5CH8A

Crystal structure of mdla n225q mutant form penicillium cyclopium
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
270
structure length
270
Chain Sequence
DVSTSELDQFEFWVQYAAASYYEADYTAQVGDKLSCSKGNCPEVEATGATVSYDFSDSTITDTAGYIAVDHTNSAVVLAFRGSYSVRNWVADATFVHTNPGLCDGCLAELGFWSSWKLVRDDIIKELKEVVAQNPNYELVVVGHSLGAAVATLAATDLRGKGYPSAKLYAYASPRVGNAALAKYITAQGNNFRFTHTNDPVPKLPLLSMGYVHVSPEYWITSPNQATVSTSDIKVIDGDVSFDGNTGTGLPLLTDFEAHIWYFVQVDAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lipase-Driven Epoxidation Is A Two-Stage Synergistic Process
doi rcsb
source organism Penicillium cyclopium
molecule tags Hydrolase
molecule keywords Mono- and diacylglycerol lipase
total genus 91
structure length 270
sequence length 270
ec nomenclature ec 3.1.1.-:
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ch8A00
4OCZA 4G1FA 3DJYA 1X70A 3RARA 5FUMA 3IVMA 2ES4A 3FBWA 4EA6A 3EQ7A 3NUZA 3UUEA 3EQ8A 1E66A 4WFKA 5DYWA 2Y6VA 4A16A 2RAUA 1UOOA 3B3QA 3WKEA 1A7UA 3AIMA 5FV4A 4XWGA 4Y2PA 1MAHA 4FLFA 3D3NA 4EZIA 1XZBA 1AC5A 5DTJA 4Y2QA 2I3DA 3O9MA 5ALDA 4B81A 2WTMA 5AM1A 1O6GA 3C6XA 4L72A 4TGLA 1UXOA 4LXIA 3X3HA 4OD0A 1Z68A 5HKAA 1HKHA 1VJ5A 4ZGBA 5LKRA 1QOZA 2J3DA 2ZYRA 3H1BA 3WJ2A 5IVKA 5JIBA 4KE6A 1X2EA 5HF5A 1JT2A 3OPMA 4N8DA 2YH2A 4IH1A 3HXKA 1L7AA 4CG2A 4H0CA 5ALHA 1XQWA 3LIIA 3DQZA 4G8DA 2CEKA 1RYYA 3W9UA 1XLUA 3AZQA 4Y2YA 2WUDA 1LPMA 1QLWA 3WWCA 3I6MA 4G4GA 3ILSA 1G5FA 2QZPA 4ZWNA 5JAHA 3ESDA 3AIKA 5SYNA 3BIXA 1GPKA 4BE9A 1K63A 5LZ8A 1BEEA 1W52X 3D0KA 4KACA 4MWSA 4F0JA 2ROQA 4GDMA 3IUNA 1HL7A 5A7FA 3FLEA 4K6HA 2QTBA 2WJ3A 1ORWA 2JIDA 5JAPA 1Y37A 3ANTA 5AI4A 5HQ3A 1HBJA 4JEIA 3D2AA 1ISPA 2GBCA 3NGMA 4Q3OA 2GBFA 2Z5GA 1XZMA 1MN6A 4UHEA 4JUIA 2WUFA 4DTCA 2Z3ZA 4P93A 3FVRA 2X5XA 4O08A 5JAUA 3KXPA 4KYVA 2XMSA 2ACEA 5AIAA 1U2EA 1GKLA 1EXWA 3C6YA 2XMBA 3STVA 1XQYA 3DLTA 3YASA 1GPLA 4I4CA 4JH0A 5CURA 2DSNA 4N8SA 4BP9A 4INZA 2XMRA 3RKSA 2G4LA 3WZLA 3WA6A 4MQMA 4CIAA 5AICA 1GKKA 2JEZA 4FBMA 1B41A 2WHQA 1XKLA 2C4HA 3WK4A 3DOIA 4FFWA 1YSCA 1H2YA 3STXA 3LIPA 2WFMA 4UPDA 5T4EA 1XZLA 4FNGA 4PW0A 4H7EA 2O2GA 3ZLUA 3IDAA 3ICVA 5AH0A 5IKXA 4C4ZA 1TRHA 2Z3WA 4B84A 4KE8A 1LPAB 4Y2RA 5AOAA 4FMPA 1R50A 2O2IA 2J4CA 4NVRA 3RK4A 3D7RA 4B0OA 1DT5A 3BDVA 5K3DA 4P08A 5I8PA 5JZ9A 5LZ2A 2WILA 5AOCA 3KDAA 2ECFA 4G4JA 4FOLA 3G02A 4AQDA 1FFAA 4M0FA 1XRNA 3H04A 2WG1A 3H1AA 4BVKA 1XROA 3AFIA 2VAVA 3AZOA 3H2JA 2QMQA 5DJ5A 2X8BA 3MUOA 2PU7A 2HDWA 3E1GA 2XUAA 2WIDA 1BS9A 2IX9A 3TJMA 4QA9A 3GROA 2P8SA 3FYUA 1ZD2P 4QZVA 4QDTA 3DCNA 5EHZA 1MNAA 2I03A 3H17A 1W75A 2Y1KA 3C6ZA 2XUIA 5AKHA 2BUCA 3D2CA 1JU4A 3V9AA 1ETHA 1R3DA 4EY8A 3E0XA 2WKWA 4XJVA 4X6UA 4UHHA 5ALFA 5JD4A 1E5TA 4QEKA 4UBLA 1MTZA 1FJ2A 1H2ZA 4Q1VA 1BROA 2H7XA 5AI0A 1A8SA 4IO0A 2OQIA 2C7BA 3WIBA 5FP0A 3VJLA 4PNZA 1TCCA 2QJWA 4E11A 1UT6A 3PE6A 3G9UA 1ZI8A 3H0CA 4BZWA 1FFDA 5AM3A 2OLEA 5ALJA 1H22A 4MEAA 2GYWA 2O7RA 3RM3A 5KWIA 1EVQA 4JYMA 1DX4A 4X6YA 2XUJA 2PVSA 3O0DA 3BJRA 1J06A 1WHTA 2QJRA 2WTNA 4W1QA 4B9AA 3QMWA 1P0QA 1CUCA 4X91A 2VQ6A 5K3AA 4WDQA 2WG0A 5AM5A 2VAXA 1R9MA 3AIOA 1TKRA 4V2IA 4H7FA 3GBSA 2HFJA 4QDOA 5EHXA 3MUNA 1BE0A 5DYYA 3ED1A 1QE3A 1X2BA 1BU8A 3NWOA 1O6FA 3WYDA 1GPNA 2JGLA 5AI9A 3VJKA 3KSRA 3C8DA 3QYJA 5AK4A 3C5VA 1BN7A 5HF9A 4U2FA 1LPOA 4OSEA 2PKYX 5F4ZA 2C0PA 1XQVA 4PSCA 3AZPA 4X85A 1ZIYA 3C70A 3K9BA 2CJPA 1LBTA 4QWMA 4CCYB 2HA4A 4CI9A 3ZLVA 1XRLA 4Y2JA 4KAJA 4UBIA 2RHWA 4UHFA 2V96A 1WB5A 1Q84A 5DLPA 4ARBA 5CW2A 1ZJ5A 2RONA 5LIPA 4C89A 4J0CA 3W04A 4Q05A 4E14A 1QONA 1QJ4A 4TVKA 4BTLA 1UZAA 4H77A 5CXXA 2G5TA 1BEZA 4HRXA 4GI1A 1UOQA 2XMCA 5E4TA 4BB0A 5CBKA 5C8ZA 5LLSA 4F5ZA 2C5FA 3DKKA 3HEAA 4PSUA 3OM8A 4F60A 1QIGA 2QRUA 2BUBA 3EQ9A 4X3CA 4A5SA 4DNFA 4E46A 2NW6A 4BCDA 4KE7A 2CUTA 4L0CA 1QTRA 4RE5A 5JD5A 2VJDA 3M82A 4DMCA 2B61A 4P92A 4BAGA 4BATA 4GHWA 5AM0A 2WHPA 1LBSA 1ZD5A 2CMFA 3GZJA 2Y2UA 3MVEA 4UHCA 5LZ9A 5K3BA 4KJXA 5ALPA 4QDZA 1C4XA 3EBLA 1CPYA 3QMMA 4B85A 5BV7A 5HFNA 4EY7A 5JADA 5JYCA 1Q0ZA 4BZZA 5ALVA 3AINA 3FAKA 5E2IA 5D3ZA 1MX1A 5ALRA 1YB7A 3O4GA 5A6VA 5C81A 2EEPA 4CIBA 3F9CA 2OGTA 3D4LA 2XB6A 1USWA 5CH8A 1LPNA 2XT0A 3I6YA 4QNNA 1XZKA 5FRDA 5A2GA 4FWBA 4EY4A 3WA7A 1DINA 4AO8A 1FFBA 1KU0A 1A8QA 2XUFA 5A7GA 3QZUA 2O7VA 1CLEA 1SC9A 3BF7A 3QBJA 4FFVA 5AKKA 1DQZA 3DEAA 2ZJ6A 2XUQA 1L7RA 2X76A 2I78A 1E89A 3DL7A 1ZJ4A 3DS8A 2PBLA 2ZJFA 5ALEA 4BP8A 3N0TA 6YASA 2JGIA 1CRLA 2XLCA 2OCKA 5AKLA 1WB4A 1YS2X 4DNPA 3B5EA 3WWPA 2PL5A 4MJ3A 3DKRA 1MPXA 2HRRA 5ALLA 1AMNA 2BJHA 1UKCA 4QLOA 5ALNA 3WLAA 2XUOA 1VOTA 2E3JA 3WI7A 5AHXA 2QOEA 5ALMA 4KEAA 4UUQA 3WYNA 1OCEA 3A70A 1EDBA 5ESRA 2XUHA 3G8YA 2AJ8A 5E4YA 2GBIA 1XQXA 3RLIA 1PFQA 2BGRA 3QM1A 3PUHA 4BVLA 4DGQA 3I1IA 4HRYA 2VTVA 4QLAA 3E3AA 3O4IA 1CUZA 1IVYA 2QR5A 4EHBA 2OAEA 2WUGA 1CFJA 3LCRA 5CMLA 2YYSA 4KR0A 4MYDA 1ZGBA 2OAGA 2AXEA 5DNWA 1VE7A 2RI6A 5A7HA 3I1YA 3ZLTA 5AKZA 4X7BA 3HI4A 4X6XA 4GECA 2BCEA 1CR6A 1Q0RA 4GXNA 2HA7A 4X94A 1DTEA 4QDXA 1EA5A 5BOVA 1DX6A 4BCBA 3C43A 2EDCA 1XZDA 5AK5A 1UK8A 3FYUC 4N5HX 3R3UA 4J0JA 1FSSA 5LZ4A 1G4HA 4Y2XA 1JKMA 5EFZA 3K6KA 3ANSA 5IVDA 3ZWQA 4HXEB 3AJAA 4AO7A 