5CHPA

T. maritima thyx in complex with tyc5-03
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of inhibitors targeting substrate-binding site in Mycobacterium tuberculosis FAD-dependent Thymidylate synthase (ThyX) through Virtual Screening: A New study de-fining the binding mechanism of Inhibitors
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Thymidylate synthase ThyX
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5chpA00
3G4AA 1O2AA 3N0CA 5IOSA 5IORA 5IOTA 1O2BA 1O27A 1O28A 1O24A 5IOQA 4GTEA 4GTLA 4GTBA 2CFAB 4KARA 1O25A 5CHPA 3N3YA 5JFEA 4GTDA 4FZBA 2CFAA 4GTCA 4GTFA 4P5BA 4GT9A 1O26A 4GTAA 3G4CA 1O29A 4KASA 4P5AA 3N0BA 4KATA 3AH5A 1KQ4A
chains in the Genus database with same CATH superfamily
2NVXA 3NUHA 4P9SA 3S2DC 3CQZK 1F7UA 3GDZA 1O24A 2PA8L 3GTOA 4KARA 5M3MK 1TWAK 2GSUA 3GTQK 4G7ZA 1L0WA 5IYCK 4A3GC 4KMAA 2NVQK 3QX3A 3HOZK 1B4AA 1AB4A 3S0XA 3HOYK 1IW7A 4G7OA 1YNNA 3G4AA 2GSOA 4C3HK 2WB1D 1WIHA 3A8IA 1ZQ1C 1VJEA 5C4JK 4GZYA 3S1MC 5IOQA 1USOA 3M3YK 4OINA 3GTQA 5IYDC 1Y1VK 1J6XA 3M3YC 1I3QC 4KM8A 3I4NK 4GTCA 2WAQL 3IPJA 4BBSK 1F7VA 2E2HK 1I3QK 4MEYA 3AH5A 5D4DA 4C45A 4X6AC 4NOIA 4YFXA 3S16K 3A8KA 3S14C 2NVTC 4C2MK 3CQZC 1O28A 3GTKK 3LAPA 3GTOK 3PO2K 5IP9C 5TJ3A 1SFOA 3ADAC 1WCMA 4Q4ZA 1IL2A 4GTDA 1Y1VC 2FQTA 2NVXK 3FHZA 2WAQD 2JA5C 3K7AK 4KMUA 3GTKA 2R92C 1WSRA 3S15K 1B4BA 1F9NA 3HOUK 4KMDA 4QJVA 4OIPA 3H0GA 2NVTK 1BDFA 5C4JC 1X31C 3OREA 1R9TA 2JH3A 4BLBA 5M5WK 4Y7NC 4BXXK 2A6EA 3S1RC 1DCPA 4A3LK 4P5BA 4QIWD 3RZOK 4LK1A 4FM9A 1INNA 4C3HC 4XLPA 1EFWA 3S1RK 3L4KA 5E68A 3GTJC 1V5VA 3FKIA 4JK1A 1XXCA 2RH6A 1ZXOA 4DDQA 5IOTA 3AQPA 2B63K 3S16C 4ILDA 4C2MC 4GTLA 2NVYA 4GTBA 1ZVUA 1O25A 4MEXA 4OIQA 1Y1WA 2O5JA 1SFOC 3JSTA 3HXAA 5M3FK 1TWCK 4A3LC 3L4JA 1TWAA 4GT9A 4Y52K 1TWHK 4PAAA 1DCHA 1IBAA 3CQZA 5L46A 1XXBA 1TWGK 3PO2C 4OIRA 3LPXA 4A3JK 3TFHA 3BUEA 4A93K 2ZFZA 1XPPA 3ERED 4XCHA 1XZPB 4LJZA 4A3DC 1JQWA 1YNJA 3K7AC 1EK8A 3S1NK 1O26A 1TWFC 4P5AA 5CJ9A 3HOWK 1VRQC 1YCLA 3WODA 3GTJK 1TWFA 5C44K 4C3JC 1R9TC 3RZDC 4BBRC 1O2BA 4A3IC 3PO3K 3CAGA 3T02A 3GTMA 1VLOA 2R93C 4RMFA 