5CHPA

T. maritima thyx in complex with tyc5-03
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Identification of inhibitors targeting substrate-binding site in Mycobacterium tuberculosis FAD-dependent Thymidylate synthase (ThyX) through Virtual Screening: A New study de-fining the binding mechanism of Inhibitors
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5chpA00
1O25A 5CHPA 1KQ4A 4GTAA 4GTEA 4GT9A 4GTBA 4FZBA 4GTCA 5IORA 2CFAB 4P5BA 4GTLA 2CFAA 3G4CA 4GTDA 4P5AA 4KASA 1O28A 5JFEA 4GTFA 3N0BA 3N3YA 1O26A 5IOSA 1O2BA 4KATA 5IOTA 1O27A 4KARA 3N0CA 1O2AA 3AH5A 1O24A 5IOQA 3G4AA 1O29A
chains in the Genus database with same CATH superfamily
2E2JC 2JH3A 4MEYA 1IE0A 1PJ7A 3HOXC 1WQFA 4GTAA 4G0VA 3AD8C 4WILA 4A3IC 3L4JA 2JA8C 5EGEA 2GSUA 2Y3PA 4RMFA 1YNJA 2WB1L 4ILDA 1HI9A 1EH1A 2JA6A 5IYDK 3N0BA 4PABA 4XSXA 3FOEA 1TWCK 1O2BA 1IQ0A 2A68A 5IYDC 4G7OA 2XCRB 3GTLK 3A8KA 4A3EK 2NVYA 4C45A 3GTLC 1TWAA 5CHPA 1WOOA 2FQOA 3IPJA 4LOWA 4A3EC 2R7ZA 2YU9C 2E2IK 3AQOA 3JSTA 4GTCA 2CFAB 2JA7A 3BP8C 3EQLA 4Y7NK 4BY1K 4KM9A 1EFWA 5TMFA 1I6VA 4OIQA 1SMYA 4Q4ZA 3GTPK 1Y1VK 3HKZL 1VRQC 1J6WA 3S2HK 1TWFA 1XZQA 4LQYA 3AQPA 4C3HK 1I6HK 3GTMC 3S2HC 3GIRA 4G7HA 3GTQK 4FZBA 3GDZA 1ZBSA 5HL8A 3H0GK 2BE5A 3GTQC 2W7VA 1I3QK 1R9TA 1WQGA 4A3DK 5JFEA 1ZXOA 3A8IA 4KDDA 3PO3K 1I3QC 2XCQA 3S1NC 2R93A 4A3DC 3S2DK 4WJ3M 5C4JC 3FHZA 1O24A 4ZH4A 2CW0A 1X31C 2B63K 3S2DC 1IBAA 4X6AC 1HQMA 1JQWA 1VH2A 4A3KK 4C3IK 2WAQD 1XPPA 2NVTK 3SZZA 3S1QK 4A3KC 4GTDA 4C3IC 5M5XK 3MMLB 3GTJC 3FOFA 1O28A 3L4KA 5FJ8K 3RZDK 3HOUK 3S1QC 3WODA 3S16K 1B4AA 1SFOA 3FKIA 3HOUC 3GTMA 4YFNA 3PO2C 3T01A 3AH5A 1BS2A 3ADAC 1ZQ1C 4OIRA 4WJ4A 4GTBA 3HOYK 2PA8L 2NVXA 3LAPA 4P5BA 4LLGA 4BY7K 3G4CA 2JA6K 4A3BK 2A6EA 5M5WK 2JA5K 4XSZA 4BY7C 3AD7C 4A3LC 2E2HK 5C4XC 2GSNA 1YCLA 2JA5C 5C44C 1O2AA 3GTKA 2PHCB 1PJ5A 2E2HC 2ZUEA 3TFIA 1GE9A 4GT9A 3GEIA 4BLBA 5C3EK 2V6UA 3NUHA 4XLPA 3BP3A 2VUMA 3N3YA 2RGRA 3HOZK 1BJTA 2PA8D 3GTOA 5IOTA 3N0CA 3T02A 3S17K 3HOZC 1Y1WA 1TWCC 4A3JK 1KQ4A 1ZVUA 2NVQK 4A3JC 1TWGK 3CQZA 1WCMK 3T00A 3V4GA 4BLAA 2NVQC 1TWGC 