5CI5A

Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
393
structure length
393
Chain Sequence
SKTLTIWIGGQVAELDETWNSVIKTFEEKYGISVEVQLFGFDTYYDKLVTALQAGKGPDLAFADLGGWVPTFAEKGWLEPMEEHLKNWEGTAQIWPNLWPTVTYKKIRYGLPWYTDCRLLLYNKAMFEKAGLNPDNPPKTWDELLDAALKITDTKNRIYGYGVSGTKTEHTTLGYMMFLYAAGGKLLTDDYSKAAFDSPEGLKALKFYTDLAKKYNVSPNAIQYHEDDYRNMMAQNRVAMAIGGPWSFPLIEAANPDIAGKYSVALHPYDAKPASVLGGWALVIPSSSPNKEDAWKLAEYLTSFDVWMKWVEEKGGPMPTRMDVCKKSKLANDVKWQIIFETFPHAVARPPIPQYPQISEQIQTMVQRVLLGELTPEEAIKIAAENVNKILGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein family 1
publication title Crystal Structure of an ABC transporter Solute Binding Protein from Thermotoga Lettingae TMO (Tlet_1705, TARGET EFI-510544) bound with alpha-D-Tagatose
rcsb
source organism Pseudothermotoga lettingae (strain atcc baa-301 / dsm 14385 / nbrc 107922 / tmo)
molecule tags Sugar binding protein
total genus 125
structure length 393
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5ci5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5ci5A02
3FIRA 5H8HA 1WVJA 3T9HB 5L9MA 4DE8A 4BDRA 3WAFA 3QUFA 2E0SA 2ALUA 4WEDA 3MVZA 2G93A 1DTGA 1MY2A 4U4XA 1IQ7A 2DXYA 2R71A 4R6YA 2ANJA 2AL4A 2ABHA 5DVFA 3SEVA 1TFDA 1BIYA 4QFLA 1OQHA 2LAOA 3U8QA 4PFTA 1BLFA 4OWDA 2AIXA 2PT2A 3H3GA 2YPNA 2XX9A 1NH8A 4PE5B 1Y3QA 1URDA 2V84A 4LONB 3S9LC 2XD2A 4HTGA 1UTHB 2QRYA 2F97A 3LUYA 1RYXA 2DXRA 5H8QB 3T96B 2Q89A 4XXUA 2RC7A 3IJXB 4R6KA 3QUJA 2F36A 3OO8A 4H1XA 3CFXA 3FVKA 4GFRA 1JW4A 3PUVE 2W7YA 2Z8EA 3SEYA 3Q26A 3E9XA 5HPQA 4LZ7A 1TFAA 2QS2A 4O3CA 4JWOA 4POWA 4GF8A 4OTEA 5ICQA 3EQ1A 1QUJA 3PMWA 4DXBA 1FTMA 1FQBA 4IO7A 4DZ1A 1S9TA 3V5AA 1DPPA 1URGA 4ZEBA 5JK4A 3TTMA 1M5CA 2DWIA 1S7YA 2CMOA 2NUVA 1TT1A 3PUYE 3G3JA 2DE2A 3SDFA 3SETA 4RY1A 5DVJA 3VDFA 1LAXA 5AA4B 3C32A 2O68A 3ONMA 5H8HB 1XC1A 3U93A 3LSFB 2OWTA 1B4ZA 3U1OA 5I59A 1MDP1 2DE3A 1EU8A 4G8MA 1NNKA 3PMVA 2QMXA 4U4SA 1DMBA 1MG1A 4YICA 1GGGA 4MBPA 1XVXA 4NF6A 5CM6A 1LAGE 1HSLA 5FTHA 1H3DA 4NE4A 3BKIB 3VE1B 3RTFB 4F1YA 3KSJA 1LBBA 5I56A 1P1UA 3OELA 4RK2A 3GZGA 4ZEDA 3U92A 1SVXB 1LBCA 5KDTA 3PPOA 4I62A 4E0WA 2REJA 2PBWA 1B5JA 3IL1B 1I69A 1DOTA 3RY3A 4LP2B 4U1ZA 4I1DA 5JTYA 3MUQA 1IXIA 4GOTA 4KI0E 5K2XA 3C34A 1B0HA 3QAXA 3ZSFA 4IGTA 3CFZA 4R2BA 3TELA 2A5SA 4X48A 2ZXTA 4U22A 1YPNA 3KEIA 1FTJA 5TPAA 3D4GA 2I0CA 4QF9A 3UORA 2F34A 4ZZEA 2DP8A 3JV9A 2QS3A 3S4UA 2P1SA 3OSRA 3ZKLA 3CI8A 3T9UA 4G68A 3LSLA 1MM6A 3HO7A 1DPEA 4GWOA 4FIMA 2O7IA 4R75A 2ZYKA 2RINA 4YKJA 1P1OA 3QSLA 1PBPA 4XKNA 5I59B 2Y7KA 2F7CA 4Q8RA 1CB6A 1N76A 1T0KA 3JYRA 3VVDA 4KYEA 3EPEA 2ONSA 2XX8A 4FE8A 2V3UA 2BJJX 3HN0A 1UIUA 3SEXA 1B52A 2I3VA 1B3FA 4OEUA 3B7DA 3FGSA 4ELQA 1ZU0A 1JEUA 2XXQA 4UACA 1URSA 3VFJA 4ECFA 1B2HA 2H25A 3KN3A 3MP6A 3MVYA 4NWDA 1ELJA 2HAUA 1LFGA 2XXIA 1OVBA 