5CHPA

T. maritima thyx in complex with tyc5-03
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of inhibitors targeting substrate-binding site in Mycobacterium tuberculosis FAD-dependent Thymidylate synthase (ThyX) through Virtual Screening: A New study de-fining the binding mechanism of Inhibitors
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Thymidylate synthase ThyX
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5chpA00
4GTCA 4P5AA 3G4CA 5CHPA 5JFEA 5IORA 1O2AA 3G4AA 4FZBA 3N0CA 1O27A 1O25A 2CFAB 1KQ4A 4GT9A 1O28A 4KASA 2CFAA 4GTLA 4KATA 4KARA 1O24A 5IOSA 5IOTA 4GTEA 4P5BA 5IOQA 4GTBA 4GTAA 3AH5A 1O29A 3N3YA 4GTFA 3N0BA 4GTDA 1O2BA 1O26A
chains in the Genus database with same CATH superfamily
3GTKC 2JA7C 4GTCA 1XXBA 3FHZA 4X6AC 2VUMK 3HOUK 3PO3C 3T02A 2R92A 1INNA 3HOYK 2PMZD 3L4KA 3HOZC 2PHCB 1ZXOA 4BBSK 4WJ4A 3H0GA 3GEHA 5M5WK 1F93A 2EBBA 3H0GC 2P5MA 2YU9C 3GTQK 3K7AC 2D6FC 2E2HA 4QIWD 3GDZA 1I3QK 3AD9C 1EI6A 2R93A 3S2HK 4GFQA 1UV7A 3GTQA 4C3HK 1YNJA 1IE0A 3GTKA 2W7VA 3S1QK 3M4OK 2E2IC 1HQMA 2R7ZA 3S1RC 4C2MK 3S14C 2PA8D 3GTLA 1O29A 3N3YA 1V5VA 1O2FB 1ZVUA 3S17C 4A93K 4BY1C 2CW0A 3H3VD 3AD7C 2BE5A 3QX3A 2A6HA 4YG2A 2PPBA 3GEEA 2NVQC 4FZBA 3S1MC 1WCMA 4KB2A 1B4BA 2E2JC 2ZFZA 1VH2A 3EQLA 3OEPA 1G51A 2ZUFA 3OPFA 1R9TC 1IS1A 1F7UA 3CQZK 3FOEA 4LK0A 1EQRA 1TWCC 3GTOC 4A3GK 4AH6A 2O5IA 1WOSA 3TFHA 2R93C 1RU0A 3N0BA 3HKZL 2NVTK 4WILA 3A8JA 3FKIK 1BGWA 2YU9A 1IW7A 3S1QC 4C3IK 4BBRC 3TFIA 4GTLA 1WOOA 1AB4A 4LR2A 3S2HC 1XZPB 3LPXA 4X6AK 3DXJA 5TMCA 1BS2A 5M3MK 2R92C 3GTGK 1TWAA 5L46A 1WQGA 4A3EK 4KMUA 5CJ9A 4Y52C 5TMFA 5IP7K 5EGHA 2VUMC 1K83C 5IORA 1DD5A 4OIQA 3ERED 3GTGC 4PAAA 4JK1A 4KASA 2RGRA 3RZOK 4A3IC 3Q3QA 4OINA 1I3QC 3WODA 3RZDC 5C4JC 2XCRB 1TWHC 1SFOA 3BP8C 5IYBC 1EK8A 5E68A 5M5YK 4GTEA 4P5BA 3M3YK 4OIOA 3CAGA 4A3FC 4Y7NC 2JH3A 3S16C 4BY7K 3SZZA 4GTDA 1DCPA 4P9SA 1L0WA 1Y1VA 1XZQB 1TWGK 3PO3K 4O2DA 3CQZA 2A6EA 3GTPK 3ADAC 4AYBL 5FLMK 3RZDK 2GAHC 3HOZK 4BXXC 1O24A 5IP9K 3FKIC 1HI9A 2NVYK 3HOWC 1WQFA 4DDQA 1TWHA 4A3MC 2A69A 3K7AK 5C4XK 4XSZA 1TWAK 4MEYA 2XCQA 4YFNA 