1R9TK 3K7AK 2E2IC 1WCMC 1G51A 4A3GK 3S1RK 1O26A 4YFKA 2FQTA 4Y7NC 3K7AC 4BY1C 1XZQB 4A3GC 4G7ZA 3S1RC 2WAQL 5IOQA 1I50K 3Q3QA 3GTPC 2P8TA 4M1XA 1C0AA 1Y1VC 2Y0SD 2A69A 5M3FK 5E68A 1IW7A 2ZFZA 4C3HC 1I6HC 4YG2A 2D6FC 2CFAA 3I4MK 4LK0A 4KASA 3TFHA 5L46A 3GTGK 3H0GC 5IOSA 3I4MC 1SFOK 4Q5SA 1K83K 3LPXA 3GTGC 3GTLA 4OIPA 5IYCK 3PO3C 1K83C 2YU9A 1WQHA 1JOEA 5IYCC 4GTEA 5TJ3A 2NVXK 2B63C 1BGWA 1XXAA 1TWHK 3BUEA 1BDFA 5IYBK 1F7VA 4QIWL 1TWHC 4GTFA 5IYBC 2NVTC 4BKWA 5TMCA 1IL2A 2R92K 3HOVK 1DCOA 1O27A 1F9NA 5IP9K 4QJVB 3RZDC 2R92C 3RZOK 3S16C 5IP9C 3GEHA 1IS1A 1INNA 1O2FB 5JVOA 3GTQA 5CJ9A 3OREA 1WIHA 4FM9A 1F93A 4PAAA 4XCHA 4LR2A 1I3QA 2PPBA 1USOA 4P5AA 3HOYC 1VGXA 4A3MK 2XCOA 1XZPB 4XLNA 1EK8A 1J98A 2JA6C 4A3BC 1Y1WK 4C3JK 2NVYK 4QIWD 2B63A 1O25A 1TWAK 4C3JC 4Y52K 2NVYC 4G0WA 2R7ZK 3CQZK 3DXJA 4G0UA 1TWAC 5IORA 3GTJA 4Y52C 2JA7K 4DDQA 1DCPA 1ISEA 2R7ZC 1XXCA 3OEPA 4LJZA 3S14K 5C3EC 2Y0SL 1XXBA 2E2JK 4J3NA 3HOXK 4AYBD 3H3VD 1JVIA 1TWFK 4AH6A 4A3IK 5D4DA 3S17C 2JA8K 1TWFC 4BXXK 5EGHA 1L0WA 2P5MA 4KMUA 4A3CK 1EQRA 1DD5A 4BXXC 1DCHA 2JA5A 4KMDA 4A3CC 4NOIA 2KWAA 4KN4A 1R9TC 4KATA 2R93K 2E2HA 2PMZD 1RU0A 3S1MK 2EBBA 4C2MK 2YU9K 2R93C 3S1MC 5M5YK 4C2MC 3QX3A 1I50C 1J6VA 1YNNA 2GAGC 4KMAA 1F7UA 1PJ6A 3M3YK 3SZYA 2O5JA 2A6HA 4KB4A 3VA7A 3A8JA 3I4NK 4KM8A 1TWCA 1ZYRA 3M3YC 1WSRA 3FKIK 3GTMK 1WORA 1EI6A 2WB1D 3I4NC 1SFOC 3FKIC 3S0XA 4GZYA 4MEXA 1TWGA 4JK1A 2E2IA 1WCMA 2GAHC 1J6XA 3ERED 5IP7K 3HOWK 3S1NK 2NVXC 3GSIA 5C4JK 5IP7C 3HOWC 4LK1A 4YFXA 1WOSA 4MQ9A 3AD9C 3GTPA 3CAGA 4X6AK 1Y1VA 3GTKK 1VLOA 4O2DA 1I50A 1O29A 5FLMK 3HOVC 1UV7A 2GSOA 4KB2A 3GTKC 4BBRK 5FLMC 3RZOC 2RH6A 3HKZD 4KN7A 3GTJK 4GFQA 4KMHA 4BBRC 4OIOA 4A93K 1WOPA 3H0GA 4BBSK 4KC6A 4AYBL 3H3VL 4OINA 3GTGA 3PO2K 2VUMK 3TTGA 4KAWX 3GEEA 4A93C 3M4OK 4BBSC 2ZUFA 1K83A 2VUMC 3GTOK 4A3MC 1VJEA 4A3FK 3M4OC 1V5VA 2V6TA 3TFJA 4P9SA 3G4AA 4KARA 4QJVA 3GTOC 3LAJA 4A3FC 3HXAA 1USMA 3OPFA 1Y1WC 2V6SA 1AB4A 3S15K 1TWHA 2PMZL 4GTLA 1WSVA 3CQZC 2O5IA 4A3LK 5C4XK 3S15C 5C44K 2JA7C 5M3MK 1XZPA 2R92A 1YX2A 1B4BA 3S14C
chains in the Genus database with same CATH topology