1JVXA 4F1UA 2I6EA 5KDTB 2CZLA 2B3FA 5FTIA 2REGA 1XVYA 2XXPA 2I58A 3CG1A 3S9MC 3VVFA 2UVIA 2XXWA 4Q30B 3BFUA 1MH4A 3S9NC 1LCTA 1MXWA 4HCYA 1BTJA 1VR5A 3TPAA 5ITPA 4ZDMA 1Q1KA 1DSNA 2HXWA 2H4IA 3R6UA 1OLAA 4GXAA 2XXHA 4WKMA 3QXMA 2I4BA 4OMBA 5H8FA 3KFMA 1OQGA 3HCQA 3IAZA 5TPAB 3RPWA 4OXVA 3G7WA 3B6WA 3PD9A 5DYHA 4U1OA 1PB7A 5J1DA 5BUUA 5I57A 4JB7A 4IO6A 5AA3A 5A5XA 4OVJA 3S2VA 1A40A 4AQ4A 1N84A 2H9BA 4R6HA 2H98A 1Y4TA 3CRBA 3KZGA 4G2ZA 1GV8A 1US5A 4LZ8A 4U21A 5HBCA 1USYE 2RC8A 5H8SA 3T22A 4PFUA 4QSEA 2F7BA 1JETA 2VD3A 4OQOA 1QVSA 1FQEA 3ECRA 1B32A 5DTBA 4ZEKA 4PFYA 4EF2A 1XHYA 5JEIA 3MAMA 1F9BA 1IXCA 4YB5A 1MRPA 3TUSA 4N6PA 2IA4A 2HFBA 4OESA 3QIMA 3N6TA 1MPCA 5AA2D 1A8FA 3MW0A 2THIA 1PB9A 3SEUA 3M8UA 4GQOA 3G3GA 1XS5A 1D4NA 1B5HA 1B40A 4C0RA 3OSQA 3TDJA 4KHZE 4NMYA 2Y7RA 3FD3A 4EDPA 1JNFA 4R72A 2H99A 3R7XA 5L9SA 1NNTA 4ELRA 1US4A 2A5TA 1B05A 3F11A 3PPQA 4KCCA 1VFEA 1HSJA 1P1QA 3V89B 4XKPA 5H8FB 1ZMGA 3H6VA 1H76A 3ILUB 4NF8A 3VLUA 1B51A 4O3BA 3CFLA 4DXCA 3IB1A 3MZ9A 3EHUA 4QSDA 2NWJA 3TTRA 3E4RA 4OHNA 1MQJA 1N3XA 5I57B 2O1MA 3HV1A 2O7UA 1EZPA 3CVGA 4ISUA 5A5XB 5AA4A 1OIBA 1J1NA 3MP1A 4Z0IA 3K6VA 1Y1ZA 1NL5A 2O6AA 3MP8A 5CMMA 4KYSA 5L8DA 2AL5A 1QKAA 2F35A 3C35A 3H6TA 2F6GA 3TQWA 3MVXA 1SDXA 5HM4B 5I84A 2UVJA 3FV2A 1SW4A 2GHAA 2DVZA 2IEEA 1VFDA 1FQFA 4NEDA 2DWHA 3DLNA 2V3TA 4YAHX 1PB8A 2V3QA 1S50A 1LB8A 2H5YA 1PEBA 2PX1A 1MY0A 3FATA 2RC9A 1SW5A 2VP1A 4M1VA 1UIVA 3QK6A 3HHFA 1XT8A 4ZE8A 4DXUA 5ICTA 2X7QA 2WKYA 5CMCA 2A5TB 4JWYA 2YJPA 1Q35A 3FVOA 2D5WA 4FJPA 2KLFA 1MPDA 3MBPA 5CMBA 3SKPA 4I9DA 5IAIA 1Z7NE 4NF8B 1PBQA 1AL3A 2B3BA 4MLQA 2QS1A 4KQPA 4LVQA 3K1PA 2ONRA 3I3VA 4G77A 4NF5B 4YZZA 4EQ7A 3OEKA 3IO6A 2F78A 3R26A 4XKRA 3FXRA 2V93A 1N7XA 3K0VA 1TXFA 1B3LA 4H8IA 3D4CA 3C33A 3K00A 4QFNA 1IIWA 1USYH 1NNPA 4OYVA 3H7MA 4F29A 1A8EA 1MXVA 1FW0A 3N6UA 2QPQA 3IB2A 1EZOA 3FZVA 3TEPA 4C1TA 4QHQA 1YCJA 3OOAA 4KD5A 4RJZA 3I5OA 3RLFE 1B3GA 1SW1A 4TLMB 4DLDA 2ZYNA 3O28A 4YKPA 3A3UA 3DP4A 3IOWA 3EN3A 4R2FA 1FQCA 2I4CA 1B6HA 3IORA 3M3KA 4P0IA 2P2AA 3K02A 4H6DA 3OXNA 1AOVA 1YAEA 2XD3A 3GBBA 1O7TA 4QRZA 4FEBA 4PETA 4RA1A 2PVUA 4PQJA 1A99A 3DP8A 1POY1 3E13X 3O9PA 4R74A 2M8CA 4H65A 2X26A 2RKMA 3KOSA 2QL3A 4KR5A 4JBZA 3OD7A 1RYOA 3H6WA 4TOZA 1QUIA 2QSXA 1PC3A 4ELOA 1TWYA 1I6AA 3CIJA 2O51A 3OEMA 4IO2A 1IXGA 4H5FA 1MQDA 3G3KA 1POTA 3DM0A 5CMKA 1SI1A 3RQTA 2HZKA 2D3IA 5K2YA 4MH5A 3TODA 4EQBA 3T66A 4KCDA 2VHAA 4OERA 3FJMA 3LC8A 3H06B 1R9LA 3K4UA 1BP5A 4OEVA 4JDFA 5FHNA 3PV0E 3DP6A 3B6TA 3TCHA 3C36A 4NF4B 2OWSA 2UVGA 1SYIA 4O3AA 4FORA 3PUZE 1P1WA 3FJ7A 3N26A 4K3FA 5I2KB 4GL0A 1MQHA 1B5IA 2GHBA 2XXRA 1QW0A 2Y7IA 3LR1A 1ANFA 1QJMA 4BLAA 2OK2A 2P0SA 4F18A 3K1NA 2DQVA 4THIA 1Y3NA 1SBPA 2Q9TA 4BDQA 1M5DA 2DOJA 4ZE9A 2XHDA 2Q2AA 1LFHA 2O69A 5LOMA 4KFQA 3N94A 