5CH8A

Crystal structure of mdla n225q mutant form penicillium cyclopium
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
270
structure length
270
Chain Sequence
DVSTSELDQFEFWVQYAAASYYEADYTAQVGDKLSCSKGNCPEVEATGATVSYDFSDSTITDTAGYIAVDHTNSAVVLAFRGSYSVRNWVADATFVHTNPGLCDGCLAELGFWSSWKLVRDDIIKELKEVVAQNPNYELVVVGHSLGAAVATLAATDLRGKGYPSAKLYAYASPRVGNAALAKYITAQGNNFRFTHTNDPVPKLPLLSMGYVHVSPEYWITSPNQATVSTSDIKVIDGDVSFDGNTGTGLPLLTDFEAHIWYFVQVDAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lipase-Driven Epoxidation Is A Two-Stage Synergistic Process
doi rcsb
source organism Penicillium cyclopium
molecule tags Hydrolase
molecule keywords Mono- and diacylglycerol lipase
total genus 91
structure length 270
sequence length 270
ec nomenclature ec 3.1.1.-:
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ch8A00
1QIDA 3Q8WA 1EB9A 1ORWA 4IQ4A 2FJPA 2DCMA 4FHZA 1AMNA 2DR0A 3LP5A 3EIOA 3FAKA 4J0JA 1IUNA 4ROTA 1JI3A 2XUAA 3HABA 3WL7A 1WOMA 4B80A 4M0FA 1ETHA 2WKWA 1IMJA 3D5EA 2V97A 3G8YA 5LP1A 1UOOA 4LIPD 3IURA 1U4NA 3T52A 3MUOA 4EB0A 3KWJA 3QYJA 4ETWA 2H9YA 2CJPA 2WTMA 5C81A 1JMKC 1LLFA 2NW6A 3KWFA 2HA2A 1AGYA 2WFLA 3I2JA 5IVIA 3D2AA 2G5TA 1DTEA 3V48A 5CT9A 1K5PA 5ALEA 3I1IA 3WQHA 2XUOA 2QJRA 3OTQA 3OG9A 5A71A 4QZVA 4X91A 3PI6A 1E8DA 1QONA 2XQKA 3PDCA 3G9TA 3A2LA 4B7ZA 3IUMA 4CCYB 2XUKA 2ZJFA 4N5IX 4H7KA 3DEAA 2UZ0A 3LS2A 5JZBA 3LCRA 2DQYA 5A7HA 1JU4A 2XQFA 1WHSA 4Y2VA 5ALYA 5ALTA 1EXWA 4BVKA 2WIJA 4H77A 1N5MA 1XKLA 5FKJA 4GXNA 4HRYA 5JATA 3DS8A 1YR2A 3I2HA 1EI9A 1ZD2P 1B6GA 1ZICA 2RHTA 4G4IA 2ZYHA 2EDAA 4F0JA 1OCEA 5LLSA 5LIPA 5DLPA 5E4JA 3AJAA 1VXRA 2WJ4A 5AKEA 1SFRA 4KR0A 3HXKA 4S0XA 5CXUA 4Q1VA 3F8SA 5ALGA 5AIAA 3GA7A 1R50A 1GKKA 5JD6A 1JJFA 2O7RA 2ECFA 1W4LA 2JGFA 3ZPXA 4X71A 3IDAA 1ZD5A 3OPMA 3AZOA 1P0QA 5D3KA 2ORYA 5ALXA 2OGTA 1N5RA 2X76A 5AM1A 2PSDA 5AKXA 3H19A 1XRLA 3PUIA 1UT6A 4F5ZA 1XLWA 1H2YA 2GZSA 2XLCA 3ICVA 2GYUA 4UFPA 2ZSIA 4WDQA 4GECA 3C43A 4FNGA 1MNQA 3GELA 4EY7A 1TRHA 4U2EA 5A2GA 3A70A 7YASA 3IIIA 4Z49A 3H04A 2QVBA 2IIVA 5D6OA 1YCDA 1ORVA 4Y9SA 2WSLA 2EEPA 4HS9A 3L1IA 1HLGA 2HFJA 1LPOA 3FYTA 1XQYA 3FOBA 3BDIA 4BVLA 3V9AA 3H18A 5CH8A 4BE9A 3O9MA 3HSSA 5CW2A 4KYVA 2CEKA 3EQ7A 4D9JA 2ZSHA 2OXEA 1SCKA 1HPLA 2ES4A 3V1LA 4I3FA 1XZAA 3IB3A 1RWQA 5DTIA 3AILA 5ALDA 4X94A 4WY5A 3G7NA 3C5WP 1IZ8A 2O7VA 1T2NA 2RAUA 3QM1A 2R11A 1XRMA 3C6YA 4C4YA 2ACKA 4CIAA 3RK4A 1CUBA 2I3ZA 2Y6UA 3STYA 4J0CA 4BZZA 3SK0A 5HQ3B 4RE5A 2WILA 2XUPA 2JBWA 1LZLA 1EB8A 3WL5A 1CUJA 3FLBA 4BRZA 1QOZA 2RGUA 5HKBA 2HRQA 1Y7HA 2CUTA 3DL7A 1USWA 4ARAA 3QPDA 4LYEA 2BKLA 3DYVA 2XMRA 4J0IA 4C88A 4K2AA 1UOQA 2H7CA 1EDEA 1Y37A 4FFWA 1Q84A 3AFIA 3H0CA 1CUSA 1O6FA 3PE6A 1MX9A 3CN9A 4UHBA 4DM7A 1SC9A 3E3AA 1O6GA 2PUJA 4BCDA 3I28A 1BCSA 2QT9A 4G8CA 2WUGA 4H35A 1PFQA 4B81A 4DNOA 2ONCA 2ZYIA 1AZWA 1VXOA 1UFOA 4KAFA 4DLNA 5SYNA 4BTLA 2QUBA 3FBWA 4AO7A 3WK7A 3HRHA 1GQSA 2ZYSA 4CI9A 4DMFA 3WZMA 4Q34A 3WKAA 2HA6A 2WFLB 5A7GA 4OSEA 4AO8A 4OUKX 4X85A 2PVSA 3I1YA 4K6HA 5ALMA 3KDAA 5C8ZA 1DQYA 4M0MA 1XZKA 5AKJA 3FSGA 5T4EA 3C6ZA 4ZXFA 3ESBA 4XX1A 3WWPA 2VA9A 4DNPA 5CTAA 2HU8A 3GUUA 5T4BA 5HFNA 4NVRA 1GXSA 2HA0A 3WWEA 1QE3A 2CB9A 1J2EA 3EQ9A 4AN1A 3HLKA 1ZIYA 3R0VA 4GHWA 3F96A 1X2EA 1OXMA 2HHAA 4LXGA 1NX9A 5AI0A 2B20A 3MGAA 2JF0A 4NMWA 5HZGA 1DWOA 2XE4A 2PUHA 5DYTA 4DMHA 3S8YA 3OOSA 1ODSA 1BCRA 3QMVA 2PSEA 3GBSA 2WHPB 5CH5A 1UK9A 4J0HA 5JAHA 4U2BA 1RP1A 1GZ7A 4AX4A 1WB4A 1THTA 1CRLA 5JAOA 5LZ5A 1KEZA 3WA7A 2X5XA 1GGVA 1QO9A 1JU3A 5C7YA 1CUFA 4H7IA 4Q3KA 4N8EA 3FLEA 3TEJA 3DNMA 5FUMA 2PSFA 2RONA 4C4XA 2K2QB 5DYYA 4JYPA 3SWWA 1GPKA 1XZDA 5HF8A 2XLBA 4QLAA 5EHXA 1AURA 4BTVA 4ZWNA 5HF5A 4ZGBA 2YASA 4WFKA 1J07A 2AJLI 1QO7A 3F97A 4OB8A 1MPXA 3C87A 2CKMA 5CBKA 4PV7A 1RYYA 2HA3A 3K2IA 4HXFB 1H2ZA 3R40A 4ZV9A 4J03A 4B83A 5EHZA 3I6MA 1YS2X 5FXMA 1CQZA 2QRUA 5FP0A 5CRIA 4NS4A 1LPAB 2Z8XA 1ISPA 1Z68A 4UBIA 4DMCA 1C4XA 2DFPA 1A8SA 1QIEA 4UBMA 1XZGA 4U2GA 5C8VA 5T4FA 1BU8A 2WIFA 3PUHA 2OCGA 1LPPA 3G0DA 1XZLA 4QWWA 3HYSA 4GWLA 2XUGA 5AK4A 5LZ8A 5EGNA 4UFOA 2Q0XA 3FNBA 2JGMA 4B9AA 4OPMA 3R3VA 3WLAA 4YPVA 1ODTC 1IUOA 3TRDA 1Q83A 3IUJA 4BYMA 1YASA 2ZJ6A 2BCEA 5F4ZA 3BJMA 1FFAA 3GZJA 5AHXA 2OCIA 3ESCA 4FKBA 3T4UA 1LPMA 4PNZA 4HZGA 4B0OA 5A6VA 3I6YA 2C0QA 4X3CA 1EX9A 3U1TA 1VOTA 2AJ8A 2XMBA 1I6WA 4XJVA 4FWBA 2EDCA 5AI8A 1AX9A 4LXIA 5K3FA 4C87A 3SC2A 3W05A 1WHTA 3HI4A 5FPPA 4X00A 1XQVA 4BZWA 5ISMA 1K63A 3BDVA 4ITVA 4ZV7A 2DHDA 4Y2UA 2OQVA 1DQZA 1JJIA 5DNVA 1BE0A 4KAJA 3VXKA 1Q0RA 3WYDA 4AXBA 2BUAA 4EHBA 3NWOA 5ALQA 3V1KA 3WJ2A 5AI6A 1MAHA 3E4DA 1YS1X 4WCVA 3ICWA 2HU7A 1EVEA 1TCBA 3AZQA 3WKDA 4QLOA 4C89A 4Q3LA 3WMRA 4FOLA 1ZGBA 3H1AA 3W9UA 1ACLA 5EHNA 3B5EA 1U8EA 2I03A 1JMYA 1GPLA 3IUQA 3HZOA 5LKAA 1CR6A 1JFRA 2ROQA 1BEZA 3C5VA 4P9NA 1YB7A 1WB6A 5HCUA 1LPSA 3BJRA 1XLVA 4H7FA 4UUQA 4EUSA 2XUJA 1J1IA 4EY5A 2YH2A 3QPCA 5IVKA 4JUIA 1ZGCA 2QZPA 3I2FA 1VA5A 5DNWA 5ALUA 2WLSA 3E1GA 1QIJA 4AO6A 5D7BA 2PM8A 6YASA 1JJBA 1H2WA 1UK6A 2QXTA 4FMPA 4MYSA 5ESRA 2E3JA 3FWHA 2WM2A 5EIEA 4W9RA 4BAUA 4N5HX 4GDMA 4NZZA 1G42A 1K6EA 3WL6A 4EA6A 1F0NA 2WHPA 1ZI6A 