4A3BK 4Q5SA 4A3LC 4QJVB 3H3VL 2R7ZK 1O2AA 3PO2C 1XXAA 1KQ4A 1TWAC 2V6UA 4QJVA 4MEXA 1VLOA 4LK1A 4A3JC 3TFJA 2PMZL 1SFOC 1Y1WK 4GTBA 3AH5A 1PJ5A 2JA8C 4PABA 5IYBK 3S0XA 3GTLK 4XSXA 2WAQL 3OREA 3H0GK 1TWFK 3G4AA 3GEIA 2CFAB 1XPPA 1O28A 1DCHA 2JA7K 3GTOA 1TWCA 3BP3A 4KB4A 3GTOK 1I6HC 3HKZD 3AQPA 5M3FK 4Y52K 4A3CK 3GTKK 2FQTA 2JA5K 3GSIA 3FOFA 1WCMK 2WB1D 3S14K 3S1MK 1C0AA 1X31C 2P8TA 4KC6A 3HOVC 1JVIA 3V4GA 3RZOC 3GTMA 1Y1WA 2CFAA 1TWGA 3HXAA 2NVXK 1B4AA 5D4DA 4KARA 4BBSC 1Y1VK 3S1NK 4M1XA 4A3LK 4KN4A 4Y7NK 4G7ZA 1R9TA 3TTGA 2WB1L 3T01A 1PJ6A 3HOUC 2NVTC 1I6VA 3GTQC 2ZUEA 1O26A 1WCMC 4A3KK 4ZH4A 4P5AA 2GSNA 4ILDA 5CHPA 1TWCK 2E2HC 3I4NC 1TWFA 4FM9A 2E2IK 2NVQK 5EGEA 3HOYC 2JA5A 3VA7A 2E2IA 3GTMK 3I4NK 3NUHA 4GTFA 3S17K 3LAPA 1YCLA 3HOXK 4LLGA 3GTJK 3I4MK 2JA7A 4A3EC 1O25A 4A3IK 4KDDA 2JA5C 5IP9C 2PA8L 3A8IA 1WSVA 4KAWX 4KATA 2O5JA 5IOSA 1WSRA 3BUEA 1TWFC 2B63C 5JVOA 4A3GC 2JA8K 1EFWA 4OIPA 5C3EK 5C44K 4A3DC 3AQOA 2WAQD 4G0UA 4Q4ZA 4G7HA 1TWHK 3IPJA 4XLNA 4KMAA 2JA6K 2E2HK 1J6WA 3GTPA 3S2DC 4NOIA 2JA6A 1K83K 4GT9A 3S15K 4C3IC 4C3HC 1SMYA 3MMLB 1WORA 2RH6A 4BY1K 4LJZA 1TWGC 5IYCC 1Y1WC 3GTMC 1XXCA 1USMA 2R92K 4WJ3M 3SZYA 5IYDC 1VRQC 2FQOA 4LOWA 1J98A 4C3JK 3S16K 3GIRA 1J6XA 2NVYA 1GE9A 5M5XK 4A93C 2A68A 3CQZC 4KM8A 1BJTA 1WOPA 3GTJA 2E2JK 4A3KC 2KWAA 3JSTA 1I50C 4C45A 3M4OC 5IOTA 1J6VA 1I6HK 1JQWA 5IOQA 3HOWK 1WIHA 3L4JA 4GTAA 4A3CC 5TJ3A 4C3JC 1YNNA 5FJ8K 2V6TA 2NVXA 1WQHA 4A3JK 1ISEA 2GAGC 1JOEA 1I50K 3T00A 4BLAA 3GTGA 1IBAA 1PJ7A 3N0CA 5C4JK 4LQYA 1IL2A 4G7OA 1XZPA 4G0VA 2GSOA 2Y0SL 1F9NA 5IP7C 4BBRK 3S15C 4C2MC 5C4XC 4QIWL 5HL8A 1O2BA 4OIRA 5IYCK 2B63K 3A8KA 3G4CA 4J3NA 2Y3PA 3PO2K 4BLBA 2NVYC 1O27A 5C44C 1YX2A 5C3EC 2NVXC 4KMDA 3S1RK 1USOA 4BXXK 4RMFA 3FKIA 1VGXA 4GZYA 4YFKA 4KN7A 3HOVK 4KMHA 4A3BC 1VJEA 2Y0SD 1I50A 1EH1A 1BDFA 4A3DK 4YFXA 4A3FK 3AD8C 1Y1VC 3S1NC 2R93K 5FLMC 1XZQA 3GTJC 3GTPC 2XCOA 1IQ0A 3I4MC 1R9TK 4AYBD 1ZBSA 3S2DK 5JFEA 5IYDK 1SFOK 4BKWA 1ZYRA 2GSUA 2V6SA 4XCHA 2B63A 4MQ9A 1I3QA 3HOXC 3GTLC 3M3YC 3LAJA 1DCOA 4G0WA 4A3MK 2R7ZC 1K83A 2VUMA 4BY7C 2YU9K 4KM9A 1ZQ1C 1F7VA 4XLPA 2JA6C