3CSGA 2XXVA 4EXLA 3MJNA 4ZEFA 2DS9A 3M3LA 4UA8A 1SW2A 2VD2A 4IY5A 4IY6A 4N13A 5F1QA 1N0TA 1B1XA 2UYFA 5FHMA 4BDNA 3W15C 2DVCA 2GRVA 1SQYA 2I3WA 4DCXA 4LZ5A 2G29A 4YMAA 4HS7A 1M5FA 3Q29A 2DE4A 5IKBA 3A09A 4ZEIA 1LCFA 2UYEA 2RF1A 5DEXB 4GL8A 3AXFA 3THIA 3IOUA 1Y3PA 2NVUB 1P1NA 2AYSA 4DDDA 4F2QA 2OZZA 3IB0A 2V25A 3MZBA 2I49A 3TMGA 4H67A 5CI5A 3MPKA 4LQ5A 3T9VA 3SEWA 2ZYMA 3G3FA 3V8XB 1AIVA 3FVGA 4F31B 4Q0CA 2ZMBA 3VXCA 1EH3A 2F7AA 5CBRA 1MS7A 1B1HA 5TP9B 4F3PA 4RK9A 3GXAA 4LUBA 5I58B 1FTKA 1FTLA 3FXQA 4H8JA 4H0WA 3OENA 1KWHA 3OO9A 2XXTA 1DTZA 3MPLA 4F19A 2I48A 1B0LA 1GVCA 3FUZA 2Q8JA 2NXOA 3ZS6A 5KZTA 3UK4A 1SD3A 2DSFA 3TTLA 3PGFA 1MXZA 2QJEA 4F3BA 2QS4A 5EHSA 3O6GA 3S9EA 2UVHA 3ILTB 4H5GA 1O64A 3TCGA 3O66A 3UA8A 2Y7PA 3QYTA 1GR2A 4POXA 1RKMA 3N5LA 2R6GE 3H03A 4DCYA 1AMFA 5AA2B 4ESXA 4NF5A 1IUDA 1H43A 5TU0A 3Q27A 1JW5A 3L6HA 4U2RA 4OETA 2I0BA 3L6GA 3K2DA 1AH5A 3PUXE 5CC2A 3G3IA 1NNFA 3KSXA 1LFIA 5ELVA 3VVEA 5DVIA 2RCAA 1MM7A 2UXAA 4TLLB 3CSBA 1LGBC 3KJ7A 2DWAA 4KYDA 2ZYOA 4P0GA 5AE4A 4OFOA 2OCUA 3CR9A 2PYYA 1QULA 3WAEA 3TAJA 4L17A 4FATA 1FCKA 3K6WA 1MXUA 1IXHA 2B65A 1Z7ME 1ZLQA 4AB5A 2O1LA 3VLWA 1UQWA 1JEVA 3C4MA 2DYXA 3UIFA 4G68C 3HPIA 3IJOB 4ZECA 4Z7EA 1H45A 3B6QA 3KN7A 1HSEA 4M4GA 4YB6A 3UGWA 1B4HA 3MQ9A 2VOZA 4GRKA 3KBRA 2HEUA 3UN6A 2OBGA 4OFLA 2DWJA 2HQ0A 1LB9A 5M2VA 3HSTA 4F39A 1MY3A 4EUOA 1QKBA 2ZNSA 4F2OA 1YTVA 1MH3A 4JXIA 4QSCA 3C31A 1IZ1A 4X1BA 4MFIA 5I2NB 3A3CA 4BDMA 1MPBA 1CE2A 3T93B 1A54A 4F22A 1R1NA 1SI0A 2Q2CA 4R9GA 1M5EA 4YKKA 2Z22A 4TQUQ 2OLBA 4Q5TA 1H44A 2PMSA 2FA7A 3W9WA 3BBRA 4PFWA 3KJTA 3LSXA 3OO6A 3IR1A 2E1SA 5B7DA 4ND9A 3U72A 5F7VA 3O29A 2XX7A 5ITOA 4NF4A 5AA1A 3MWBA 3LSWA 1B7ZA 2Q88A 3EHSA 1Y9UA 4RYAA 4HCWA 4KPTA 4YB7A 2VGQA 3FASA 4OZ9A 5I2KA 2D21A 1VE4A 2XXUA 2X7PA 2ZNTA 4YU0A 3IO4A 4ELPA 4IO4A 3DELB 3PD8A 4RPOA 3TYHA 1N3WA 1ZIUA 3OMBA 4X1DA 1QUKA 4EF1A 4IO5A 1MQGA 1MXXA 1UTBA 1LAHE 3MZ1A 3IOTA 3PUWE 4GD5A 4LA9A 2NOOA 3GLBA 3RNNA 1IEJA 2YLNA 3USDA 1XOCA 4GIZA 4X9TA 3PPPA 1B9JA 4R9FA 3VV5A 5FHOA 2R9JA 2Z8DA 3TCFA 3KN8A 4IGRA 3I6VA 4ZZAA 1D9VA 3W9VA 5CBSA 3TTKA 1I6QA 1B3HA 3H6UA 2HAVA 5DEXA 3IK6B 4JSOA 1LAFE 3RT8A 4P11A 3BFTA 3TZAA 1N04A 3IX1A 4EXKA 4JWXA 3U94A 4MLVA 2QMWA 3H4ZA 3P7IA 3TTNA 1NMUA 3KOTA 1Y1MA 3MVWA 3FV1A 4G8NA 4HW8A 5H8NA 5TP9A 3ZKKA 4F3GA 1PDAA 4JSDA 3VXBA 4OFJA 1MQIA 1JW1A 3VLVA 5I58A 3TKDA 4AB6A 3T9XB 2Z8FA 2HCAA 3O6HA 1O63A 3PMXA 3MC2A 3EHTA 1M5BA 4NF6B 4XIGQ 1NKXA 1A7LA 3RGYA 1FQAA 5I56B 1SYHA 3TFLA 3IOVA 3Q25A 1FQDA 1UTBB 3HHGA 1JVYA 4F3SA 4BDLA 4NWCA 1MY4A 5JTYB 1MY1A 5ISUA 2F6PA 3C9HA 1MDQA 2O84X 1B7HA 4WEPA 1I6BA 5CRYA 2Y84A 3K1MA 5KCJA 1LLSA 1NH7A 4YKIA 3PPNA 5AA2A 1P99A 1B7UA 1OLCA 3FJGA 1ZTYA 1ZJLA 4F1VA 2ESNA 4C1UA 3JZJA 5B70A 4OENA 1EZ9A 1Y4CA 3V83A 1VSOA 3SESA 3RN8A 2HZLA 3RT6B 