2CZQA 3FVTA 4LXHA 1TAHA 3T52A 3WL6A 2XE4A 1TIBA 3W05A 1E8NA 5JANA 1FFCA 1N1MA 1EB8A 1YB6A 5K3FB 1VZ3A 5AM4A 3D2BA 2ZYSA 5ALGA 1L7QA 3QPDA 4X71A 1CUSA 1R1DA 4UBJA 3WKCA 1CQZA 3NOXA 4B80A 1S8OA 4AO6A 3R0VA 1IZ8A 3FLAA 3V1LA 2R8BA 1N8SA 5AJHA 4YPVA 5JATA 2VJAA 2YXPX 1JJIA 2LIPA 4Q3LA 3I2GA 3CCBA 1XZGA 2C5GA 2HU7A 1W4LA 2B4KA 3LS2A 3STWA 1P0MA 2WFZA 1R88A 2JF0A 2XQIA 1JU3A 3PF8A 2G63A 1WM1A 4AN0A 4OB8A 1CV2A 5JZBA 1JJBA 3DL4A 2FJPA 3HRHA 2XUGA 4L9AA 4QWWA 3HLKA 4LHEA 1QFSA 5AO9A 3L1HA 4H7HA 1Y7HA 1TCAA 1DWQA 1ODCA 1WB6A 1EK1A 3K2IA 5HCUA 3PDCA 4FTWA 4QE3A 2H7CA 5AKJA 4EY5A 5DNUA 1VXOA 2XUDA 1Y7IA 2D0DA 4BRZA 1F0NA 4OU5A 5IH7A 3Q0TA 1QIKA 3MGAA 1A8UA 5EIAA 1HDEA 4A23A 4G4IA 4ZXFA 5AI8A 2B9VA 4K6GA 3BDIA 3P2MA 3H2GA 1GXSA 3QMVA 3L1JA 2WFLB 3G0CA 4MWTA 1BN6A 4OPMA 4EB0A 1C7JA 2QT9A 4HTAA 3WL5A 4H18A 5H3HA 2XDWA 3DYVA 1VXRA 3IIIA 1XRPA 3Q8WA 5K3FA 2IIVA 4BCCA 3H19A 5D3KA 4U2BA 4HZGA 4YX9A 1IMJA 2V9ZA 3R3XA 3WIOA 3VVMA 2R11A 1WOMA 4BDSA 4PSDA 1U4NA 3U1TA 1H2XA 1YASA 5AKGA 4OYLA 3GFFA 5C8XA 3H2HA 5EHNA 2PPLA 3WWEA 2QS9A 1E3QA 1LGYA 4X97A 3WMRA 1RP1A 1YA8A 2WIKA 3CCCA 1YAJA 1CIJA 3ZPXA 3DDUA 2VJCA 1TQHA 1BCSA 1DT3A 4C01A 2OXEA 1JMYA 1NX9A 5AM2A 4F21A 2XUPA 2IITA 4KAFA 1UWCA 2OGSA 1EDEA 1JI3A 2HA3A 3IB3A 4GW3A 3V1KA 4LIPD 3VJMA 3HC7A 3BL8A 3I28A 3WWOA 1SOMA 2HL6A 4BDTA 4FDMA 3U0VA 4HXFB 5LKAA 1C7IA 2JGMA 4OU4A 5CXUA 4GWLA 4DMHA 1UKAA 1CUEA 4LKOA 2BGNA 2W6CX 3W06A 2DHEA 3KD2A 4AX4A 2WHRA 1AGYA 5T4FA 4ARAA 3BE8A 3ESCA 2GZRA 5JALA 5ALKA 2Y2VA 3VVLA 3AILA 3WKDA 2RGUA 1QIIA 5AP9A 1CEXA 5EI5A 2RIPA 4W63A 4Y2SA 3IBTA 5C7YA 5CH5A 4C4XA 4I3FA 1G66A 2WIFA 3AUKA 3A6ZA 2PX6A 3BXPA 2FJ0A 5AK3A 2AJLI 4K6KA 4BBZA 1AX9A 5ALSA 2CB9A 1G42A 2Q0XA 4WCVA 3M3DA 1DWOA 4FNMA 4WJLA 5ALXA 2BFNA 1XZIA 1IUNA 1MX9A 5CT8A 5JZSA 3O4HA 3STTA 5D6OA 2QUBA 1ODTC 4U2GA 4DNOA 1RWQA 4RGYA 2OQVA 1THGA 4OB6A 1CUAA 2WIGA 4LXGA 1K6EA 5ALUA 4PO3X 4G9GA 5K3EA 4UHDA 4AB1A 1WPXA 2VT6A 3WK8A 4KRXA 4DMKA 5K3CA 3HJUA 3V1MA 4DYHA 3G0BA 4AMYA 5AKEA 3BIWA 2AJDA 4H7IA 1BCRA 2V98A 3OURA 5ALTA 1QTIA 2ZVDA 1MX5A 3F97A 5ALIA 4X90A 3FYUB 5FKJA 2JGEA 3LLCA 1XZFA 4OB7A 1KEZA 4W1PA 3UMJA 5DWDA 1LZKA 4BRSA 2K2QB 3I2HA 1IUPA 5LP1A 4CG3A 1I6WA 5JASA 4DLNA 3C8HA 1R4ZA 3PUIA 2I3ZA 2HU8A 3PICA 4G8CA 4J03A 2CBGA 4FHZA 1ZI6A 2HHAA 3I2FA 1T2NA 2W22A 5T4HA 5FDFA 3VDXA 3DNMA 1UK7A 1WHSA 4W1RA 4BE4A 3VISA 1K8QA 1Q83A 4BVJA 1OILA 1CUXA 1MU0A 2VEOA 3ICWA 4W9RA 2RHTA 3WK6A 5AK6A 3A2LA 4G8BA 4C88A 3N2ZB 2WLSA 4NMWA 4EY6A 4OUKX 1MNQA 3R41A 5HFAA 7YASA 3C5WP 1EK2A 2WG2A 2VT7A 3I2KA 1QIJA 5LYYA 5BWBA 4B83A 1VA5A 1UOPA 1QIDA 2XQGA 2ACKA 4IH4A 2JGJA 2VA9A 4K2AA 4YASA 1DU4A 1XFDA 2J4FA 3DOHA 1W1IA 1UKBA 3F98A 4C4YA 2CKMA 3QITA 2YASA 3R3YA 5ISMA 1VKHA 1R9NA 4HVTA 5A62A 1LPPA 5JARA 4BYMA 1XKTA 1ORVA 2PSHA 1F0PA 3OG9A 2H1IA 3STYA 1CUDA 3H2IA 1GT6A 3SK0A 1XRRA 3IA2A 2ZJ7A 1E8MA 1XLVA 4B0PA 1YAHA 1EVEA 1K5PA 5T4BA 3FNBA 4U2CA 1IUOA 4X93A 1EHYA 5ALZA 3HACA 4EUSA 1ZD4A 3HZOA 4XX1A 3TGLA 3CXUA 5DNVA 1SFRA 4MQLA 5HF6A 3G9TA 2JBWA 2BKLA 1VLQA 4PV7A 1DQYA 5CTAA 1W76A 2GYVA 2XQKA 4XIIA 5K5EA 2Y6UA 2J3QA 4KRYA 2WJ4A 4RNCA 3EIOA 1M33A 1WCYA 4ZV7A 2VATA 2WFLA 2XQFA 2OGZA 5IVIA 4HXGA 1IZ7A 3G9XA 4WY8A 1XZAA 4UHBA 2WJ6A 2ZYHA 3DD5A 4ZREA 2QUAA 5YASA 4G5XA 5ALYA 1QIHA 1H23A 2VF2A 2WQZA 5HZGA 1XRMA 3B12A 2XMGA 2JEYA 4LYDA 5BWCA 4KE9A 1LPSA 1CUUA 4UFOA 1HQDA 1ZGCA 4DMFA 1MO2A 2OCIA 2DHDA 4U2EA 1QZ3A 4B7ZA 4NZZA 1N5MA 1K4YA 1AQLA 5LZ5A 3WKBA 3WL7A 3WQHA 1JJFA 4N5IX 2ZSIA 3WKAA 3FCYA 5I7UA 4IH9A 4Y2TA 1AKNA 2PSDA 4X92A 2VJBA 3WK7A 1MJ5A 3V48A 2DQZA 3C6BA 3A2NA 3CN9A 2PSJA 3HSSA 3WL8A 3GELA 1QIMA 3G0IA 4CCWA 4TPKA 1LNSA 2UZ0A 1N5RA 4J0GA 4WFJA 4BAUA 1WPRA 4N8EA 5SYMA 5ALWA 3TRDA 1XZEA 4WDRA 5AI5A 5IVHA 3M83A 4PF1A 2XMDA 4DSZA 4P9NA 4FLEA 1J1IA 3CN7A 1JFRA 2V97A 4U2DA 3VKFA 2DFPA 4DM7A 3JW8A 2D5LA 3JYHA 1HLGA 1J07A 2HIHA 4S0XA 3GUUA 1EH5A 3FLBA 5CRIA 3W2TA 3IUQA 3UUFA 4UBOA 1XLWA 1NU8A 4XVCA 3W9BA 5HF8A 3SC2A 4G9EA 3S2ZA 4QDUA 4UFNA 3QVMA 2Z8ZA 5FPQA 1YA4A 3FOBA 2QKYA 3L1IA 1CUHA 3QH4A 3ZI7A 1HPLA 3HABA 5KWJA 3WWDA 4GBGA 4K5QA 2VSQA 5EIHA 1YS1X 1UK9A 1CVLA 3WZMA 1B6GA 4UBNA 4B9EA 5FPPA 2G5PA 4X00A 4BC0A 2PUHA 5AOBA 3LP5A 4C87A 1VA4A 1ZI9A 1SCKA 4DNQA 4W1SA 3O4JA 3STUA 4BAZA 4WY5A 2B20A 2DHCA 4H7DA 5HK9A 2HADA 1AUOA 5AKIA 5AI6A 5CT4A 5KBYA 1LPBB 2HA6A 4UBKA 4AN1A 1CUJA 3BJMA 1VZ2A 3JWEA 4CFSA 1EI9A 3G7NA 4GEGA 4Y2VA 4AXBA 2WHPB 4UFPA 2OCLA 5EHQA 3WK5A 2PSEA 4X95A 3OTQA 1PV1A 3ZV7A 4J3JA 5E4JA 2GBGA 2H7YA 1W6RA 1TCBA 5FOQA 2DQYA 1THTA 5DTIA 3SX4A 4JNCA 5A71A 1JMKC 2DCMA 4Q3KA 4E15A 2HA2A 2PU5A 1QO9A 4HS9A 1OXMA 1ZIXA 1F8UA 2DR0A 3OC0A 3G9ZA 1F6WA 2ORYA 4Y7DA 5AKXA 3I2JA 4UBMA 3D5EA 4WFIA 3F96A 2GYUA 1AZWA 1YCDA 1NU6A 4ZV9A 5JAOA 1CUVA 5HK8A 4D9JA 5I9IA 2WSLA 1H2WA 3KWFA 1U8EA 3H2KA 3IUJA 4HAIA 4H7KA 2WM2A 4RE6A 4FBLA 3PI6A 5AKYA 1EINA 1QFMA 1VE6A 3KWJA 2XLBA 2HA0A 4NS4A 3IURA 2QVBA 4DIUA 3D59A 2XQJA 4MXDA 5CT9A 4YK7A 1EDDA 1CUWA 3PFCA 1BRTA 1QGED 5HQ3B 1GGVA 3R3WA 1ACJA 4MEBA 3FCXA 1LLFA 3SWWA 2WU4A 4B6GA 3BWXA 3QPAA 2FUKA 2WU3A 2HU5A 1UFOA 2PSFA 1SCIA 5EIEA 1EB9A 3FSGA 4ROTA 1LZLA 