB 5EFDA 1KJMA 1UD4A 1MI5E 3GXIA 1L8NA 5LKNA 4AISA 1BIIA 1YDPA 5GS1B 3THMH 1LO4H 3UJTL 4NZUH 4JGJA 5EBWA 3ARGA 5I9QC 3MNVB 3E8UL 5E0CA 2CSPA 4LIQL 2ZWLT 5HHOA 3VX1A 1T3FA 3KPSA 3IB4A 3VFUA 1F5WA 1JF6A 4NUJA 3IDNA 5HGHA 2E8YA 2OW6A 2PN5A 4Q9BA 5CJ8A 4CU7A 4U1GB 4JN1L 4NSBA 4B41A 3GGWA 4UIKH 3KJ6L 1RUAH 4ZTPH 4FNLH 1QNZH 3BP6A 4C83A 3EYOA 1DP0A 4UB0H 4HXAH 3AYSA 3AAZB 3C8HA 4LPWA 3VFTB 3ALXA 3S4SB 5EORL 4FQXD 3QDJE 5MEOA 1R87A 1XYZA 5F89B 2EYSB 5I76B 1V7ML 2XIIA 2CLZA 3D39D 3QZWG 2YMXL 4U31A 4XH2B 2AJSL 4PJIB 5F1SA 2HVKA 4Z18A 3GK8H 3OB8A 3ZL4H 2QQNH 2C3GA 3RZCD 3ZDYF 5D7IB 4FFWC 3B9KC 4TVPD 4WO4A 3MRKA 5E94B 1QYGL 4P8WA 3MBXL 3N04A 5AZEL 1FJ1A 1UJ3C 1W8OA 3QNZB 1TQUA 4ODHH 4JRWA 1JV5A 5HYJA 1CIDA 5J89A 1HILB 2R56H 3H9ZA 1EHNA 1AGEA 1AQKL 4CUCA 3S35L 4GINA 2R4RL 2EXWD 3IU4L 3BPCB 3QCTL 5FYKL 3OMZA 2BRQA 3MRLB 3IKCB 5GGVL 5GJSH 3BZEB 3BP7B 3FONB 4LPUA 2VXQH 4ODXB 4WI4A 4MGXA 5DFAA 3X13A 1D5ZB 4KJPD 3W11D 5A95A 2XG5A 3QDJB 2PB1A 4NF7A 3T3ME 1Z3GL 3C6LB 4QT5A 1E40A 1IFHL 1U8NA 3RWDA 3U6RA 2NXZD 3BISA 4YDVB 5CZKA 2SEBA 4J12A 2CLRB 4WFGD 4NO3A 3U0WH 1UC6A 1BECA 3TO4B 4TQEL 5SX4H 5DZNA 4NQEE 1TMCB 4F9JA 3C8KB 3L3DB 4NQDA 1YNTB 3EGSA 4Z78A 5IBLD 3VGBA 2Q6WB 2EE2A 4C57C 4ERSL 3CMJA 4K3DH 1BZ7A 1N8ZA 5JXAH 5DD6B 5GISL 4MXVE 3N1MC 3QQ4A 3SY0B 3UMTA 4BK4A 2L7UA 5LXGH 3MACH 5L6YL 3D69A 3TJHC 1CGSH 1N6QH 1K9EA 1QLRA 5C0CD 3ZR6A 4U5IA 4U6VL 5DMKA 2DS4A 5F7LB 3VIKA 1BFNA 2GAZB 2L0DA 1EO8H 5JHDD 4IRSD 3FT2A 5FUCC 1I3UA 1CBVH 1EGJA 1HEZB 1CLOH 4P59H 4QGTA 4XMPH 3F6IA 1DBBH 2JJSA 2VYRE 1HHIA 1HXJA 2CKBA 1BEYL 2A73B 1T7VA 4R90H 1MHCA 4TUKH 4HF5H 1NSNL 1A6ZB 1B3XA 4JFYB 1U0QA 