4U23A 4G68B 4ZS9A 1II5A 2F8DA 4R73A 4LQ2A 4GLIA 3CG3A 2F5XA 3Q28A 4GVOA 3PPRA 3RUMA 4G8HA 1ATGA 4N07A 1BKAA 5H8NB 2FYIA 3K6UA 1Y20A 3RTWB 4BDOA 1ZKBA 4QFPA 1MXYA 1FTOA 3UP9A 3EF7A 1JQFA 4ESWA 3KG2A 5DT6A 4GXSB 2FNCA 1OVTA 3FVNA 3OO7A 1B3EA 4EQ9A 2RCBA 2PT1A 4LATA 3K01A 1R6ZA 4RPNA 3TQLA 4XKQA 1UTHA 5BWJA 4RNSA 4QFKA 1OMPA 5H8QA 3O6IA 2OJTA 1LSTA 4IB2A 1R9QA 4ONYA 2XXXA 4QFOA 3O97A 1B46A 4XTCQ 4I8CA 2GFEA 3E3KA 3O2AA 4FECA 4FAJA 4NTLA 3K6XA 4IO3A 1NFTA 3G3HA 3GBAA 5EHMA 5L9OA 3KGCA 5I2NA 5KCJB 4DIGA 1ZBMA 4E0XA 1L5TA 1D3KA 1N7WA 2ONKE 4G4PA 4YMBA 3LBSA 1D9YA 4RXLA 1A55A 1GTKA 2XXYA 1WODA 3M3FA 4MF3A 1IITA 4WXJA 2Y7WA 4FEDA 2Z23A 4PP0A 2ZNUA 1B58A 3ODBA 1WDNA 3SERA 3PU5A 3FXUA 2GH9A 5EYFA
chains in the Genus database with same CATH superfamily
3FIRA 5H8HA 1WVJA 3T9HB 2ZZVA 5L9MA 4DE8A 4BDRA 4GX4A 1NUYA 3WAFA 3QUFA 1BK4A 2E0SA 2ALUA 4WEDA 3MVZA 2G93A 4N17A 1DTGA 1MY2A 4OVSA 3SZPA 4U4XA 1IQ7A 2DXYA 2R71A 4R6YA 2ANJA 2AL4A 2ABHA 5DVFA 3SEVA 1TFDA 1BIYA 4QFLA 1OQHA 2LAOA 3U8QA 4PFTA 1BLFA 4OWDA 2AIXA 2PT2A 3H3GA 4MMPA 2YPNA 2XX9A 1NH8A 4PE5B 1Y3QA 1URDA 2V84A 4LONB 2XWKA 3S9LC 2XD2A 4PFBA 4HTGA 2XWOA 1UTHB 2QRYA 2F97A 3LUYA 1RYXA 2DXRA 5H8QB 3T96B 2Q89A 4XXUA 2RC7A 3IJXB 4R6KA 3QUJA 2F36A 3OO8A 4H1XA 4XFEA 3CFXA 3FVKA 4GFRA 1JW4A 3PUVE 2W7YA 1NUWA 2Z8EA 3SEYA 3Q26A 3E9XA 5HPQA 4LZ7A 1TFAA 2QS2A 4O3CA 1NV3A 4JWOA 4POWA 4GF8A 1FBPA 4OTEA 4HE2A 2Q8MA 5ICQA 3EQ1A 1QUJA 3PMWA 4DXBA 1FTMA 1FQBA 4IO7A 4DZ1A 1S9TA 3V5AA 1DPPA 1URGA 4ZEBA 1FTAA 5JK4A 3TTMA 1M5CA 3MSTA 4MNPA 2DWIA 1S7YA 2CMOA 2NUVA 1TT1A 3PUYE 3G3JA 2DE2A 3SDFA 3SETA 4RY1A 5DVJA 3VDFA 2BJIA 1LAXA 4H45A 5AA4B 3C32A 4GWYA 2O68A 3ONMA 5H8HB 1XC1A 3U93A 3LSFB 3BIGA 2OWTA 1IMBA 1B4ZA 3U1OA 3KC0A 5I59A 4PAIA 1MDP1 2DE3A 1EU8A 4G8MA 4MCOA 1NNKA 3PMVA 2VPOA 2ZZXA 2QMXA 4U4SA 4HE1A 1DMBA 1MG1A 4YICA 1GGGA 4MBPA 1XVXA 2KQZA 4NF6A 5CM6A 1LAGE 1HSLA 5FTHA 1H3DA 4NE4A 4OVTA 3BKIB 3VE1B 3RTFB 4F1YA 3KSJA 1LBBA 5I56A 1SPIA 1P1UA 3OELA 4RK2A 3GZGA 4ZEDA 3U92A 1FPEA 1SVXB 1LBCA 5KDTA 3PPOA 4I62A 3B8BA 4E0WA 2REJA 2PBWA 1B5JA 3IL1B 2PCRA 1I69A 1DOTA 3RY3A 4LP2B 4U1ZA 4I1DA 5JTYA 3MUQA 1IXIA 4GOTA 4KI0E 5K2XA 3C34A 1B0HA 3QAXA 3ZSFA 1FPFA 4IGTA 3CFZA 4R2BA 3TELA 2A5SA 4PFIA 4X48A 2ZXTA 2XA5A 4U22A 1YPNA 3KEIA 1FTJA 5TPAA 3D4GA 4PBQA 1NV4A 2I0CA 4QF9A 3UORA 3FBPA 2F34A 4ZZEA 5ET6A 2DP8A 4NN3A 3JV9A 2QS3A 3S4UA 2P1SA 3OSRA 3ZKLA 3CI8A 3T9UA 4G68A 3LSLA 1INPA 1MM6A 3HO7A 1DPEA 4GWOA 4FIMA 5EQ8A 2O7IA 4R75A 2ZYKA 4AS4A 1KA1A 2RINA 4YKJA 1P1OA 3QSLA 1PBPA 4PC9A 4XKNA 5I59B 2OX3A 2Y7KA 2F7CA 4Q8RA 1CB6A 4P8BA 1N76A 1T0KA 2FIEA 3JYRA 3VVDA 4KYEA 3EPEA 2ONSA 2XX8A 4FE8A 2V3UA 3NOHA 2B4LA 2BJJX 3HN0A 1UIUA 1IMEA 3CHGA 3RPLA 3SEXA 1B52A 2I3VA 1B3FA 4OEUA 3B7DA 3FGSA 5T3JA 4ELQA 2B4MA 1NI9A 1ZU0A 1JEUA 