3A2MA 1YR2A 3ESBA 1ACLA 4AZ0A 2BUAA 1PJAA 4MYSA 4JYPA 2QXUA 3PFBA 4FKBA 2XI4A 2AJBA 4RPCA 5ALQA 3WK9A 2O2HA 2XMQA 4Q82A 5EGNA 5CT6A 3DYIA 3FWHA 3R3VA 3G0GA 4B82A 4DSAA 4PQEA 1ZICA 2OCGA 3O95A 2JGFA 1QIEA 2BAGA 2JGKA 2GZSA 3S8YA 3H18A 5DYTA 2OG1A 1XZHA 3OOSA 1CUGA 4H35A 1MAAA 3WJ1A 1CUYA 3F8SA 1CQWA 4J0IA 1CUIA 3V1NA 4FLMA 1FFEA 1ODSA 4CCYA 3PF9A 3IULA 1QIFA 4CG1A 1ZOIA 5JD6A 2OPHA 5ALOA 3TEJA 4LYEA 5HKBA 1AURA 4KAAA 3KOOA 1SCQA 4OYYA 3GA7A 2HRQA 3R3ZA 3FSGD 4Y9SA 3M81A 2HM7A 4IQ4A 4GLBA 4ZI5A 5FXMA 1D07A 2PM8A 5LZ7A 3O9VA 1XRQA 3BF8A 4AMZA 1MT3A 3C87A 4EBBA 1EX9A 2Z8XA 2QM0A 2ONCA 4AZ3A 3EF3A 5D7BA 3I6ZA 4ITVA 4C6HA 4IHAA 4ZRDA 5CH3A 1DWPA 2FX5A 1XZJA 2XMZA 2XUKA 1KU6A 2H9YA 4J7AA 4J0HA 3VXKA 4BTVA 2EDAA 2PUJA 1GQSA 1CUFA 1UK6A 2QXTA 3T4UA 1U65A 2C0QA 1TK3A 1P0IA 3F67A 2WUEA 2HA5A 3QPCA 1GZ7A 5KREA 2AJCA 1GQRA 4Z49A 2ZYIA 3IUMA 4ETWA 5FLKA 2ZSHA 3E4DA 3FYTA 1T4MA 5J3JA 1P0PA 4L3WA 1J2EA 4I19A 2WIJA 4J0KA 2C58A 3ESAA 1CUBA 1XZCA 3HYSA 4BC1A 3I2IA 4M0EA 1A88A 5CT5A 5AIBA 5C8VA 1QO7A 3G0DA 2HFKA 4H7JA 3R40A 4J0DA 4M0MA 4Q34A 3C45A 1E8DA 1ZD3A 4Y2UA
chains in the Genus database with same CATH superfamily
2GAJA 2O3UA 1A77A 5BP7A 4UUAA 4G1FA 4G2TA 1X70A 1G64A 3CMCO 6PFKA 5FUMA 3KYIB 1G41A 4ZU3A 2WKSA 3OCZA 3L7JA 5C9ZA 2C2HA 1YDGA 1IVSA 2WA1A 2ZRBA 4Y9RA 2H52A 2HKIA 3UUEA 1DC4A 1I94B 2DAPA 3EQ8A 3UK6A 2EF0A 4NE7A 4OEHA 2GTPA 3W1WA 3QVSA 4WFKA 1Y9ZA 1NTOA 4UCQA 5DYWA 2O52A 2Q2NA 4I1IA 4B6RA 4CGZA 1ZSNA 1ZM3A 2ZS7A 3BJIC 3EXHB 4AICA 1I3KA 3L7CA 1U0HC 3GJ0A 2VRWA 2ZXUA 3AVOA 2XX3A 1Z29A 5BSUA 1E7RA 4BLSA 1TZKA 1UBCA 4OHXA 3ND7A 3GCZA 4WKNA 3OF2A 2Q9AA 2FPRA 1G8HA 1N2BA 3AR2A 3FHTA 3L7NA 1QO0D 4RTPA 1NJ5A 3EH1A 1QZUA 1QX3A 2A9RA 3OEWA 4FHGA 4S12A 4TRJA 5C1IA 1W5AA 1XZBA 1RCTE 4I5DA 5JC1A 4XUCA 2J9FA 4OKIA 2AQ8A 2GO7A 2H51A 3QFFA 2I3DA 4AJ9A 2AF3C 2QPAA 2Y8EA 4JKYA 1O6GA 3AHIA 4PLCA 3TE6A 2PUFA 1KO8A 3X3HA 3SF8A 1I2CA 5HKAA 3SIWA 3EPJA 3TL6A 5KYUA 4DPKA 5F2EA 1P2FA 4Z51A 4ZI7A 1HDRA 3UQYS 4GC9A 3BSWA 1E4EA 4Q4HB 1XMQB 4BIMA 1I4LD 3ZZTA 4DA7A 2IPLA 3DR5A 2BCGY 4ZO4A 1Y8CA 4HQLA 1N1DA 4KE6A 1MENA 2J9RA 2RAPA 3MELA 3EXAA 4W7HA 3P4XA 3OPMA 1Q1EA 3KTAA 1SBZA 2F1JA 4N8DA 3TM5A 3ASYA 3IAS6 3IJ5A 1CZHA 4CG2A 4P4NA 2DTDA 1XQWA 5CIQA 3HSYA 3LIIA 4G8DA 1XTZA 4MUFA 4CTMA 2G4CA 1RCFA 4TMVA 5H68A 5IARA 3U9SA 3AZQA 4EG6A 1DKOA 3MJRA 4TTAA 4U7GA 2X0JA 3WWCA 3MLAA 2I67A 3Q5EA 3DLPX 3DVAB 3H5AA 2QG4A 1JEJA 5KTRA 2BFOA 3F5FA 1NDQA 2E18A 4TWZA 2WZCA 1SG9A 2H5JA 3AIKA 5SYNA 5JCZA 2XT9A 1EUZA 4KQHA 1W4RA 4XA8A 5G2OA 3BH0A 5H82A 3HR8A 5K0BA 3TFOA 2F1RA 2ZAMA 1TC1A 2A9QA 5CP8A 5CFQA 4BQFA 1ULZA 2WQ6A 3ZJTA 5BRNA 1TJ5A 1N9GB 3FDZA 3MILA 4N9WA 4JQCA 2OHXA 3B6JA 4M9CA 1X74A 5LZ8A 5B1DA 3F78A 4M36A 3D0KA 4MYCA 3RKUA 4ENTA 5JWRA 1JFFB 4EDFA 1NMSA 1TO6A 4ZI2A 4ZJYA 4W7IA 1RJ9B 2JLZA 4CKZA 2ID4A 2E37A 3DEJA 1RQLA 4GDMA 4ZYXA 1V6SA 4ZYUA 3GDHA 1NVVQ 4DBLC 5A7FA 3MGKA 3FLEA 5DLYA 2VOJA 2XNKA 2AHRA 4RELA 3WDLA 2R60A 2QV7A 1PNOA 4NHEA 5KQSA 3WLMA 1U98A 2ZUEA 4PZ9A 2JFFA 1UWLA 1NBAA 3IUBA 2JIDA 3HL4A 1Y37A 2ZSAA 3ESZA 3FKSD 1P2GA 4YAKA 4NFSA 3KUUA 3U81A 4EELA 4ACBA 3AP1A 3JAKA 2VHJA 3CB2A 3HXPA 1QH0A 4J7CA 3TI9A 3GT4A 4RXMA 5HQ3A 3GLFE 1M2HA 1S2MA 1ZGJA 3NGMA 1MC8A 1RIFA 3ICOA 2Z5GA 5D2CA 4YMVA 4BGUA 5KO2A 3UB2A 1Z08A 2GR9A 3O6VA 3KP1A 5CYOA 3TMAA 4D92A 2Y1XA 4EFDA 1YR8A 4OQNA 4LY3A 2ODQA 3CRQA 1G21E 3HFSA 1SVIA 1REQA 3OT4A 1UXGA 1TJ4A 4KGZA 1A1SA 4R8KA 3ACDA 4FGKA 1SD5A 4YT2A 4JLDA 3EDOA 1PQUA 4GAEA 1THZA 1E99A 2N0SA 1AY0A 1KKUA 3A04A 3DFMA 4NCHA 1VLLA 1OHHD 3ENNA 5J4HA 3ZE0B 2XMSA 3ZHBA 2QW8A 3H5OA 2Q5QA 3DMPA 5AIAA 2ZSKA 1LRKA 4X8OA 2QY9A 3LY5A 5H1YA 2CDNA 2H8GA 3FNIA 2BM0A 4GE3A 2B1RA 4LSWA 4TXLA 5JECA 1HGXA 2YYAA 4NFHA 3HMQA 3STVA 3RO7A 5LOVB 2CVOA 2I5PO 2QDXA 1GPLA 4J6FA 4RL4A 4D80A 1LW6E 1WCIA 4RQTA 3TQTA 4DA0A 2DSNA 4BP9A 5EKTA 3B6ZA 1E1CA 1YTUA 1XX6A 3WICA 2XMRA 5GMOA 1QDLB 1UMBB 4LHWA 2GRAA 2EGGA 4CMKA 4MQMA 1QHNA 1WZIA 1SIWA 2EV9A 2P77A 4K9LA 5CVJA 4YFYA 4BV8A 2F43B 4RV5A 1MVOA 1GKKA 2G04A 4I5GA 3CVJA 5HMLA 5KYKA 1UBLS 1BWQA 3T38A 5ITSA 2VQDA 4OAQA 4UVHA 4UQLA 1B41A 2REOA 4TTPA 2GN1A 1XKLA 2WHQA 3TTTA 1KDVA 3AW8A 3HLTA 1RE1A 1UKYA 2CJWA 1B6TA 2EFCB 2XV1A 3WK4A 4JVSB 1QHXA 3QE3A 3BJZA 1DAPA 1H2YA 3STXA 5BOSB 4A36A 5HCIA 1PVVA 3WLEA 1L4YA 4I5IA 4UPDA 4OQLA 3DB2A 4FGWA 3T41A 2O3SA 4BFCA 2W2NA 5C1DA 1R6UA 1CK4A 2C42A 1ECPA 4YRBA 3F6SA 4XWTA 4PHCA 4GKAA 3OZUA 4DLKA 3ICEA 3K2QA 5EGSA 5IKXA 5AVKA 3IUYA 1E94E 4BRUA 4Q12A 1MFZA 1E61A 2R97A 3IBYA 4W6ZA 4C4ZA 4RVUA 4L5IA 2DWUA 2Z3WA 1IQUA 2GZ2A 4OTZA 4TT3A 4CTOA 1W5EA 1E6EA 1H85A 1MF7A 2RG7A 3A3YA 1U90A 1ZJZA 1PJSA 2OAQ1 1OLXB 4PWYA 4CL3A 4IGIA 4GOLD 1P1FA 4FGJA 1TM2A 2WE7A 1M0TA 2QYTA 3DBHB 1SU8A 3NONA 3EZGA 1LW7A 4FMPA 5DX8A 1R50A 3ZDQA 2WVAA 1V8FA 3VPGA 3TRIA 2I1QA 3O3MB 3BGOS 4B31A 3LWDA 3RK4A 2WF9A 1LF0A 3DMTC 4I81A 4QELA 3D7RA 1TJNA 3PJFA 1DT5A 1QNLA 4J1TA 4OHYA 1OC4A 2IUUA 1WU7A 621PA 3UAXA 2X7HA 5E4FA 3TVTA 4QU5A 4MROA 1CEYA 3KDAA 3CLSD 3ETEA 5AW9A 4G4JA 1J90A 1EFPB 2VSNA 3G02A 5K2MA 4YV0A 1FFAA 1P29A 3UKOA 3CVWA 1XRNA 2GCGA 1V1JA 3H04A 5E0OA 2O1SA 6ABPA 