5D7LB 1X5KA 3SE4A 5IHSA 3GJFH 3VRIB 3DYOA 2WM0A 2YEZB 5C08D 3U4BH 3UTZB 4B53A 2ZWYA 3BJLA 4ORGB 3WXWH 4N1CA 4S1QH 3LV3A 3MRGB 1N4XL 4U6XA 3X12A 4RIRB 5KBNC 1E73M 1BBJB 1DUZA 1ZT1A 4OF5A 2ZXBA 1F6FB 2HISA 1UKQA 4V1DD 2X89A 2PYFA 3J7HA 5EULV 2VC2L 4Z7WE 5DRWA 1FA2A 1Z9LA 1MJJB 1QI5A 4Q22A 3RBSA 3D18A 4FK9A 1B1YA 1FPTL 2FBJL 5DUBB 3O41B 3BZFB 1LO3H 3G08B 5GQBA 4M03A 1RP8A 7TAAA 2PYEE 3EOTL 3QJHB 1V5JA 4KWUA 1UKPA 3DTXA 4G8GB 3MSPA 5E5RB 5EWIL 2DWEB 4RZCB 3DSFH 5HHQA 2ICWI 1UQYA 1CDGA 4F58L 2QBWA 4M29A 1PG7H 2ADFH 3VXUB 5GGSY 1X5ZA 3IU3A 4GI8A 3AIWA 4JRYE 1J9YA 2L7JA 4FFZH 1W9PA 1W0VA 1N59A 3VXMB 4HA3A 1PYWB 2IF7A 9CGTA 2XN2A 1KB9K 3DBXA 1NL0L 1U8MA 2CRIA 2OL3L 1L9NA 1S7WB 3AREB 3MV01 4LF3B 2J79A 4OM0L 4L1HA 4TVPH 2BVYA 5D7JB 4ZYKB 2FDBP 3WO3B 4LCCC 2GYSA 1S9WA 5CGYC 1J7VR 1MWOA 3RHWK 2YPLE 2F9BT 4H8WL 5ETUB 3P0YL 3TH2T 4GJTB 4FQIH 2JB6A 3LKQB 2QLYA 4OI9A 4GMSH 2Y7QA 3MRDB 3OLIA 1EO8L 2D1ZA 4POZD 5JW5B 4PRHB 5D2LA 3LSOB 3MRBA 3MJ8A 2CJUH 2VABB 4N0YH 5FF6A 5IBTH 3BWUC 3IDJB 2J7DA 4RAUA 1ZBWA 4PJFE 3X14A 4J7RA 3P4OB 4GRWH 3S6CA 2UWFA 4U1HB 5DYOB 1M6OA 1I7TA 1YUHB 2NY2C 4FQCL 4Y4FA 5EIVA 4XCNB 3I3DA 4N8VA 1D6VH 5IEKB 2E7BA 1X4XA 2EDYA 4FN0A 1SJEA 3QQNA 1OM0A 2P8MA 4U1KA 4ZD3H 5CUSH 1F3JB 1QSFB 3RY6C 1KSRA 2W66A 5ERWA 2IPTL 5C0DA 5KSUA 4XCNA 4Y4FB 4TQEH 4HX1A 1KJ2B 2J8OA 3QUXD 2Q76B 4NWUL 1R46A 2DSZA 2HT4C 3CTTA 5FGCE 3RFZC 3WCYA 4CD7A 1R3KB 2HG5B 2XQBH 3D4YA 1MJUH 3RX5A 5MP6H 4QP0A 5GIRB 3FT4B 1UD8A 3BZ4A 3TT1L 1LO3L 1RH9A 1TZHB 2VABA 4DCQB 1FZJB 4HG4J 2X4QB 3K4AA 3G6AA 1N7ML 1LEGB 4JKLA 3VXSB 3MRDA 4XNMB 2XKNB 3D85D 4UFMA 3SUVA 1QNOA 3TH4T 43C9B 3LKQA 2J62A 