chains in the Genus database with same CATH topology
1GE9A 4GTCA 3FOFA 1XXBA 5EGHA 5IORA 4KC6A 1DD5A 4KM8A 3FHZA 1BJTA 3ERED 3GTJA 3V4GA 4KASA 2R92A 3GTMA 2RGRA 1Y1WA 2CFAA 1TWGA 3Q3QA 1B4AA 2KWAA 4KARA 2XCRB 3L4KA 4M1XA 5IOTA 2PHCB 1SFOA 1ZXOA 1EK8A 4GTEA 4P5BA 3H0GA 5IOQA 1R9TA 3CAGA 1WIHA 3L4JA 4GTAA 2JH3A 5TJ3A 2P5MA 4C3JC 4GTDA 2E2HA 2NVXA 1WQHA 1O26A 1ISEA 1Y1VA 2GSNA 4P5AA 4ILDA 5CHPA 2R93A 4BLAA 4GFQA 3GTGA 3GTQA 3N0CA 3CQZA 4LQYA 1TWFA 3GTKA 4G0VA 2GSOA 1O24A 1F9NA 4FM9A 2JA5A 5EGEA 1WQFA 2R7ZA 4DDQA 1TWHA 3VA7A 2E2IA 4C2MC 3GTLA 1O29A 3N3YA 3NUHA 1ZVUA 4GTFA 2XCQA 3LAPA 1O2BA 3G4CA 3QX3A 4J3NA 2Y3PA 2JA7A 4BLBA 1O2AA 4FZBA 1O27A 1XXAA 1O25A 1WCMA 4KB2A 1B4BA 1KQ4A 2ZFZA 4KMDA 4KDDA 3FKIA 4KATA 4KAWX 3OEPA 3OPFA 5IOSA 1IS1A 3BUEA 3FOEA 4KMHA 5JVOA 1I50A 1EH1A 4GTBA 3AH5A 3AQOA 4G0UA 3N0BA 2XCOA 4KMAA 3S0XA 1ZBSA 3OREA 5JFEA 1BGWA 2YU9A 3GTPA 3G4AA 2JA6A 2CFAB 4GT9A 1O28A 4BKWA 4C3IC 4C3HC 4GTLA 3MMLB 2GSUA 3GTOA 1TWCA 1AB4A 2RH6A 4LR2A 2B63A 1I3QA 3LPXA 4KB4A 1XXCA 1TWAA 3LAJA 4G0WA 1WQGA 3AQPA 1K83A 5CJ9A 2VUMA 4KM9A 2NVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTC A;  4P5A A;  3G4C A;  5CHP A;  5JFE A;  5IOR A;  1O2A A;  3G4A A;  4FZB A;  3N0C A;  1O27 A;  1O25 A;  2CFA B;  1KQ4 A;  4GT9 A;  1O28 A;  4KAS A;  2CFA A;  4GTL A;  4KAT A;  4KAR A;  1O24 A;  5IOS A;  5IOT A;  4GTE A;  4P5B A;  5IOQ A;  4GTB A;  4GTA A;  3AH5 A;  1O29 A;  3N3Y A;  4GTF A;  3N0B A;  4GTD A;  1O2B A;  1O26 A; 
#chains in the Genus database with same CATH topology
 3GTK C;  2JA7 C;  4GTC A;  1XXB A;  3FHZ A;  4X6A C;  2VUM K;  3HOU K;  3PO3 C;  3T02 A;  2R92 A;  1INN A;  3HOY K;  2PMZ D;  3L4K A;  3HOZ C;  2PHC B;  1ZXO A;  4BBS K;  4WJ4 A;  3H0G A;  3GEH A;  5M5W K;  1F93 A;  2EBB A;  3H0G C;  2P5M A;  2YU9 C;  3GTQ K;  3K7A C;  2D6F C;  2E2H A;  4QIW D;  3GDZ A;  1I3Q K;  3AD9 C;  1EI6 A;  2R93 A;  3S2H K;  4GFQ A;  1UV7 A;  3GTQ A;  4C3H K;  1YNJ A;  1IE0 A;  3GTK A;  2W7V A;  3S1Q K;  3M4O K;  2E2I C;  1HQM A;  2R7Z A;  3S1R C;  4C2M K;  3S14 C;  2PA8 D;  3GTL A;  1O29 A;  3N3Y