2JA6K 4A3GK 3HOVC 5JFEA 1GE9A 2FQOA 1I6HK 5EGEA 3S2HC 2V6UA 3SZYA 2JA5A 2R92A 4A3EC 2P5MA 3I4NC 4A3MK 2RGRA 3AD8C 2R7ZK 3S1QK 4QJVB 3VA7A 4KC6A 3H0GC 3AD9C 1I50A 2E2IC 3S1MK 3DXJA 3HOXC 1Y1WC 4A3IK 1PJ6A 2R93A 1I50C 5CHPA 2R93K 1O2FB 2CFAA 4BKWA 5FJ8K 1XZQA 1Y1VA 4GFQA 4OIOA 4GTFA 2PMZD 2E2JC 4AH6A 4LLGA 4KMHA 3G4CA 1BGWA 2NVYK 4LOWA 3GIRA 2VUMK 3N0CA 3GTLK 4J3NA 1DCOA 5HL8A 3SZZA 3FOEA 5EGHA 5M5YK 4BY7C 3GEEA 3GEIA 2JA6A 4XSZA 5IYDK 2YU9K 4FZBA 4YFKA 2ZUFA 3HOVK 2WB1L 1VGXA 5IYBK 4WJ3M 2PHCB 1TWAC 1TWFK 1VH2A 2E2JK 5IYBC 2XCRB 4A3CK 3BP3A 4KATA 4C3IC 3I4MK 4KN4A 2W7VA 2A68A 3HOYC 3BP8C 5IORA 1ZYRA 1WOOA 5IP7K 4XLNA 3FOFA 1O27A 4BY7K 2YU9A 4A3FK 1Y1WK 3OPFA 1RU0A 1I6HC 4M1XA 4XSXA 1IS1A 4G0WA 4KM9A 2JA7K 3GTPK 2V6TA 3HOZC 5C3EK 2ZUEA 3S14K 4KASA 3S15C 4AYBD 4A3BC 4C3IK 3I4MC 1O2AA 3S17C 1J6WA 5C3EC 2E2HC 3M4OC 1ZBSA 1TWGC 2O5IA 4X6AK 1K83K 4QIWL 4A3KK 2GAHC 3Q3QA 4AYBL 2Y0SL 3GTOC 5IP9K 2VUMA 3H3VD 1EQRA 3RZOC 4YG2A 3GTMK 3HOUC 2VUMC 3TFIA 2NVXC 5TMFA 3GTLC 2P8TA 2A69A 4ZH4A 4PABA 3GSIA 2JA5K 3H3VL 1HQMA 1TWGA 4A3JC 4A93C 1WCMC 1IE0A 2A6HA 4C3JK 4LK0A 1WQGA 4A3DK 3N3YA 1EH1A 3GTPA 2JA7A 4LR2A 4A3KC 5M5XK 2JA7C 3T01A 2GAGC 3GTPC 2R7ZA 3GEHA 1PJ5A 3HKZL 4BXXC 1BJTA 1I3QA 2PPBA 1O29A 1USMA 3GTGC 1I6VA 2R92K 3N0BA 1PJ7A 4A3MC 4BY1K 4KB2A 3V4GA 1XXAA 1SMYA 1WQFA 1G51A 1JVIA 1UV7A 1WCMK 3HKZD 3M4OK 1K83A 4BY1C 3AD7C 1I50K 4Y7NK 4MQ9A 1WQHA 1TWHC 3EQLA 4BBSC 4A3EK 3FKIC 5TMCA 1EI6A 1TWHA 1TWCC 4WILA 3HOWC 2B63A 2EBBA 3GTLA 1ISEA 2NVYC 5IOSA 3GTKC 4Y52C 3TFJA 1HI9A 3AQOA 1K83C 2B63C 1WOPA 4GTEA 2XCQA 1WOSA 1F93A 1C0AA 2GSNA 1J6VA 2JA6C 3MMLB 1DD5A 3GTQC 3S1NC 3GTMC 1XZPA 3TTGA 4KDDA 3FKIK 5C44C 2R7ZC 4BLAA 4KB4A 3GTGK 3H0GK 4A3CC 4O2DA 3T00A 2XCOA 3HOXK 3GTJA 1YX2A 2PA8D 1JOEA 5FLMC 2JA8K 5IP7C 3LAJA 2E2IA 1R9TK 2YU9C 4Q5SA 1BS2A 2D6FC 1WORA 3OEPA 3PO3C 2JA8C 4G0VA 5C4XK 4KN7A 3S2HK 2KWAA 1IQ0A 1KQ4A 1TWCA 2Y0SD 5C4XC 1J98A 4YFNA 4WJ4A 1WSVA 2PMZL 4G7HA 3RZDK 4A3FC 4BBRK 4G0UA 3S17K 5FLMK 2E2HA 2BE5A 2CFAB 1SFOK 2E2IK 5JVOA 2CW0A 4KAWX 4LQYA 5IYCC 2Y3PA 2V6SA 2NVQC 3A8JA 3GTGA 1XZQB 3S2DK 4GTAA 4A3BK 3S1QC