2XXQA 4UACA 1URSA 3VFJA 4QBAA 3U65A 4ECFA 4PTKA 1B2HA 4GX6A 2H25A 3KN3A 3MP6A 3MVYA 4NWDA 1ELJA 2HAUA 1LFGA 2XXIA 1OVBA 1JVXA 4F1UA 2I6EA 5KDTB 2CZLA 2B3FA 5FTIA 2REGA 4NGUA 3FXBA 1XVYA 2XXPA 2I58A 3CG1A 3S9MC 3VVFA 2UVIA 2XXWA 4Q30B 3BFUA 5IZZA 1MH4A 3S9NC 1LCTA 1MXWA 4HCYA 1BTJA 5ET7A 1VR5A 1FBHA 3TPAA 5ITPA 4ZDMA 1Q1KA 1DSNA 2HXWA 2H4IA 3R6UA 1OLAA 4GXAA 2XXHA 4WKMA 3QXMA 2I4BA 4OMBA 5H8FA 5EYGA 3KFMA 1OQGA 3HCQA 4O8MA 3IAZA 5TPAB 3RPWA 4OXVA 5A5LA 3G7WA 3B6WA 3PD9A 5DYHA 4U1OA 2WX9A 1PB7A 5J1DA 5BUUA 5I57A 4JB7A 3ISPA 2P3NA 4IO6A 5AA3A 5A5XA 4OVJA 3S2VA 1A40A 4AQ4A 1N84A 2H9BA 4R6HA 2H98A 1Y4TA 3CRBA 5J16A 3KZGA 4G2ZA 1GV8A 1US5A 4LZ8A 4U21A 5HBCA 1USYE 2QVRA 2RC8A 5H8SA 3T22A 4PFUA 4QSEA 2VPNA 2F7BA 1JETA 2VD3A 2V4CA 4OQOA 3KBZA 4LN5A 1QVSA 1FQEA 3ECRA 1B32A 5DTBA 4ZEKA 4PFYA 4EF2A 1XHYA 1EYKA 5JEIA 3MAMA 1F9BA 1IXCA 4YB5A 1MRPA 3TUSA 1RDYA 4N6PA 2IA4A 4PE3A 2HFBA 4OESA 3QIMA 1JP4A 3N6TA 3HFUA 4DI4B 1MPCA 4NHBA 5AA2D 1A8FA 3MW0A 2THIA 1PB9A 3SEUA 3M8UA 4GQOA 2QVUA 3G3GA 1XS5A 1D4NA 1B5HA 5EYHA 1B40A 4C0RA 3OSQA 3TDJA 4KHZE 4NMYA 2Y7RA 3FD3A 4PFRA 4EDPA 1JNFA 4R72A 2H99A 1EYIA 3R7XA 1DCUA 5L9SA 4P1LA 1AWBA 1LBVA 1NNTA 4ELRA 1US4A 4NX1A 2A5TA 1B05A 2PFZA 3F11A 3PPQA 4KCCA 1VFEA 1HSJA 1P1QA 3V89B 4XKPA 2FHYA 5H8FB 1ZMGA 3H6VA 1H76A 3ILUB 4NF8A 3VLUA 3PTYA 1B51A 4O3BA 3E78A 3CFLA 4DXCA 3IB1A 3MZ9A 3EHUA 4QSDA 2NWJA 3TTRA 3E4RA 4OHNA 1MQJA 1N3XA 4NQ8A 5I57B 4OANA 2O1MA 3HV1A 2O7UA 1EZPA 3CVGA 4ISUA 5A5XB 5AA4A 1OIBA 1J1NA 2KR0A 5I5PA 4I40A 3MP1A 4Z0IA 3K6VA 1Y1ZA 1NL5A 2O6AA 3MP8A 5CMMA 4JVIA 4KYSA 5L8DA 2AL5A 1QKAA 2F35A 3C35A 4PCDA 4P47A 3H6TA 2F6GA 3TQWA 3MVXA 4GWUA 1SDXA 5HM4B 5I84A 2UVJA 3FV2A 1SW4A 2GHAA 2DVZA 2IEEA 1VFDA 5LTCA 4GX3A 5LDZA 1FQFA 4NEDA 2DWHA 3DLNA 2V3TA 4YAHX 1PB8A 1RDZA 2V3QA 1S50A 1LB8A 2H5YA 3D1RA 1PEBA 2PX1A 1MY0A 3FATA 2RC9A 4XEQA 1SW5A 2VP1A 4M1VA 4I3EA 1UIVA 3QK6A 3HHFA 2WEFA 5IZ3A 1XT8A 4ZE8A 4DXUA 5ICTA 2X7QA 2WKYA 5CMCA 2A5TB 3EKIA 1FSAA 4JWYA 2YJPA 1Q35A 3FVOA 3GYYA 2D5WA 4FJPA 2KLFA 1MPDA 3MBPA 5CMBA 3SKPA 4I9DA 2P3VA 5IAIA 1Z7NE 4NF8B 1PBQA 1AL3A 1LEVA 2B3BA 4MLQA 2QS1A 4KQPA 4LVQA 3K1PA 2ONRA 3I3VA 4G77A 4NF5B 2FIXA 4YZZA 4EQ7A 3OEKA 3IO6A 4OVRA 2F78A 3R26A 4XKRA 3FXRA 1CNQA 2V93A 1N7XA 3K0VA 4MEVA 1TXFA 1B3LA 4H8IA 3D4CA 3C33A 3K00A 4QFNA 1IIWA 1USYH 1NNPA 4OYVA 3H7MA 4MNIA 4F29A 1A8EA 1MXVA 1FW0A 3N6UA 4NAPA 2QPQA 3IB2A 1EZOA 3FZVA 3TEPA 4C1TA 4QHQA 1YCJA 3OOAA 4KD5A 4RJZA 3I5OA 3RLFE 1B3GA 1SW1A 4TLMB 4DLDA 2ZYNA 4MIJA 4XF5A 3O28A 4YKPA 3A3UA 3DP4A 3IOWA 3EN3A 4R2FA 1FQCA 2I4CA 5IZ3B 1B6HA 3IORA 3M3KA 1FJ6A 4P0IA 2P2AA 3K02A 4H6DA 4PGPA 4OA4A 3OXNA 1AOVA 1YAEA 4I3YA 1LBXA 2XD3A 3GBBA 1O7TA 4QRZA 4FEBA 4PETA 4RA1A 1NV0A 2PVUA 4PQJA 1A99A 2MKZA 3DP8A 1POY1 3E13X 2XXKA 3O9PA 4R74A 2CZKA 