1UMDB 2GN8A 2Q46A 4KU4A 4G97A 4DIFA 1Y1RA 4F9GA 5DRYA 4FC6A 1SOAA 2QW0X 2Y1WA 3QY9A 5EWLB 4BWFB 4W5TA 4OMDA 2O2DA 2VAVA 3AFIA 4QBKA 2Z2IA 4BVHA 2JLXA 3AZOA 3H2JA 5DBFA 1HO3A 2NO9A 5P8WA 3LTNC 3K1YA 5DJ5A 2AWOA 5H5JA 4EY3A 5LQAA 2PU7A 4IVQA 4KYIB 3I73A 1R8SA 1MB4A 2XUAA 3E1GA 2WIDA 4KXQA 1FIUA 1H3EA 1H1DA 2VBFA 1SKAA 1GPUA 2B36A 2XWBF 3H86A 4TLCA 2IX9A 2I33A 1RACA 3GROA 3L2OB 4H6WA 3GLUA 3NOOA 3BGDA 2GZ3A 2EG9A 3QTBA 4HEQA 2DVMA 3CF2A 3R6TA 4R0NA 4LF5B 1G8SA 1NIJA 4QDTA 4CCSA 1ODKA 3DE1X 4TLLB 1FYDA 2HJRA 1L1QA 4CW7A 3QBDA 3SE0A 4FSDA 2G0TA 4GZ3A 2XVYA 1W75A 3IELA 5AUOB 1A5SB 2FFRA 2VRCA 2I1WA 3IVGA 4WKCA 4CI0B 5KNCA 1BVHA 1U0NA 4U5QA 4BBPA 3H99A 2BUCA 1UPFA 1JQLB 1AS3A 2YKGA 4Y6LA 3RVBA 4EY8A 2A9JA 3E0XA 2FLVA 3FPGA 4YCDA 1I7DA 4KLNA 3PEVA 4CEJB 1KXZA 2GARA 5JV5A 1O58A 1S3IA 4ND4A 4X6UA 1AKQA 5GM1A 3UCXA 3WRXA 4GOMD 3C3JA 3GGOA 4LRSB 2XB8A 4UHHA 2CBXA 3RRYA 4YAIA 5JD4A 5HS6A 3VPXA 2IEIA 4UBLA 1J70A 2DPLA 2C4KA 2QVGA 1FYWA 4QXOA 2IHZA 4O3FA 1BROA 2B78A 3DMTA 4TV9F 3PDJA 1T6BY 4IJ6A 3T7JA 4BFWA 1TQDA 3R24A 4NYMQ 3L7MA 4WXYB 1CHDA 2ZUBA 1QVZA 4X1IB 4FR5A 4E12A 3GFGA 5JJCA 3BK2A 3EYAA 8ATCA 2X5JO 3PQ4A 4I46A 1OGIA 3MTQA 3PC8A 4E11A 1HZZC 1M1ZA 3W8EA 2PGOA 3B60A 4EG3A 3PE6A 1NW6A 1VFNA 3N3BC 3U13A 1AB6A 1OSNA 2CXSA 5JNRA 3GLRA 1SQ0A 4G24A 3RIEA 3ZWKA 1JAXA 3WGUA 3KUCA 3PNYA 4HOYA 3G82C 4MEAA 1NRIA 5T6MA 2GYWA 2O4CA 4FKMA 3BGIA 1L6IA 3QTTA 2P11A 1CY2A 2X0KA 2RGNC 3TUJC 1EVQA 4HFNA 4DTIA 4D9EA 1NI5A 1ODIA 4YJFA 4DM4A 3DFKA 5IF3A 1DTWB 4HCJA 5MFZA 5I5GA 2PT6A 4BZQA 2FNAA 1SXJB 1RYMA 1J06A 2QYSA 3T3MB 3VQTA 2PX3A 2WTNA 3H9GA 4W1QA 2BH2A 2BI8A 4B9AA 1V26A 1T8SA 2P1DA 4HLCA 3PYLA 5K3AA 4RTOA 2P3OA 1JF8A 5H7XA 3D1JA 4D0RA 1ZWKA 2Y05A 4JHXA 3RAJA 3SDBA 4AKTA 2QTWB 4JT4A 1R9MA 2ABWA 3MS4A 3OBBA 3AIOA 4DSTA 1TKRA 4NY1A 2A0KA 4H7FA 3VYRB 4KFCA 1ENZA 4FYJA 3R6DA 3LT5A 2HCBA 3VR4H 3WTBA 1AV6A 1ZNWA 3P2KA 3TSAA 1NOIA 1RQ7A 4CM4A 5EHXA 4G1UC 5KTKA 1PK8A 4LYAA 4OJQA 3G89A 3N2IA 3EOBI 1AXGA 2VRBA 1NLYA 5AVWA 5E7IA 4IW3B 4FHCA 4JT2A 1L1FA 3VYVA 3OOYA 1O4WA 3G7UA 4MWCA 3NWOA 1Q0HA 3ZDXB 3JQ7A 1Z22A 1GPNA 3QX7A 2P2SA 5D5PA 4A3SA 4WVLA 4ABYA 4F92B 5J2UA 2CHGA 1RKVA 3I8OA 4E1VA 1ZONA 2CWDA 2Z9BA 4NBWA 2O8DA 2FW8A 3BHNA 3Q6IA 3QYJA 5AK4A 3TIIA 3UMVA 2KPOA 1TPZA 5FBVB 4U2FA 2V6IA 5EUBA 1TT5B 5ARDA 2I87A 3T3DA 3BIOA 821PA 1S8NA 6Q21A 2QORA 3DE5X 1SBHA 5HTOA 3RS3A 3VM6A 1MHTA 2RARA 3MQ2A 4HN9A 3ORHA 5GJCA 1XQVA 4HDOB 4DWOA 2Z5VA 1OIVA 4I4TB 4FM9A 2Z09A 1ZIYA 3I64A 2AFVA 5U9CA 4PHFA 3C70A 1G0OA 2QI9F 1FPQA 4EVSA 3K9BA 2DT8A 1XU4A 3GFOA 1UPAA 4H59A 4MUAA 4FFOA 4CI9A 4M4SA 3ZVRA 3IEVA 1QF9A 3OPYA 2WWWA 3L04A 1ZDMA 1IYZA 2O07A 4FSXA 1QXSA 4JEUA 1GAWA 1U2PA 4NFLA 4P36A 4IDFA 3BZWA 1QWSA 4TL7A 5I7OA 4IRXA 4UBIA 4JJ8A 1O5IA 1AQNA 2QRKA 1ZMOA 2VA8A 3OCJA 5FADA 2I8AA 4PN3A 5CUQA 3LHSA 1Z83A 1WWKA 4JYAB 2IYEA 2GNAA 3I04M 3O7MA 2AEMA 2RONA 1WG8A 2R00A 5C8YA 4J0CA 4FWIB 3ZWBA 4M0DA 1EQUA 1U0LA 2IWHA 3ZCRA 2HNKA 1VMEA 4P2BA 4EMUA 1RXIA 3K9QO 5HZKA 5ARBA 4NG4A 1NBEA 1Q0LA 3JYOA 5IULC 1QJ4A 2QRNA 1GVNB 3N86A 2SKEA 3ZQUA 3BWMA 4BQRA 3NHWA 2YXLA 4H77A 5BT8A 5ECGC 1MRSA 4Q4CA 4UPVA 2VF4X 3R7NA 2G5TA 3ET5A 1AO3A 1JPVA 1J5XA 1BEZA 2ZU6A 3JQFC 5K4AA 1LA2A 3N6VA 4HRXA 5D1NA 5C4IA 3SJ7A 3JARA 4JQZA 4PC2A 5CA0B 1Z6QA 1YUMA 1B15A 4TKZA 1PJ4A 1YR1A 1PR4A 2QUIA 1IL0A 1UOQA 3ABOB 4ZT6A 1UL1X 1YB2A 2BCJQ 3KLMX 2XMCA 1V11B 4JNKA 5E4TA 4BB0A 4KQJA 4E3ZA 3A6LA 4OXYA 5EAIA 5EOVA 4HH3C 4B87A 3GQVA 3KJHA 4U0KA 2X6TA 4FX2A 5EZYA 3DKKA 3HEAA 3C5CA 1NUAA 3KVOA 4NZMA 3BH6A 3TD6A 1GADO 1G20A 2G5CA 4PYNA 3N6XA 3N2YA 4QHSA 1ZSYA 4B4DA 1A0OA 4NCAA 4GZLA 1YBMA 1KVRA 2IXFA 1QJCA 4X3CA 2ZJ2A 3EFOB 3O74A 5I7AA 3BE4A 1KAEA 3F6BX 4JB0A 4KTTE 1M67A 1NHGA 2BEJA 5L3RA 1AGNA 1G18A 1E9BA 1W4AA 3ESXA 3EW7A 4XE5A 4D42A 1NVWQ 3SF8B 4A5SA 4PLZA 3PZRA 5EP3A 4BNLA 5I9MA 2WRZA 4E2FA 4TYWA 3F0TA 4AUEA 3N87A 1YIDA 2QAJA 4C76A 2CUTA 4I9UA 2H17A 3MNFA 1JIIA 2D3TA 1IATA 3NYQA 4RD3A 4W4TA 4X7RA 1A9PA 3QLJA 5FYDA 2NO5A 2GCOB 3DT8A 4EF6A 3U5TA 2ON6A 2C1EA 3OZBA 4ZVTA 3TJRA 2Z0MA 4WN9A 3K5IA 2X42A 4U8HA 1CNFA 1H69A 1YMUA 5I9NA 3DL2A 3LUDA 4WLVA 3O7WA 3L07A 1LEHA 4H4CA 3RK1A 2IY9A 2C5HA 3FDXA 4ZAGA 4I99A 1PJTA 1LBSA 1YL5A 4IDOA 4PIMA 5CU7A 1MABB 1PSWA 1Y8QB 3OCCA 3GQBA 2I4TA 4DXAA 1V7PC 2JAOA 1IN8A 4Z7NB 1LI5A 3E9RA 3KJNA 5B3LA 5K3BA 3D7KA 2D1RA 2ATVA 4II7A 4BKPA 1T6ZA 1PIWA 2CZCA 1DADA 3GJ7A 4QDZA 1AA6A 1JB1A 3UPTA 2X40A 3IHTA 4IHKA 2V6JA 1Z4MA 1KP2A 3LDUA 3UT5B 4XYBA 3AUXA 4B85A 1BJRE 4ENQA 5K0ZA 1QG2A 3AETA 3OX2A 5HFNA 5JADA 2C7RA 1Q0ZA 5LU9A 1NJ1A 5DEOA 3AINA 3AF5A 1NW8A 2QU8A 1UKZA 2QP9X 5E2IA 2QSZA 4YP9A 2YXBA 2P35A 4KN8A 4AS3A 4DQVA 4EG1A 3PGKA 1MX1A 1SBTA 3K1AB 3K05A 2JFOA 1YB7A 1PP4A 1YQDA 3O4GA 5HPYB 1ECJA 5FLXA 3P26A 1MB3A 3X1WA 4CEJA 4L5JA 3K1JA 2RD2A 1GL6A 2WT9A 3OZTA 1R9JA 4A15A 2XB6A 3GLHA 3LUHA 4RXUA 1I6LA 4CR7A 1DXOA 721PA 3K20A 2CLDX 3KU1A 5DYNA 4RMIA 4BTEA 3DAYA 2VWGA 4C05A 1NJ2A 3EVAA 1C3XA 3FMGA 2BZSA 3P5SA 3F7NA 3LPMA 2IDKA 2LD4A 1C3EA 4MRNA 4FW8A 4NULA 1DKLA 1XZKA 1EK6A 4LW8A 2V7EA 4TS4A 2O2XA 1Y3BE 5J2TF 4HNQA 3SJBA 1EXDA 3VHXB 1MJNA 5A4KA 