5CHPA

T. maritima thyx in complex with tyc5-03
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
b'MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Identification of inhibitors targeting substrate-binding site in Mycobacterium tuberculosis FAD-dependent Thymidylate synthase (ThyX) through Virtual Screening: A New study de-fining the binding mechanism of Inhibitors
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5chpA00
4KASA 4P5BA 2CFAB 3N0BA 1O2AA 4GTCA 4GTAA 1O27A 3N3YA 4GTFA 1O25A 5CHPA 4GTBA 1O28A 1O2BA 5IOQA 5IORA 3G4AA 1KQ4A 4GTEA 1O29A 4GTLA 3N0CA 5JFEA 3AH5A 1O26A 4KARA 5IOSA 2CFAA 4KATA 5IOTA 4FZBA 3G4CA 4GT9A 4P5AA 4GTDA 1O24A
chains in the Genus database with same CATH superfamily
3GTKA 2CFAB 3L4JA 3N0BA 2O5JA 3HOUK 4KMAA 3S17K 1EQRA 1J6VA 3S16K 1ZQ1C 3S2HC 2NVYA 1WOPA 1O27A 2ZUEA 4GTFA 4A3MK 5TJ3A 3S15K 3G4AA 2GSNA 2KWAA 5IYCC 3OPFA 1V5VA 3S14C 1PJ6A 3V4GA 5M3MK 4G7OA 4KMUA 4AYBD 3M4OK 1Y1WK 1TWFC 5C44K 1EFWA 4BBRC 3SZYA 3TFHA 3S2DC 3H0GK 1L0WA 5IP9K 1C0AA 3LAPA 4BY1C 2YU9K 2VUMK 4ILDA 4XLPA 5M5WK 3AQOA 4Y7NK 3I4NK 1IBAA 3DXJA 1XZPA 4Y52K 1YNNA 1BGWA 3OREA 4KN4A 3S1QK 4YFKA 5IP7K 3ERED 3GTPK 1IW7A 4BY7C 2GAHC 4X6AK 4GTDA 3GTLA 4KASA 4DDQA 3S1NC 1JVIA 4A3JC 2EBBA 3SZZA 4OIOA 1WQGA 2NVXK 1XXBA 4A3KK 4LQYA 4A93K 3RZDK 2JA6K 1IS1A 1SFOK 2YU9A 1Y1VK 3IPJA 1O29A 1K83A 3EQLA 2D6FC 1F93A 4AH6A 4P9SA 3CAGA 1B4BA 1J98A 4LJZA 2XCRB 2WB1L 4A3FC 4XLNA 5C4JK 1USMA 3M3YC 4OIPA 1DCOA 2B63A 1WOSA 3CQZA 1ZYRA 4PABA 3L4KA 4A3CC 2Y3PA 3PO2K 5TMFA 5CHPA 2R92K 2R93A 1TWGC 2NVXA 2NVTC 2JH3A 5JFEA 3A8IA 4BLBA 2JA5C 3HOYK 1SFOA 3GTQA 3GTOA 5EGEA 1O24A 1R9TA 2R7ZC 1GE9A 1TWCC 4KM8A 1WCMC 4O2DA 4MQ9A 2O5IA 1EI6A 5FLMC 3HOVC 3I4MK 3GTGC 4GTBA 2V6UA 3K7AC 5EGHA 4J3NA 2E2IC 3GTMC 4BXXC 2NVQK 1I6HC 2JA7C 2R92A 1TWHA 1WORA 1VLOA 2E2HK 4KMHA 5IYDK 3TFIA 1DD5A 5CJ9A 2V6SA 3GTKC 3FOFA 3FKIA 1TWAC 1YNJA 1EK8A 1I50C 1YCLA 2E2JC 4GZYA 1SMYA 4C3HK 4C3JC 2NVYC 4QJVB 3HKZD 3GEIA 3GTLK 1XZPB 3S0XA 4XCHA 4OINA 1F7VA 1VH2A 2GSOA 4LR2A 4AYBL 3T01A 4ZH4A 1ISEA 4KC6A 3GEHA 3HOZC 2P8TA 2E2HA 2PA8D 3GTJC 4WJ4A 