2M8CA 3A29A 2X26A 4H65A 2RKMA 3KOSA 2QL3A 4KR5A 4JBZA 3OD7A 1NV2A 1RYOA 3H6WA 4TOZA 1QUIA 2QSXA 1PC3A 4AS5A 4ELOA 1TWYA 1I6AA 3CIJA 2O51A 3OEMA 4IO2A 1IXGA 1FPDA 4H5FA 1MQDA 5I7IA 3G3KA 1POTA 3DM0A 5CMKA 1SI1A 3RQTA 2HZKA 1EYJA 2D3IA 5K2YA 4MH5A 3TODA 4EQBA 3T66A 4KCDA 2VHAA 4OERA 3FJMA 4N6KA 3LC8A 3H06B 1R9LA 3K4UA 1BP5A 4OEVA 4JDFA 5FHNA 3PV0E 3DP6A 3B6TA 3TCHA 3C36A 4NF4B 3E79A 2OWSA 2UVGA 1SYIA 4O3AA 4PF8A 4FORA 1LBZA 3PUZE 1P1WA 3FJ7A 2CEYA 3N26A 4K3FA 2Y5LA 5I2KB 4GL0A 1MQHA 1B5IA 2GHBA 2XXRA 4PAFA 1QW0A 2Y7IA 3LR1A 1ANFA 1QJMA 4BLAA 2OK2A 2P0SA 4F18A 3K1NA 2DQVA 4THIA 2Q74A 1Y3NA 2XWVA 1SBPA 2Q9TA 4BDQA 1M5DA 2DOJA 4ZE9A 2XHDA 2Q2AA 1YZ0A 1LFHA 2F3DA 2O69A 5LOMA 4KFQA 1FPLA 2GQ1A 3N94A 3CSGA 1RDXA 2XXVA 4UABA 4EXLA 3MJNA 4ZEFA 2DS9A 3M3LA 4UA8A 1SW2A 1VDWA 2VD2A 4IY5A 4IY6A 4N13A 5F1QA 1N0TA 1B1XA 2UYFA 5FHMA 4BDNA 3W15C 2DVCA 2GRVA 1SQYA 2I3WA 4DCXA 4LZ5A 2G29A 4YMAA 4HS7A 1M5FA 3Q29A 2DE4A 5IKBA 3A09A 4ZEIA 1LCFA 2CZIA 2UYEA 2RF1A 4G61A 2DDKA 5DEXB 4GL8A 3AXFA 3THIA 3IOUA 1Y3PA 4P9KA 2NVUB 1P1NA 4KXPA 1DK4A 2AYSA 4P56A 4DDDA 4F2QA 2OZZA 3IB0A 2V25A 3MZBA 2I49A 5ET5A 5ESYA 3TMGA 4H67A 2CEXA 5CI5A 3MPKA 2ZZWA 4LQ5A 3T9VA 3SEWA 2ZYMA 3G3FA 3V8XB 1AIVA 3FVGA 4F31B 4Q0CA 2ZMBA 3VXCA 1EH3A 2F7AA 5CBRA 1MS7A 1B1HA 5TP9B 4F3PA 2F3BA 4RK9A 1XI6A 1IMCA 3GXAA 3LUZA 4LUBA 5IGAA 4MAGA 5I58B 1FTKA 1FTLA 3FXQA 4H8JA 4H0WA 3OENA 1KWHA 3OO9A 2XXTA 1FPJA 1DTZA 3MPLA 4F19A 1FPGA 2I48A 1B0LA 1GVCA 3FUZA 2Q8JA 2OWZA 2NXOA 3ZS6A 5KZTA 3UK4A 1SD3A 2DSFA 3TTLA 3PGFA 1MXZA 1FRPA 2QJEA 4F3BA 2QS4A 5EHSA 3O6GA 3T1BA 3S9EA 2UVHA 3ILTB 1YXIA 4H5GA 1O64A 3TCGA 4MJOA 3O66A 3UA8A 2WYKA 3BIHA 2QFLA 2Y7PA 3QYTA 1GR2A 4POXA 2WBBA 1RKMA 3N5LA 1YYZA 2R6GE 4JVDA 3H03A 4DCYA 1AMFA 5AA2B 4ESXA 4NF5A 2VT5A 1IUDA 1H43A 5TU0A 3ROJA 3Q27A 1JW5A 3L6HA 4U2RA 2QVVA 4OETA 2WYPA 2I0BA 3L6GA 3K2DA 1AH5A 3PUXE 5CC2A 3G3IA 1NNFA 3KSXA 1LFIA 5ELVA 4GWWA 3VVEA 5DVIA 2RCAA 1MM7A 2UXAA 4TLLB 3CSBA 1LGBC 1FBFA 3KJ7A 2DWAA 4P3LA 4KYDA 2ZYOA 4P0GA 5AE4A 4OFOA 2OCUA 3CR9A 2PYYA 1QULA 3WAEA 3TAJA 4L17A 4FATA 1FCKA 3K6WA 1MXUA 1IXHA 3LV0A 5IM2A 2B65A 1Z7ME 1ZLQA 4AB5A 2O1LA 3VLWA 1UQWA 1JEVA 3C4MA 2DYXA 3UIFA 5IZ1A 4G68C 3HPIA 3IJOB 4ZECA 4Z7EA 1NV1A 1H45A 3B6QA 3KN7A 1HSEA 4M4GA 4YB6A 3UGWA 1B4HA 3MQ9A 2VOZA 4GRKA 3KBRA 5EQAA 3T0JA 2HEUA 3UN6A 2OBGA 4OFLA 2DWJA 2HQ0A 1LB9A 5M2VA 3HSTA 4F39A 1D9QA 1MY3A 4EUOA 1QKBA 1G0IA 2ZNSA 4F2OA 1YTVA 1MH3A 4JXIA 4QSCA 3C31A 1IZ1A 4PDHA 4X1BA 4MFIA 5I2NB 1FJ9A 3A3CA 4BDMA 1MPBA 1CE2A 3T93B 2L5VA 1A54A 4F22A 1FPKA 1R1NA 5DW8A 1SI0A 3IFAA 2Q2CA 4R9GA 4GBVA 1M5EA 4YKKA 2Z22A 4TQUQ 4HE0A 2OLBA 4Q5TA 1H44A 2PMSA 2FA7A 3BBRA 3W9WA 4PFWA 3KJTA 3LSXA 3OO6A 3IR1A 2E1SA 5B7DA 4HXVA 4ND9A 3U72A 4FBPA 3O29A 5F7VA 2XX7A 2Y5KA 5ITOA 4NF4A 5AA1A 3MWBA 3LSWA 