2JH3A 1WQHA 1WQFA 4GTAA 4G0VA 4C2MC 4GTEA 3QX3A 5TJ3A 4GTBA 2NVXA 3LAPA 1BGWA 1XXAA 4P5BA 3L4JA 3BUEA 4KMAA 5EGEA 2GSUA 2Y3PA 3G4CA 4ILDA 1EH1A 2JA6A 4GTFA 3N0BA 4BKWA 3FOEA 4KB4A 3VA7A 1O2BA 4KM8A 1TWCA 1O27A 1F9NA 2GSNA 2XCRB 1O2AA 3GTKA 2PHCB 2NVYA 3S0XA 1TWAA 1IS1A 5CHPA 1GE9A 2R7ZA 4GT9A 4BLBA 5JVOA 3GTQA 1TWGA 3AQOA 4GTCA 5CJ9A 3OREA 1WCMA 2CFAB 2E2IA 2JA7A 1WIHA 3NUHA 3ERED 4FM9A 4LR2A 1I3QA 4KM9A 4P5AA 2XCOA 2VUMA 3N3YA 2RGRA 1EK8A 1BJTA 3GTOA 5IOTA 3GTPA 3CAGA 3N0CA 1Y1VA 1TWFA 1Y1WA 4LQYA 1I50A 1O29A 2B63A 3AQPA 1O25A 2GSOA 1KQ4A 4KB2A 4C3JC 1ZVUA 4G0WA 2RH6A 4FZBA 3CQZA 4G0UA 4GFQA 5IORA 1ZBSA 3GTJA 4KMHA 3V4GA 4BLAA 4DDQA 1ISEA 3H0GA 1XXCA 3OEPA 4KC6A 1R9TA 3GTGA 1WQGA 5JFEA 4KAWX 1ZXOA 1O26A 4KDDA 2XCQA 2R93A 1XXBA 4J3NA 1K83A 3FHZA 1O24A 5IOQA 3G4AA 4KARA 3Q3QA 3LAJA 4M1XA 3OPFA 1AB4A 2ZFZA 4C3HC 5EGHA 1TWHA 2P5MA 4GTLA 2CFAA 1DD5A 4GTDA 4C3IC 3MMLB 4KASA 3FOFA 1O28A 3L4KA 2JA5A 4KMDA 5IOSA 1B4AA 2KWAA 2R92A 4KATA 1SFOA 3LPXA 2E2HA 3FKIA 3GTMA 3GTLA 1B4BA 3AH5A 2YU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O25 A;  5CHP A;  1KQ4 A;  4GTA A;  4GTE A;  4GT9 A;  4GTB A;  4FZB A;  4GTC A;  5IOR A;  2CFA B;  4P5B A;  4GTL A;  2CFA A;  3G4C A;  4GTD A;  4P5A A;  4KAS A;  1O28 A;  5JFE A;  4GTF A;  3N0B A;  3N3Y A;  1O26 A;  5IOS A;  1O2B A;  4KAT A;  5IOT A;  1O27 A;  4KAR A;  3N0C A;  1O2A A;  3AH5 A;  1O24 A;  5IOQ A;  3G4A A;  1O29 A; 
#chains in the Genus database with same CATH topology
 2E2J C;  2JH3 A;  4MEY A;  1IE0 A;  1PJ7 A;  3HOX C;  1WQF A;  4GTA A;  4G0V A;  3AD8 C;  4WIL A;  4A3I C;  3L4J A;  2JA8 C;  5EGE A;  2GSU A;  2Y3P A;  4RMF A;  1YNJ A;  2WB1 L;  4ILD A;  1HI9 A;  1EH1 A;  2JA6 A;  5IYD K;  3N0B A;  4PAB A;  4XSX A;  3FOE A;  1TWC K;  1O2B A;  1IQ0 A;  2A68 A;  5IYD C;  4G7O A;  2XCR B;  3GTL K;  3A8K A;  4A3E K;  2NVY A;  4C45 A;  3GTL C;  1TWA A;  5CHP A;  1WOO A;  2FQO A;  3IPJ A;  4LOW A;  4A3E C;  2R7Z A;  2YU9 C;  2E2I K;  3AQO A;  3JST A;  4GTC A;  2CFA B;  2JA7 A;  3BP8 C;  3EQL A;  4Y7N K;  4BY1 K;  4KM9 A;  