1X31C 3A8JA 4QJVA 3N3YA 1K83K 3AD8C 2PA8L 1TWFA 4G0VA 4KMDA 3S1MK 4GTLA 4A3LK 3HOUC 3S17C 4BKWA 1I3QK 2PHCB 3S16C 1INNA 4FZBA 4GT9A 4LOWA 3PO3K 2B63K 3CQZK 4A3MC 2ZUFA 3S15C 4A3BK 1VGXA 4GFQA 4JK1A 3JSTA 2R93K 4A3IK 3M4OC 1Y1WC 5C3EK 5C44C 4YFXA 1F7UA 4OIRA 2JA8K 3H0GC 3GTQK 1EH1A 5IP9C 3GTOK 3N0CA 4KARA 4WILA 4MEYA 1R9TK 3G4CA 2YU9C 2VUMC 4Y7NC 3I4NC 2FQOA 1VJEA 1I3QA 1JOEA 4P5BA 4C3IK 4Y52C 2W7VA 4A3DK 4A3EK 4FM9A 3S1QC 3LAJA 4BBSK 4GTAA 3HOXK 1BS2A 5IP7C 3GTPC 1ZVUA 4X6AC 3HOWK 1TWHK 5C4XK 3BUEA 2RGRA 3GSIA 4QIWD 3BP3A 2NVXC 4A3GK 1UV7A 4A3KC 4A93C 3RZDC 2JA6C 2WAQD 3FKIK 4C2MK 1SFOC 5IYBK 1Y1VC 2BE5A 1XPPA 4YFNA 4KB4A 5FJ8K 4C45A 1PJ5A 1O25A 3S1RK 3RZOK 1IE0A 2JA5A 1O2BA 5IOQA 4Q4ZA 4M1XA 5C4JC 3S2HK 2R7ZA 3QX3A 1TWCA 3TFJA 1IQ0A 4P5AA 5D4DA 3PO2C 1USOA 3WODA 5IYCK 2R92C 3S14K 3GTGA 4OIQA 1TWFK 4BLAA 1BJTA 3AQPA 3GIRA 4PAAA 1G51A 4BBRK 2E2IA 3HOYC 3S2DK 2JA7A 5HL8A 1J6XA 1O28A 1IL2A 1B4AA 4C2MC 4BY1K 3TTGA 4KATA 1BDFA 1JQWA 2P5MA 2Y0SD 3I4MC 3HKZL 1J6WA 1TWAA 3FOEA 1I50A 1O2AA 2Y0SL 4BY7K 1WOOA 5M5XK 2NVQC 1F9NA 1XZQA 4WJ3M 4Q5SA 3S1NK 4KAWX 4A3JK 2E2HC 5IYDC 4YG2A 1RU0A 2V6TA 4G0WA 5IOSA 3A8KA 2ZFZA 1I6VA 2CFAA 3ADAC 2RH6A 1HI9A 3GTJA 3RZOC 3Q3QA 2CW0A 1ZBSA 4NOIA 4C3HC 1WIHA 2A6EA 5E68A 3GTLC 3GDZA 3T02A 4A3FK 3AD9C 3M3YK 4GTEA 4KB2A 1O2FB 1DCHA 1ZXOA 4A3CK 1WQHA 5IOTA 5TMCA 4G7ZA 1TWGK 3LPXA 1K83C 4G7HA 2NVTK 2A6HA 1Y1WA 3MMLB 3S1MC 2JA5K 4A3LC 3H0GA 3T00A 1I3QC 4XSXA 4LK0A 2R7ZK 1TWCK 5IORA 2B63C 3CQZC 3OEPA 3PO3C 2VUMA 2A69A 1WCMK 3AD7C 4KN7A 5FLMK 4A3BC 3HOVK 2GAGC 2WB1D 3VA7A 1XXCA 1HQMA 2R93C 4A3IC 4LK1A 4KM9A 1WSVA 2GSUA 5M5YK 3GTGK 5C3EC 1XXAA 3K7AK 4RMFA 4QIWL 3GTPA 2E2IK 3GTMK 4BXXK 2JA8C 3NUHA 3GTQC 4GTCA 3GTOC 1I6HK 2JA7K 1TWGA 3BP8C 1R9TC 2WAQL 3HXAA 4G0UA 3FHZA 5JVOA 5M3FK 1PJ7A 1KQ4A 4C3IC 4KDDA 3H3VD 3AH5A 2JA6A 3GTKK 4A3DC 2XCOA 4A3EC 1TWAK 4BBSC 3HOXC 1Y1VA 1I50K 3H3VL 1WCMA 2E2JK 2PPBA 4C3JK 2A68A 2NVYK 3HOWC 1TWHC 1AB4A 5C4XC 2PMZD 4LLGA 3GTMA 2PMZL 2XCQA 4A3GC 4MEXA 1VRQC 3HOZK 3FKIC 1O26A 1XZQB 3GTJK 5IYBC 5L46A 4XSZA 1DCPA 1YX2A 3GEEA 1WSRA 1WQFA 3S1RC 2FQTA