4ZDJA 2GK6A 1Y7TA 5DI3A 3WA7A 1O0BA 3K53A 4ILKA 4M1OA 1VP3A 4YPFA 4A10A 2FDCA 3RRBA 1PFKA 1NYLA 1HEIA 4MWDA 2DU8A 2ZLBA 1XB2A 2ZUCA 1YZFA 1CZLA 3KPWA 3U3RA 5LP6F 4LRUA 2O3QA 2OV4A 4HLQB 1XAGA 4KMOA 1L5GB 3ZEAA 3ROXA 3QW2A 2HU2A 4JUFA 2C2WA 3WGGA 4MI1A 4FFVA 3N8KA 1Y9EA 4A6EA 2IS4A 2ID9A 1BQ3A 3FBTA 1VHJA 2FCRA 3ML1A 4TTVA 4AZ0B 2MINA 4XVUA 4F6CA 2Q1SA 1I3LA 2RB4A 1RBZA 4H3VA 4YRSA 1ISMA 1SBCA 2OZLA 1AZSC 2C7GA 3KUDA 3L4SO 5CFOA 4FONA 3E3NA 1H9CA 1AA9A 4HGQA 5TLSA 2UYCA 3GEDA 4YRNA 2D4AA 2QJOA 4NDAA 1L7RA 2RB5A 3LYUA 1QYCA 1K08A 4BMXA 4HG2A 3UJNA 5F3DA 4HSGA 3AUYA 2JZOA 1NI3A 1POWA 3VZDA 3QE0A 5BSGA 2J0SA 2QTZA 4CNQA 1WCV1 1WS6A 3QHPA 1NT2A 3M4NA 3R5SA 4PG6A 3PFKA 4DAOA 4URVR 2PBLA 2ZJFA 4BP8A 3R44A 2NTVA 2ZM5A 2IDMA 6YASA 5JROA 5K0GA 4MCIA 1AGRA 2QYOA 4C7BA 1Z4OA 5AKLA 3TO5A 9GPBA 3W5DA 1WB4A 4G41A 4DNPA 4DC9A 3B5EA 1JHRA 1TIKA 3HLYA 3LQ2A 3PJDA 4LZPA 3FCUB 4R69A 3WWPA 3FUCA 1P81A 4Z0PA 2ZT7A 3OIDA 3T9CA 4CLDA 1SAYA 1MPXA 1W48A 2HRRA 3NLLA 4O2BB 4PZAA 1IBLB 3RU7A 4Z4QA 3WIEA 1H4QA 4IZ6A 5JMPA 2ZIAA 5KYYB 3QNWA 1T2DA 3W6ZA 2I7CA 5GINE 2P90A 1WB9A 1MUUA 2V0CA 4DCMA 4FQ7A 2I3GA 2Z3VA 4OHZA 1BW9A 2AV6A 1SWWA 1BFKA 1GZUA 2X0IA 4K88A 4P53A 3E6AA 1NV8A 1PLLA 2R44A 3NVKI 1L4KA 3RJTA 4J16C 1MA3A 3M7IA 1SXHA 1Z2EA 4GXTA 4RVOA 4J2HA 3V1YA 5HYVA 3IUPA 1G3QA 4ARCA 4UUQA 4HX2A 1E2UA 1NUHA 2CKDA 3WYNA 3G8AA 1TMKA 3KK0A 3HR7A 3OCVA 4GZ6A 2VTBA 1N6RA 1ZAKA 4PHHA 2XYQA 3E2IA 3KOYA 4BX2A 3G8YA 1PTJA 1H3FA 3P9NA 4K1LA 4DQLA 1S2DA 3DZFA 2CDAA 2AJ8A 3FUXA 2FZLA 1OWMA 5JZOA 4DY4A 4M88A 2C78A 2PGLA 4BRWA 3HB9A 4CZ2A 4HWPA 3RLIA 3QWHA 4M7WA 4LOJA 2DHQA 3LT1A 2W11A 1XKQA 3DBLB 4CL8A 5INTA 3H83A 4X7PA 1SHKA 1QQTA 2Y1LA 3V46A 2X4DA 1P62B 3QE2A 4MW5A 5ED0A 4JU8A 4INJA 3NXSA 3E9NA 4HRYA 5EPOA 5DHUA 1RZRD 1FB5A 1N6PA 3CLRC 3KYBA 1MBZA 5MN5A 3I39X 4S1VA 1MO4A 1ADCA 1YI0A 4GSYA 3D6HA 1GUAA 1GP2A 2WUGA 3EZFA 2D62A 3H3FA 1TC2A 2GAIA 2YY7A 1IXKA 5DP2A 4RTLA 5JVDA 2BE7A 3DLCA 3EZ6A 3OZRA 2ERYA 3N76A 1W19A 2AG1A 3R5JA 1DJLA 2OAGA 2AXEA 1JLLB 2PR2A 1VE7A 3B2EA 3B53X 4HDCA 2IUFA 5A7HA 3U3DA 4DCUA 4I9FA 4I9HA 3WRXC 2QTMA 3TQQA 2JFGA 4X3PA 4J75A 5DGTA 2OV6A 5E6UB 4MGHA 4RH1A 1EMDA 2AN3A 3OEED 4YQYA 3RAPR 2WF6A 4V39A 1PYGA 3VV2A 4TXNA 3GNSA 3V7YA 1KSFX 2GA8A 1MAVA 4EOGA 4YAJA 1PL7A 2H1FA 4DT1B 3NH9A 1U3GA 3GXOA 1UMCA 1WXWA 3EHEA 3L93A 4MGYR 1DTEA 1ZHFA 2OHHA 3QVXA 4LDRA 4RABA 5BOVA 3RSHA 3RI3A 1Y81A 3FGZA 1XZDA 1D3AA 2W90A 4TLBA 5D01A 2YS7A 1CBUA 1JU9A 5HUJA 3VKHA 1RKUA 5AK5A 4XGKA 2FXIA 2YV5A 1QX4A 1QCYA 3DLAA 3HVKA 4ZEWA 3O47A 3WGYA 2ZJOA 1SA0A 4QGAA 3KLPX 3UVEA 5KTTA 1E60A 4AMUA 4JGGA 5EXTA 5FLYA 2W2KB 2WR8A 4U4AA 1DV2A 3JZFA 2WABA 1FSZA 3LDHA 3TZ6A 1ZJ6A 5IDWA 1JH9A 4CUKA 2AG0A 2OO7A 4P83A 3K6KA 3V00A 1IEVA 4CKCB 5DM70 2VDPB 2A4MA 3CF4A 3F9IA 3GFPA 5IVDA 1UIRA 4IJWA 2QX7A 1EVKA 3TK1A 1JTFA 4CRWB 2OFFA 4QARA 1QLJA 2AN4A 4HFRA 2CZQA 2OILA 4V0RA 3P27A 2PT9A 3INYA 1PEKE 3TW0A 3C8ZA 3MW8A 4JXJA 4O4HA 3RTBA 1PYOA 4DCGA 2CL5A 1SK9A 5IT5A 3R3SA 3C6MA 2VK2A 2XE4A 5C5DA 4E0BA 2C3PA 1TKBA 5JANA 3FPJA 1FFCA 1N1MA 1U3WA 2OBBA 2QMOA 3I23A 5DN9A 2ODNA 3WLLA 1T1GA 3N2LA 4NH4A 1ZQ1A 2Y9MB 3KUXA 4X71A 5BQ3A 2P6NA 1A98A 3CEJA 1YZVA 1PWXA 1N6LA 1WMSA 3EPPA 2OO5C 2MCFA 4HBGA 3WKCA 4WKBA 2ODPA 3DFZA 1CQZA 2OG2A 1WR8A 3ZCQA 4B80A 5TB5A 1QC5A 1Z8NA 1XPOA 2CLLB 2J4DA 2W6NA 3FLAA 1WIWA 1H05A 2R8BA 1N8SA 1WF3A 3KYDB 1I14A 5I3CA 5BNFA 4F84A 5JY1A 3L06A 2V54A 5JATA 1PX0A 1YJQA 1ZCFA 4QPDA 1VLMA 4TTRA 2LIPA 1G60A 2JKZA 3ADKA 4Q3LA 3VU3A 3O03A 3NEAA 3PHLA 1V39A 5DHQA 2PXCA 1VJTA 4FIDA 1XZGA 1NOJA 3PPWA 3T1HB 4CM9D 1IHDA 4AXXA 4P35A 5CG2A 2Z4SA 4NHOA 4U1RA 1ZMTA 4A0FA 1X77A 2I91A 1JNXX 3HA7A 3WGKA 1IRIA 2WWGA 5DLEA 4CDMA 4F1JA 3T5BA 3EGDA 3WB1A 4V2UA 4ZT3A 3EASA 1DL5A 1E1RD 1W2GA 2G63A 2AE2A 2P4EA 1PL0A 3C3EA 3CUVA 3PF8A 3JVVA 1OPXA 5DI9A 5HRAA 4EATA 3VBEA 2CE7A 3T1YB 1NJGA 3Q7EA 3A6JA 4LJRA 1KVSA 4DMGA 3IE1A 1E3SA 3ZIAA 4ECEA 2VYCA 3FUVA 3IP9A 1JJBA 3P52A 3TOZA 5A04A 5H59A 4DSNA 2EBWA 4BFTA 4RHUA 4CQMB 2GEFA 3EIFA 4E5KA 2X4LA 2W4QA 5BV2P 5AK0A 3HLKA 2MWMA 4LHEA 2J9FB 4BX0A 2HDHA 5AO9A 3OA2A 2JBHA 2G1UA 3L8EA 1H1LA 3QHAA 4OK5A 1NSFA 1TCAA 4J6EA 4LXXA 1EUCA 3K0AB 2GFIA 1U9CA 4X84A 1UBGA 1EK1A 3ESYA 4F12A 4NSNA 5HCUA 3VUFA 3THSA 5CFNA 5JRZA 4LKRA 4YCSA 4D1YA 4DEVA 2H2WA 6AT1A 2VCHA 4R51A 1VXOA 4RK0A 1Y7IA 1NJSA 1K98A 1A96A 5G02A 4BZXA 1F0NA 1M6EX 3PWKA 5CITA 3VR6H 4OLBA 4EQZA 2B8TA 4ZCPA 1P1IA 5CA1A 3NBMA 2VZLA 5CGZA 1QVRA 1A8UA 4JR1A 2YQ4A 1N2CE 4P54A 4OM8A 2Y0PA 3O2SB 4QYIA 4A23A 3HCWA 4BMVA 1TM3E 4JJGA 4MVXA 4ZXFA 1LD3A 4QUAA 4Y8VA 3RBZA 1QKIA 2PVPA 3VRHA 4DV5B 4PNHA 3BDIA 5DK6A 2Q3MA 3H2GA 2R6R1 4TL8A 3L1JA 3LUKA 3SX2A 2AMYA 4ZEOA 1H2FA 2C84A 3FB1A 1EWRA 5BQPA 2NUAB 2WFLB 3U40A 1GTSA 5HBRA 3KRTA 3U26A 3DPSA 4CTJA 1QGDA 4ZJPA 4MVJG 4E3WA 2G9RA 1FXSA 4KPYA 2NU8A 3EGVA 2RGGA 4EB0A 1JXMA 3V4OA 3LC2O 4NC9A 5BOSA 1IQRA 3M2TA 3PS9A 4PQGA 3J80A 3FWPA 2AFRA 3V42A 5EUCA 3WGNA 5H3HA 2XDWA 4K9RA 4DLWA 4WNAA 1SJ9A 5FB3A 1TF7A 3NZEA 1IZ0A 1M0SA 4F86A 1HUQA 2P41A 4ZVLA 1VXRA 1W88A 3Q8WA 4FCCA 1N6NA 4F06A 2VQ3A 5ITVA 3KQUA 1T3TA 4BCCA 5D3KA 5FX2A 