4OYLA 1CUDA 1MJ5A 4H7EA 1F6WA 2FX5A 4BBZA 1XZBA 1GKLA 4QNNA 1WCYA 2GBIA 1PV1A 1LNSA 1CVLA 1TAHA 2AJCA 4FBLA 3TJMA 4IH4A 4DNQA 1P0IA 2OGZA 4OYYA 1E89A 3W04A 2W22A 1MO2A 1QIKA 5BOVA 4IH1A 3H17A 3L1HA 4UHCA 2BJHA 5AOBA 4AMZA 2I3DA 1FFBA 3DJYA 4YK7A 1MX1A 2OAEA 1XZCA 2QR5A 3CCCA 4J0KA 4TVKA 4BB0A 3KSRA 3FVTA 3WIOA 1DWPA 4BCCA 4CFSA 4WJLA 5JD4A 4G9EA 3G9ZA 4WFIA 4OB7A 1XZEA 4GEGA 1QFMA 2PSHA 2V9ZA 3R3WA 1KU0A 3H2IA 2GBCA 4W1PA 1LZKA 2Z8ZA 5E4TA 2OPHA 1ZJ4A 1AC5A 3PF8A 2QS9A 3FCYA 5LZ4A 3WK6A 3C70A 2J4FA 1FFEA 3EQ8A 4EZIA 2QXUA 4TPKA 1CUAA 3ESDA 5DNUA 3WWOA 1E5TA 3I2GA 4BE4A 1L7RA 3PFCA 3QZUA 4OCZA 3SX4A 2BGRA 2C0PA 5ALJA 1MT3A 1W52X 2G63A 5FLKA 3R41A 5JADA 4B6GA 4E11A 3V1NA 2XUIA 4KE7A 1ACJA 3NUZA 4KRXA 2WG1A 1TK3A 2GZRA 3FYUC 3WK9A 3ZI7A 2AXEA 1LPNA 4WY8A 2ZVDA 2AJDA 5DWDA 4U2DA 1YAHA 2VJBA 4FLFA 4MQMA 5AKLA 5ALPA 1EHYA 3BF7A 4LKOA 1IZ7A 4UBJA 3M81A 2OCLA 1EK2A 3VVLA 1AUOA 5CT4A 3C8DA 3O4IA 3H2GA 2FUKA 4K6KA 4X6XA 1CLEA 5JALA 4JYMA 5SYMA 3BE8A 3WZLA 3STXA 3C6XA 3LIIA 5LZ2A 1X70A 4PSCA 2LIPA 4HTAA 1AKNA 3PFBA 2B4KA 3WKBA 3I2KA 4LHEA 4PO3X 5AH0A 3VJLA 1MAAA 3IULA 3G9XA 1OILA 3H1BA 4UHDA 5HFAA 3B12A 4KEAA 3VJKA 4LYDA 1XRRA 1YSCA 5AICA 2QM0A 4FNMA 4AZ0A 5IVDA 1UK7A 5DJ5A 3X3HA 5CT6A 4JH0A 2XQJA 4G5XA 4AZ3A 4DIUA 1MNAA 1A88A 1CQWA 4CG3A 3N2ZB 3VKFA 3HC7A 4K5QA 4ZREA 3DQZA 3CCBA 4XIIA 2Z5GA 3ED1A 3W2TA 2Y1KA 4P92A 5FPQA 3ZV7A 3N0TA 1TCAA 3HACA 4DTCA 1CUGA 4DYHA 4FLMA 4EY8A 3D3NA 1K8QA 2Y2VA 3RLIA 2G4LA 5K5EA 1VZ2A 5E2IA 5KWJA 1TQHA 4I4CA 2V98A 1YB6A 3FYUA 2GYWA 4F21A 5CXXA 5HKAA 1JKMA 4BDSA 4INZA 2VT6A 1JT2A 1CUEA 3RM3A 2PSJA 1CUHA 5BV7A 2BUCA 2OG1A 1A7UA 3H2KA 5BWBA 5ALOA 4K6GA 1WPRA 3JWEA 4Y2RA 5AM2A 4QDUA 3OURA 1T4MA 1E66A 1ZD3A 4OU5A 1XZFA 1HL7A 5KWIA 2C7BA 4XWGA 3FSGD 4B82A 5KBYA 5KREA 4GLBA 2O2IA 4PQEA 4PW0A 2PU5A 1GPNA 3IUNA 5JD5A 1KU6A 2HL6A 1VZ3A 1ZJ5A 2DQZA 3R3YA 4LXHA 4BDTA 3FYUB 4IH9A 4HVTA 3G0CA 4RNCA 2WIDA 1VLQA 4KE8A 5K3DA 3DL4A 1TKRA 1E8NA 3RKSA 2O2GA 5A7FA 1XKTA 2BGNA 4A16A 1Q0ZA 5AKGA 4H7HA 1SCIA 4G4GA 5AM4A 3VVMA 2XT0A 1QFSA 4I19A 1R9NA 3WWCA 3ZLTA 4W1RA 5ALFA 2QUAA 4L0CA 1FJ2A 4FBMA 1UWCA 2QJWA 4G9GA 2O2HA 2WIGA 1QTRA 5AK6A 5EIHA 1UK8A 5JYCA 3K6KA 4MWSA 4BC0A 3DOIA 1M33A 2VATA 1P0PA 4OU4A 1LPBB 3B3QA 4J3JA 1P0MA 5IH7A 3KD2A 1CUWA 3FLAA 5IKXA 2HU5A 4C4ZA 2WG0A 5AM0A 5I7UA 3ZLVA 1XZMA 2B61A 2Z3WA 1NU8A 4UBNA 2CZQA 5CMLA 3ANSA 4MEBA 2C5GA 2WU3A 1CUZA 5HK8A 3ANTA 4O08A 4X97A 4KRYA 3NGMA 3V1MA 4E46A 1EH5A 2HA5A 3CXUA 5AJHA 4DGQA 3GROA 1VE6A 5I8PA 1CV2A 1HBJA 1VJ5A 1YAJA 4U2FA 2DHCA 3BIXA 3UMJA 1F0PA 1MTZA 1HDEA 1U2EA 3A2MA 4FTWA 3G0IA 3C6BA 3O0DA 5AK3A 1VA4A 3S2ZA 1W6RA 3BL8A 3H2HA 4ZRDA 1ZI9A 3F98A 1CUCA 5AOCA 5JZSA 2CBGA 3M82A 3DCNA 2H7YA 1X2BA 4FDMA 5LYYA 5HQ3A 4KAAA 2VQ6A 1BEEA 2JGKA 3WJ1A 2JGEA 5JAUA 1CFJA 3MVEA 4PSUA 3D2BA 3UUFA 1VE7A 4OD0A 3C45A 3D59A 2HM7A 2WHRA 3LLCA 4C6HA 5AKHA 4KACA 5JASA 4W1QA 1QLWA 5CT8A 5ALWA 3ESAA 3AUKA 3D7RA 3P2MA 5AI5A 1IVYA 3BIWA 1R3DA 1W75A 5A62A 1ZD4A 2GBFA 3QH4A 4CIBA 2WIKA 5K3FB 2QKYA 5FV4A 2WUEA 2WU4A 1XQWA 1CUXA 2QTBA 3VDXA 1FFCA 3D0KA 1QJ4A 3G0BA 4Y2JA 4Y7DA 1S8OA 3BWXA 3YASA 4X95A 4KE9A 5T4HA 3WKEA 3WL8A 1WPXA 2XMSA 3C8HA 2ZJ7A 4X6UA 1XROA 1THGA 1EDDA 4J0GA 1WB5A 1G66A 2DSNA 1XRQA 1XFDA 4W63A 4UBOA 1FSSA 2XUHA 3QVMA 5HK9A 1Y7IA 5K3EA 2OLEA 2XMQA 1CUYA 2VAXA 5LZ7A 4B84A 3O4GA 1GT6A 5ALIA 4X93A 4UFNA 4UHHA 2VAVA 3R3XA 1HKHA 1DU4A 1N8SA 5CH3A 3AIKA 4BCBA 3O9VA 4QWMA 4B9EA 1MU0A 1H22A 4GI1A 2R8BA 5D3ZA 1CUVA 2BFNA 2PX6A 3PICA 4MQLA 3BXPA 1C7IA 2VJAA 1W1IA 5K3AA 3VISA 4J0DA 1BN7A 5HF9A 5K3BA 3L1JA 1XQXA 2GYVA 4DNFA 2BAGA 3CN7A 4P08A 5AKIA 3K9BA 5IVHA 3G9UA 3LIPA 1CUIA 4ARBA 3WA6A 4TGLA 3AIMA 3U0VA 1QGED 4FFVA 1R1DA 4JEIA 3GFFA 1DINA 2OCKA 4MWTA 1XZHA 2OGSA 3DD5A 4BVJA 3WYNA 1A8QA 4QDXA 1HQDA 3AZPA 1QIMA 2JEYA 3O4JA 4RGYA 4Y2YA 4RPCA 4BC1A 4QDOA 1G5FA 1W76A 2XQIA 5EHQA 1QIHA 1QIFA 3F67A 4H7DA 2Z3ZA 3I6ZA 1XRPA 4DMKA 1EK1A 1SCQA 2JGLA 4UPDA 4CCYA 4A23A 2DHEA 2W6CX 1CEXA 5JIBA 2WFMA 2HA7A 2WFZA 1ODCA 4A5SA 2VJCA 3ILSA 5DTJA 2PL5A 4QDZA 3STWA 4X90A 2JGIA 4DSZA 4AN0A 3DLTA 2HA4A 3ZLUA 5EIAA 2PU7A 4BATA 3O4HA 1LBTA 1MX5A 3A6ZA 5AP9A 3Q0TA 4IHAA 2JGJA 3QBJA 1E3QA 3D4LA 1CIJA 4N8SA 3R3UA 2VT7A 2WQZA 2WHQA 4BAZA 2XMCA 1F8UA 4KJXA 1XLUA 3WWDA 2C58A 1L7AA 4X92A 4MEAA 3G0GA 4H18A 2VSQA 2C4HA 4YASA 1EA5A 5H3HA 4Q3OA 5AIBA 2GBGA 3G02A 5YASA 4G8DA 4L72A 4GW3A 4RE6A 1QTIA 5AOAA 3QMWA 4UBLA 4X7BA 2D5LA 1DWQA 2HFKA 2OQIA 1LGYA 2FJ0A 2Y6VA 2VF2A 5CURA 4MYDA 4HXGA 3E0XA 1DT3A 2CMFA 5JARA 5AKYA 2VEOA 1XZIA 3AIOA 5EI5A 1XRNA 4H7JA 2WG2A 3FCXA 4CCWA 2J4CA 2VJDA 2HADA 2WTNA 3R3ZA 4Y2XA 3IA2A 4P93A 4CG1A 2YYSA 3STVA 2WUDA 4KE6A 5ALHA 2RI6A 4GBGA 5HF6A 4N8DA 1R88A 2IX9A 1L7QA 4HXEB 5JAPA 3IBTA 4Y2SA 4Y2TA 1K4YA 5LKRA 2YXPX 2XUQA 3DDUA 3W06A 5JZ9A 2XDWA 5DYWA 3A2NA 5AM3A 2PBLA 3QITA 1UZAA 4UHEA 2C5FA 4W1SA 5ALZA 1H23A 4QE3A 1BROA 1EINA 2HDWA 5JANA 3JYHA 3TGLA 3JW8A 4M0EA 4E15A 2XQGA 2WJ3A 5ALSA 2QMQA 4HAIA 4OB6A 4WFJA 4YX9A 4B0PA 1BN6A 4J7AA 4FLEA 3WKCA 4G8BA 3FVRA 3RARA 1MN6A 4Y2QA 5ALNA 4MJ3A 5LZ9A 1A8UA 3OM8A 3PF9A 2JIDA 1U65A 5FDFA 5AI9A 1QZ3A 