chains in the Genus database with same CATH topology
3GTKA 3Q3QA 1I3QA 1GE9A 4P5BA 1ZBSA 2CFAB 3L4JA 4C3HC 3N0BA 1WIHA 4KMAA 4KM8A 4FM9A 3LAJA 4GTAA 2NVYA 1O27A 4GTFA 1ZVUA 5TJ3A 4GTBA 3G4AA 5EGHA 3BUEA 2GSNA 4GTEA 2KWAA 4J3NA 3OPFA 4KB2A 2RGRA 3V4GA 1ZXOA 1WQHA 5IOTA 2R92A 1TWHA 3LPXA 4KMHA 1Y1WA 3MMLB 1DD5A 3LAPA 5CJ9A 4KB4A 3H0GA 4ILDA 3FOFA 3AQOA 3FKIA 1EK8A 1O25A 2JA5A 1O2BA 5IOQA 5IORA 2VUMA 3OEPA 4C3JC 1BGWA 3OREA 4M1XA 2R7ZA 3QX3A 1TWCA 3ERED 3VA7A 1XXCA 3S0XA 4P5AA 4KM9A 2GSUA 4GTDA 1XXAA 3GTLA 4KASA 4DDQA 2GSOA 4LR2A 3GTPA 1ISEA 3NUHA 3GTGA 4KC6A 4GTCA 1WQGA 2E2HA 1TWGA 1BJTA 1XXBA 3AQPA 4BLAA 2E2IA 3N3YA 4G0UA 4LQYA 2JA7A 3FHZA 1TWFA 1O28A 5JVOA 1IS1A 4G0VA 1B4AA 4KMDA 1KQ4A 2YU9A 4C2MC 4C3IC 1O29A 4GTLA 4KDDA 1K83A 3AH5A 2JA6A 4BKWA 2XCOA 2PHCB 4KATA 4FZBA 1Y1VA 4GT9A 2P5MA 1WCMA 3CAGA 1B4BA 1TWAA 2XCRB 3FOEA 1R9TA 1I50A 1O2AA 1AB4A 4GFQA 2B63A 3CQZA 3L4KA 2Y3PA 1F9NA 3GTMA 5CHPA 2XCQA 4KAWX 2R93A 2NVXA 1EH1A 2JH3A 3N0CA 5JFEA 4G0WA 1O26A 4KARA 4BLBA 5IOSA 2ZFZA 2CFAA 2RH6A 3G4CA 1SFOA 3GTQA 3GTOA 3GTJA 1WQFA 5EGEA 1O24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAS A;  4P5B A;  2CFA B;  3N0B A;  1O2A A;  4GTC A;  4GTA A;  1O27 A;  3N3Y A;  4GTF A;  1O25 A;  5CHP A;  4GTB A;  1O28 A;  1O2B A;  5IOQ A;  5IOR A;  3G4A A;  1KQ4 A;  4GTE A;  1O29 A;  4GTL A;  3N0C A;  5JFE A;  3AH5 A;  1O26 A;  4KAR A;  5IOS A;  2CFA A;  4KAT A;  5IOT A;  4FZB A;  3G4C A;  4GT9 A;  4P5A A;  4GTD A;  1O24 A; 
#chains in the Genus database with same CATH topology
 3GTK A;  2CFA B;  3L4J A;  3N0B A;  2O5J A;  3HOU K;  4KMA A;  3S17 K;  1EQR A;  1J6V A;  3S16 K;  1ZQ1 C;  3S2H C;  2NVY A;  1WOP A;  1O27 A;  2ZUE A;  4GTF A;  4A3M K;  5TJ3 A;  3S15 K;  3G4A A;  2GSN A;  2KWA A;  5IYC C;  3OPF A;  1V5V A;  3S14 C;  1PJ6 A;  3V4G A;  5M3M K;  4G7O A;  4KMU A;  4AYB D;  3M4O K;  1Y1W K;  1TWF C;  5C44 K;  1EFW A;  4BBR C;  3SZY A;  3TFH A;  3S2D C;  3H0G K;  1L0W A;  5IP9 K;  1C0A A;  3LAP A;  4BY1 C;  2YU9 K;  2VUM K;  4ILD A;  4XLP A;  5M5W K;  3AQO A;  4Y7N K;  3I4N K;  1IBA A;  3DXJ A;  