5JORB 1S78D 2P45B 4L8SA 1XSKA 3PXHA 4HJ0C 4HV8A 2PXYD 2WC3A 1I7UA 2LU4A 4X7TB 4XZWA 5J1AA 1MIMH 3T0EC 3FTGB 4Z5RB 5HYSB 4KJQC 5INDA 4AEIH 1BWWA 1VCAA 3AS1A 2V7NB 4P23A 3DBXB 2I26N 1D6EB 2VDPL 1WWCA 1Q9LB 2R0ZL 4RGND 3TZVD 3NFPA 2X1OA 3L4WA 4GW1A 3FW6A 4OCRL 1SYSB 3Q6FA 3BSGA 2WHMA 3IU3B 3QGVA 1T7XA 5CILL 1JUFB 5D2LF 4O58H 1HNFA 3QIBD 3PZIA 1HKKA 1HQRB 1U6AL 3GSQA 2NY6B 4NQSA 5LWYL 3TA3D 4HJGA 5HHQB 3V6FA 1FG2B 5DO2D 4QXTA 3NZ8A 5BCAA 4D72A 3ARFC 1KJVB 1FAIL 3AZRA 1CLVA 1HIZA 3SUUA 5C09E 2YRPA 2MKLC 3P3YA 4GKNA 4P2YA 4E8CA 5IMOB 4I4WB 4H2CA 1NCAL 1NCDL 4LPYA 4F33A 3D6GA 3TZVA 2PYFB 3KYAA 3FAXA 3AXLA 2WKLA 4F8XA 1NFDE 3EYQD 4F58H 3RWEB 3A4AA 1CGWA 3BPLB 3DDFA 3WE6A 1OOAA 1JAEA 3LAFA 3CX5K 4JRXA 4RMRA 1NM9A 4CMMB 3K46A 1JFQL 5DVOA 4N1HB 2IBBA 3LMYA 4HUWA 5KS9B 1N3NA 2CKBL 1DR9A 1MHCB 3AIRA 4JFQB 5TQ2H 2XQBL 3WEXA 4Z77B 5D6CB 1U92B 3RNQB 4QGYA 3RUGE 2K3TA 2Y6SC 2WQRA 4JAMA 3VGAB 2CK0L 3ZZ1A 1ZVSB 1YNLL 3D5OF 3U4AA 4LSQH 1KWGA 1KNOA 4XBGA 4HWBL 1U3HD 1UQSB 4OB5L 4PJ5B 4ALAH 2DT3A 3MNZA 3ETBF 4LGPB 3M07A 3PF2A 2NW3A 5T1LB 3VFOA 3BRFA 1CICC 1IT9L 3MSGA 2P1YA 2PCPB 4L5FL 2C8NA 4AIUA 1B2WH 3FN9A 2XACC 3PWUA 5C3LD 5DQDL 5DO2C 2VDPH 1T21B 2XFXB 3MV9B 3ZKXC 2AV7B 3VFNA 2RBLA 1GHSA 1BG4A 5F9WC 4AW7A 1MJ7H 1AQMA 1V3HA 1AXTL 4EI5A 4HZ6A 2QHLA 4M4RA 5C0RL 1EHLL 1S7QB 4NO3B 4UQ3B 4HJJH 3RWDB 2Y06L 4MAUH 3WQ8A 4MB5A 3AHZA 3OPZH 2IADB 4G3YL 4ZUWA 4LARH 1D5ZA 3QPXL 2FHCA 2UUDH 2F54A 4UV7L 3VE0A 4KJQD 3UR8A 1VFAA 5I15H 4KZDL 3ARDD 3FONA 4KU1A 2X05A 1KCKA 3H9SA 3RU8H 3VGHA 3VWJA 1Y0LB 2H32B 3AMKA 1JNLL 4DAGL 4X98A 5T3XD 1FE8L 3KPPA 2AI0H 5DC9B 3MLZH 4XB8A 1YMME 5D5MF 