1OU0A 1BHSA 1HDCA 2BRUA 2X3FA 3EFEA 1VHTA 4U2BA 2W70A 4I7EA 1I0LA 3WL3A 1IMJA 5ITWA 1FFGA 4Q39A 1CVRA 4I66A 1I2DA 2RHRA 2V9ZA 4JYCA 5DTMA 5ADWA 3R3XA 3WIOA 5KOJA 5TQVA 2BBSA 2XNDD 1USGA 2GRUA 1O2DA 5KX5F 1JEYB 4GI7A 2FN8A 1YQTA 4Q9AA 2FAXA 3NRBA 1Q0QA 4QOHA 3NNDA 4A92A 1IAVA 1TUBA 1H6BA 3CRNA 1VKNA 4BDSA 1U4NA 2RH4A 3EW9A 4FKZA 4L1KA 1V2HE 4H08A 3H1EA 2IKQA 5EG5A 3U1TA 1VP9A 2RAVA 1G55A 3F3MA 5KNCH 4HEHA 1E6MA 2M1ZA 4PZDA 4OLFA 5KNDD 1NURA 2FWRA 2A5YB 3H2HA 5GOTA 1UBOS 1O0SA 2PPLA 1VSQA 4L7QA 2RHOA 1E3QA 3WWEA 4AMVA 4BFSA 4UTOA 4UE3S 2PNFA 4WZZA 2BZ1A 3DPUA 5JUWA 3OQHA 1TYDE 1PJZA 2YHIB 3VNQA 5C1OA 1Y9DA 3OIGA 4H1TA 2WJAA 2YCLA 4QDKA 4W8GA 4P3PA 3C4JA 5KTOA 3N8HA 3DDUA 4DLPA 2P9TA 1LV7A 3CLRD 1YGYA 1XDZA 1DC5A 1ZIOA 2FY8A 4LK2A 5FFNA 4F3RA 3LRTA 4QJ3A 2TS1A 1Q22A 3OZSA 5IJ0A 1AM4D 1ZLYA 2VK1A 3LYAA 2QG6A 2VTBB 4O4JB 4RK6A 2O8BB 1ISIA 2CYBA 1G2QA 1ZM9A 1YRAA 2NO1A 3ZDZB 4JP2A 2B5OA 2OGSA 2FVXA 3OM9A 5LDDC 3J7TA 3HY4A 2J9XB 1DIHA 3VJMA 3KM0A 2B9EA 4FR0A 1MO5A 1Z6XA 3COPA 1E0DA 3IAAA 2H65A 3LP6A 3NAGA 2FWPA 2GZMA 3MA0A 4GSLA 1PQPA 4UUBA 4EG0A 3I28A 3K5WA 1H0RA 5K0TA 1F0KA 2AD5A 2Q3DA 1G6Q1 2R5NA 2CLIB 3G17A 4Z6KA 4MA0A 1DCTA 4ZZ3A 1GUDA 3ADBA 1CQIB 1DBRA 1SXIA 3L02A 4EW1A 1P2DA 1C7IA 5LKAA 4OU4A 4DMHA 3Q2KA 3CGWA 4ZOLB 1FW6A 4QFCA 2P68A 3UAYA 4LKOA 2JGNA 3SJZA 3GXBA 2AIRA 5MF6A 3IPRA 2ZWAA 1M2NA 1IBSA 3B82A 1GYQA 1U63A 4ZQFA 4MLZA 1RM0A 4EHNA 4RZUA 2HLDD 3FPAA 3TPZA 2H48A 1NNLA 3PNOA 1PN3A 5DN6A 3T9EA 1AGYA 4MULA 1WMFA 3PYXA 3T99A 5IC5A 3VTZA 1Z4QA 2K7ZA 4L76A 4D4LA 4QM7A 3BE8A 3LVFO 3IP6A 1Z45A 4I36A 4RK7A 4WASA 4F3TA 2Y0DA 3DXXA 3TSZA 2G72A 2Y2VA 3AKYA 2VPQA 3WKDA 3BIJA 3GA5A 1KRWA 5DPMA 5I9SA 2CUNA 1GKUB 2VDWB 4XFKA 1J0XO 5AP9A 4CM4B 2B7LA 4C7JA 3FHLA 1SUEA 5KJCA 5IBPA 2ZZKA 3QQPA 1SN7A 1VI2A 2EW2A 5AMXA 3RREA 3VZCA 4B8ZA 1FRNA 4UQPA 4C4XA 5BVHA 3ZZ1A 1FCJA 2R1VA 2GLTA 1G66A 3ZIAD 2Q3HA 1KZ7B 1VGVA 1W2WB 4GE0A 4TVBA 3AUKA 3S2FA 2F8SA 1C7RA 4BL5A 1XN1A 3BXPA 4XB1A 3BWEA 2ACVA 3RSGA 4OV6B 3ZK9A 3S5JA 1IN7A 1SG6A 2ZIFA 3NIWA 2PBZA 4P5DA 4PAOA 1U8YA 4D45A 1CHNA 2FI1A 1PR6A 1TVKB 2ANBA 3QG5A 2NP7A 1BIFA 3NHBA 2HSJA 2O2ZA 2YWBA 4A6DA 1S3FA 4IY1A 4YS6A 5ALXA 5JQGF 5LD2C 2WM3A 1A5BB 4TXMA 1EBUA 1SVWA 2J87A 2BFEB 2W5UA 1Y9JA 3LW8A 3TXAA 4RVCA 3M33A 2OCBA 5JZSA 2F67A 2NSLA 3THXB 1JILA 1GM5A 3TPCA 3DTYA 2F9FA 3A4LA 1DFGA 1ODTC 3C4QA 3COJA 1RWQA 2H63A 2XRZA 1ESZA 5J2UF 2TMDA 3K9FC 4OB6A 1ZH4A 2HCRA 2B7BA 3V8BA 1CUAA 2CHQA 3FCEA 3MRXA 4C4SA 2MINB 4Y2HA 3ZCVA 3H84A 2QRGA 4NU6A 1Q3KA 1W35A 3NIDB 2ZRGA 2Q6KA 1FFYA 1GWNA 4PLVA 4TLDA 1EZZA 4UU7A 1BX0A 2NIPA 4ZOLA 2H00A 2VT6A 1RHJA 2MSEB 3HWWA 1ZM2A 2PV0A 4N01A 1FQKA 1U7XA 2IPMA 5DTEA 3SHVA 3FJOA 3IQIX 3QW4B 2Z30A 1W8IA 3HGQA 3JQAD 4NK5A 5K3CA 5BXQC 2ATCA 2OO3A 4FFPA 3S99A 4NZPA 2IS6A 1T5LA 3JQ8A 2CW5A 2FPGA 5C2JB 1V5FA 3P20A 3N7AA 3RK0A 4EF4A 2YNMD 5AKEA 1WD5A 4M9SA 3OJEA 3U31A 3BIWA 2OHVA 4H7IA 1AHIA 3HTXA 1UJNA 3ILYA 3FPBA 1BCRA 2FFBA 3JVIA 4QT0A 3ABQB 3N0XA 1MQSA 2QGZA 3QYAA 3OP1A 3S55A 1JIUA 4CTNA 1FDRA 3KAPA 3G2NA 4P8RA 3UWDA 1X8XA 3LK7A 5EESA 4EI7A 5BY2A 4MUEA 2JH9A 3F97A 5AJUA 2G25A 3CH6A 4DIDA 3QEBZ 2QTVB 4E51A 3ZDBA 1HETA 2GM3A 3L8MA 4PG8A 3W2GA 2VL7A 4OFZA 2NXJA 4D3YA 3NWEA 4DR4B 2IYAA 1KIFA 4FZRA 4B6JA 2FSUA 2XDQB 4TTJA 3LLMA 4L3VA 4EX7A 3DZCA 3AH8A 1J2RA 5FKJA 1E6WA 1DAFA 2JGEA 4EZIA 2MMGA 4EI9A 1IEQA 4GMDA 4JSTA 1R0YA 1D03A 3JWHA 1JZQA 3LYLA 3IAM1 1V8ZA 2FZ4A 3T1OA 3CZQA 4YACA 4UDNA 1AHNA 4H4DA 4XTRA 4CE6A 1E59A 1N6OA 4W1PA 5IDYA 1IOVA 1W30A 4ON9A 2QR2A 4JLUA 2GH1A 4IPTA 1X7ZA 3T8YA 2XZOA 4O2BF 5KMGA 3ZHQA 3KU4A 3LRPA 3QU5A 3QBVA 3LPDA 5KDDA 1ESNA 1N6HA 1M1YB 1T8PA 1ZXXA 2G06A 3OBIA 1VI6A 3GPLA 3K0AA 4Q47A 1T2CA 2IOQA 3O8OB 4M1EA 4WX2B 4JBGA 1SCUA 2PRJA 3R0QA 2XCSB 4JP8A 2W2KA 3C8HA 2FN4A 1I2MA 2VZ9A 5EYPA 3TLJA 2E21A 4QGFA 1GARA 3PB3A 5I4KA 1RYDA 3BAZA 3N7TA 3GWZA 4BLPA 2CBGA 3AUAA 4MGIR 1WCIB 1UAAA 4KWEA 5COQA 1CY8A 3EDRA 1CD5A 4ETMA 3JZDA 3UB3A 5ENZA 3HXMA 4YMSA 5T5QA 4OQPA 4A8JA 2KW5A 1VLJA 5F51A 5ICCA 2HOQA 1NXVA 2V58A 2HHAA 1BGXT 3NBKA 5ICFA 4X1IA 2YJ4A 2W22A 3R7AA 2GDJA 5T4HA 2D0IA 5BSWA 1DAIA 3I5MA 4MNTA 4NAHA 1FJXA 3DNMA 3IDZA 3AV3A 1WHSA 3WOHA 2YHUA 1BDMA 4JA2A 4B3CA 3URMA 1QK5A 3M4XA 1NPDA 2GJ9A 4G09A 4BE4A 1R18A 4CMIB 1K8QA 2Q9BA 4RZIA 4BQSA 2VEOA 2EAUA 1KDOA 1TZJA 1ENOA 3A4TA 1QK3A 1TKAA 4W9RA 4HDMA 1BJTA 1XRSB 5EQTA 2IHNA 4HRVA 4F9FA 2BLNA 5HUHA 3CIOA 4KR2A 3MEQA 2OE2A 2A1UB 3GLFB 3PKJA 4DJTA 3EA5A 3ED5A 4NPAA 1OJLA 1Q77A 1FFXA 5AVOA 1EFAA 5MN4A 5J2TB 4MVJE 2XJ9A 4OUKX 4RFSB 5F73A 3R7FA 1NE7A 4BFYA 4PX5A 4BJ3A 1DIGA 1LDNA 2WJGA 2NUAA 2J9GA 3JQBA 1TVCA 4O4JF 2Y9PB 3KELA 1Y1SA 3L6OO 5KWVA 5ILGA 2B34A 1X7XB 2JB9A 2WG2A 3DHEA 4HLNA 4MRMB 3I2KA 2CJWB 1TT7A 1M10A 5L7YA 1FP2A 4UNPA 3HB4X 1NGSA 1XR3A 1Y5IA 3G1TA 3G1WA 4OKSA 1LBEA 1SURA 1UOPA 1BQ4A 1T1JA 1VA5A 1E62A 2Q3LA 4MP6A 1V1RB 4K40A 1MG5A 2HB6A 4K6CA 1MG0A 3QOXA 4KQ9A 1Z37A 4D5EA 3TQSA 5C4MA 2YW2A 5BW8A 1C29B 2YJ6A 5A2QA 4WERA 1XFDA 2QT1A 1R0CA 4DDMA 4F56A 2FXVA 3FF1A 1C50A 4MVJF 5CGQB 4F11A 3TKAA 1F2VA 1PUXA 4O4HB 2GSWA 4E5MA 4HPWA 1X7GA 3TDMA 5LP6C 1UZUA 