4X8RA 5EQ9A 1B7ZA 2Q88A 3EHSA 1Y9UA 4RYAA 4HCWA 4KPTA 4YB7A 2VGQA 1NV5A 3FASA 4O7MA 4OZ9A 5I2KA 2D21A 1VE4A 2XXUA 2X7PA 3QMFA 2ZNTA 4O7IA 4YU0A 3IO4A 4ELPA 2HHMA 4IO4A 3DELB 3PD8A 4RPOA 3TYHA 4P1EA 1N3WA 1ZIUA 3OMBA 4X1DA 1QUKA 4EF1A 4IO5A 1MQGA 2JJKA 1MXXA 1UTBA 4N8YA 1LAHE 3MZ1A 4O94A 3IOTA 3PUWE 4GD5A 4LA9A 2NOOA 3GLBA 4PAKA 2R8TA 1IEJA 2YLNA 3RNNA 3USDA 1XOCA 4GIZA 5FBPA 4X9TA 3PPPA 1B9JA 4R9FA 3VV5A 5FHOA 2R9JA 2Z8DA 3TCFA 1LBWA 3KN8A 4IGRA 3I6VA 4PDDA 4ZZAA 1D9VA 3W9VA 5CBSA 1FBGA 3TTKA 1I6QA 1FBDA 1B3HA 3H6UA 2HAVA 5DEXA 3IK6B 4JSOA 4GWZA 1FBEA 1LAFE 4N4UA 3RT8A 4P11A 1KZ8A 3BFTA 3KC1A 3TZAA 1N04A 3IX1A 4EXKA 4JWXA 3U94A 4MLVA 2QMWA 3H4ZA 4N81A 3P7IA 3TTNA 1NMUA 3KOTA 1FPIA 1Y1MA 3MVWA 3FV1A 4G8NA 4HW8A 5H8NA 1NUZA 3MYUA 1NV7A 5TP9A 3ZKKA 4F3GA 4PBHA 5F24A 1PDAA 4OVQA 4JSDA 3VXBA 1FBCA 1MQIA 4OFJA 2FBPA 1JW1A 3VLVA 5I58A 1IMAA 3TKDA 4AB6A 3T9XB 2Z8FA 2HCAA 3O6HA 1O63A 3PMXA 3MC2A 3EHTA 1M5BA 4NF6B 4XIGQ 4MHFA 1NKXA 1A7LA 3RGYA 4GWSA 1FQAA 3IFCA 1IMDA 4IR8A 5EQ7A 5I56B 1SYHA 3TFLA 4QXDA 4GBWA 1NV6A 4PGNA 3IOVA 1Q9DA 3Q25A 1FQDA 1UTBB 3HHGA 1K9YA 4N15A 1JVYA 4F3SA 4BDLA 4NWCA 1MY4A 4MX6A 5JTYB 1MY1A 4N8GA 5ISUA 5I3SA 2F6PA 3C9HA 1MDQA 2O84X 1B7HA 1G0HA 4WEPA 4MNCA 1I6BA 5CRYA 2Y84A 3K1MA 5KCJA 1LLSA 1NH7A 4YKIA 3PPNA 5AA2A 1P99A 1B7UA 1OLCA 3FJGA 1ZTYA 3RYDA 4DI3D 1K9ZA 1ZJLA 4F1VA 1QGXA 1IMFA 1DBZA 2ESNA 4C1UA 3JZJA 5B70A 4OENA 1EZ9A 1Y4CA 3V83A 1VSOA 3SESA 3RN8A 2HZLA 4H46A 3RT6B 4U23A 4G68B 4ZS9A 1II5A 2F8DA 4R73A 4LQ2A 4GLIA 1NUXA 2XWIA 3CG3A 2F5XA 2HXRA 3Q28A 4GVOA 3PPRA 4X04A 4JVCA 3RUMA 4G8HA 1ATGA 4N07A 1BKAA 5H8NB 2FYIA 3K6UA 1Y20A 3RTWB 4BDOA 1ZKBA 4QFPA 1MXYA 1FTOA 3RPLB 3UP9A 4NG7A 3EF7A 1JQFA 2PFYA 4ESWA 3KG2A 5DT6A 4GXSB 2FNCA 1OVTA 3FVNA 3OO7A 1B3EA 4EQ9A 2RCBA 2PT1A 4LATA 2WBDA 3K01A 1R6ZA 4RPNA 3B50A 3TQLA 4XKQA 1UTHA 5BWJA 4RNSA 4QFKA 1OMPA 5H8QA 4NF0A 3O6IA 1LBYA 2OJTA 1LSTA 4IB2A 1R9QA 4ONYA 2XXXA 4QFOA 3O97A 1B46A 1FPBA 4XTCQ 4I8CA 2GFEA 3E3KA 3O2AA 4FECA 2CZHA 2HPGA 4FAJA 4NTLA 4PF6A 3K6XA 4IO3A 1NFTA 3G3HA 3GBAA 5EHMA 4N91A 5L9OA 3KGCA 5I2NA 5KCJB 4DIGA 1ZBMA 4E0XA 1L5TA 1D3KA 1N7WA 4N6DA 2ONKE 4G4PA 4YMBA 3LBSA 1D9YA 4OVPA 4RXLA 1A55A 1GTKA 2XXYA 1WODA 3M3FA 4GWXA 4MF3A 1IITA 4WXJA 2Y7WA 4FEDA 2Z23A 4PP0A 2ZNUA 1KA0A 1B58A 3ODBA 5ET8A 1WDNA 3SERA 3PU5A 2FVZA 3FXUA 2GH9A 5EYFA
chains in the Genus database with same CATH topology