A;  1V5V A;  1O2F B;  1ZVU A;  3S17 C;  4A93 K;  4BY1 C;  2CW0 A;  3H3V D;  3AD7 C;  2BE5 A;  3QX3 A;  2A6H A;  4YG2 A;  2PPB A;  3GEE A;  2NVQ C;  4FZB A;  3S1M C;  1WCM A;  4KB2 A;  1B4B A;  2E2J C;  2ZFZ A;  1VH2 A;  3EQL A;  3OEP A;  1G51 A;  2ZUF A;  3OPF A;  1R9T C;  1IS1 A;  1F7U A;  3CQZ K;  3FOE A;  4LK0 A;  1EQR A;  1TWC C;  3GTO C;  4A3G K;  4AH6 A;  2O5I A;  1WOS A;  3TFH A;  2R93 C;  1RU0 A;  3N0B A;  3HKZ L;  2NVT K;  4WIL A;  3A8J A;  3FKI K;  1BGW A;  2YU9 A;  1IW7 A;  3S1Q C;  4C3I K;  4BBR C;  3TFI A;  4GTL A;  1WOO A;  1AB4 A;  4LR2 A;  3S2H C;  1XZP B;  3LPX A;  4X6A K;  3DXJ A;  5TMC A;  1BS2 A;  5M3M K;  2R92 C;  3GTG K;  1TWA A;  5L46 A;  1WQG A;  4A3E K;  4KMU A;  5CJ9 A;  4Y52 C;  5TMF A;  5IP7 K;  5EGH A;  2VUM C;  1K83 C;  5IOR A;  1DD5 A;  4OIQ A;  3ERE D;  3GTG C;  4PAA A;  4JK1 A;  4KAS A;  2RGR A;  3RZO K;  4A3I C;  3Q3Q A;  4OIN A;  1I3Q C;  3WOD A;  3RZD C;  5C4J C;  2XCR B;  1TWH C;  1SFO A;  3BP8 C;  5IYB C;  1EK8 A;  5E68 A;  5M5Y K;  4GTE A;  4P5B A;  3M3Y K;  4OIO A;  3CAG A;  4A3F C;  4Y7N C;  2JH3 A;  3S16 C;  4BY7 K;  3SZZ A;  4GTD A;  1DCP A;  4P9S A;  1L0W A;  1Y1V A;  1XZQ B;  1TWG K;  3PO3 K;  4O2D A;  3CQZ A;  2A6E A;  3GTP K;  3ADA C;  4AYB L;  5FLM K;  3RZD K;  2GAH C;  3HOZ K;  4BXX C;  1O24 A;  5IP9 K;  3FKI C;  1HI9 A;  2NVY K;  3HOW C;  1WQF A;  4DDQ A;  1TWH A;  4A3M C;  2A69 A;  3K7A K;  5C4X K;  4XSZ A;  1TWA K;  4MEY A;  2XCQ A;  4YFN A;  4A3B K;  4Q5S A;  4A3L C;  4QJV B;  3H3V L;  2R7Z K;  1O2A A;  3PO2 C;  1XXA A;  1KQ4 A;  1TWA C;  2V6U A;  4QJV A;  4MEX A;  1VLO A;  4LK1 A;  4A3J C;  3TFJ A;  2PMZ L;  1SFO C;  1Y1W K;  4GTB A;  3AH5 A;  1PJ5 A;  2JA8 C;  4PAB A;  5IYB K;  3S0X A;  3GTL K;  4XSX A;  2WAQ L;  3ORE A;  3H0G K;  1TWF K;  3G4A A;  3GEI A;  2CFA B;  1XPP A;  1O28 A;  1DCH A;  2JA7 K;  3GTO A;  1TWC A;  3BP3 A;  4KB4 A;  3GTO K;  1I6H C;  3HKZ D;  3AQP A;  5M3F K;  4Y52 K;  4A3C K;  3GTK K;  2FQT A;  2JA5 K;  3GSI A;  3FOF A;  1WCM K;  2WB1 D;  3S14 K;  3S1M K;  1C0A A;  1X31 C;  2P8T A;  4KC6 A;  3HOV C;  1JVI A;  3V4G