1ZIXA 3H2JA 3VJMA 2I78A 4PSDA 1DX6A 3UUEA 2P8SA 4WDRA 1PJAA 2V96A 2WUFA 4L3WA 1DT5A 5ALVA 1BRTA 3AINA 2G5PA 3WK8A 3I2IA 1SOMA 4H0CA 4EY4A 4Y2PA 1EDBA 2BUBA 3O95A 1EVQA 5E4YA 3HEAA 2XMZA 4U2CA 2ACEA 2XUDA 4AMYA 1VKHA 5FOQA 1UKCA 2Y2UA 1B41A 4BAGA 1UKBA 1WM1A 1XZJA 5AKZA 1J06A 1IUPA 4MXDA 2PPLA 3EF3A 1UXOA 1AQLA 1E8MA 5K3CA 1G4HA 1NU6A 2D0DA 4L9AA 4XVCA 1YA4A 2VTVA 2RHWA 4X6YA 4UBKA 1GQRA 4ZI5A 2WJ6A 2XUFA 2PKYX 4F60A 2H1IA 3M83A 2HRRA 3ZWQA 3DOHA 5J3JA 5FRDA 4UHFA 2XI4A 4B85A 4JNCA 3WK4A 1ZI8A 3HJUA 1BS9A 4Q05A 3DKRA 1YA8A 4AQDA 4IO0A 4AB1A 1R4ZA 3DYIA 1D07A 4V2IA 4E14A 5AM5A 3W9BA 1CPYA 3NOXA 3F9CA 2AJBA 5AKKA 1QIIA 3WIBA 2H7XA 3QPAA 3IVMA 1QIGA 2J3DA 1UOPA 3MUNA 4BP9A 5CT5A 5C8XA 4EY6A 3KOOA 3OC0A 3STTA 1TCCA 4G1FA 1CUUA 1TIBA 2X8BA 5BWCA 4G4JA 5AO9A 1LBSA 4Q82A 3BF8A 4DSAA 4CG2A 2OAGA 5ALRA 3QMMA 3D2CA 4QA9A 2XMDA 4BP8A 5AK5A 5ALLA 1UKAA 1DX4A 2J3QA 2XB6A 2QOEA 2RIPA 4PF1A 4QDTA 2HIHA 3M3DA 2B9VA 1ZOIA 3EBLA 5AI4A 4C01A 3WK5A 4EBBA 2XMGA 4HRXA 1R9MA 3KXPA 5ALKA 1H2XA 2IITA 5EFZA 3DKKA 4BRSA 3WI7A 3STUA 1N1MA 5I9IA 1FFDA 1C7JA 4QEKA 2ZYRA 2JEZA
chains in the Genus database with same CATH superfamily
1FTGA 3CX4A 2R79A 2HQOA 2JH3A 1ORWA 3ICQB 2VNJA 1YZUA 2FJPA 2Z57A 5CCXA 4MW0A 2XUZA 2EX0A 2ERYA 3LP5A 3EULA 1ZJWA 3EIOA 2N47A 1EHCA 1ZVKA 2L18A 2WOOA 2HAEA 4G2NA 4HZUB 4J0JA 5BW4A 4CVNA 5D5HA 3HABA 2JVIA 4FGJA 3WL7A 2XZOA 4B80A 3UMYA 1O1YA 8ABPA 1YQGA 1I32A 1AD2A 3UWDA 3HXMA 2W6QA 1JJVA 3JSAA 3SVZA 3ZY5A 4J1SA 4MRNA 1O7JA 2RG1A 1F2DA 4WWHA 1UOOA 2HHCA 2WNHA 3BHIA 4WOKA 5TPZA 3MUOA 1N1GA 3KWJA 1ZD8A 4OAPA 2HR1A 3BFJA 2JK0A 4G67A 4D9MA 4TTTS 3QYJA 2GKGA 4WADA 4ZEWA 1QF6A 1R0LA 1RRGA 2NADA 3ORFA 1U11A 1Y5NA 3MD9A 2Y67A 2D1SA 3WHLA 2CJPA 2CYBA 1JMKC 2WVHA 1RXSA 4LK2A 1MBZA 2P9CA 4R68A 2NW6A 1CRQA 5IYZF 1E2GA 2IXBA 2F8MA 3KZXA 2VZ0A 4JROA 1R0SA 1UC8A 2VPTA 3IEKA 4Q7LA 1X1QA 3I2JA 1KDRA 1RACA 4Q1AA 4URVR 3D2AA 2G5TA 5E7MA 4A03A 5JY6A 3BFXA 4L5IA 1DTEA 2C9MA 4KPFC 1U8CB 5IZ4A 3DMTC 5G4KA 3WQHA 1RPZA 3IL2A 4B4WA 2BN4A 3OG9A 5KWVA 5A71A 3M9LA 4X91A 1QH0A 2Q2VA 2Q6TA 3LV8A 1E8DA 4J75A 4XIYA 2XQKA 3PDCA 1PIWA 1E3WA 2J9RA 1GLNA 1SC3A 3HYNA 3T1VA 5KC9A 2NT4A 2W90A 3AVOA 3SQDA 2KM1A 1UBKS 3GEGA 3OWHA 1HORA 1BE8A 1DTWA 4ONEA 3SF8A 3T4XA 4BE7B 1LS6A 2ZJFA 2ZQYA 1ZG3A 1JSZA 2ATEA 4JB8A 4KXYA 5THKA 2IZ7A 3DEAA 3GJ0A 4PQGA 1WVGA 3LS2A 2ZIXB 3IQFA 3QSGA 2HUNA 4BX9A 1CQIB 2PNJA 2JK1A 2EVWX 2CLCX 2VP9A 5JSZA 2GHRA 1A69A 3FCUB 3DF7A 1WAMA 4UAGA 1DAKA 1KY4A 3AUYA 3U0BA 1U0HC 2JGRA 1X7GA 3AR7A 4HJXA 2OZKA 3T4PA 4DFDA 5HS6A 5LQMA 3OEWA 4Y2VA 5G4LA 4F11A 1KOGA 4KC0A 2GERA 2QG9A 3KQQA 3SS7X 1VDZA 4C7VA 4BNKA 2P3OA 4GYYA 1GR1A 2GAJA 4P80A 4YGYA 3S8EA 1EGHA 3DEYX 3GJYA 1D9ZA 4FKMA 3PFWO 3HWSA 3SYLA 3RYHB 1RRKA 1MF7A 1XTBA 2OORC 2YWJA 3JQCA 4LNUA 3RJ9A 5H9WA 4OHPA 5JAZA 3BFKA 3DMPA 3HKDA 2OAP1 3OPVA 3DS8A 3TBFA 4DV2B 3I2HA 3MCAA 4JUBA 3K1ZA 1ZD2P 5K0GA 1ZICA 1CU1A 2RHTA 5H59A 1SBYA 4F46A 4TS1A 1H4TA 1V37A 1YL5A 3LUBA 4Y0AA 1G5IA 3QKSB 4H27A 1U0BB 5E4JA 4JJFA 2H2IA 1VXRA 3A3PA 2CLLB 3NRCA 5EPEA 4ZI7F 5G0WA 4JJ8A 2DBVO 1DBWA 2DR3A 2OXFA 5IDQA 1HDGO 1NFRA 2RH5A 1QH8B 1GGFA 3AUFA 3HXKA 1JBQA 3MWDB 4KKVA 4MOWA 1O94D 2GBPA 1JB1A 4REMA 4I1VA 3INRA 4PAWA 1C9DB 2H5IA 2ICAA 3WO1A 1SH7A 2WWHA 3INNA 2AEFA 3PGJA 4XIJA 2IS4A 3GW8A 1QYIA 3DBRA 3P1JA 3VDMA 1ZH8A 3HKCA 4WD3A 2IYTA 1WSBA 1WW8A 4YI5A 3UAVA 3L0PA 2CB0A 1CQIA 1MT0A 1GKKA 4NQRA 2O7RA 4I1UA 4X3OA 2ECFA 1KH2A 2V54A 5F77A 4NE7A 4C2AA 3EF0A 3TB4A 3ZPXA 2IPLA 4X71A 2R6FA 5K3SA 2VYNA 3IPYA 5AW5A 1ZD5A 2CL5A 3BBLA 5BQ3A 3DUFA 2SKEA 1P80A 2C3MA 1HLFA 3KBBA 3WLPA 2R6DA 1B76A 1NN5A 1P0QA 4B6SA 2PH1A 1WKVA 2IIPA 2IFTA 4S35A 4DF3A 2K6GA 4H6PA 2OGTA 3Q3GE 2UDPA 3PC8C 5CVCA 1ONOA 5DPMA 1I01A 5AKXA 2V5AA 1L1FA 3P4XA 1MVLA 3MB8A 4KXUA 1HFWA 3AVQA 1KK3A 2D62A 1EWVA 2HCBA 5CAEA 3LZ6A 5LXTF 1W19A 4RFSA 2Q6LA 1T1EA 4DANA 2GNOA 3E23A 3LUDA 4JEUA 1YB1A 3TTWA 5CA0B 4N0PA 1QMPA 4OGLA 3RUEA 3T5DA 1G2QA 3FOAA 5B3JA 4UFPA 2X2FA 2ZSIA 3ZHXA 1GLGA 2AI3A 4G5FA 3JCZA 2IHVA 3B78A 1BE6A 3J81A 4GECA 5CA1A 4ZQIA 1BWPA 3QU7A 1GAEO 4GIBA 1N3LA 3C15C 2H5LA 3NM5A 2WD7A 4GKAA 4NAUA 2JLWA 1A5AB 5AW7A 1MA3A 1QHHA 3NHWA 3VNSA 4BFYA 1B73A 2FFRA 1RLUA 2R7KA 4EY7A 5DTEA 3BUSA 5A2GA 4DJJA 1VRVA 4YT4A 4REQB 3A70A 4PC6A 5B4VA 2VNIA 1CF2O 2DC1A 4AP9A 3IIIA 3IMGA 4UQPA 3QVTA 1QQ6A 2QVBA 5C8DA 5D6OA 3W3AD 3ZDFA 3LH5A 2KQUA 3ECSA 4EB6A 1EP9A 3A6LA 3QUAA 3PHGA 4IIXA 3VOSA 1KVRA 4ZVUA 5FAKA 5CYPA 2VNHA 5HEKA 2HFJA 2R6ZA 1LDBA 3MERA 2DPMA 3OZWA 2Q1XA 2HI0A 1OR8A 1CQXA 5EINA 5FUVA 5ITSA 5JHHB 1PNOA 1RAAA 1DQPA 3EG9A 1EVKA 2OILA 3PEVA 4YRSA 4IHKA 5AD1A 5BSFA 4BE9A 3O9MA 4HKTA 2AMFA 3HSSA 2W2XA 4URUR 2LZ0A 1FFYA 2LPMA 3ABIA 4CV2A 1U2GC 2KLBA 4TRMA 1Y6FA 2PMEA 3ZDYB 1OBVA 2C7GA 3BL5A 4LI3X 3CH4B 4XEUA 2ZG6A 3U31A 3ZD7A 4FYHA 4B74A 2V8BA 2ZREA 3EWSA 3RS9A 2ZIFA 3TW0A 3UC5A 2Q3MA 3QKWA 4MW5A 1YDFA 2ZRMA 3NLLA 1J9EA 4Y9TA 4QFDA 1XZAA 3TPFA 3DQQA 4C7OA 2QPOA 4AY2A 1XEWY 1G7TA 2DU8A 1SUDA 3RRFA 1KI3A 1IY8A 3IDFA 5B53A 3S27A 3CKLA 3B20A 5ALDA 3TNLA 4N6NA 4MHTA 3IQZA 4DLXA 1PR1A 5CAEB 4LF4B 4J4HA 4LRWA 2LBPA 5L3QA 3L8YA 