1EFW A;  5TMF A;  1I6V A;  4OIQ A;  1SMY A;  4Q4Z A;  3GTP K;  1Y1V K;  3HKZ L;  1VRQ C;  1J6W A;  3S2H K;  1TWF A;  1XZQ A;  4LQY A;  3AQP A;  4C3H K;  1I6H K;  3GTM C;  3S2H C;  3GIR A;  4G7H A;  3GTQ K;  4FZB A;  3GDZ A;  1ZBS A;  5HL8 A;  3H0G K;  2BE5 A;  3GTQ C;  2W7V A;  1I3Q K;  1R9T A;  1WQG A;  4A3D K;  5JFE A;  1ZXO A;  3A8I A;  4KDD A;  3PO3 K;  1I3Q C;  2XCQ A;  3S1N C;  2R93 A;  4A3D C;  3S2D K;  4WJ3 M;  5C4J C;  3FHZ A;  1O24 A;  4ZH4 A;  2CW0 A;  1X31 C;  2B63 K;  3S2D C;  1IBA A;  4X6A C;  1HQM A;  1JQW A;  1VH2 A;  4A3K K;  4C3I K;  2WAQ D;  1XPP A;  2NVT K;  3SZZ A;  3S1Q K;  4A3K C;  4GTD A;  4C3I C;  5M5X K;  3MML B;  3GTJ C;  3FOF A;  1O28 A;  3L4K A;  5FJ8 K;  3RZD K;  3HOU K;  3S1Q C;  3WOD A;  3S16 K;  1B4A A;  1SFO A;  3FKI A;  3HOU C;  3GTM A;  4YFN A;  3PO2 C;  3T01 A;  3AH5 A;  1BS2 A;  3ADA C;  1ZQ1 C;  4OIR A;  4WJ4 A;  4GTB A;  3HOY K;  2PA8 L;  2NVX A;  3LAP A;  4P5B A;  4LLG A;  4BY7 K;  3G4C A;  2JA6 K;  4A3B K;  2A6E A;  5M5W K;  2JA5 K;  4XSZ A;  4BY7 C;  3AD7 C;  4A3L C;  2E2H K;  5C4X C;  2GSN A;  1YCL A;  2JA5 C;  5C44 C;  1O2A A;  3GTK A;  2PHC B;  1PJ5 A;  2E2H C;  2ZUE A;  3TFI A;  1GE9 A;  4GT9 A;  3GEI A;  4BLB A;  5C3E K;  2V6U A;  3NUH A;  4XLP A;  3BP3 A;  2VUM A;  3N3Y A;  2RGR A;  3HOZ K;  1BJT A;  2PA8 D;  3GTO A;  5IOT A;  3N0C A;  3T02 A;  3S17 K;  3HOZ C;  1Y1W A;  1TWC C;  4A3J K;  1KQ4 A;  1ZVU A;  2NVQ K;  4A3J C;  1TWG K;  3CQZ A;  1WCM K;  3T00 A;  3V4G A;  4BLA A;  2NVQ C;  1TWG C;  1R9T K;  3K7A K;  2E2I C;  1WCM C;  1G51 A;  4A3G K;  3S1R K;  1O26 A;  4YFK A;  2FQT A;  4Y7N C;  3K7A C;  4BY1 C;  1XZQ B;  4A3G C;  4G7Z A;  3S1R C;  2WAQ L;  5IOQ A;  1I50 K;  3Q3Q A;  3GTP C;  2P8T A;  4M1X A;  1C0A A;  1Y1V C;  2Y0S D;  2A69 A;  5M3F K;  5E68 A;  1IW7 A;  2ZFZ A;  4C3H C;  1I6H C;  4YG2 A;  2D6F C;  2CFA A;  3I4M K;  4LK0 A;  4KAS A;  3TFH A;  5L46 A;  3GTG K;  3H0G C;  5IOS A;  3I4M C;  1SFO K;  4Q5S A;  1K83 K;  3LPX A;  3GTG C;  3GTL A;  4OIP A;  5IYC K;  3PO3 C;  1K83 C;  2YU9 A;  1WQH A;  1JOE A;  5IYC C;  4GTE