A;  3RZO C;  3GTM A;  1Y1W A;  2CFA A;  1TWG A;  3HXA A;  2NVX K;  1B4A A;  5D4D A;  4KAR A;  4BBS C;  1Y1V K;  3S1N K;  4M1X A;  4A3L K;  4KN4 A;  4Y7N K;  4G7Z A;  1R9T A;  3TTG A;  2WB1 L;  3T01 A;  1PJ6 A;  3HOU C;  2NVT C;  1I6V A;  3GTQ C;  2ZUE A;  1O26 A;  1WCM C;  4A3K K;  4ZH4 A;  4P5A A;  2GSN A;  4ILD A;  5CHP A;  1TWC K;  2E2H C;  3I4N C;  1TWF A;  4FM9 A;  2E2I K;  2NVQ K;  5EGE A;  3HOY C;  2JA5 A;  3VA7 A;  2E2I A;  3GTM K;  3I4N K;  3NUH A;  4GTF A;  3S17 K;  3LAP A;  1YCL A;  3HOX K;  4LLG A;  3GTJ K;  3I4M K;  2JA7 A;  4A3E C;  1O25 A;  4A3I K;  4KDD A;  2JA5 C;  5IP9 C;  2PA8 L;  3A8I A;  1WSV A;  4KAW X;  4KAT A;  2O5J A;  5IOS A;  1WSR A;  3BUE A;  1TWF C;  2B63 C;  5JVO A;  4A3G C;  2JA8 K;  1EFW A;  4OIP A;  5C3E K;  5C44 K;  4A3D C;  3AQO A;  2WAQ D;  4G0U A;  4Q4Z A;  4G7H A;  1TWH K;  3IPJ A;  4XLN A;  4KMA A;  2JA6 K;  2E2H K;  1J6W A;  3GTP A;  3S2D C;  4NOI A;  2JA6 A;  1K83 K;  4GT9 A;  3S15 K;  4C3I C;  4C3H C;  1SMY A;  3MML B;  1WOR A;  2RH6 A;  4BY1 K;  4LJZ A;  1TWG C;  5IYC C;  1Y1W C;  3GTM C;  1XXC A;  1USM A;  2R92 K;  4WJ3 M;  3SZY A;  5IYD C;  1VRQ C;  2FQO A;  4LOW A;  1J98 A;  4C3J K;  3S16 K;  3GIR A;  1J6X A;  2NVY A;  1GE9 A;  5M5X K;  4A93 C;  2A68 A;  3CQZ C;  4KM8 A;  1BJT A;  1WOP A;  3GTJ A;  2E2J K;  4A3K C;  2KWA A;  3JST A;  1I50 C;  4C45 A;  3M4O C;  5IOT A;  1J6V A;  1I6H K;  1JQW A;  5IOQ A;  3HOW K;  1WIH A;  3L4J A;  4GTA A;  4A3C C;  5TJ3 A;  4C3J C;  1YNN A;  5FJ8 K;  2V6T A;  2NVX A;  1WQH A;  4A3J K;  1ISE A;  2GAG C;  1JOE A;  1I50 K;  3T00 A;  4BLA A;  3GTG A;  1IBA A;  1PJ7 A;  3N0C A;  5C4J K;  4LQY A;  1IL2 A;  4G7O A;  1XZP A;  4G0V A;  2GSO A;  2Y0S L;  1F9N A;  5IP7 C;  4BBR K;  3S15 C;  4C2M C;  5C4X C;  4QIW L;  5HL8 A;  1O2B A;  4OIR A;  5IYC K;  2B63 K;  3A8K A;  3G4C A;  4J3N A;  2Y3P A;  3PO2 K;  4BLB A;  2NVY C;  1O27 A;  5C44 C;  1YX2 A;  5C3E C;  2NVX C;  4KMD A;  3S1R K;  1USO A;  4BXX K;  4RMF A;  3FKI A;  1VGX A;  4GZY A;  4YFK A;  4KN7 A;  3HOV K;  4KMH A;  4A3B C;  1VJE A;  2Y0S D;  1I50 A;  1EH1 A;  