3G7NA 2FPMA 3NHBA 5J5CA 1RLIA 2F43A 2Q2WA 3IESA 4LJ7A 3BMCB 1TZKA 3DR5A 3PWKA 2Q5JA 4WUVA 4YDRA 3SXUA 1IZ8A 5AW6A 1AF4A 3FGPA 2O7VA 5B3JC 1UPUA 4GL2A 4RULA 1AS2A 5H0IA 5IWCA 4R8LA 3ZBTA 4EDHA 4WVLA 1IEVA 1YHNA 3QM1A 3FUXA 3QIAA 4X8HA 5J63A 5LOVF 5J1SB 4TXMA 4YONB 1JDNA 4YJDA 2ZCUA 2COKA 3ROQA 1NP7A 2ACKA 4MI1A 2H4XA 1NJGA 5ELMA 2CXPA 2AC2A 1N9ZA 2Y0EA 3ZW9A 2PWYA 3AEZA 2HQSA 3V00A 3EPKA 2JIOA 3WRWA 3FOZA 2GFHA 2PCLA 4BVGA 2Q6OA 4J0CA 4LDNA 5FBWB 5BOSA 5F3DA 3AI2A 2W2QA 4A0HA 5EKUA 1YUMA 1RD4A 4CT4B 1EVLA 1TC2A 3WRVA 4EPRA 1J0AA 1CJTC 3ZLBA 3JVEA 1ZOPA 1IBLB 1SA0B 2CFRA 3E8MA 4OUDB 3A9SA 4ZODA 5BSHA 1RPNA 3SBXA 3TAHA 3F5MA 2DETA 3O31A 4J7CA 3ZQKA 5HKBA 4N3CA 4A2CA 4CKWA 1Y7HA 2CUTA 3LUAA 4BLSA 5KX5B 1XMSA 1XVLA 2C5EA 3OLQA 2XIJA 3ZE0B 1QZXA 3DW1X 2CLHB 3NHAA 1Z4QA 4AMVA 1M2VA 2B3TA 2BEJA 1USWA 4O0MA 5JMPA 1YWGO 1CS4C 1RLTA 1VCHA 2BVNA 4HBZA 4QYTA 5L4SA 1L6RA 4EX7A 4C88A 2EFHB 3WJAA 3AV3A 1P1JA 3JQ6A 1U0GA 2QP4A 4N5LA 4L16A 1UWVA 2O5VA 3JRWA 4B33A 1NUAA 1IL0A 2DKOA 3PUYA 1S4QA 1T6NA 3P9XA 3NWEA 4IS2A 4MR9A 1KEUA 2FZ5A 1BA2A 1KP3A 2Z1MA 3FNIA 4ZCSA 4DIMA 4DRZA 3D0OA 1Q84A 2ZPTX 3JQRA 1CUSA 4WKPA 2QJOA 2HMVA 3CN9A 4UHBA 2AG8A 2ZBUA 1VPTA 3NKFA 3NTOA 3WDLA 3QA9A 4A0RA 1E0DA 3ZCQA 1S2GA 1SC9A 1PYGA 2CUNA 1E59A 2PGLA 3E3AA 4ER0A 2DJ5A 1NTOA 2Q27A 4Y6RA 2BSQA 1FW8A 4UM8B 4V02A 1TDJA 1GPJA 3V2UA 1BCSA 2PGXA 2QZJA 4LVOA 4F7WA 2CCJA 2K2WA 5JQGF 2F1JA 4OFXA 4FR2A 4QBHA 5C31A 1I3LA 1P6UA 5AJYA 4DNOA 4E33A 1MVNA 1S6YA 3AWDA 1G21E 2FUEA 4LMRA 2JAPA 3BGWA 4NS1A 2J6IA 3JQBC 4AKEA 3CUEF 1W5TA 4CEIB 1Q0SA 1MHPA 4S1NA 4KAFA 4DLNA 3GLHA 5BSKA 4D26A 4N49A 1RIIA 3LLSA 5BYBA 2RD2A 3ZDCA 3FX2A 2ZETA 1SEPA 5G4KB 2QUBA 4BWVA 5E2AA 3GLGA 4KWIA 3FBWA 4URZR 4KVFA 4AO7A 3ZWKA 1V4NA 1HGXA 3H2SA 1Y1TA 2ZYSA 1W94A 3AMVA 1QHNA 2BH9A 4MROA 1TLFA 3RVRA 3WKAA 3O1JC 1H4VB 1NPTO 1YMVA 4MCJA 4MLPA 1M3SA 5A7GA 5TX7A 3G8BA 3R75A 3USZA 5B7PA 1FRFS 2E9SA 4K6HA 5KIAA 2W48A 4N18A 5ALMA 5C8ZA 1U8UA 4M0MA 4WK2B 4AKIA 3KEGA 4U7DA 3FSGA 2M2IA 3PJFA 3KVNA 5T4EA 3B6JA 4I66A 1Z3CA 2W2MA 4PGMA 4BNMA 5EPOA 1JHUA 2VAMA 2C0CA 3VHRA 3TOSA 3RAEC 2AK2A 3ZJ4A 1TCUA 1HYHA 4HNHA 4DNPA 1F60A 2PAFA 4TWRA 1CX9B 2WV9A 3NUGA 2P6RA 3LGAA 5HFNA 3KBOA 3W2FA 4NVRA 2A5GA 2HA0A 3ES9A 6ABPA 2CB9A 1B43A 3SEFA 2JFGA 3AF6A 4D81A 3PJDA 4Q47A 3ZJVA 4Y18A 5BRNA 1QC5A 5A05A 3NCTA 3E61A 2IS1A 4C2TA 1NIPA 4LXGA 4L9SA 5HKLA 5DIZA 4D3DA 2GFQA 4MWDA 3VR4A 1M7HA 3Q7IA 4PHTA 2YX1A 2B20A 3MGAA 2AMLA 3ANNA 3F5FA 4NMWA 3G2MA 4K1LA 5B3AA 4BFCA 4DCJA 4DUGD 1BYUA 1DOAA 3OZBA 2XE4A 5LQNA 4AG3A 3T3NA 4S04A 1I4LD 4ZT7A 3R4CA 4GRDA 1X1SA 4DMHA 1BDBA 2AB0A 3IDOA 1BA3A 4ZAVA 5DDIP 4BNIA 1H6BA 1NURA 5GTDA 1HWYA 1ODSA 1RKXA 1N2JA 2J3KA 2Y77A 1PYOA 3SLKA 4DSOA 4JIGA 1A2OA 1LX7A 4LWZA 4P6VF 3UT6A 1KBZA 3EY4A 3PZBA 4TLMB 2WHPB 2CXTA 3A6HA 2J8ZA 4J6FA 5IJ9B 4J0HA 1BXGB 2B3DA 2A5JA 4B2PA 4OM8A 4BHTA 4BQSA 1GZ7A 1GU1A 3LP8A 4MW9A 4AQ7A 1WP9A 2WABA 2VH5R 1ZDMA 5JJCA 3O9ZA 1UP4A 3PQ8A 1W30A 3ZV6A 2YFYA 5AW0A 1ZH2A 5EJ9A 1RXCA 2NUPA 1VL6A 3IMFA 1FUIA 3LY5A 3L5OA 4IJMA 4LHYA 1IN5A 4R01A 4UNSA 3UAWA 5CBPB 1RXWA 1QE0A 3PA8A 5LZ5A 1KEZA 3DHWC 3VZRA 2FN8A 3WA7A 1GL6A 2EGHA 4YIKA 5DB4A 4ZAGA 1KIMA 1QO9A 2HF2A 1H2AS 1FS4A 2R6CA 1NBHA 2RH8A 3E7FA 3LDFA 4LXYA 1EVZA 3TK1A 3UQYS 3T3PB 4Q3KA 2QN7A 2X42A 1GUAA 2GWHA 5FBZA 3SIXA 3LCCA 2IYPA 3ASYA 5LWQA 4N4AA 1VBMA 3U7RA 1UBNA 2XZTA 1IIBA 3QVVA 5REQB 1BFUA 2D2EA 3FLEA 3TEJA 4EHDA 4ZMRA 2RHJA 2ZTVA 3K5WA 1I0LA 5E1MA 5A3QA 2H3EA 2VPXA 3WO0A 5CLJA 5FUMA 1C30B 1C8LA 1ZK3A 2F8SA 2VTEA 1ADFA 1AKRA 1PJ2A 2YNMA 4C4XA 3AR5A 2K7FA 4ZYUA 3KSAC 1JHVA 1PJ4A 1K8XB 3EQ6A 1A9YA 2PKQO 3CJQA 1FFSA 1OXTA 1DC7A 2RGXA 3DZDA 3HO6A 4R1OA 4UZFA 1CS0A 2C82A 2ODWA 5JZOA 1O54A 1QKJA 3UBTA 4IJ5A 4IKPA 5HW0A 4U1RA 5AHKA 4IRUB 3VZPA 1J25A 1KQOA 1Z2CA 4BMPB 2O8BA 3AC0A 3PTZA 1C41A 1UCFA 5B58C 2ZYGA 1C4WA 3CLSC 4R51A 5LA6A 3WXBA 1PQUA 4BTVA 4WLOA 2P78A 4LFCB 2R00C 1Q1EA 1O08A 1P1RA 1L1EA 1VJ1A 4JJIA 1HLDA 2GN0A 2DUMA 4QFCA 1H9BA 3I9OA 3WLIA 4GD3Q 3J7AC 4NJEB 1SAYA 2CNLA 1DXHA 4G0VA 3BD6A 1YUNA 3WFJA 5K4HA 4E7PA 2GEFA 2XCQA 2C4KA 1RFLA 2VLBA 2FOXA 2HB6A 1DCMA 2BT4A 3GCZA 5LBUA 3EXG2 3S2GA 4AU1A 4PV7A 5BSRA 4PBSA 4DCTA 1VGVA 2QU8A 1JQLB 2C9DA 4F3NA 3K2IA 2B4AA 4L4YA 4MINA 3E8SA 3FCCA 5F2KA 3WG9A 2CDAA 4B83A 5F5XA 1E2KA 1JEQA 2OV4A 3EFEA 3V2HA 5FTKA 4RVFA 4BRUA 3LLMA 5DTMA 2P68A 2XRMA 2HX1A 3GJZA 2CJXA 4F4JA 5BSGA 1QO0D 1VIDA 4IO1A 4Q4AA 1KVTA 2QRUA 3H3XA 5FP0A 1JLLB 4JSYA 2OHVA 2QNBA 3E58A 3JALA 1LPAB 4XYBA 4Z4EA 2P5SA 2Z5VA 1KJNA 4H7PA 3TG8A 4K46A 4UU7A 2B0CA 2QLFA 3HDJA 1E4EA 5LDHA 1P81A 5JISA 1EJ6A 2VK2A 1ULZA 1J5PA 4L2IA 4GSKA 1ZFNA 4PLZA 5A0FA 4UBMA 5C8VA 4U2GA 3VR5D 4KBGA 2VBFA 3J7TA 5CG1A 1KEVA 5TQ0B 1T35A 4AYTA 1G8MA 2Y1CA 4O2AF 1DO2A 2XXBA 1RW4A 3D8HA 3RPEA 3VR5A 3PK0A 5DO9A 4Q3EA 4Q1CA 2SNIE 4FT2A 2A1TR 1P39A 1NUHA 2P9TA 3TZLA 2EKPA 4X84A 3SIWA 1E5QA 2VT3A 3D7NA 4GR4A 1HDZA 4EFMA 2DPHA 3B6KA 4NBSA 5LZ8A 1C1HA 3MWEB 2VHEA 3G2PA 2QU7A 2QE7D 4X45A 3L05A 4MUGA 4M7WA 5KHAA 4P5EA 4B9AA 1B0ZA 5DGHA 5CIYA 2BL4A 1JA0A 5FLXA 1ZN7A 1FLVA 1E6LA 2A35A 2NG1A 2OSBA 4ALNA 3ZWNA 