1XZP A;  4Y52 K;  1YNN A;  1BGW A;  3ORE A;  4KN4 A;  3S1Q K;  4YFK A;  5IP7 K;  3ERE D;  3GTP K;  1IW7 A;  4BY7 C;  2GAH C;  4X6A K;  4GTD A;  3GTL A;  4KAS A;  4DDQ A;  3S1N C;  1JVI A;  4A3J C;  2EBB A;  3SZZ A;  4OIO A;  1WQG A;  2NVX K;  1XXB A;  4A3K K;  4LQY A;  4A93 K;  3RZD K;  2JA6 K;  1IS1 A;  1SFO K;  2YU9 A;  1Y1V K;  3IPJ A;  1O29 A;  1K83 A;  3EQL A;  2D6F C;  1F93 A;  4AH6 A;  4P9S A;  3CAG A;  1B4B A;  1J98 A;  4LJZ A;  2XCR B;  2WB1 L;  4A3F C;  4XLN A;  5C4J K;  1USM A;  3M3Y C;  4OIP A;  1DCO A;  2B63 A;  1WOS A;  3CQZ A;  1ZYR A;  4PAB A;  3L4K A;  4A3C C;  2Y3P A;  3PO2 K;  5TMF A;  5CHP A;  2R92 K;  2R93 A;  1TWG C;  2NVX A;  2NVT C;  2JH3 A;  5JFE A;  3A8I A;  4BLB A;  2JA5 C;  3HOY K;  1SFO A;  3GTQ A;  3GTO A;  5EGE A;  1O24 A;  1R9T A;  2R7Z C;  1GE9 A;  1TWC C;  4KM8 A;  1WCM C;  4O2D A;  4MQ9 A;  2O5I A;  1EI6 A;  5FLM C;  3HOV C;  3I4M K;  3GTG C;  4GTB A;  2V6U A;  3K7A C;  5EGH A;  4J3N A;  2E2I C;  3GTM C;  4BXX C;  2NVQ K;  1I6H C;  2JA7 C;  2R92 A;  1TWH A;  1WOR A;  1VLO A;  2E2H K;  4KMH A;  5IYD K;  3TFI A;  1DD5 A;  5CJ9 A;  2V6S A;  3GTK C;  3FOF A;  3FKI A;  1TWA C;  1YNJ A;  1EK8 A;  1I50 C;  1YCL A;  2E2J C;  4GZY A;  1SMY A;  4C3H K;  4C3J C;  2NVY C;  4QJV B;  3HKZ D;  3GEI A;  3GTL K;  1XZP B;  3S0X A;  4XCH A;  4OIN A;  1F7V A;  1VH2 A;  2GSO A;  4LR2 A;  4AYB L;  3T01 A;  4ZH4 A;  1ISE A;  4KC6 A;  3GEH A;  3HOZ C;  2P8T A;  2E2H A;  2PA8 D;  3GTJ C;  4WJ4 A;  1X31 C;  3A8J A;  4QJV A;  3N3Y A;  1K83 K;  3AD8 C;  2PA8 L;  1TWF A;  4G0V A;  4KMD A;  3S1M K;  4GTL A;  4A3L K;  3HOU C;  3S17 C;  4BKW A;  1I3Q K;  2PHC B;  3S16 C;  1INN A;  4FZB A;  4GT9 A;  4LOW A;  3PO3 K;  2B63 K;  3CQZ K;  4A3M C;  2ZUF A;  3S15 C;  4A3B K;  1VGX A;  4GFQ A;  4JK1 A;  3JST A;  2R93 K;  4A3I K;  3M4O C;  1Y1W C;  5C3E K;  5C44 C;  4YFX A;  1F7U A;  4OIR A;  2JA8 K;  3H0G C;  3GTQ K;  1EH1 A;  5IP9 C;  3GTO K;  3N0C A;  4KAR A;  4WIL A;  4MEY A;  1R9T K;  3G4C A;  2YU9 C;  2VUM C;  4Y7N C;  3I4N C;  2FQO A;  1VJE A;  1I3Q A;  1JOE A;  4P5B A;  4C3I K;  4Y52 