5F7EH 3AHVA 1C92A 1WTLA 2V7HB 4P2OC 1FJ1B 3QO1B 4Z7VF 5F7DB 2XI9A 4RBPH 5T1MB 2XY2A 3JXAA 4LNVA 4YHPA 4L8DA 1LE5A 3GMRB 2O61A 4R97B 2YA1A 4YPGA 5GRVK 4M62L 4KPHL 2OMBA 4KRPB 5IFJB 2HP4A 3O11A 3EYFB 5DJZB 3H9YA 3UBXA 5IB4B 2JEPA 2AEQL 4O58L 4HUKB 1JFXA 3CO4A 5DT1H 1NQ6A 4FTVD 5HVFB 3VFPA 3CLFL 4XX1G 5DZOA 3MLWL 1S9XB 1XH3B 2IUZA 5E8EB 3VIPA 5D1ZA 4CNIB 4RISH 1ZEAL 1L9MA 1VPOL 5JDSA 5T3XE 5HGHB 2YD6A 4B7IA 3W5MA 5GGUA 5LGHH 4M5YH 2HJLA 2XKUA 5HDQH 5IJKC 4U6YB 4WU7B 3AXIA 1B6UA 3HPLB 1Z0MA 1ZS2A 3MNVA 4OI8A 4BQ8A 1N64L 4CKVX 2HTKC 4OFYD 3S3PA 4B3LA 2P8LB 5BV7B 5HVHC 1FVEA 4WJ5A 5FO8A 4GMTH 4OV6F 2XG9A 3WIFA 3QFJD 5K9OA 4PJHA 5ICZB 3UBXI 3PXJA 3F6LA 1XD0A 4R5EA 1A6VH 2YIHA 5DJAB 5EORH 4EBQH 4M7LH 3QUZA 1WP6A 5J6GB 2D03L 2EIZA 4HU8A 3B3IB 3D3VB 2V3GA 4PY7B 1KXQA 2ILLA 1JNLH 1JGEB 1RQ5A 3CZSA 4HIHB 2OLDA 2R0LL 2Z35B 3AS3A 1AY1H 2NW2B 1OSPL 1XR9B 5AYUH 1RIUH 3PWPA 3UO1H 2FR4B 3BVXA 1XAUA 4NCC2 1QEWA 3IT8D 3TBYB 1EMTL 2FECI 5J3HD 1I7RB 4DWSA 2W62A 3FCTB 3WL0A 4NM4L 2UZYB 4AD1A 2CEQA 2NY1B 4GRWB 3UTSE 4P0DA 3VXOB 2F7QA 4YDLB 5SV4A 3KJ4C 2GJ6D 2E9BA 3UJTH 3WS6A 1IGYB 4JFOA 1ADQA 5DQDH 4PRNB 4XPBL 4DKEH 2R4RH 4FNTA 1IQDA 3WLWC 2OR8A 3QCUH 4FQQB 3W2DL 1OGSA 3SCMB 3MV7E 2QSVA 2VZ3A 1BFTA 1TJGH 4YNYB 1Q8MA 4MHHI 1T2JA 4F9LC 1DUYB 1AQKH 1KQZA 2BNQA 1L7TL 1VPOH 3CZEA 4M1RA 1S8DB 1S8DA 3CUJA 1RUKL 4QNPF 3FB8A 5GXBB 1TCMA 4Z2LA 4PTXA 2JE8A 1BVKB 1V7MH 4H5SA 4L3ED 2AABL 4UIKL 1M1SA 1S7SA 2AS5M 1T22B 2W0LA 3RDTB 3ZL4L 2UVEA 3MRNA 4FQQA 5I1JH 5DEFA 3FQXB 3QXAA 3O6FC 4J3VA 3AVEA 2V9RA 1OP5K 5IGXL 1DSFL 3QWQB 5HYJE 4NFDA 5TDPB 3C5ZB 2C4FT 2AJVH 2XWDA 4H20L 5EBMB 4EBQL 4F3FA 