A;  5TJ3 A;  2NVX K;  2B63 C;  1BGW A;  1XXA A;  1TWH K;  3BUE A;  1BDF A;  5IYB K;  1F7V A;  4QIW L;  1TWH C;  4GTF A;  5IYB C;  2NVT C;  4BKW A;  5TMC A;  1IL2 A;  2R92 K;  3HOV K;  1DCO A;  1O27 A;  1F9N A;  5IP9 K;  4QJV B;  3RZD C;  2R92 C;  3RZO K;  3S16 C;  5IP9 C;  3GEH A;  1IS1 A;  1INN A;  1O2F B;  5JVO A;  3GTQ A;  5CJ9 A;  3ORE A;  1WIH A;  4FM9 A;  1F93 A;  4PAA A;  4XCH A;  4LR2 A;  1I3Q A;  2PPB A;  1USO A;  4P5A A;  3HOY C;  1VGX A;  4A3M K;  2XCO A;  1XZP B;  4XLN A;  1EK8 A;  1J98 A;  2JA6 C;  4A3B C;  1Y1W K;  4C3J K;  2NVY K;  4QIW D;  2B63 A;  1O25 A;  1TWA K;  4C3J C;  4Y52 K;  2NVY C;  4G0W A;  2R7Z K;  3CQZ K;  3DXJ A;  4G0U A;  1TWA C;  5IOR A;  3GTJ A;  4Y52 C;  2JA7 K;  4DDQ A;  1DCP A;  1ISE A;  2R7Z C;  1XXC A;  3OEP A;  4LJZ A;  3S14 K;  5C3E C;  2Y0S L;  1XXB A;  2E2J K;  4J3N A;  3HOX K;  4AYB D;  3H3V D;  1JVI A;  1TWF K;  4AH6 A;  4A3I K;  5D4D A;  3S17 C;  2JA8 K;  1TWF C;  4BXX K;  5EGH A;  1L0W A;  2P5M A;  4KMU A;  4A3C K;  1EQR A;  1DD5 A;  4BXX C;  1DCH A;  2JA5 A;  4KMD A;  4A3C C;  4NOI A;  2KWA A;  4KN4 A;  1R9T C;  4KAT A;  2R93 K;  2E2H A;  2PMZ D;  1RU0 A;  3S1M K;  2EBB A;  4C2M K;  2YU9 K;  2R93 C;  3S1M C;  5M5Y K;  4C2M C;  3QX3 A;  1I50 C;  1J6V A;  1YNN A;  2GAG C;  4KMA A;  1F7U A;  1PJ6 A;  3M3Y K;  3SZY A;  2O5J A;  2A6H A;  4KB4 A;  3VA7 A;  3A8J A;  3I4N K;  4KM8 A;  1TWC A;  1ZYR A;  3M3Y C;  1WSR A;  3FKI K;  3GTM K;  1WOR A;  1EI6 A;  2WB1 D;  3I4N C;  1SFO C;  3FKI C;  3S0X A;  4GZY A;  4MEX A;  1TWG A;  4JK1 A;  2E2I A;  1WCM A;  2GAH C;  1J6X A;  3ERE D;  5IP7 K;  3HOW K;  3S1N K;  2NVX C;  3GSI A;  5C4J K;  5IP7 C;  3HOW C;  4LK1 A;  4YFX A;  1WOS A;  4MQ9 A;  3AD9 C;  3GTP A;  3CAG A;  4X6A K;  1Y1V A;  3GTK K;  1VLO A;  4O2D A;  1I50 A;  1O29 A;  5FLM K;  3HOV C;  1UV7 A;  2GSO A;  4KB2 A;  3GTK C;  4BBR K;  5FLM C;  3RZO C;  2RH6 A;  3HKZ D;  4KN7 A;  3GTJ K;  4GFQ A;  4KMH A;  4BBR C;  4OIO A;  4A93 K;  1WOP A;  3H0G A;  4BBS K;  4KC6 A;  4AYB L;  3H3V L;  4OIN A;  3GTG A;  3PO2 K;  2VUM K;  3TTG A;  4KAW X;  