5KAMA 5A4MS 4TSFD 1KZGB 3F98A 3H87A 3ZHXA 3K9CA 2E4YA 4ZHQA 2NSJA 2CKMA 3ZKAA 1EA7A 2OY0A 2XGSA 4PO8A 3Q3CA 1ZOLA 4Q9NA 4C78A 1MRZA 1XCGB 3R3YA 2CFRA 1VKHA 3MJCA 5EVJA 1R9NA 4YJGB 4CCAA 1OY1A 2GYYA 3UWMA 2GZAA 2GI4A 1BD4A 2R84A 4HVTA 3UOAB 1R2QA 2B37A 1JSZA 1TA4A 1P7ZA 2I2CA 5HKKD 5K09A 1KYYA 1P72A 2PTHA 5JARA 3GLGE 2PANA 3AY7A 1WY7A 5DP1A 4P86A 4PC7A 5HILA 1SB8A 4EPRA 2W9XA 2ZB2A 1P5RA 1QBGA 1ORVA 3RYCB 4L8WB 2D8MA 2C00A 5LSAA 4FI3F 4U7PB 3W8DA 3DE3X 4RKYA 2C4UA 3ASVA 4LC0A 2PSHA 1F0PA 4NARA 1KI1A 4I6GA 1U2SA 4LRXA 3OG9A 3TRFA 4BB9A 1EWQA 3F3KA 1ZNYA 1UM9A 2H1IA 3H11B 3O0TA 3FMFA 3R0ZA 3STYA 2FHSA 1RPJA 3DC2A 3OPNA 4M0UA 1O6CA 5JH7B 1CUDA 3H2IA 4J1QA 5TGTA 3RODA 2PFSA 3GFQA 3ZU3A 4DDHA 2BV3A 1CTQA 2JS7A 4TRNA 1OYOA 4UOZA 3T7RA 1XRRA 4AP5A 2ZJ7A 4XYLA 4GMFA 4AECA 2NZ2A 3FTPA 1BDIA 4KR3A 1DQRA 1WVGA 4J7XA 2Y92A 1EVEA 1K5PA 1LDMA 5T4BA 3KSZO 2E1RA 3CZRA 3Q3VA 4C5AA 1AV7A 1G3MA 5JDCA 3T5AA 5K0LA 1N9KA 3VHRA 3I4LA 3EQ6A 4B8YA 1K4KA 2FEXA 3P0IA 1OW3B 4EUSA 1ZD4A 4QBTA 4XX1A 4JKIA 3RHTA 3HDJA 2PO7A 1ORDA 5SY6A 4GPZA 2R0QC 2RG1A 4L07A 1JWAB 1YVDA 3D1VA 5HDBB 5B2FA 4PINA 4MWZA 4PCUA 2A7XA 2JBWA 1TCUA 4JBHA 3GH3A 1XTUA 3S7ZA 5IJ9B 4OMUA 2Q3EA 2V55B 5DEIA 1BRMA 1UKVY 4PV7A 4Z3DA 4Z4IA 2RHCA 3O4FA 5AQEA 3LNTA 3OMXA 3QKIA 2A1UA 2EFDB 3ZK7A 2Y6UA 1P3JA 1XTIA 1ZOSA 2CGEA 3ELDA 3ESRA 3F3SA 5AVYA 3ZHZA 4JQYA 3K31A 2WJ4A 1X80B 1DBQA 2O7SA 4HF7A 1I8TA 4RGBA 4AURA 1H6DA 4F1WA 1YQQA 3H3XA 4DV1B 1GRVA 3FRHA 3G79A 5JWHA 4O4LB 2VATA 2QU7A 4NCIA 2XVXA 3TR5A 4YV2A 1N2CA 2CNBA 2XQFA 2FWIA 1BKDR 3ABIA 5K01A 1U0OC 3UC5A 2OZPA 1VIYA 5FAKA 3CSUA 4HXGA 1IZ7A 4L9RA 1CF4A 5HFJA 3W8FA 3LE8A 5EKSA 5KHAA 1GGFA 2O8VA 3WLQA 2O8DB 4A8TA 1GQOA 3OJOA 1RJEA 3G9XA 3SEQA 4E2ZA 3PXAA 4MUJA 4Z2AA 1YGPA 1VE3A 1UM8A 3EEBA 1NQTA 2KWIA 4LUCA 3RC9A 4NYJR 2Z04A 2NVWA 5BW5A 1IK4A 4ZREA 4D56A 5ITZB 1F8XA 4LI0A 4O2AB 1K3FA 5YASA 1SOVA 3GEGA 3I8XA 3RB8A 1I33A 1QIHA 3FYCA 5BUQA 1H23A 3GLIB 2D1QA 2VF2A 4D8YA 2D5CA 2LPMA 2P9ZA 2X14A 4HDNA 4IX1A 4KH1A 4Y6PA 2XZLA 3JS5A 4LAFA 1QCDA 3BGWA 2A78A 2Q4DA 4PWZA 2IHBA 4RD6A 4RJ2A 5AHOA 1O1YA 4G0UA 1NVXQ 3QWFA 5KSWB 2MSCB 1TO1E 1JIJA 3HB1A 3KB6A 3AVPA 1UBUS 3KBBA 1A8IA 3II6X 4U63A 5AHRA 1UADA 2FEPA 2TMKA 5BWNA 1FMJA 2EW8A 1YOBA 1ICIA 1M6HA 1O03A 1AUPA 2RBGA 7GPBA 1T2VA 4DA6A 4C14A 3W8NA 1YZ3A 4DT1A 1EFCA 1U0GA 4FXPA 4YXFA 4QIHA 4DMFA 3DT9A 2J6CA 4PBSA 3F2VA 2OP0A 4TWBA 5D8DA 5JMOA 3THRA 2DHDA 4AD8A 2JIMA 3T5GA 2QP4A 4CR8A 2K87A 2IBSA 1PJRA 4TM8A 4CN9A 2YJNA 2RJ3A 1G5TA 3VGJA 1WZNA 2E82A 2GEUA 2FR0A 1POXA 5IZ4A 4KXWA 1FPMA 3GJTA 5LZ5A 3RIHA 1GTZA 1RM4A 1QQ6A 3T12A 5FULA 3E53A 3Q3IA 1UP6A 4M46A 1CZRA 4KFSA 2ISSD 4M21A 4K26A 3AWIA 1PFVA 1GU1A 3GV0A 4GUDA 5DE3A 4NBLA 2BHSA 1FF9A 4S1NA 4YDSA 5KC8A 1OF1A 2C20A 2WJHA 3PFGA 1NOKA 2BT4A 2FPSA 2X41A 1WMEA 4KGXA 3FCYA 4IH9A 5FO0A 4UDYX 4GS5A 5E7QA 3WK7A 4ACAA 3KHTA 4G4SP 2OOSA 3F1KA 3NRCA 4DR3B 2VUHB 2PZLA 3CN9A 2ZYGA 3GEIA 3KBOA 3LUCA 3ICCA 4R0MA 4MX8A 4MDEA 4V0LA 3PEYA 1QIMA 3T5TA 4NCXA 3NV7A 1A2KC 4CCWA 3VR6D 1X8LA 1W93A 3IPXA 1N33B 5JYEA 2VOEA 4AJKA 4KQKA 4TSKA 1G5QA 4YP6A 1GFWA 4J0GA 3WWYA 1YRYE 3O4VA 3IVRA 3NHKA 3DG9A 4X62B 3H5TA 3RC3A 3WY9A 2ZYWX 4WXRA 5BSVA 1IQPA 4IHQA 1I5OA 2V7XA 4PFJA 2PLFA 4MRVA 1OAAA 1ZM4A 4WDRA 4YCAA 1L4HA 2QN2A 3QUSA 2ATXA 3WTCA 2BWJA 2Q62A 4R7TA 2OHOA 3C1OA 3ZDYB 4IUCS 4AF7A 3AESB 5IVHA 4L0DA 1QSGA 3G49A 1OH5A 4DSZA 1MMFB 3QBEA 1J33A 3PHBE 1J1IA 2JHAA 2FK7A 3AR9A 4FLEA 4R1NA 5J59A 4MWBA 4MQ5A 3LX4A 4Z4CA 2Z8YA 4KQXA 2HQBA 1BE6A 1RI4A 1TM4E 2DFPA 3MXOA 4TMXA 3SBOA 3CG4A 4MP8A 1DS6A 3CKYA 3JYHA 3KZKA 1VJRA 4XRGA 3QX3A 2BMWA 5ES4B 2HV8A 1DKMA 4DJEC 5B3JA 4IUBS 3ZK8A 4GDFA 3ICQB 1IY1A 3PI7A 4PC1A 5CRIA 4JI3B 1HFWA 2DY0A 2JJ8A 1H4VB 2ZTSA 4FSHA 5FQNA 2BGKA 4KWIA 4MRAA 3GK3A 4ENWA 2E4UA 2J3EA 3ANNA 5C32A 4MS4A 4F2HA 4TV9B 2VDWA 3ITNA 2E89A 2POQX 4O1HA 4EUFA 3FI0A 3ZQ4A 2WY2D 4EG5A 2ZWIA 3KCNA 4R8LA 4KMMA 4TS9A 1Z7BA 4KQ1A 4UFNA 3QVMA 4URHA 3QFRA 4HUQB 2BLLA 1TUEA 2Z8ZA 5FPQA 4Z86A 2YVUA 3CLSC 3KTOA 2CWWA 3BEDA 3NBUA 1XAHA 4A2QA 4LSZA 3GLFA 1TQ8A 5JJ5A 5KDLA 4IRMA 4J3FA 3L1IA 3L4KA 1DDGA 1DC3A 4CQMA 3HABA 5KWJA 1Z5UA 4EKNB 4YH1A 1L7BA 1NVTA 3D5TA 2HMVA 3WRYA 2VSQA 4COOA 1Z82A 3CW2A 3AY3A 3IAS1 4PSVA 1J39A 4RWEA 2F48A 3WSTA 1X0XA 2CK3A 3U4MA 1HKUA 4NI5A 3SBEA 3WOVA 1J0AA 2YQZA 1IWOA 4C22A 4B9EA 4MUHA 3NR2A 2G5PA 4ERXA 1NR1A 1B93A 2ZEJA 1H8EA 1GPBA 2JI4A 3I32A 3IAUA 2JCGA 2PUHA 4IP0A 4QO8A 2X4GA 5CX1B 5AOBA 3SZUA 3P7MA 4JR0A 1B8PA 3MWFA 2V0GA 5WRFA 1GRNA 2I2XB 1PL6A 1VA4A 3F6RA 4TLMB 1L5NA 4AY3A 4UARA 2BM1A 4RVGA 3AK4A 1WUTA 4BV3A 4W1SA 3F7TA 1BWPA 3P32A 4RM3A 4WFQA 3TX6A 2I4OA 4WY5A 2IPOA 2L17A 3L0BA 4GP6A 2WNHA 4FNOA 2A9KA 2GETA 4JOSA 1KBZA 2HJVA 3D8RA 4GYYA 2WQ7A 1SQ6A 2ZIWB 2YRXA 1WF6A 4CV0A 3HQ4O 1VPEA 3RTEA 4RZXA 5A5EA 4LF8B 4GBED 1QO0A 3LD9A 4JBWA 2CMDA 2JGRA 3O8OA 2GOYA 1PVOA 2PG3A 4GZ5A 3WGJA 1U3VA 1AUOA 3KE9A 5DT9A 2G9ZA 1SD1A 3R6WA 4ZKEA 4YUXA 1QS0A 5AI6A 2PX0A 2XPCA 1LPBB 2HA6A 3MCZA 3EVGA 4CWAA 4RIEA 3Q5DA 3BXXA 4B6SA 1PHRA 3FMOB 3F6CA 1ZS9A 1DUVG 2Q1XA 3FYHA 5ER6A 3G7NA 1C0IA 5HCNA 2ZRHA 2YXDA 3UB4A 1R0RE 