2IXVA 3CHDA 1P1ZB 4ERSH 4XMPL 3AISA 4PRPA 4PV9B 2IQ9H 4QRQA 3OIHA 3WLBA 2F8OA 3V4PH 1JTOA 4XCCH 4FABL 3VUPA 1I7RA 4K2UL 2HKHL 2R1WB 2AXJA 6TAAA 5K33A 4PD4K 1HHHB 3E6FB 1N6QL 4Q0XH 4QXWA 2D22A 3MMEA 3GXNA 2BSED 4UQAA 5C0FA 1JGEA 1N4XH 5E6IC 1KLGA 4PJ7F 1G0XA 1A9EA 3UC0H 4YUEH 5FUZH 5BO1L 4E41D 2YKKA 4OZHB 1H0DA 3CCHA 1CDIA 5HDQL 3KL5A 4DW2L 1IGTA 2DLEA 2RB8A 4ZOEA 2YSSB 3WD5L 4Y8DC 3NTCH 4PUBL 2F58H 4R26H 5FO8B 1N5YL 3P2TA 1NGXA 1J1XL 4KHXH 2XGBA 3MUIA 2P5WD 1E28A 2BNRE 3AS2A 3B83A 4NWTH 4TRPH 4Z0XA 4G5ZH 2ORBH 1GOHA 3FO1B 3IDIB 2R2BB 4Y16A 4L29B 4AT6A 1LWHA 4WU7A 4OQ1A 4EXPX 4GO6B 4JM2B 4HAFA 4X6FA 4TTUA 2X4UA 4FFYL 3QHFH 3V0VA 5LJYH 1CWYA 2VH5L 1CLOL 4PGBA 1UWIA 5E8EA 1NCTA 3EYUL 3P4MA 5LVEA 4QLJA 1ZA3B 5IKCB 1E4IA 2OK0L 4MPKA 3DSFL 1UD2A 4JZNB 4OF3A 3DO3A 5GNZA 1GSMA 4QY8B 4AZ8A 2CXKA 4LCWD 1RUQL 4EQ2A 5IFJA 1HHGA 1GONA 1KEML 5IF0B 1G01A 1OGAE 3A5VA 4PRIE 2DTML 1EFXD 3PTKA 5EU6B 4DWSD 1T1XB 1MI5D 2PO6A 2J4WH 3ARPA 3RKPA 5BOPA 1NL0H 5CINL 4BQ9A 1NCCH 1B3WA 2DAVA 3IGUA 4XGZB 5E1AB 4QRSA 4YQXL 5F7DA 3L4VA 3TO2B 4P4KD 4ODSH 2OZ4H 3DIFA 2V7HA 3WXWL 1KN4L 1KXHA 5E8DL 4Y5XC 5I8EB 4RGOL 4XX6A 4MJ5B 3VDHA 3LIZL 1E43A 2EE6A 3KPPB 4Q6YA 1UEMA 5EWIH 5AYQA 2G2RB 1U3HC 1GH7A 5IHZA 2ID5A 4AMKH 2B31A 2VURA 3HE7D 3UC0L 5AWNL 4D9RE 1IAKA 1FPTH 3CDYA 4NZDA 3VDBA 1KR0A 3VXRE 2LAAA 4Y4KA 4ODTL 5EUOF 4PSRA 2MCPH 4NRSA 1NANH 4WO4D 3DX3A 4GXPA 4MCYA 4PJBA 5CBEA 5EB8A 1GOKA 4JFSA 2F58L 3AMLA 3N13A 1T0NA 2P5EE 4R26L 1MJUL 4UQ3A 4Y16C 1UWEH 4DEPB 1S7QA 4R9HA 1NGWA 4HS3A 3DX0A 1B3YA 4FQPA 4G5ZL 4XWOD 3OKOB 4PJ5E 1N7MH 3T2NH 2AV7A 4K7PY 2XFXA 3WDIA 2EADA 2VE6A 4LLUA 1XGTA 3OKNA 