chains in the Genus database with same CATH topology
2NVXA 3NUHA 3N0CA 1XXCA 4KB2A 3V4GA 1XXAA 1ZXOA 2RH6A 4J3NA 1WQFA 4DDQA 3AQPA 5IOTA 3FOEA 5EGHA 1O24A 4ILDA 2JA6A 4C2MC 4GTLA 1K83A 2NVYA 4GTBA 3GTOA 4KARA 2GSUA 1ZVUA 1O25A 1Y1WA 4FZBA 1WQHA 4KMAA 2PHCB 3QX3A 3L4JA 1B4AA 1AB4A 1TWAA 3S0XA 4GT9A 1TWHA 2XCRB 4KATA 2B63A 4C3IC 3G4AA 3CQZA 2GSOA 3GTLA 1XXBA 1WIHA 1ISEA 5IOSA 5IORA 3AQOA 3LPXA 3FOFA 1O27A 3BUEA 5IOQA 2YU9A 4GTEA 2XCQA 2ZFZA 3OPFA 2GSNA 3ERED 3GTQA 3MMLB 4M1XA 1DD5A 4G0WA 1IS1A 4KM9A 4KM8A 4GTCA 4KDDA 1EK8A 1O26A 4KASA 4P5AA 5CJ9A 4BLAA 4KB4A 3AH5A 1TWFA 1O2AA 4C3JC 2XCOA 3GTJA 1O2BA 1O28A 1ZBSA 3LAPA 3CAGA 3LAJA 2E2IA 3GTMA 5TJ3A 1SFOA 1WCMA 5JFEA 4GTDA 1GE9A 3Q3QA 3OEPA 5EGEA 4G0VA 2VUMA 2JA5A 3FHZA 2R92A 2P5MA 3GTKA 2RGRA 2KWAA 1B4BA 3VA7A 1KQ4A 4KC6A 1TWCA 1F9NA 1I50A 4KMDA 1TWGA 3H0GA 4G0UA 2R93A 2E2HA 3OREA 2CFAB 1R9TA 1WQGA 5CHPA 3N3YA 2JH3A 1EH1A 4BLBA 5JVOA 3GTPA 4KAWX 2JA7A 4LR2A 4LQYA 2Y3PA 2CFAA 4BKWA 1Y1VA 4GFQA 4GTFA 4P5BA 3GTGA 2R7ZA 4KMHA 4FM9A 4C3HC 1BJTA 1I3QA 4GTAA 3G4CA 1O29A 1BGWA 3L4KA 3N0BA 3FKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4A A;  1O2A A;  3N0C A;  5IOS A;  5IOR A;  5IOT A;  1O2B A;  1O27 A;  1O28 A;  1O24 A;  5IOQ A;  4GTE A;  4GTL A;  4GTB A;  2CFA B;  4KAR A;  1O25 A;  5CHP A;  3N3Y A;  5JFE A;  4GTD A;  4FZB A;  2CFA A;  4GTC A;  4GTF A;  4P5B A;  4GT9 A;  1O26 A;  4GTA A;  3G4C A;  1O29 A;  4KAS A;  4P5A A;  3N0B A;  4KAT A;  3AH5 A;  1KQ4 A; 
#chains in the Genus database with same CATH topology
 2NVX A;  3NUH A;  4P9S A;  3S2D C;  3CQZ K;  1F7U A;  3GDZ A;  1O24 A;  2PA8 L;  3GTO A;  4KAR A;  5M3M K;  1TWA K;  2GSU A;  3GTQ K;  4G7Z A;  1L0W A;  5IYC K;  4A3G C;  4KMA A;  2NVQ K;  3QX3 A;  3HOZ K;  1B4A A;  1AB4 A;  3S0X A;  3HOY K;  1IW7 A;  4G7O A;  1YNN A;  3G4A A;  2GSO A;  4C3H K;  2WB1 D;  1WIH A;  3A8I A;  1ZQ1 C;  1VJE A;  5C4J K;  4GZY A;  3S1M C;  5IOQ A;  1USO A;  3M3Y K;  4OIN A;  3GTQ A;  5IYD C;  1Y1V K;  1J6X A;  3M3Y C;  1I3Q C;  4KM8 A;  3I4N K;  4GTC A;  2WAQ L;  3IPJ A;  4BBS K;  1F7V A;  2E2H