3NX4A 3ACBA 2Y05A 3FOCA 1GYRA 5JS6A 3OH8A 1LI7A 3A36A 1U8ZA 3OJXA 4JQZA 4L7QA 4XX0A 3KE8A 3BEDA 3E3LA 3NAGA 1Y48E 2PMDA 3N2GA 1E1CB 1G291 4WSOA 4UQLA 2EGUA 5A4AA 3O2NA 3VYWA 1OOEA 4TRNA 2DGDA 5EIBC 2QX7A 1TFUA 5K0BA 1ND5A 1KC3A 1Q83A 1JSRA 4ZYZA 1IY9A 3QKTA 1Z83A 5K6AC 2DUWA 5KHOC 4GVLA 4BYMA 3QEBZ 1OHHA 2NPFA 2ZJ6A 2BCEA 1JLSA 1E79A 3V4SA 1WUHS 2Q4DA 4EFKA 5F7OA 1F8GA 5IDWA 3EXIB 3GZJA 3RAJA 3P4UA 4CR7A 5FBHA 3H65A 5IJ0B 3T4UA 3HVRA 4M76B 4XDZA 2XADA 1ETUA 4DIKA 4BQIA 1JG4A 3EEIA 4M0KA 4GC5A 4FSDA 4ASUA 1Y42X 4C3VA 2DWCA 3T95A 2ZDHA 4GF5A 4JBLA 4BMOB 1B3RA 1EX9A 1YIDA 4ZANA 4F4FA 3NCHA 4K87A 4JI6B 1IVNA 3DO6A 1VOTA 1M1YE 4NU0A 1KP9A 3TKAA 2VHTA 1RYBA 2IYYA 4Y6OA 5EZSA 3VKUA 1I4WA 2Q2OA 1T6YA 2YJ6A 1I6WA 1UC5B 5FA8A 3RNLA 4DJTA 5BYKA 1X6VA 3ER9A 1IB0A 2EDCA 5AI8A 4J7XA 1ZXLA 1YMQA 1N2GA 2FQQA 4HH4A 2NX2A 3SM3A 4BO4A 2O1XA 5D87A 4P34A 3ZWCA 1H0SA 2C4VA 1T2AA 1L5FA 3ORSA 3T38A 3L9WA 3LNCA 4HQ0A 5KQPA 3GLHE 2KBEA 3G79A 4HDRA 3GRPA 4DR4B 1WHTA 1ZXXA 1OPRA 4RTLA 4F1WA 2XCOA 1LJUA 2IC5A 3F1KA 4W5JA 7ABPA 6REQA 2FRVA 4UTOA 2F7SA 4ITVA 2CFIA 3OLZA 1T0PA 3P5BA 1VPLA 2OL4A 3LAWA 3V5NA 1DQZA 1P17A 3W5BA 3RUCA 1Q7BA 1V7ZA 5CDFA 4F84A 4YCAA 4BECA 4F93B 3G2HA 1XV5A 1BE0A 4YYZA 3R8FA 2M32A 1M2OA 4WZAB 3JD3A 3WSWA 5NULA 4OQXA 4GEKA 3RF6A 1RI3A 4EHBA 2W0MA 4ZDJA 5F7JA 5ALQA 5LXTA 1LBIA 2PIAA 5EJ7A 1MAHA 2IEAA 3COVA 3NC4A 1PEDA 2C4MA 1JALA 2FSPA 1JEQB 3NBMA 3PD7A 3E9DA 2QX6A 3GO4A 1YS1X 3NBXX 1NKTA 3RUFA 1KDVA 5DM2A 4E31A 3ICWA 2R6R1 3Q7SA 1H0HA 2CY0A 1E1RA 4B43A 2ZJ8A 2QTAA 2BTOA 2MWMA 2FX3A 3G8DA 3ELBA 3WC4A 1WUYA 3U3JA 2IY7A 2FEAA 4C89A 3ETEA 3VV3A 4RCZA 3AETA 1ZGBA 3AHDA 3IVCA 2FWJA 2XTMA 3H1AA 3MCUA 4UMVA 3B5EA 5J5AA 3R7FA 2I03A 4G0OA 1GVNB 1Q22A 4MKRA 4AUEA 2QQ0A 2EL7A 2I1WA 3IEIA 3N9IA 1XDGA 4IL5A 4P4NA 4Q48A 5CYFA 5C5IA 1QQBA 2DTEA 3FMGA 4LDPA 2VSOA 3TMKA 4DJFC 4MRMA 5AHOA 4AUKA 4RTKA 3HZOA 5LKAA 2QP9X 1HMPA 4M1OA 5LA6B 2HZ7A 3OCCA 1ZN9A 2A1TS 4M87A 5C8YB 3WGVA 1IPEA 2V6FA 3GBVA 4PICA 4RYDA 5HCUA 1Y82A 1EHIA 1VSTA 2WJZB 3AHFA 1CS0B 1ECCA 1EWKA 4XVRA 1YR3A 1RQLA 4C22A 2AD1A 3UMMA 1EFCA 1YOVB 2BM8A 1J1IA 3GN1A 3HCEA 4EY5A 3GLUA 1PKXA 4JFRA 1KJIA 2X1MA 1QRAA 1DEAA 2YH2A 5AYVA 1RYHA 1NVBA 4MI9A 2PRSA 1N2IA 2QZPA 4XDHA 4DA8A 1DAHA 1E3IA 1MHTA 2HEGA 3AVVA 5AJZA 3P0FA 3CNOA 5I7HA 3FFTA 2BGKA 4HAZA 1P5JA 3HJAA 4HY3A 1QIJA 2YUIA 1RVDA 5GV7A 5TE9A 3TQTA 1A9ZA 3VPFA 3MMSA 4RK6A 6YASA 1UK6A 2EG5A 4YQEA 1VHLA 1F6DA 3JQFA 4WCFC 2PFKA 2QXTA 2GPTA 4FMPA 4EFNA 4CW7A 4UTVA 4MYSA 3L6DA 3BWYA 1YZYA 4GNKA 1AS0A 4MR7B 3QYAA 4II2A 1ZUWA 4F97A 2E3JA 4P7BA 2FUG1 2WM2A 3E81A 4ATNA 3CVXA 1TLLA 3RSQA 2PEYA 2OFXA 4MUBA 4RABA 4NMXB 4EW1A 1U9IC 1MAUA 1N7JA 2RGNA 1M2WA 1QB7A 2WHXA 3NHKA 4GNRA 4IGIA 1V47A 5DYGA 2X8WA 1J2TA 3NEYA 5T8KA 1SOUA 4LHZA 1U6KA 1BXGA 2QZ4A 3QG5A 2XDAA 4NTZA 5G0TA 1UKVY 1FRNA 2VDLB 1YRAA 2D5AA 3D9QX 1FY2A 2YWXA 4BEWA 4EA6A 4Q7QA 2ISSD 1F7VA 1ECBA 1FTWA 1RJWA 2BRUC 2QROA 4DJDC 3I0ZA 4AS1A 4QUGA 3ZWOA 2OM6A 2XH8A 3O8DA 2C2KA 2V7BA 3MXOA 4GX1A 5HZKA 2CUKA 3EVTA 1KAQA 2FX5A 4DVJA 2GM3A 1X74A 1XZBA 5KNDD 2QMEA 1WF3A 2ZVQX 5EIXA 1GKLA 2D1RA 4NMLA 2I9KA 4YP1A 1NUTA 2QENA 1DVRA 3D8TA 3G8AA 4Z4FA 1NN0A 2GWRA 4RKYA 3VNUA 1ZRHA 3OUZA 1UBRS 3E03A 5DBEX 4M8LA 2VOJA 3H83A 4ZCRA 3H5WA 4K26A 2XMPA 5DI3B 2EW8A 4FBLA 4M9QA 3TBKA 2O2ZA 4H9GA 2BEWB 4RHYA 2CSXA 1KHHA 4IH4A 2FF7A 3S3TA 3V6LA 1N0HA 3VZBA 1RZ3A 4DNQA 1A5ZA 1QRDA 3FPKA 4LYAA 1W88A 2R4UA 4I46A 5BSWA 5GZ3A 2GPBA 4IIJF 1QIKA 3AP3A 4QREA 3H1EA 4M9RA 2AZXA 4XCQA 2UZIR 4XD2A 1PT6A 2FG7C 2GESA 2X5OA 4JELA 4JL8A 3L1HA 1IZYA 2BJHA 1HT3A 1IHXA 1NBWB 1U99A 1WQ1R 4J1NA 2I3DA 4PG7A 5I7EA 1SQ0A 4P84A 1ODKA 3FOEC 3JQDA 1ADJA 1WDTA 4J0KA 4LHSA 2Q4TA 4XGIA 1JP7A 1O4WA 2GUWA 2HXGA 3C2QA 2Q46A 4JEHA 3PKIA 5LA6F 2B8NA 5KYXB 2GCGA 3DMTA 2FE4A 3M8KA 1DWPA 2WHEA 3GNTA 4LC0A 1CR2A 4NK4A 4I55F 3ST7A 2OMEA 3ENKA 2WB2A 5JWRA 5J2UF 5CDSA 1SCJA 2J9ZB 3LT0A 1CNMA 1DIHA 2PMWB 1L8XA 1ZVQA 2HOQA 1YRLA 2R48A 1XHFA 4WXHA 1HF3A 2IT1A 4TMYA 3RASA 5DU2A 1ILEA 3ZDRA 3GLGB 2PSHA 3OQOA 5KDDA 2O8CB 2GH1A 3K9LA 3DTVA 4GH5A 1MAWA 1VLZA 4DHEA 2ISCA 3H2IA 3OQBA 4TMTA 4CLRA 5I4BA 1ULUA 2GBCA 4FOTA 1Y4ZA 4H08A 4FE7A 5EWJA 2NU9B 3WGGA 2QTCA 4QGFA 1PQYA 1SUCA 2H51A 3HCFA 1KI6B 3C7DB 3KVRA 1V5EA 2R6HA 2Z8ZA 3T54A 3UHPA 1KS2A 4C0HA 3RF7A 3F4LA 3TLXA 4H4EA 4Y1RB 2VH2A 2OPHA 1C9KA 4K88A 3PF8A 3I8SA 2PWBA 3X1MA 1DKMA 3BX1A 2V4ZA 2RHMA 2QS9A 2W8BA 3FCYA 3IOEA 1LDMA 4ZMSA 3DP7A 3EVCA 4HN9A 2Q21A 5SZIA 1J0BA 3INGA 2C5BA 2J4FA 4E2YA 1FFEA 2OKGA 2C5AA 4Q7EA 4ZVTA 5KAPA 1WY7A 1AXGA 2V8OA 4LE2A 4XGKA 1U0TA 1P73A 5HHTA 1NKSA 3IQXA 3BE6A 3NHFA 2O0JA 4J29A 3I2GA 4NU8X 1R4NA 4TLCA 3BREA 1XK7A 1PHRA 4RKQA 2ZIGA 3BCRA 3HUUA 3ZCTA 4QLBA 1L6IA 1V4BA 2C0PA 2JFBA 2PT5A 3L7CA 4JLPA 3D6TB 1GG2A 4HL6A 5JDCC 3UGKA 1MT3A 4FWTA 1M54A 2JFVA 1L5NA 4FYMA 1EM8A 1A5BB 2IODA 4L3OA 4PRZA 4ZYWA 3I52A 3RVLA 3L7KA 2IRWA 1EUQA 1PW7A 1ZCAA 2X8AA 3FUCA 5HZMA 3FHTA 4FB5A 2O0HA 4URXR 3CO0S 1TJ4A 1QP7A 1LKZA 5IXJA 4DYVA 5EZYB 2IYZA 4IJQA 2G83A 4HF7A 4IJKA 3PI7A 2A9KA 3B1WA 1ACJA 3FXAA 2IUUA 1SA0A 5DBFA 4B6EA 4D8XA 3UGJA 3CSUA 3BRQA 