3GEE A;  4A93 C;  3M4O K;  4BBS C;  2ZUF A;  1K83 A;  2VUM C;  3GTO K;  4A3M C;  1VJE A;  4A3F K;  3M4O C;  1V5V A;  2V6T A;  3TFJ A;  4P9S A;  3G4A A;  4KAR A;  4QJV A;  3GTO C;  3LAJ A;  4A3F C;  3HXA A;  1USM A;  3OPF A;  1Y1W C;  2V6S A;  1AB4 A;  3S15 K;  1TWH A;  2PMZ L;  4GTL A;  1WSV A;  3CQZ C;  2O5I A;  4A3L K;  5C4X K;  3S15 C;  5C44 K;  2JA7 C;  5M3M K;  1XZP A;  2R92 A;  1YX2 A;  1B4B A;  3S14 C; 
#chains in the Genus database with same CATH homology
 2JH3 A;  1WQH A;  1WQF A;  4GTA A;  4G0V A;  4C2M C;  4GTE A;  3QX3 A;  5TJ3 A;  4GTB A;  2NVX A;  3LAP A;  1BGW A;  1XXA A;  4P5B A;  3L4J A;  3BUE A;  4KMA A;  5EGE A;  2GSU A;  2Y3P A;  3G4C A;  4ILD A;  1EH1 A;  2JA6 A;  4GTF A;  3N0B A;  4BKW A;  3FOE A;  4KB4 A;  3VA7 A;  1O2B A;  4KM8 A;  1TWC A;  1O27 A;  1F9N A;  2GSN A;  2XCR B;  1O2A A;  3GTK A;  2PHC B;  2NVY A;  3S0X A;  1TWA A;  1IS1 A;  5CHP A;  1GE9 A;  2R7Z A;  4GT9 A;  4BLB A;  5JVO A;  3GTQ A;  1TWG A;  3AQO A;  4GTC A;  5CJ9 A;  3ORE A;  1WCM A;  2CFA B;  2E2I A;  2JA7 A;  1WIH A;  3NUH A;  3ERE D;  4FM9 A;  4LR2 A;  1I3Q A;  4KM9 A;  4P5A A;  2XCO A;  2VUM A;  3N3Y A;  2RGR A;  1EK8 A;  1BJT A;  3GTO A;  5IOT A;  3GTP A;  3CAG A;  3N0C A;  1Y1V A;  1TWF A;  1Y1W A;  4LQY A;  1I50 A;  1O29 A;  2B63 A;  3AQP A;  1O25 A;  2GSO A;  1KQ4 A;  4KB2 A;  4C3J C;  1ZVU A;  4G0W A;  2RH6 A;  4FZB A;  3CQZ A;  4G0U A;  4GFQ A;  5IOR A;  1ZBS A;  3GTJ A;  4KMH A;  3V4G A;  4BLA A;  4DDQ A;  1ISE A;  3H0G A;  1XXC A;  3OEP A;  4KC6 A;  1R9T A;  3GTG A;  1WQG A;  5JFE A;  4KAW X;  1ZXO A;  1O26 A;  4KDD A;  2XCQ A;  2R93 A;  1XXB A;  4J3N A;  1K83 A;  3FHZ A;  1O24 A;  5IOQ A;  3G4A A;  4KAR A;  3Q3Q A;  3LAJ A;  4M1X A;  3OPF A;  1AB4 A;  2ZFZ A;  4C3H C;  5EGH A;  1TWH A;  2P5M A;  4GTL A;  2CFA A;  1DD5 A;  4GTD A;  4C3I C;  3MML B;  4KAS A;  3FOF A;  1O28 A;  3L4K A;  2JA5 A;  4KMD A;  5IOS A;  1B4A A;  2KWA A;  2R92 A;  4KAT A;  1SFO A;  3LPX A;  2E2H A;  3FKI A;  3GTM A;  3GTL A;  1B4B A;  3AH5 A;  2YU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...