K;  1I3Q K;  4MEY A;  3AH5 A;  5D4D A;  4C45 A;  4X6A C;  4NOI A;  4YFX A;  3S16 K;  3A8K A;  3S14 C;  2NVT C;  4C2M K;  3CQZ C;  1O28 A;  3GTK K;  3LAP A;  3GTO K;  3PO2 K;  5IP9 C;  5TJ3 A;  1SFO A;  3ADA C;  1WCM A;  4Q4Z A;  1IL2 A;  4GTD A;  1Y1V C;  2FQT A;  2NVX K;  3FHZ A;  2WAQ D;  2JA5 C;  3K7A K;  4KMU A;  3GTK A;  2R92 C;  1WSR A;  3S15 K;  1B4B A;  1F9N A;  3HOU K;  4KMD A;  4QJV A;  4OIP A;  3H0G A;  2NVT K;  1BDF A;  5C4J C;  1X31 C;  3ORE A;  1R9T A;  2JH3 A;  4BLB A;  5M5W K;  4Y7N C;  4BXX K;  2A6E A;  3S1R C;  1DCP A;  4A3L K;  4P5B A;  4QIW D;  3RZO K;  4LK1 A;  4FM9 A;  1INN A;  4C3H C;  4XLP A;  1EFW A;  3S1R K;  3L4K A;  5E68 A;  3GTJ C;  1V5V A;  3FKI A;  4JK1 A;  1XXC A;  2RH6 A;  1ZXO A;  4DDQ A;  5IOT A;  3AQP A;  2B63 K;  3S16 C;  4ILD A;  4C2M C;  4GTL A;  2NVY A;  4GTB A;  1ZVU A;  1O25 A;  4MEX A;  4OIQ A;  1Y1W A;  2O5J A;  1SFO C;  3JST A;  3HXA A;  5M3F K;  1TWC K;  4A3L C;  3L4J A;  1TWA A;  4GT9 A;  4Y52 K;  1TWH K;  4PAA A;  1DCH A;  1IBA A;  3CQZ A;  5L46 A;  1XXB A;  1TWG K;  3PO2 C;  4OIR A;  3LPX A;  4A3J K;  3TFH A;  3BUE A;  4A93 K;  2ZFZ A;  1XPP A;  3ERE D;  4XCH A;  1XZP B;  4LJZ A;  4A3D C;  1JQW A;  1YNJ A;  3K7A C;  1EK8 A;  3S1N K;  1O26 A;  1TWF C;  4P5A A;  5CJ9 A;  3HOW K;  1VRQ C;  1YCL A;  3WOD A;  3GTJ K;  1TWF A;  5C44 K;  4C3J C;  1R9T C;  3RZD C;  4BBR C;  1O2B A;  4A3I C;  3PO3 K;  3CAG A;  3T02 A;  3GTM A;  1VLO A;  2R93 C;  4RMF A;  2JA6 K;  4A3G K;  3HOV C;  5JFE A;  1GE9 A;  2FQO A;  1I6H K;  5EGE A;  3S2H C;  2V6U A;  3SZY A;  2JA5 A;  2R92 A;  4A3E C;  2P5M A;  3I4N C;  4A3M K;  2RGR A;  3AD8 C;  2R7Z K;  3S1Q K;  4QJV B;  3VA7 A;  4KC6 A;  3H0G C;  3AD9 C;  1I50 A;  2E2I C;  3S1M K;  3DXJ A;  3HOX C;  1Y1W C;  4A3I K;  1PJ6 A;  2R93 A;  1I50 C;  5CHP A;  2R93 K;  1O2F B;  2CFA A;  4BKW A;  5FJ8 K;  1XZQ A;  1Y1V A;  4GFQ A;  4OIO A;  4GTF A;  2PMZ D;  2E2J C;  4AH6 A;  4LLG A;  4KMH A;  3G4C A;  1BGW A;  2NVY K;  4LOW A;  3GIR A;  2VUM K;  3N0C A;  3GTL K;  4J3N A;  1DCO A;  5HL8 A;  3SZZ A;  3FOE A;  5EGH A;  5M5Y K;  4BY7 