4KTTE 5KINB 3WK9A 3OQIA 1C8VB 2W6PA 1F38A 5K45A 4YJ2B 1YKFA 1X1AA 3F47A 1SVKA 5ITWA 3BBPA 4TM8A 5LP6A 4OMDA 4WY8A 4YXWA 2AF3C 5DX0A 4ENPA 1E9VA 5DWDA 1YAHA 2VBGA 2VJBA 1Q2UA 2Q3CA 2QMZA 1UDBA 3LVQE 3WGMA 1ZC4A 5ALPA 2FI1A 3ANLA 1ZVMA 4V1CB 3MJDA 4K9DA 3W1VA 2HBRA 3H0EA 1WHTB 1T6ZA 3SSMA 1P3Y1 5BV0A 5K8CA 2HHLA 1HY3A 3E0QA 3VO1A 3IIKA 3WJ7A 1M2JA 1MXFA 4UBJA 3ZEAA 1LQ2A 1LV7A 1R6TA 1XA4A 2JCYA 3GFRA 4OH7A 2GCNA 1JTFA 3T1QA 3MNFA 1QPGA 2NP7A 2PXHA 1QU3A 3UA4A 3MC1A 1GNRA 4NCNA 4OJQA 1HKUA 1OLXA 2DBYA 3C6QA 1MW8X 3DFMA 3BOSA 4Q19A 3DFIA 1FUKA 2DF8A 2PD4A 5KU7A 3DULA 2FUKA 2Y99A 1VSQA 3NUQA 4K6KA 4D9HA 5IANA 1QH1B 2ZAOA 3L4BC 3WHPA 4EI9A 4ZOQI 5JALA 1K98A 1QGZA 2NLOA 3DTTA 2X7JA 2I71A 1P4JA 4QYWA 1KQFA 3PHIA 3OPXA 5AVVA 5CCBA 3C5CA 1L9KA 4JYMA 1Z36A 4C7OB 2Q5CA 4MUXA 2D2IA 4BFZA 1SD1A 3WZLA 1TMKA 1OT5A 2WF8A 3QKRB 1XL1A 3Q12A 2J3IA 1TW2A 1DEHA 3R9KA 2I55A 3OLVA 4JVNA 4Q7JB 3VKWA 3QTBA 4DAEA 3R5SA 4HTAA 1AKNA 4HCJA 3K0FB 3O82A 2XTJA 2FOLA 3HH8A 4CKCB 1U0LA 4JAVC 4RVCA 1U81A 4XPIB 3R2JA 1RXUA 1G3UA 4GI7A 4AJHA 1VLVA 2G40A 4HNQA 5AXAA 3OZIA 5EAIA 3EVGA 1SIBE 1G59A 2GA9A 1XZPA 3GHHA 3H1BA 3L8HA 2A7QA 4KQWA 5HFAA 4R0MA 2ZM6B 1WNTA 1N3YA 5GPBA 3A6KA 4LYDA 1QTNA 3VJKA 1XVVA 1JRLA 3UTDA 2VR1A 1XMQB 4V0MA 5KOIA 3UKDA 3E9EA 4FNMA 2W5UA 1WUKS 4I5FA 4HTFB 2PTHA 1J97A 1KRXA 2A0XA 1MTOA 2JI4A 2X2OA 3NVMB 5IDYA 3HYCA 4MWGA 5HCIA 4I3HA 1B2RA 1UAGA 4M1EA 5DJ5A 2AR9A 2P9JA 4AJKA 2C2XA 2L82A 2NZ8A 1ZSVA 1N0UA 2XQJA 1RP7A 3E5NA 4MJLA 5F73A 5H80A 2ZU6A 1T5HX 5TMDA 4AZ3A 3OIDA 2QR3A 4L57A 1DE0A 4DIUA 5IZCA 3Q3CA 4LW8A 1DKLA 5KHLB 3CVWA 4Z3OA 2QWXA 2JLCA 1BW9A 3QKUA 3JQPA 4M9CA 3DQZA 1XA0A 4WKOA 4TUYB 2HCRA 4D46A 2Z5GA 1T36B 2ZXFA 2F17A 3O8QA 4OHMA 4YNBA 1DQNA 3BXXA 1KZYC 1I8TA 2ZT5A 4GMFA 1TEXA 1X9HA 3O7MA 2W11A 1JEEA 5TGTA 2PT7A 3N0WA 1FMTA 1X7ZB 3MWJA 3ZNPA 4K9KA 3EXHC 2XDQB 3V46A 1QVAA 1WBDA 3AERA 2VYCA 3HCBA 4GXTA 4LYFA 3RLFA 3LOQA 2BV3A 1E5XA 1X7XA 2X8LA 3AEYA 2GN6A 4DTCA 2WA2A 1IEWA 1X92A 2C1ZA 2XVMA 5ITVA 1YJ5A 5AVQA 4C78A 3OI7A 2Y2VA 5HMMA 3TEMA 1I9CA 1SCAA 1JW9B 4P36A 3RLIA 1LQTA 3WB9A 1DX9A 5K6TA 5KWJA 4RX1A 4RIEA 1SUEA 1IU9A 2QPLA 4X1IB 3DMFA 4EJSB 3DLHA 2UU9B 3P7MA 1RT9A 5D3MB 4YQFA 4QBKA 1Y9EA 4ZAYA 1F6BA 2P2ZA 2V98A 4XOUA 4BO7A 4OBBA 3DUFB 2HHHB 4KI7A 1BGVA 3GLFE 1KFKB 2WTEA 3B53X 5CVDA 4F21A 3HM9A 4Q9LA 4ZXPA 3U2QA 1P2VA 5HKAA 2RB5A 5D8DA 1YQEA 2VQEB 3CYFA 1USVA 2Q41A 4J6EA 3PXDA 5BURA 3HYRA 3HCNA 1PDOA 1YQQA 2EWVA 3CUTA 4W5WA 4CJXA 1A27A 5HUJA 4I7EA 1RAHA 1SWWA 2VT6A 4MS1B 5KCMA 5FNVB 1TMGE 4BB5A 4B09A 2O06A 3KZKA 3DVAB 3GVIA 1U7PA 2GEDA 5IPFA 3N2IA 3RBZA 3S55A 2Q8NA 1MFPA 3IUPA 2PRKA 2PL3A 2PVPA 4NWIA 4QECA 3W9UA 1OHHD 2ZBFA 1U3TA 1TT5A 2DFKB 4AAYA 5LP6B 3FCAA 1CY8A 4H6VA 5E7QA 2VPQA 5FH9A 4KFUA 3D4OA 2W93A 4K6GA 2V7VA 4B46A 3KB8A 2ORWA 5AW4A 4NE2A 1KO1A 4F4HA 3RG8A 3N28A 3JWEA 1NMXA 2AOXA 2PXAA 2LD4A 1NGSA 3UPTA 2QORA 4AZSA 1YHYA 3K8OE 2DUNA 3OURA 5HA5A 1E66A 5AUOB 4UD2A 3QFHA 3VTKA 1ZD3A 2AN1A 2FW8A 1XZFA 2C29D 4IZHA 1NBIA 2C77A 2RG7A 4OOFA 1RC1A 4ZEVA 2BMVA 2C7BA 2BFCB 2DT5A 3F6CA 1C5KA 1H1LB 2F9MA 3IE0A 1C3EA 4YI3A 3FSGD 3SR0A 1OX5A 3L1VA 1U80A 3A4MA 1RBQA 4GICA 4KMRA 4MQFA 5EUQB 3TBHA 5HKOA 2FR8A 3ECAA 3ZWDA 3ZZMA 5LYJB 4UNQA 4R6WA 2XA9A 2G77B 4CM5A 4LF5B 2UYCA 3IX7A 5KTOA 4MHOA 3L6BA 1QR6A 3ICCA 4JYCA 1DKNA 1PK8A 3GEHA 4X41A 3RSLA 4LG1A 4WVFA 5JD5A 1O4VA 1X80A 4TZ0A 1M5UA 2P5YA 1N7IA 1T9HA 1U2SA 3N74A 1L7VC 1EGQA 2RAFA 1DBQA 4DZRA 2G6TA 1ZJ5A 2PMFA 4L5CA 4LXHA 1NVDA 1R5JA 4BUZA 2ECQA 3DOCA 2DTXA 3KSUA 3QI7A 2C9YA 4RNCA 5LNK6 2FAXA 2G06A 2SHKA 2F3TA 1V6CA 4D4MA 4DXHA 3IMKA 1VLQA 2ZBPA 1HQCA 2ZE6A 4D4JA 3DL4A 1Z17A 4G9BA 1HXHA 1L5KA 3CZ5A 4M1TA 3TGPA 5FUQA 1EGAA 3ZX4A 2GPAA 3TE6A 3KR2A 1K7SN 2X9GA 3I34X 3KZOA 4EKDA 1NLUA 4XASA 1G2PA 2O2GA 4BZXA 1KPHA 2ZB4A 3UH0A 5DFAA 1T0IA 1PR2A 2WWRA 3VAYA 1DP4A 3N6RA 1YO6A 2C4UA 2Q49A 3DTVB 4CDNA 3M5WA 1CBUA 1V1JA 4A16A 3BGIA 3FKJA 3ROKA 1NM5C 5A4MS 4DADA 1C3JA 1H69A 1RPJA 1LUAA 3PFFA 3R0ZA 1GOTA 3TOXA 4H7HA 3OHPA 4J43A 1JAIA 4JVLA 5BORA 5AM4A 2PIDA 5J1TB 4Z9FA 3BMQA 3UJ8A 3HB1A 3WOHA 5CG2A 3HEBA 3FB4A 3ZKWB 1B1AA 1X8KA 2I34A 4W1RA 1CY7A 1FNCA 2JLAA 3MLEA 3QE3A 3DFUA 4Z4CA 2EQAA 2BZ1A 1T34A 4FZJA 3PG5A 3AYXB 3GCWA 4XKJA 4CEJA 1FJ2A 1FDIA 3CH5A 2WIBA 3FM9A 2F2TA 4JXZA 1HZZC 3U7IA 5KJFA 3AL3A 3EGIA 3OT5A 1V5FA 3Q1KA 1TK9A 4YACA 5IXYA 1KYIA 1AA9A 3O73A 3E7PA 1SIWA 4JHLA 4AG5A 2CF5A 5A5EA 4N01A 1QHYA 2NYUA 1ZRSA 4XDYA 5LP6F 3TIXB 2I4NA 4ER6A 3B6IA 3OOEA 3EOZA 3L8EA 3ROEA 1NQTA 3BKWA 4OSOA 2BEWA 5E4FA 4BC0A 3OZTA 1F3LA 5DMHA 5HTKA 1M33A 2YC4C 4EQ6A 3EEOA 5E6UA 3W2EA 5G0UA 5JC1A 4F5EA 1Z37A 3JZAA 4PCUA 3HJBA 4DCOA 4OU4A 5C1OA 4UEQA 3VU0A 1RAEA 5EKXA 1M75A 4OXYA 2TMKA 1ECGA 3HG7A 1Q77A 1IXYA 4FHEA 4REOA 3IP7A 2P5TB 3FY4A 3KD2A 5EZ5A 1GZ3A 3WICA 3UK0A 1J20A 2I22A 2YCLA 4M8SA 4RIFA 4EUKA 2PX2A 4KO2S 5E0OA 2QUJA 4F2HA 1E1LA 1PJRA 4KX3A 2EBWA 3ET4A 3NG1A 5BP7A 4KYTA 3U7GA 5J4YA 4K8OA 2IU0A 5CUQA 3T7RA 1GTG1 3S5UA 4YQZA 4NCIA 5JNVA 4DLZA 3AH8A 1WS6A 2PE5A 4CMCA 3ZLVA 3GMIA 4ZO6A 1U2RA 1XZMA 2B61A 2DWQA 3OX1A 2CZQA 1Z12A 3EUEA 5KYYA 3UJNA 5D86A 