1Y4ZA 2G1KA 4BP1A 2C04A 1NPYA 4G81A 4D0SA 2ZI6A 1T91A 3CRRA 3F7OA 4UHJA 3LQFA 5IG2A 1EVZA 3JALA 3WK5A 4ALMA 4DBZA 2D5AA 4IIBA 3T4EA 2YMMA 1Z28A 3L4EA 2PSEA 3UV7A 2JAPA 1N2SA 2C4NA 2HHLA 4X95A 3LA8A 2XB2A 1L5HA 1PV1A 3ZV7A 4J3JA 4OI2A 1VE1A 2JC3A 1XMPA 5E4JA 4CQMD 4GX1A 2QD5A 3M6FA 2B30A 3L0CA 1OI2A 2VP0A 1G291 3ILHA 1UT8A 3USES 1KFBB 3WE7A 1LWNA 3O73A 4ZVRA 2G9QA 4DZRA 1KJQA 1TCBA 2P4HX 5EE0A 2II6A 4IIXA 4LVOA 5FJIA 5I48A 4OO3A 1T2FA 1OH8A 3KQQA 3FVWA 1ZU5A 4MYRA 5FOQA 5LQDA 4Z3OA 2NQ2C 1K75A 2QPTA 4I6EA 1R9GA 4HNHA 4DA8A 1LRJA 1Q3TA 4LV8B 1N7IA 4LJLA 2B1GA 2HGSA 3L4BA 1TMYA 1PZNA 4D0LB 3VNUA 2WM9B 3OHSX 2VDQB 2C8LA 3GP8A 2ZSJA 3A4VA 1CRWG 2W8BB 3ELBA 4GD3Q 1AS2A 1KI6B 2DCMA 2WHYA 4JBXA 3SEFA 3WQBA 2B4TO 4EECA 2PCLA 3ZXXA 2IOFK 4R31A 1HT0A 5JJKA 1OAKA 4ZCSA 2Q7DA 1KR5A 4W5OA 4R7ZA 4BYGA 2F2TA 4DL9A 1IBRA 1MB0A 3IKMB 2PU5A 5FIUA 3U7FB 3RRJA 3FTFA 3N9IA 4HS9A 5EZSA 4UD2A 4POOA 4Q93A 4XJSA 3UFBA 3NWPA 4RHXA 1KF0A 2R7AA 4LS3A 4KDCA 4M6WA 3HBFA 4EKEA 2M98A 4FZ5A 4PLTA 4PN7A 3HVIA 5DN6D 1E79D 1PR0A 2HLDA 3FDJA 2DZDA 3ENZA 4WOCA 3E9ZA 4Y7DA 1Y4SA 5AKXA 3ZGXA 1NVAA 1Z4NA 2HWXA 1J6UA 2X9GA 2XYVA 3LHKA 2OYSA 3X1JA 3ZVNA 3GLHE 1F7VA 5A4FS 3DVLA 3F96A 2W2XA 4FOTA 1HF3A 2VYVD 1XQ1A 1YCDA 1NU6A 1QH8B 3HUFA 5ICGA 3IT2A 4TZKA 4ZV9A 3LFUA 4EYKA 2O20A 3L8CA 1BX1A 3CZ5A 5HK8A 4D3DA 2PY6A 3NT2A 5EJ9A 5JDIA 3FOWA 1L9XA 1TLTA 1X80A 2Y67A 4GPAA 4I1RA 5JO9A 4AY5A 4CQNA 1YWGO 3H2KA 1BSVA 3PHHA 4KUGA 3WRWA 4WLEA 4HY3A 2B4AA 2VXYA 4JV5B 1FU8A 4ARUA 4D4IA 2GN9A 4MQEA 1PV2A 2YY6A 3WHLA 4CL0A 2ZIZA 1NQAO 3TCNA 2VPXA 5BWLA 5M7EA 1EFUA 1YRHA 3QVKA 1QK4A 3U44B 1LI7A 4EYSA 2YHBA 4L85A 4M9RA 4ZQHA 1KJYA 3EF1A 1V9CA 3OLXA 1T0JB 4PR0A 4LOLA 5EJAA 3Q4GA 3HUUA 2QVBA 4MKIA 3S5UA 5DGCA 1XVIA 4BO6A 4EHHA 1G8YA 4S05A 2XQJA 5CT9A 3A06A 1PGOA 3I04A 4UM9D 2E2WA 2R6GA 4O4LF 1CYDA 3Q7QA 3ETGA 3FWZA 3NHSA 1BRTA 1S3SA 2FZCA 2HBQA 2I2FA 1NA5A 2O2SA 3MINB 4FDUA 3NHAA 3ZQ6A 3R3WA 5IAOA 1ACJA 1KJ8A 3IIJA 1SUWA 4JLWA 5EJ8A 1L4EA 3CZPA 3FCXA 3R4CA 1VIVA 4IDEA 4K46A 4WCFC 3D43A 2WU4A 2D1TA 5PGMA 4KLCA 3DV9A 4LGMA 1GZ4A 2B6HA 4GLJA 4CEHA 3C6QA 3IEUA 4J07A 1JFTA 1P9RA 1PU2A 3FUWA 1D9XA 1U8UA 1K5DA 1Y33E 2JJMA 2C3UA 2PKQP 4RFLA 4P6VF 3PC6A 5DI3B 3TR6A 3ROQA 1ES9A 2GJ8A 5KYVA 4BNDB 1IMOA 1GAQA 2IYYA 1N5JA 5ER9A 4ARZB 2HU5A 4JENA 3EC2A 3OE4A 3ODPA 4KO1S 3U4DA 5BN3A 3BMNB 4TWIA 2HF8A 3K6RA 3JRXA 1XJ0A 3RVQA 2H1HA 1UJ6A 3S2UA 2JVKA 2B0JA 4L4YA 1LZLA 1OT3A 2GO1A 4C7MA 4M54A 5FLEX 3THXA 1M8KA 4LDPA 4HQRA 3M1LA 1EK5A 4Q3NA 3MGCA 3ZY3A 4AZ0A 1TNDA 3D3KA 1N5DA 1I4TD 4Y7CA 4B3TB 4RTSA 4MYSA 4MQFA 1H42A 3LT0A 4JYPA 3PFBA 2QVLA 4IMJB 3MSCA 3A9UA 3QLVA 1AUQA 4WLUA 2AJBA 4RPCA 4KPGA 3H42B 2X0DA 4XX0B 4C2UA 1JLRA 2H9IA 2RSLA 4DLTA 1KP3A 4LPSA 5CBPB 2O5EA 2CNWA 2O2HA 1Z26A 5H02A 1BA2A 1NXOA 2I55A 3EZ9A 4Q16A 2H2DA 2YJZA 3AVWA 1WQ1R 4LDZA 3U3ZA 3ZE2B 3LU1A 3DVAA 4C3VA 3GRFA 1V7CA 3DA8A 3EGOA 3DFUA 2QN3A 3VPCA 3GT7A 3A1EA 3HBJA 4EYGA 4G5OA 4TRRA 4WV3A 5FWYB 1M76A 3H1PA 4U7JA 5TY0A 1U1CA 4N7RA 4HWSA 3RS8A 3B1FA 1J9ZA 2YTZA 4D9IA 3GLKA 2YQ5A 3RJ5A 2GZSA 2H54A 3KEQA 2ZRCA 1GPWB 3S8YA 2X9LA 2DB3A 2YFQA 3TVDA 4GX5A 1FYEA 4ETIA 1B8VA 1ULAA 1R4NA 3PQ3A 3VC2A 1NVVR 1PS0A 1NI4B 1EP2B 4H35A 4C08A 2DPHA 2H1SA 1MAAA 3E7XA 1WW3A 5K8UA 1AHPA 3WJ1A 2QK4A 2QTVA 1VL5A 2UDPA 1VG0B 1CQWA 4RBNA 1GGKA 4X1KB 3WGTA 5CCDA 2AUTA 3AOGA 3ONEA 3PNQA 4MVCA 4OX9B 3OQJA 3NTOA 3TNYA 3SG0A 1X3LA 1FFEA 3NGXA 1ODSA 1WXFA 4P3OA 3GPCA 3ZJ4A 5A3RA 4NCBA 1PK7A 4I50B 3N53A 3DR3A 1JSXA 2QZSA 3U9TA 1T1SA 1ZEJA 1P61B 4Y6GB 3ZW8A 1WW2A 4HL6A 1YL6A 1KYXA 2CL6X 4GGMX 1FA9A 3D31A 4G0WA 2V9CA 3H4MA 3U7IA 2P4UA 4QICA 4QNMA 1V43A 4Y98A 1UQRA 2JLAA 2AWNA 3TEJA 1KBQA 4YP0A 4LYEA 5HDQA 2HY7A 1WULS 1AXRA 4GI5A 1ZRSA 3D54D 4B44A 1UF9A 3HDGA 3K8YA 4Y6QA 4UZFA 2Q8QA 4HEJA 1U81A 1SCQA 3ZWNA 4X1YB 2XGMA 1P9WA 4OHRA 4Y9SA 4QUHA 2B25A 4BC0A 1NAIA 4G1CA 4BLTA 3LBYA 4IQ4A 3MB8A 2F90A 3HXLA 1W7AA 4GLBA 1V5GA 4ZI5A 1UFRA 4RKFA 4NJMA 4TQ9A 4NENA 1JPNA 1ULTA 1THMA 4IR7A 1O9GA 4CFZA 5GTDA 2JLSA 2Q8PA 2WVGA 3EDQA 2HQRA 3QKRB 4LMAA 1TEHA 4OHCA 2NU9A 5FWXA 4UKDA 4YAGA 3NKFA 1XA4A 3A1DA 4E5PA 2VDMB 1KK1A 4RNDB 2AEJA 1Z15A 5FTJA 1MT3A 4XKJA 5IN4A 4EABA 2Q7XA 4LJKA 3VSAA 4B2PA 2L2QA 1EX9A 3PHCA 2ONCA 3A6DA 3CF6R 1ELOA 3TAUA 4EO9A 2JKYA 5E3IA 3TZLA 2Y99A 3JQCA 4ITVA 2YUTA 3GRCA 1E1DA 4ZRDA 5CH3A 5DNAA 1XPRA 4TMKA 1DWPA 2IS1A 2FX5A 2BSQA 2GPJA 2QL5A 5F52A 4JB8A 3BDAA 4ZAYA 5BRAA 5ICMA 5GONB 2WVJA 5TDHA 4DUGA 1WZCA 3CVYA 1RKXA 4MO9A 2FKAA 4W9NA 1NRWA 4TXJA 4B71A 3K9NA 4D6YA 1GQSA 4FT4A 4L22A 2GDZA 4M3NA 3WO1A 3ZXSA 1Y8ZA 1UK6A 3B20A 3HCBA 2CLEB 3ZUPA 2IDJA 1G1AA 4JLMA 4LQDA 3H13A 2JLVA 4M8NE 1PZHA 2O0HA 4Q1EA 4DLRA 4MUGA 3WGZA 2VZ8A 1C9DB 4WA7A 4IVPA 1NASA 1RI3A 2PXXA 2QL6A 5IYZF 1HFJA 5K3SA 5E8RA 3PR1A 5TXGA 5KREA 4AYWA 3IIMA 3LO5A 3M1YA 4PPNA 3AJ9A 3KR0A 2ZT6A 1PJ2A 2X8JB 2RHLA 4UM7A 2WPNA 3L8YA 1G16A 2DE0X 2ZYIA 3ASUA 5EERA 2MSDB 3A1CA 4Q3AA 5CXQA 2RC5A 1QR2A 3A9SA 5FLKA 4AW9A 2GVZC 3LWBA 2IYOA 4KUEA 3WV4A 4EK9A 2ZSHA 1Z62A 1JQ3A 1KTVA 1U1GA 1UBTS 2FQ1A 2YVQA 3H8WA 4IV5A 4KGDA 3TQRA 4IKOA 1FC0A 1TVMA 1A7AA 4YV1A<