C;  3GEE A;  3GEI A;  2JA6 A;  4XSZ A;  5IYD K;  2YU9 K;  4FZB A;  4YFK A;  2ZUF A;  3HOV K;  2WB1 L;  1VGX A;  5IYB K;  4WJ3 M;  2PHC B;  1TWA C;  1TWF K;  1VH2 A;  2E2J K;  5IYB C;  2XCR B;  4A3C K;  3BP3 A;  4KAT A;  4C3I C;  3I4M K;  4KN4 A;  2W7V A;  2A68 A;  3HOY C;  3BP8 C;  5IOR A;  1ZYR A;  1WOO A;  5IP7 K;  4XLN A;  3FOF A;  1O27 A;  4BY7 K;  2YU9 A;  4A3F K;  1Y1W K;  3OPF A;  1RU0 A;  1I6H C;  4M1X A;  4XSX A;  1IS1 A;  4G0W A;  4KM9 A;  2JA7 K;  3GTP K;  2V6T A;  3HOZ C;  5C3E K;  2ZUE A;  3S14 K;  4KAS A;  3S15 C;  4AYB D;  4A3B C;  4C3I K;  3I4M C;  1O2A A;  3S17 C;  1J6W A;  5C3E C;  2E2H C;  3M4O C;  1ZBS A;  1TWG C;  2O5I A;  4X6A K;  1K83 K;  4QIW L;  4A3K K;  2GAH C;  3Q3Q A;  4AYB L;  2Y0S L;  3GTO C;  5IP9 K;  2VUM A;  3H3V D;  1EQR A;  3RZO C;  4YG2 A;  3GTM K;  3HOU C;  2VUM C;  3TFI A;  2NVX C;  5TMF A;  3GTL C;  2P8T A;  2A69 A;  4ZH4 A;  4PAB A;  3GSI A;  2JA5 K;  3H3V L;  1HQM A;  1TWG A;  4A3J C;  4A93 C;  1WCM C;  1IE0 A;  2A6H A;  4C3J K;  4LK0 A;  1WQG A;  4A3D K;  3N3Y A;  1EH1 A;  3GTP A;  2JA7 A;  4LR2 A;  4A3K C;  5M5X K;  2JA7 C;  3T01 A;  2GAG C;  3GTP C;  2R7Z A;  3GEH A;  1PJ5 A;  3HKZ L;  4BXX C;  1BJT A;  1I3Q A;  2PPB A;  1O29 A;  1USM A;  3GTG C;  1I6V A;  2R92 K;  3N0B A;  1PJ7 A;  4A3M C;  4BY1 K;  4KB2 A;  3V4G A;  1XXA A;  1SMY A;  1WQF A;  1G51 A;  1JVI A;  1UV7 A;  1WCM K;  3HKZ D;  3M4O K;  1K83 A;  4BY1 C;  3AD7 C;  1I50 K;  4Y7N K;  4MQ9 A;  1WQH A;  1TWH C;  3EQL A;  4BBS C;  4A3E K;  3FKI C;  5TMC A;  1EI6 A;  1TWH A;  1TWC C;  4WIL A;  3HOW C;  2B63 A;  2EBB A;  3GTL A;  1ISE A;  2NVY C;  5IOS A;  3GTK C;  4Y52 C;  3TFJ A;  1HI9 A;  3AQO A;  1K83 C;  2B63 C;  1WOP A;  4GTE A;  2XCQ A;  1WOS A;  1F93 A;  1C0A A;  2GSN A;  1J6V A;  2JA6 C;  3MML B;  1DD5 A;  3GTQ C;  3S1N C;  3GTM C;  1XZP A;  3TTG A;  4KDD A;  3FKI K;  5C44 C;  2R7Z C;  4BLA A;  4KB4 A;  3GTG K;  3H0G K;  4A3C C;  4O2D A;  3T00 A;  2XCO A;  3HOX K;  3GTJ A;  1YX2 A;  2PA8 D;  1JOE A;  5FLM C;  2JA8 K;  5IP7 C;  3LAJ A;  2E2I A;  1R9T K;  2YU9 C;  4Q5S A;  1BS2 A;  