4DDMA 4TL8A 3U3OA 2AG5A 1Z4IA 5HK8A 3LUHA 2FZVA 4HWGA 4A0QA 2NO9A 4CKYA 2UUCB 3V4LA 4MRAA 2DT8A 4L5BA 2LIVA 4N03A 4KRYA 4ZJPA 2JJMA 2I0FA 4BMSA 4AQYB 4LECA 5DRYA 2QLMA 3KAJA 3NU1A 2QQ5A 4DGQA 4P8RA 3QF4A 1XB2A 1VE6A 5A04A 1XTSA 2ZSFA 1CV2A 2R1VA 1YAJA 4O4LF 1Z5UA 4OGWA 4L8WB 1T8YA 4U4AA 1HEUA 3BIXA 4TQAA 4HAOA 1MTZA 2H5EA 3O8BA 4V1CI 1HDEA 2D1YA 1U2EA 2HSWA 4C03A 3DT9A 4PPGA 3TLKA 4FU0A 4PYQA 3UUWA 5GINE 4B35A 2FMHA 1O89A 1D9XA 2DX7A 2VF5X 3G0IA 4KGXA 1J39A 1AHIA 4INJA 5E2BA 3TYXA 3P52A 4H4DA 3G89A 4DAOA 4FYYA 4MQBA 1S2MA 4PIMA 4QPCA 4D92A 1XDUA 2H8GA 8OHMA 1T43A 3BL8A 4ZHQA 4XLTA 3IAEA 5LLDA 3GH1A 4BLWA 2NU7A 1V8DA 5KX5A 1Y89A 3HB9A 4L51A 1RMTA 3AV0B 4DVGA 4G0MA 1MIHA 3URKA 1RRFA 1OFUX 3KXIA 1KJZA 4K6CA 2IELA 4NOLA 4GYKA 1IE3A 3EGOA 5B7GA 3OOYA 4X9XA 3DDHA 2QZZA 1EX1A 1T8RA 1Z62A 2G0NA 2YVQA 3I76A 4B2YA 1S7GA 5IFLA 1GQ2A 1NQVA 3RFFA 3V97A 1Z0DA 1ZNQO 4N5DA 3L7LA 3JATB 1VI2A 3FPLA 4BFVA 2IYEA 1EUCB 2D3WA 4FMDF 1EFHA 3OP1A 4TQ9A 5LIRA 2VDNB 2WPDA 4MRPA 1OFHA 3LVBA 4BQQA 4PN3A 1T29A 4QAQA 5CK4A 3T3EA 1GKIA 4YS6A 1F20A 3EHDA 1N9GA 4GE3A 2Z43A 3RRNA 1G7RA 2WK1A 2O3JA 1AOXA 2WKSA 5DBHX 1ORTA 3TKLA 3K6SA 1TK2A 2HGZA 4HXYA 1M8GA 3TXXA 3U9TA 1Y6RA 4Z7OB 2FG6C 1VE7A 5TQ2A 4YHHB 1VB5A 1GPDG 3UFXB 1RHKA 3PC3A 1KPIA 3X1XA 2HM7A 1V96A 2XZPA 3IPRA 4O63O 1MQSA 1FL9A 4IFTA 3BB1A 4MV9A 3E53A 1ZM3A 1R74A 1Q50A 2BR4A 1GQFA 2GM9A 3A6FA 3IRUA 5AKHA 2ZRGA 4GLOA 1PG5A 4RXTA 3PGXA 1Y1PA 1MJNA 3FOWA 2FLWA 4IYRA 4W82A 3TAXA 1QLWA 2Y76A 4GKKB 2P2GA 3AUKA 3S29A 1U7OA 1N92A 3OOHA 3P2MA 3SEAA 4CF7A 3SM9A 1F2VA 3GLFA 2CLDX 5LQDA 1M2KA 4FUQA 2VWPA 3CVJA 2RB4A 3BIWA 3AL0C 3K9NA 3OZSA 1HE3A 1M9NA 1ZD4A 1T3TA 2B4TO 4JR2A 5DMXA 3DXFA 2WYVA 2GK3A 3D3JA 3LKBA 2QTVA 2YYYA 4LXTA 2JKYA 2I91A 1TKCA 3EE6A 2P2NA 4R83A 2PRZA 2QF7A 1VE9A 2IDMA 3K0AB 3CEJA 4FSXA 3PXGA 3SYMA 4BO5A 4IXMA 5B1YA 5JWOA 2C94A 1MD9A 4ZZ2A 1JSCA 2RH9B 5LQCA 4M1WA 1E6UA 3E82A 5JO9A 4IBOA 3HJNA 3VAAA 1QAMA 2VP5A 5JJKA 3M3PA 2BHSA 1MH1A 5HTOA 1Y4DE 1SHUX 3N75A 3QU2A 1QCYA 2A5DA 3BWXA 1OGJA 3FRIA 2P6OA 3MOSA 2CW5A 1LK0A 1U8XX 3DAYA 4A8PA 2B4RO 3HA3A 3WL8A 4AZ0B 3RV3A 3ZY6A 2IYXA 4FDTA 4R9SA 1KDZA 2WNIA 2C59A 2ZJ4A 1U6IA 3NDRA 4B48A 5IKMA 221PA 1THGA 3S2YA 2H4HA 5CHEA 3BRCA 2FPIA 1G66A 4LE1A 3KTOA 4UEOA 2ZB8A 3I01M 3TCKA 1DRVA 3MWKA 4HP8A 5DW0A 4CKXA 4L07A 1J21A 2ZR8A 4UBOA 4IDOA 2Q5EA 2XUHA 3IAM6 3QVMA 1NVAA 2TECE 4DQKA 2NN3C 2OCDA 4YRTA 3UFBA 5FL7A 4GXQA 2FQWA 1X39A 1HG0A 1NJFA 2H1FA 3B48A 3IBFA 3JVUA 3UMRA 2WYHA 3NYQA 3KOZA 4RA6A 4YC7A 3FPJA 4MI6A 1K7XB 3AESB 2YWRA 2LP4Y 4KG7A 1PT8A 3ON5A 4PIVA 2ZXEA 3CBQA 3BWEA 4EP1A 2Y1EA 5ALIA 4NX2A 1JIQA 2F3PA 3U40A 4X93A 3GG9A 3R1IA 4TSKA 2Q4RA 1QCZA 5H16A 5AOVA 5ICSA 1H6AA 3RSOA 3GFTA 4DQVA 2AOTA 3A05A 1NVGA 2O59A 5K0ZA 4W8GA 5CH3A 4BCBA 1SVLA 4IDCA 1U5BB 3O83A 3K1AB 3O9VA 4DR7B 3UC9A 4HR7A 4RZUA 2GCOA 2OBXA 3LHSA 1HX7A 1XCBA 3GEIA 3U7JA 4OK6A 1IOWA 2R8BA 2ZRPA 2VSNA 5D3ZA 4CQNA 3PICA 3H1TA 5AW8A 4JNKA 3E2PA 1DAIA 2HNKA 4QYMA 4ALLA 4WEOA 3KLNA 3ZHUA 4BV2A 4HDSB 3PEYA 2V9CA 1GNPA 1C3LA 2XAUA 3LSYA 2VDRB 4J0DA 5EWMB 5HF9A 3WGIA 2GAFA 4OOEA 3O8CA 3L1JA 2C2HA 1XQXA 3DOFA 3VPAA 1RYDA 4LZNA 5C37A 1C3OB 2X1LA 3WGOA 5A6SB 5JQWA 1MQAA 5FOTA 4C7JA 1CUIA 1EWRA 1SCBA 3FYSA 3P2OA 3C39A 3CQ9A 4PU0A 4ARBA 3EWNA 5EJ8A 1QVWA 5JS8A 3X1ZA 4NAHA 1T5TA 1TEVA 1V1MA 1W85A 3PIDA 1A0OA 3RSHA 3A10A 4TGLA 2JEOA 1R66A 2QVYX 3SCZA 1Z4NA 4D2IA 2BC9A 3HMKA 4XFJA 1ULHA 3U4GA 4IVQA 2CL6X 4Z54A 4QOFA 1XEXB 2PX0A 2VTDA 3QLVA 4P82A 3TZCA 1FXUA 1VYVA 5I4CA 2Z6QA 1H6CA 2B37A 2C3UA 4CV3A 2R62A 4EJMA 5BV1A 5C5DA 2VXCA 2C00A 3RJ5A 1NBME 1KL7A 1HQDA 2A6PA 1JEOA 4AY5A 2LCQA 4JMLA 1R12A 3WGUA 3D1LA 2QUHA 1M1YA 1PWXA 5JSYA 1DJOA 1L4GA 5JTUA 4R2XA 1G6HA 2GGSA 1PTKA 2G7MC 3CMCO 3O4JA 1I7NA 4OJMX 1H3EA 3ZQ4A 2FWNA 1O96B 5KTPA 2H2HA 1Z6QA 2UYOA 1UJ5A 4OKNA 4HQNA 1JAHA 3OE4A 1C7RA 1P31A 4PFQA 1PWZA 3KJGA 1VG0B 3FPAA 3GRVA 2A9QA 2WMOB 2YVLA 4MLDA 2FPOA 1DFGA 1UBHS 2J9GA 5KOJA 4ZRNA 1FB5A 4ZVQA 1JIUA 3TVYA 1QIFA 2C9ZA 4KGVA 2Z3ZA 1IWBB 1SQFA 1T9GS 4Q93A 4DMKA 2HRZA 4LGVA 5CB4F 2BHNA 3LCJA 2QT0A 1SCQA 2JGLA 2MYTA 5TJHA 5IK2A 1MRSA 3C3KA 1L5OA 4RESA 1DTWB 2WSSD 3GJSA 1JHRA 1EK0A 2A0UA 1MGOA 2OXIA 3VHXA 3TSOA 4QBGB 3EWIA 3PYMA 2PZBA 4N3GA 1TZ2A 2HA7A 2Q1WA 3DSRA 4BJHB 4EW6A 1RIFA 3I64A 4KB5A 2C97A 3WX0A 1S4MA 2VRNA 4IICA 4WE3A 4WLVA 3U48A 4A5SA 2ABWA 3LWBA 1QF9A 1FU7A 2GF2A 4JCOA 2AV6A 2IK8A 2VHZA 4O0LA 1G98A 2JCVA 1H42A 1NMEA 2B8TA 2J85A 3KKOA 1C7FA 3F71A 3KTAA 4P81A 3UYLA 4F45A 4DSZA 1FYEA 3LZCA 3TLJA 1F4PA 2V58A 2OWDA 1Z0AA 2ZE5A 2Z08A 5EWMA 1GCAA 1PEKE 3CZ4A 1JF8A 1BDHA 3GYGA 4B3BA 3L6EA 1ZGJA 5EIAA 3K9HA 1Q1AA 2PU7A 1DELA 4RVNA 1E7WA 2P79A 5COAA 3RIEA 2AG0A 2ZSKA 2X13A 1T13A 3S2EA 4EJFA 5CA0F 5HJ7A 2KMLA 1BO6A 2OPBA 3H4IA 3A6ZA 2FHPA 2FTKE 2J30A 2AX3A 1NYLA 2PWAA 3OQ6A 4YLEA 2GR9A 3FYDA 4E4YA 1EUDB 2GBLA 5KVSA 3IAAA 3IILA 3W4JA 3OKAA 5BSEA 2QZSA 2R84A 2Y9MB 1FEZA 4CKBB 1K3TA 5DSTA 4GYWA 1PZGA 5FPHA 1XTTA 3VDRA 4FCVA 1PJTA 2HT1A 4OHUA 4RIGA 3QBJA 1FFHA 1E6CA 1E3QA 3NDJA 1QRRA 4P7FA 4PPYA 4EKYA 1RWBA 4MGKR 4GPBA 2ATXA 4BPBA 5F3WB 5KOHA 2IKSA 5E1OA 