C;  2W7V A;  4A3D K;  4A3E K;  4FM9 A;  3S1Q C;  3LAJ A;  4BBS K;  4GTA A;  3HOX K;  1BS2 A;  5IP7 C;  3GTP C;  1ZVU A;  4X6A C;  3HOW K;  1TWH K;  5C4X K;  3BUE A;  2RGR A;  3GSI A;  4QIW D;  3BP3 A;  2NVX C;  4A3G K;  1UV7 A;  4A3K C;  4A93 C;  3RZD C;  2JA6 C;  2WAQ D;  3FKI K;  4C2M K;  1SFO C;  5IYB K;  1Y1V C;  2BE5 A;  1XPP A;  4YFN A;  4KB4 A;  5FJ8 K;  4C45 A;  1PJ5 A;  1O25 A;  3S1R K;  3RZO K;  1IE0 A;  2JA5 A;  1O2B A;  5IOQ A;  4Q4Z A;  4M1X A;  5C4J C;  3S2H K;  2R7Z A;  3QX3 A;  1TWC A;  3TFJ A;  1IQ0 A;  4P5A A;  5D4D A;  3PO2 C;  1USO A;  3WOD A;  5IYC K;  2R92 C;  3S14 K;  3GTG A;  4OIQ A;  1TWF K;  4BLA A;  1BJT A;  3AQP A;  3GIR A;  4PAA A;  1G51 A;  4BBR K;  2E2I A;  3HOY C;  3S2D K;  2JA7 A;  5HL8 A;  1J6X A;  1O28 A;  1IL2 A;  1B4A A;  4C2M C;  4BY1 K;  3TTG A;  4KAT A;  1BDF A;  1JQW A;  2P5M A;  2Y0S D;  3I4M C;  3HKZ L;  1J6W A;  1TWA A;  3FOE A;  1I50 A;  1O2A A;  2Y0S L;  4BY7 K;  1WOO A;  5M5X K;  2NVQ C;  1F9N A;  1XZQ A;  4WJ3 M;  4Q5S A;  3S1N K;  4KAW X;  4A3J K;  2E2H C;  5IYD C;  4YG2 A;  1RU0 A;  2V6T A;  4G0W A;  5IOS A;  3A8K A;  2ZFZ A;  1I6V A;  2CFA A;  3ADA C;  2RH6 A;  1HI9 A;  3GTJ A;  3RZO C;  3Q3Q A;  2CW0 A;  1ZBS A;  4NOI A;  4C3H C;  1WIH A;  2A6E A;  5E68 A;  3GTL C;  3GDZ A;  3T02 A;  4A3F K;  3AD9 C;  3M3Y K;  4GTE A;  4KB2 A;  1O2F B;  1DCH A;  1ZXO A;  4A3C K;  1WQH A;  5IOT A;  5TMC A;  4G7Z A;  1TWG K;  3LPX A;  1K83 C;  4G7H A;  2NVT K;  2A6H A;  1Y1W A;  3MML B;  3S1M C;  2JA5 K;  4A3L C;  3H0G A;  3T00 A;  1I3Q C;  4XSX A;  4LK0 A;  2R7Z K;  1TWC K;  5IOR A;  2B63 C;  3CQZ C;  3OEP A;  3PO3 C;  2VUM A;  2A69 A;  1WCM K;  3AD7 C;  4KN7 A;  5FLM K;  4A3B C;  3HOV K;  2GAG C;  2WB1 D;  3VA7 A;  1XXC A;  1HQM A;  2R93 C;  4A3I C;  4LK1 A;  4KM9 A;  1WSV A;  2GSU A;  5M5Y K;  3GTG K;  5C3E C;  1XXA A;  3K7A K;  4RMF A;  4QIW L;  3GTP A;  2E2I K;  3GTM K;  4BXX K;  2JA8 C;  3NUH A;  3GTQ C;  4GTC A;  3GTO C;  1I6H K;  2JA7 K;  1TWG A;  3BP8 C;  1R9T C;  2WAQ L;  3HXA A;  4G0U A;  3FHZ A;  5JVO A;  5M3F K;  1PJ7 A;  1KQ4 A;  4C3I C;  