2D6F C;  1WOR A;  3OEP A;  3PO3 C;  2JA8 C;  4G0V A;  5C4X K;  4KN7 A;  3S2H K;  2KWA A;  1IQ0 A;  1KQ4 A;  1TWC A;  2Y0S D;  5C4X C;  1J98 A;  4YFN A;  4WJ4 A;  1WSV A;  2PMZ L;  4G7H A;  3RZD K;  4A3F C;  4BBR K;  4G0U A;  3S17 K;  5FLM K;  2E2H A;  2BE5 A;  2CFA B;  1SFO K;  2E2I K;  5JVO A;  2CW0 A;  4KAW X;  4LQY A;  5IYC C;  2Y3P A;  2V6S A;  2NVQ C;  3A8J A;  3GTG A;  1XZQ B;  3S2D K;  4GTA A;  4A3B K;  3S1Q C; 
#chains in the Genus database with same CATH homology
 2NVX A;  3NUH A;  3N0C A;  1XXC A;  4KB2 A;  3V4G A;  1XXA A;  1ZXO A;  2RH6 A;  4J3N A;  1WQF A;  4DDQ A;  3AQP A;  5IOT A;  3FOE A;  5EGH A;  1O24 A;  4ILD A;  2JA6 A;  4C2M C;  4GTL A;  1K83 A;  2NVY A;  4GTB A;  3GTO A;  4KAR A;  2GSU A;  1ZVU A;  1O25 A;  1Y1W A;  4FZB A;  1WQH A;  4KMA A;  2PHC B;  3QX3 A;  3L4J A;  1B4A A;  1AB4 A;  1TWA A;  3S0X A;  4GT9 A;  1TWH A;  2XCR B;  4KAT A;  2B63 A;  4C3I C;  3G4A A;  3CQZ A;  2GSO A;  3GTL A;  1XXB A;  1WIH A;  1ISE A;  5IOS A;  5IOR A;  3AQO A;  3LPX A;  3FOF A;  1O27 A;  3BUE A;  5IOQ A;  2YU9 A;  4GTE A;  2XCQ A;  2ZFZ A;  3OPF A;  2GSN A;  3ERE D;  3GTQ A;  3MML B;  4M1X A;  1DD5 A;  4G0W A;  1IS1 A;  4KM9 A;  4KM8 A;  4GTC A;  4KDD A;  1EK8 A;  1O26 A;  4KAS A;  4P5A A;  5CJ9 A;  4BLA A;  4KB4 A;  3AH5 A;  1TWF A;  1O2A A;  4C3J C;  2XCO A;  3GTJ A;  1O2B A;  1O28 A;  1ZBS A;  3LAP A;  3CAG A;  3LAJ A;  2E2I A;  3GTM A;  5TJ3 A;  1SFO A;  1WCM A;  5JFE A;  4GTD A;  1GE9 A;  3Q3Q A;  3OEP A;  5EGE A;  4G0V A;  2VUM A;  2JA5 A;  3FHZ A;  2R92 A;  2P5M A;  3GTK A;  2RGR A;  2KWA A;  1B4B A;  3VA7 A;  1KQ4 A;  4KC6 A;  1TWC A;  1F9N A;  1I50 A;  4KMD A;  1TWG A;  3H0G A;  4G0U A;  2R93 A;  2E2H A;  3ORE A;  2CFA B;  1R9T A;  1WQG A;  5CHP A;  3N3Y A;  2JH3 A;  1EH1 A;  4BLB A;  5JVO A;  3GTP A;  4KAW X;  2JA7 A;  4LR2 A;  4LQY A;  2Y3P A;  2CFA A;  4BKW A;  1Y1V A;  4GFQ A;  4GTF A;  4P5B A;  3GTG A;  2R7Z A;  4KMH A;  4FM9 A;  4C3H C;  1BJT A;  1I3Q A;  4GTA A;  3G4C A;  1O29 A;  1BGW A;  3L4K A;  3N0B A;  3FKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...