1GNSA 3OY2A 3N2LA 4TXLA 3EVNA 1Y3IA 1R0ZA 3WGZA 5IK2D 2R25B 2VJQA 4JQOA 2ZAYA 4IGEA 3G5MA 2AF4C 1UBSB 4UOEA 4F6LA 2CHGA 3LI2A 3LQRA 1BQ4A 1YI0A 2BKVA 3DMDA 2QSYA 4NNOA 3U7QA 3WWDA 1M8PA 1UT5A 5EVCA 1ODFA 5G2OA 4CWAA 2ZANA 5HYVA 2R751 3DLPX 4LC1A 5TGZA 5KSPA 4V0LA 5BSTA 4UEKA 4I9FA 2RGCA 5HMLA 2OO5A 1F8YA 4KQIA 5AVZA 1AZSC 3G0GA 2VSQA 2HLHA 2YRFA 4ENUA 3DNPA 4NBKA 5HXAA 3ZWAA 3DTYA 3GLGE 1M2GA 4HX2A 3SZMA 2GBGA 5KUTA 4NP6A 5AK0A 1RQ7A 1P29A 1KMNA 3H87A 1SHTX 2O2EA 5YASA 3SJCA 3NWJA 3FNGA 4ECEA 3C3YA 2XRFA 4LXQA 5IEBA 2YJ4A 4GW3A 3I09A 4FCCA 4KYIB 2WJJA 3AY3A 1Z2OX 4YJGB 5TT1A 1NQ5A 2FFHA 2P69A 3I5UA 3FJ1A 3IT1A 4X7BA 2D5LA 2QDKA 1US8B 2WMYA 3FJOA 3L6RA 3GF4A 4OXRA 3K0AA 4LMPA 4RF2A 1J7JA 1PD1A 5KQSA 1O6CA 3CZ9A 3F3KA 3ZV3A 5CX1A 2OFWA 1DC4A 2BY4A 3OZDA 1WPQA 4AP6A 2W7TA 1Q1ZA 3QA3E 5CURA 1HNWB 1I10A 3PPIA 3NEJA 2WOJA 4B1FA 3HPQA 3TUIC 2CXNA 1ZJJA 2EKZA 2ZQ5A 3KKKA 3KZMA 2GNPA 2JAUA 3M9WA 3K3PA 3QQ5A 2B4YA 4HXGA 2AFIE 2X0FA 3WGHA 3AIOA 3BE5A 2AUMA 3F5QA 1KKLA 2QTMA 4H7JA 3A9CA 2NU6A 2CDBA 1Y5RA 5ERXA 1FTNA 2HADA 3FMPB 4PFJA 2XAAA 4A6XA 4FZVA 4E4TA 4XZ3A 1XU4A 4TLBA 2C4WA 2GVNA 2MU1A 4Y2XA 1KETA 3PL1A 4OHXA 4PM4A 2H11A 4Q37A 2V3VA 1F9AA 1L7OA 4H16A 2FCRA 4L1KA 4HLDA 3G7SA 1GCOA 2PS0A 4Q12A 5K2MA 3F6RA 3TMYA 5F3RA 4D80A 4YV1A 3COPA 1JKJB 1OKKD 2DPLA 2IW3A 3CY6A 4OIFA 1R4MB 4RZXA 4X5OA 2XPCA 2P67A 2JKVA 3ZCVA 1P2DA 2BCGY 4GP6A 3NEPX 2UZAA 4WASA 1U9ZA 4GWGA 1Z2DA 1CERA 2JFFA 2LDBA 4KDCA 5FORA 2IX9A 1NUQA 1Z88A 2WWGA 4OREX 1N9GB 2RI0A 1U5CA 1KMQA 4A2QA 1MC1A 5KNLA 3AUXA 1BOOA 1F2UA 4P2GA 1E79D 1WLYA 4X63A 1TYAE 5CK5A 5HQTA 5K0EA 1A8IA 3H7IA 2AZMA 1OX4B 1FP6A 4QYIB 4W7HA 1EUCA 5C46F 1VIYA 2PQ0A 3MK31 3Q8LA 4TMZA 1RMQA 2GD2A 3WAGA 1RI2A 1KYVA 4QJBA 3GCXA 3E84A 5F9MA 2XRYA 5LKRA 5LD2C 3UW1A 1SCUA 3BSWA 5DLDA 1NSYA 1SUIA 3DDUA 3KIPA 1R8YA 1VHQA 3M9XA 3NPAA 5JZ9A 3EC7A 2P8JA 3R5KA 2ZAGA 1R4AA 4IKEA 1OXSC 2PBLA 4JLAA 1K2VN 2F1OA 4NBVA 4QVGA 1JHMA 2I33A 3L3BA 4HDNB 3QITA 1E1QD 1ZK1A 2HT6A 1R4MA 1UZAA 2HNAA 4MUIA 4LQLA 4BNHA 1AUXA 1SXJA 1N2OA 2ILTA 2X0RA 3D6MA 2WP8J 1H23A 4IOJA 4F92B 3RK0A 4WBNB 1PO7A 2I6QA 3HCWA 5JRDS 2YJ5A 4N41A 4PRYA 1P60A 3F46A 5K0FA 1JE1A 3AJ8A 1JJAA 1OBCA 4IIDA 4YCBA 3RB8A 3LD9A 3N86A 3DXXA 4MV3A 4U7GA 4YH1A 5E6SB 1X8XA 4ADSG 5AXBA 5JSKA 2W2LA 3K1TA 3AKZA 3JYHA 3JW8A 4KDRA 1G7CA 5BOSB 1PQPA 2FWPA 3ONEA 1LH0A 5IH3A 5DNEA 2I3GA 3N6VA 3A1CA 1HOXA 4TYYA 4HAIA 4ZU3A 3WQQA 5IAAA 2O19A 5G40A 3IKVA 3I61A 1W44A 1QZUA 4RSGA 4DJAA 5CXQA 4OVKA 4YX9A 3U60B 4LSWA 2QX4A 3T61A 1EWYA 3NAZA 4QHSA 2H1VA 5IAGA 3NKVA 3DHEA 2GRJA 3K1AA 4K40A 5KDLA 4DCCA 3OQMA 2G36A 1RTTA 2WC1A 4J7AA 2CV1A 4FLEA 3WKCA 3M4YA 5J2TF 3RARA 1XCMA 1ZHHA 3N0VA 4LGYA 1MN6A 4HG2A 4WESB 4Y2QA 3V3TA 3FFWA 3OPYB 5K3OA 3FF1A 4KXQA 4UCFA 3EQZA 4U2KA 5LZ9A 2I4OA 1PSZA 2HCFA 1JDVA 3KCQA 3OM8A 3ZCPA 5GIPE 1QRSA 4BNDB 2JIDA 3CNEA 3ZIDA 4DDVA 1M74A 1GL9B 4A27A 1DIOB 3KAKA 2G88A 4RA6B 1L4NA 5DF1A 3RANA 4ZTZB 4OH1A 1QZ3A 1E1QA 4JKYA 4YLYA 2GKOA 4PSDA 4F8YA 3HSYA 2JHAA 3EAQA 1L5ZA 3LLVA 4WDRA 2C8KA 3AVPA 3E9YA 4JOQA 2CNOA 1VCMA 1VJRA 2X77A 2QNIA 3TRHA 1PUIA 3O6VA 4QGHA 3O2JA 2A57A 3NAQA 2PH7A 5EL0A 1GRCA 2OK7A 4RLFA 5EQFA 4O4LB 4CIWA 3K4PA 2PO5A 4ZMBA 1W1WA 4FINA 3G1WA 4KWHA 4P86A 2BLNA 4V0OA 1JDJA 3R74A 1F2TB 1V6SA 3PNVA 4H4CA 4P98A 3WK8A 4EGAA 1Q21A 3D3KA 5TJ9A 1G38A 3LUFA 3VPHA 4I4NA 2PUAA 3BQNB 2WB4A 1GN9A 5F9HA 1PQWA 2W2KB 1ZN2A 1JZSA 1WW2A 4MEJA 5G1OA 3PFHA 2YV1A 4G63A 1EVYA 3O3CA 2R60A 2CLOB 1P1IA 3I05A 2X8JA 3KKPA 4JI4B 3I12A 1K0FA 4TRRA 4MP3A 1CEYA 1NUPA 5CPBA 2YJGA 2YXNA 4I5IA 2XMZA 2CFSA 3COZA 4L5AA 4MUNA 4IOLA 3FNEA 1FUYB 3FBTA 2ETVA 3JWHA 4Q4CA 3N58A 4NECA 3GVCA 1AB5A 1B7GO 2DTDA 3EDRA 1B41A 3BGSA 3HO8A 1HDCA 2FH5B 3LL4A 4KQJA 4Y6LA 3FCSB 3ZJUA 1WM1A 4EW2A 2WD7B 2VQFB 1XZJA 2F62A 3OTIA 3HS3A 2UZ1A 1J06A 5FO0A 1F48A 1XIVA 1G4AE 1O97C 3HXQA 4GXRA 5IXSA 3DAGA 3PKZA 4ZQEA 3ANMA 2LRHA 3EF3A 4JJEA 4U5XA 2G3YA 5GM2A 1CHDA 3EIQA 2QLBA 3N8DA 1NU6A 2D0DA 1ISMA 2OO3A 5FWYA 1MOQA 1CNFA 3IQHX 3KOXA 4DIBA 2MINB 2V45A 4B6PA 3IUBA 1Q1NA 1HEYA 2NZVG 3DGFC 4JKIA 4Z8YA 2BSAA 4DG9A 4HN2A 4D9GA 1FBNA 4AWAA 1V9CA 2HRRA 3QOWA 1ZCJA 1LRLA 3ZWQA 4U6NA 4CETA 1QWOA 3OHMA 3L43A 2C5SA 3K6SB 3I04M 4C06A 4HDNA 3MTGA 1SOWA 3FDZA 2VP0A 3LRPA 2RJNA 1LC0A 2IVFA 1SHJA 1STOA 2O5EA 1PHPA 1G8KA 1WDLA 1PFKA 5DYNA 3ROXA 1MGPA 2IOFK 4ZRMA 3R5XA 1C3VA 4G4SP 2VPYA 1T3HA 4DKJA 3TLGA 2EXXA 1D6MA 3E4CA 4QTTB 3ABOB 2WTUA 1QUFA 5AM5A 3MWYW 1WZUA 1NPDA 3F1LA 4CFYA 5D2CA 3DPIA 2GZ2A 2C95A 3JQGB 4Q66C 3T5MA 3VR4D 3K16A 3KWLA 3CW2A 2ZB3A 3CUSA 5DHRA 5M5BA 3AUAA 3ZV5A 2A33A 4EAQA 1IRIA 3WIUA 1UFVA 4LJ9A 4DS3A 4I1PA 3WMXA 3BKXA 5AKKA 4ILEA 4JB2A 3FPCA 2RK3A 4RW0A 2FXIA 2R4TA 4JT4A 1FMFA 1JKJA 1UBOS 2H7XA 3CE9A 3T7EA 2HPAA 3KEOA 1WIWA 1T9BA 2AWNA 4DMRA 1QIGA 2J3DA 3MPOA 3MUNA 3W6PA 5L40A 3RIGA 2A5LA 2IPAB 4D82A 2C5HA 3OC0A 5DRTA 4KLZA 1XTJA 2C4TA 2JFUA 5EP2A 2AR7A 5I9BA 2X8BA 5BWCA 1PT9A 1OVGA 5EE1A 4BO0A 1BMQA 1WMBA 2G80A 4UULA 2OY0A 4Q82A 3BF8A 3WV4A 3ICOA 2DRIA 3FWPA 2HO4A 1E61A 3B5JA 2CNNA 1NRIA 4E21A 4I1RA 4EBFA 4ER5A 4PLCA 3K0SA 3THYA 4MVJE 3QMMA 4MQ4A<