5KSVA 3IXAB 5ELIA 4U33A 5TQ0L 4OM0H 4TVPL 1MCRA 2NY3B 4QF1A 3EYUH 4LPTA 2V5TA 4MB3A 1DQDL 1PY9A 3GBLA 3MNZB 5EZOH 4XCCL 5CKAA 2HKHH 2EEXA 1EK3A 3BLBA 3ARED 3EUUA 3F5WA 4G6AD 1U8JB 1RUQH 3Q0HA 3KPQA 1N0LA 4LCWB 3LQZA 1LVEA 1A6WL 1SBSL 3NIFE 2DWDB 1IAMA 5EZLA 4O9HL 5LWYH 4PMYA 4P8XA 4HGMA 1QI0A 1E6JH 5F7WC 4HUWB 2R69L 5IWLA 3I75A 3TTSA 1LK2A 4Y5XB 1V8HA 2EDNA 4JRXB 5EU6E 4BH8B 3CUGA 4C4KO 1JK8B 3G5XA 5D93B 4ODSL 1FYHB 3WE6B 3BHBA 5CCKL 1OB1B 1FLTX 2Z0BA 2FIKA 4RE2A 2B5IB 4OQTA 2BZDA 3PZUA 2NTFB 4P2RA 3AXLB 1KCSL 4RGOH 1AGCB 4MXWL 4WI5A 1A6TA 1FIEA 1YNKL 1J0KA 4ZPTA 4FZ8L 2HMID 1XF2B 1DHKA 2APVA 4JO1H 3D5HA 5IMOA 1FP9A 3U0TB 4TX8A 4K94L 3SDCB 3BZDA 3QG7H 1JPFA 3QZWB 1MUJA 1H8SA 2QHRL 3OKDA 5AD0A 1W3JA 4L3EE 1VA9A 4D3CL 1CFSA 5HJ3B 3GUTB 3GJEB 4AEIL 1FG2A 3G6JE 3NMEA 3VM7A 5JOEA 1AKJB 1O7DC 4LVHB 2N1KA 4YFLF 3PIQB 5D71L 1XGRA 4RAVA 1ZBKA 2VITB 3RPIB 4ZO9A 4Q7NA 2CK0H 4OFPA 3HHRB 2CLVA 4G80A 3OAZK 2P46B 3BWAB 3T04D 4PLNC 1Q9LA 3QG6A 1S7TB 3PTQA 2ZWZA 2CR6A 4WKHA 3MI6A 4OZIA 3WQ5A 2J4WL 3X17A 1FBIH 4LRIA 3L4TA 4QAWA 3UG3A 1K8DB 5CZXD 1FNGB 1ZU8A 5IMKB 2BVEA 1TJHH 2QLVB 5E8OB 3N0PB 1TUXA 4XHQA 2O5ZL 4QWWD 2V9TA 3DXAA 4L8SB 5DO8A 2WIMA 4PLKD 5JORA 3VG9C 3W38A 1QHZA 1LP9F 3M46A 1NFDF 1HJWA 1RIHL 2F5AH 3VXSA 2GSJA 3DURB 3G6AB 1ZHBB 5D9OA 3V6OE 4UFKA 2WNWA 1FAIH 3EYPA 2J75A 1LL6A 4WDIA 1B2WL 3MXWL 3P0VH 2P5WE 5JQ6L 4KTEL 1AGBA 1I3GL 5B38B 5FKPB 1BZ9B 1T03L 4OZIF 4PJFB 1G9MH 4JFEE 1JD7A 3I3EA 4O51A 2P8MB 3PP3K 1SJEB 4DAGH 4YO0B 1K5NB 3STBA 1RU9L 2AJUH 3ZDXF 4HKXB 4KQ4L 2B8OT 4O02H 4QHMB 4MVBD 1ACZA 4S2SA 5KJRH 1I9JH 3I6LD 1K6QH 4Z9KB 4BSWA 4U1NA 1PX4A 3CFDA 4OB5H 