4KDD A;  3H3V D;  3AH5 A;  2JA6 A;  3GTK K;  4A3D C;  2XCO A;  4A3E C;  1TWA K;  4BBS C;  3HOX C;  1Y1V A;  1I50 K;  3H3V L;  1WCM A;  2E2J K;  2PPB A;  4C3J K;  2A68 A;  2NVY K;  3HOW C;  1TWH C;  1AB4 A;  5C4X C;  2PMZ D;  4LLG A;  3GTM A;  2PMZ L;  2XCQ A;  4A3G C;  4MEX A;  1VRQ C;  3HOZ K;  3FKI C;  1O26 A;  1XZQ B;  3GTJ K;  5IYB C;  5L46 A;  4XSZ A;  1DCP A;  1YX2 A;  3GEE A;  1WSR A;  1WQF A;  3S1R C;  2FQT A; 
#chains in the Genus database with same CATH homology
 3GTK A;  3Q3Q A;  1I3Q A;  1GE9 A;  4P5B A;  1ZBS A;  2CFA B;  3L4J A;  4C3H C;  3N0B A;  1WIH A;  4KMA A;  4KM8 A;  4FM9 A;  3LAJ A;  4GTA A;  2NVY A;  1O27 A;  4GTF A;  1ZVU A;  5TJ3 A;  4GTB A;  3G4A A;  5EGH A;  3BUE A;  2GSN A;  4GTE A;  2KWA A;  4J3N A;  3OPF A;  4KB2 A;  2RGR A;  3V4G A;  1ZXO A;  1WQH A;  5IOT A;  2R92 A;  1TWH A;  3LPX A;  4KMH A;  1Y1W A;  3MML B;  1DD5 A;  3LAP A;  5CJ9 A;  4KB4 A;  3H0G A;  4ILD A;  3FOF A;  3AQO A;  3FKI A;  1EK8 A;  1O25 A;  2JA5 A;  1O2B A;  5IOQ A;  5IOR A;  2VUM A;  3OEP A;  4C3J C;  1BGW A;  3ORE A;  4M1X A;  2R7Z A;  3QX3 A;  1TWC A;  3ERE D;  3VA7 A;  1XXC A;  3S0X A;  4P5A A;  4KM9 A;  2GSU A;  4GTD A;  1XXA A;  3GTL A;  4KAS A;  4DDQ A;  2GSO A;  4LR2 A;  3GTP A;  1ISE A;  3NUH A;  3GTG A;  4KC6 A;  4GTC A;  1WQG A;  2E2H A;  1TWG A;  1BJT A;  1XXB A;  3AQP A;  4BLA A;  2E2I A;  3N3Y A;  4G0U A;  4LQY A;  2JA7 A;  3FHZ A;  1TWF A;  1O28 A;  5JVO A;  1IS1 A;  4G0V A;  1B4A A;  4KMD A;  1KQ4 A;  2YU9 A;  4C2M C;  4C3I C;  1O29 A;  4GTL A;  4KDD A;  1K83 A;  3AH5 A;  2JA6 A;  4BKW A;  2XCO A;  2PHC B;  4KAT A;  4FZB A;  1Y1V A;  4GT9 A;  2P5M A;  1WCM A;  3CAG A;  1B4B A;  1TWA A;  2XCR B;  3FOE A;  1R9T A;  1I50 A;  1O2A A;  1AB4 A;  4GFQ A;  2B63 A;  3CQZ A;  3L4K A;  2Y3P A;  1F9N A;  3GTM A;  5CHP A;  2XCQ A;  4KAW X;  2R93 A;  2NVX A;  1EH1 A;  2JH3 A;  3N0C A;  5JFE A;  4G0W A;  1O26 A;  4KAR A;  4BLB A;  5IOS A;  2ZFZ A;  2CFA A;  2RH6 A;  3G4C A;  1SFO A;  3GTQ A;  3GTO A;  3GTJ A;  1WQF A;  5EGE A;  1O24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...