1BDF A;  4A3D K;  4YFX A;  4A3F K;  3AD8 C;  1Y1V C;  3S1N C;  2R93 K;  5FLM C;  1XZQ A;  3GTJ C;  3GTP C;  2XCO A;  1IQ0 A;  3I4M C;  1R9T K;  4AYB D;  1ZBS A;  3S2D K;  5JFE A;  5IYD K;  1SFO K;  4BKW A;  1ZYR A;  2GSU A;  2V6S A;  4XCH A;  2B63 A;  4MQ9 A;  1I3Q A;  3HOX C;  3GTL C;  3M3Y C;  3LAJ A;  1DCO A;  4G0W A;  4A3M K;  2R7Z C;  1K83 A;  2VUM A;  4BY7 C;  2YU9 K;  4KM9 A;  1ZQ1 C;  1F7V A;  4XLP A;  2JA6 C; 
#chains in the Genus database with same CATH homology
 1GE9 A;  4GTC A;  3FOF A;  1XXB A;  5EGH A;  5IOR A;  4KC6 A;  1DD5 A;  4KM8 A;  3FHZ A;  1BJT A;  3ERE D;  3GTJ A;  3V4G A;  4KAS A;  2R92 A;  3GTM A;  2RGR A;  1Y1W A;  2CFA A;  1TWG A;  3Q3Q A;  1B4A A;  2KWA A;  4KAR A;  2XCR B;  3L4K A;  4M1X A;  5IOT A;  2PHC B;  1SFO A;  1ZXO A;  1EK8 A;  4GTE A;  4P5B A;  3H0G A;  5IOQ A;  1R9T A;  3CAG A;  1WIH A;  3L4J A;  4GTA A;  2JH3 A;  5TJ3 A;  2P5M A;  4C3J C;  4GTD A;  2E2H A;  2NVX A;  1WQH A;  1O26 A;  1ISE A;  1Y1V A;  2GSN A;  4P5A A;  4ILD A;  5CHP A;  2R93 A;  4BLA A;  4GFQ A;  3GTG A;  3GTQ A;  3N0C A;  3CQZ A;  4LQY A;  1TWF A;  3GTK A;  4G0V A;  2GSO A;  1O24 A;  1F9N A;  4FM9 A;  2JA5 A;  5EGE A;  1WQF A;  2R7Z A;  4DDQ A;  1TWH A;  3VA7 A;  2E2I A;  4C2M C;  3GTL A;  1O29 A;  3N3Y A;  3NUH A;  1ZVU A;  4GTF A;  2XCQ A;  3LAP A;  1O2B A;  3G4C A;  3QX3 A;  4J3N A;  2Y3P A;  2JA7 A;  4BLB A;  1O2A A;  4FZB A;  1O27 A;  1XXA A;  1O25 A;  1WCM A;  4KB2 A;  1B4B A;  1KQ4 A;  2ZFZ A;  4KMD A;  4KDD A;  3FKI A;  4KAT A;  4KAW X;  3OEP A;  3OPF A;  5IOS A;  1IS1 A;  3BUE A;  3FOE A;  4KMH A;  5JVO A;  1I50 A;  1EH1 A;  4GTB A;  3AH5 A;  3AQO A;  4G0U A;  3N0B A;  2XCO A;  4KMA A;  3S0X A;  1ZBS A;  3ORE A;  5JFE A;  1BGW A;  2YU9 A;  3GTP A;  3G4A A;  2JA6 A;  2CFA B;  4GT9 A;  1O28 A;  4BKW A;  4C3I C;  4C3H C;  4GTL A;  3MML B;  2GSU A;  3GTO A;  1TWC A;  1AB4 A;  2RH6 A;  4LR2 A;  2B63 A;  1I3Q A;  3LPX A;  4KB4 A;  1XXC A;  1TWA A;  3LAJ A;  4G0W A;  1WQG A;  3AQP A;  1K83 A;  5CJ9 A;  2VUM A;  4KM9 A;  2NVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...