1I1RA 3EYVA 4UDUB 1V03A 1XGUA 4HFUH 1BBDH 1HNGA 2DICA 5T3XL 4FLRA 1U36A 2VIRB 5KVEL 1G6RL 3FN0H 2Q7NA 3O3EA 5DGRA 3KZSA 1OW0A 3B2UD 1VKXA 2AJSH 4J2XA 4HSQA 1F3RB 3K74B 5FYJD 3ZDYE 1JL8A 3KPLB 4KGLA 4QHLA 3EYSH 2NXYD 4NNYA 3VOCA 2BFVL 4HD9A 2J7GA 1NAKL 2OCFD 4JL2A 2BJML 1XCXA 4KMTH 2YUXA 2WVTA 4YFEA 4ZNEA 1UXSA 5CSZB 4ACZB 1ND0A 3LKOB 4ODHL 4HS8L 4P4KC 2PYEB 4KI5E 3D0VB 1PYWA 4QOKD 5DUPH 5J11B 1FYTD 3DRTB 3S35H 3WS3B 1V3JA 5FUOL 5DUMH 1TJHL 4UIMB 3OKKB 5JHLL 3EJRA 3LN4A 2APXA 4PGZA 2Q8BL 3L2LA 1QW9A 3ES6A 4KRLB 4M5YL 2A3BA 5F96H 2VQTA 4HCRH 1C8QA 1UG9A 5M3WA 1A3LH 1EO7A 4S11A 5FGSA 2Y06H 1A1MB 4MAUL 5DJ2A 1ZA6B 2YXMA 3IKKA 4OLEA 1VFMA 3HZ3A 3WFDL 3G08A 1FVDA 3Q5YA 4GUPA 3UZEA 3O41A 2P5ED 1JGDB 3HG1B 1C5BL 5CP7A 4KTYA 3AZTA 4ONFL 2ZP0T 4WWID 1PG7X 5DRWB 3VXPA 5CS7A 4GAGL 1XMWA 3CSPA 1I3GH 3QDGA 4P2OA 3W27A 1VJSA 3FQTA 2OJZL 5TDNB 3TIDB 1KIQB 3ZE0E 4WUUA 5F21B 3B4NA 3L9RA 5JXAL 2DTSA 3KYNB 4NZCA 1BG9A 3L5HA 1NDGA 1ZTXH 4YHNB 4KVCL 4LDOB 1JZ5A 3NUKA 3KPRD 3BD5A 4LLVA 4XB7A 4OOZA 4OZOA 4G43A 5C0ND 1BQSA 2V6HA 1A6ZA 4RRPG 5BVPL 4PGDB 1LE9B 2ZCHH 3CUPB 1QFWH 3GI8H 4MXQD 2AK4D 4I0CC 5DJDA 2PBGA 1HEZA 4EUPG 3QO0A 3SPVB 1GZJA 3MGTA 1UHVA 1WB0A 4HLZG 4Y0GA 5DMKB 3F7VB 2VZUA 4QHUB 1K2DA 2NY0D 4QFUA 2E27L 2R29H 2BFVH 1FZMA 2IPKB 1TR1A 5IK3A 1CG9B 1QBLL 2ESCA 3QQ4B 3SY0A 3AHXA 2DBLH 4LCWE 5TGBA 2ATKB 5IESL 1NFDA 4F8QA 1QSEB 4FQ1H 3KR3H 1OAKH 1RY7B 2Q6WA 1F4YL 4Z78B 1N26A 2J5LC 5F6IC 5SX5H 4Z7WF 2BDNH 5E6ZA 3PP4L 1QVBA 3UZVB 2WBWB 3U36A 4Y19B 3ARWA 3DYPA 3QXTA 1BD2D 3ZDXE 1WO2A 2FBJH 5CSYA 4PRDB 2SEBB 1NOUA 2P8PA 3MPCA 1TENA 4D6GA 4OZHF 2HVJB 3NIFF 3RJYA 4MA1C 1OAQH <