3FIRA 5H8HA 1WVJA 3T9HB 5L9MA 4DE8A 4BDRA 3WAFA 3QUFA 2E0SA 2ALUA 4WEDA 3MVZA 2G93A 1DTGA 1MY2A 4U4XA 1IQ7A 2DXYA 2R71A 4R6YA 2ANJA 2AL4A 2ABHA 5DVFA 3SEVA 1TFDA 1BIYA 4QFLA 1OQHA 2LAOA 3U8QA 4PFTA 1BLFA 4OWDA 2AIXA 2PT2A 3H3GA 2YPNA 2XX9A 1NH8A 4PE5B 1Y3QA 1URDA 2V84A 4LONB 3S9LC 2XD2A 4HTGA 1UTHB 2QRYA 2F97A 3LUYA 1RYXA 2DXRA 5H8QB 3T96B 2Q89A 4XXUA 2RC7A 3IJXB 4R6KA 3QUJA 2F36A 3OO8A 4H1XA 3CFXA 3FVKA 4GFRA 1JW4A 3PUVE 2W7YA 2Z8EA 3SEYA 3Q26A 3E9XA 5HPQA 4LZ7A 1TFAA 2QS2A 4O3CA 4JWOA 4POWA 4GF8A 4OTEA 5ICQA 3EQ1A 1QUJA 3PMWA 4DXBA 1FTMA 1FQBA 4IO7A 4DZ1A 1S9TA 3V5AA 1DPPA 1URGA 4ZEBA 5JK4A 3TTMA 1M5CA 2DWIA 1S7YA 2CMOA 2NUVA 1TT1A 3PUYE 3G3JA 2DE2A 3SDFA 3SETA 4RY1A 5DVJA 3VDFA 1LAXA 5AA4B 3C32A 2O68A 3ONMA 5H8HB 1XC1A 3U93A 3LSFB 2OWTA 1B4ZA 3U1OA 5I59A 1MDP1 2DE3A 1EU8A 4G8MA 1NNKA 3PMVA 2QMXA 4U4SA 1DMBA 1MG1A 4YICA 1GGGA 4MBPA 1XVXA 4NF6A 5CM6A 1LAGE 1HSLA 5FTHA 1H3DA 4NE4A 3BKIB 3VE1B 3RTFB 4F1YA 3KSJA 1LBBA 5I56A 1P1UA 3OELA 4RK2A 3GZGA 4ZEDA 3U92A 1SVXB 1LBCA 5KDTA 3PPOA 4I62A 4E0WA 2REJA 2PBWA 1B5JA 3IL1B 1I69A 1DOTA 3RY3A 4LP2B 4U1ZA 4I1DA 5JTYA 3MUQA 1IXIA 4GOTA 4KI0E 5K2XA 3C34A 1B0HA 3QAXA 3ZSFA 4IGTA 3CFZA 4R2BA 3TELA 2A5SA 4X48A 2ZXTA 4U22A 1YPNA 3KEIA 1FTJA 5TPAA 3D4GA 2I0CA 4QF9A 3UORA 2F34A 4ZZEA 2DP8A 3JV9A 2QS3A 3S4UA 2P1SA 3OSRA 3ZKLA 3CI8A 3T9UA 4G68A 3LSLA 1MM6A 3HO7A 1DPEA 4GWOA 4FIMA 2O7IA 4R75A 2ZYKA 2RINA 4YKJA 1P1OA 3QSLA 1PBPA 4XKNA 5I59B 2Y7KA 2F7CA 4Q8RA 1CB6A 1N76A 1T0KA 3JYRA 3VVDA 4KYEA 3EPEA 2ONSA 2XX8A 4FE8A 2V3UA 2BJJX 3HN0A 1UIUA 3SEXA 1B52A 2I3VA 1B3FA 4OEUA 3B7DA 3FGSA 4ELQA 1ZU0A 1JEUA 2XXQA 4UACA 1URSA 3VFJA 4ECFA 1B2HA 2H25A 3KN3A 3MP6A 3MVYA 4NWDA 1ELJA 2HAUA 1LFGA 2XXIA 1OVBA 1JVXA 4F1UA 2I6EA 5KDTB 2CZLA 2B3FA 5FTIA 2REGA 1XVYA 2XXPA 2I58A 3CG1A 3S9MC 3VVFA 2UVIA 2XXWA 4Q30B 3BFUA 1MH4A 3S9NC 1LCTA 1MXWA 4HCYA 1BTJA 1VR5A 3TPAA 5ITPA 4ZDMA 1Q1KA 1DSNA 2HXWA 2H4IA 3R6UA 1OLAA 4GXAA 2XXHA 4WKMA 3QXMA 2I4BA 4OMBA 5H8FA 3KFMA 1OQGA 3HCQA 3IAZA 5TPAB 3RPWA 4OXVA 3G7WA 3B6WA 3PD9A 5DYHA 4U1OA 1PB7A 5J1DA 5BUUA 5I57A 4JB7A 4IO6A 5AA3A 5A5XA 4OVJA 3S2VA 1A40A 4AQ4A 1N84A 2H9BA 4R6HA 2H98A 1Y4TA 3CRBA 3KZGA 4G2ZA 1GV8A 1US5A 4LZ8A 4U21A 5HBCA 1USYE 2RC8A 5H8SA 3T22A 4PFUA 4QSEA 2F7BA 1JETA 2VD3A 4OQOA 1QVSA 1FQEA 3ECRA 1B32A 5DTBA 4ZEKA 4PFYA 4EF2A 1XHYA 5JEIA 3MAMA 1F9BA 1IXCA 4YB5A 1MRPA 3TUSA 4N6PA 2IA4A 2HFBA 4OESA 3QIMA 3N6TA 1MPCA 5AA2D 1A8FA 3MW0A 2THIA 1PB9A 3SEUA 3M8UA 4GQOA 3G3GA 1XS5A 1D4NA 1B5HA 1B40A 4C0RA 3OSQA 3TDJA 4KHZE 4NMYA 2Y7RA 3FD3A 4EDPA 1JNFA 4R72A 2H99A 3R7XA 5L9SA 1NNTA 4ELRA 1US4A 2A5TA 1B05A 3F11A 3PPQA 4KCCA 1VFEA 1HSJA 1P1QA 3V89B 4XKPA 5H8FB 1ZMGA 3H6VA 1H76A 3ILUB 4NF8A 3VLUA 1B51A 4O3BA 3CFLA 4DXCA 3IB1A 3MZ9A 3EHUA 4QSDA 2NWJA 3TTRA 3E4RA 4OHNA 1MQJA 1N3XA 5I57B 2O1MA 3HV1A 2O7UA 1EZPA 3CVGA 4ISUA 5A5XB 5AA4A 1OIBA 1J1NA 3MP1A 4Z0IA 3K6VA 1Y1ZA 1NL5A 2O6AA 3MP8A 5CMMA 4KYSA 5L8DA 2AL5A 1QKAA 2F35A 3C35A 3H6TA 2F6GA 3TQWA 3MVXA 1SDXA 5HM4B 5I84A 2UVJA 3FV2A 1SW4A 2GHAA 2DVZA 2IEEA 1VFDA 1FQFA 4NEDA 2DWHA 3DLNA 2V3TA 4YAHX 1PB8A 2V3QA 1S50A 1LB8A 2H5YA 1PEBA 2PX1A 1MY0A 3FATA 2RC9A 1SW5A 2VP1A 4M1VA 1UIVA 3QK6A 3HHFA 1XT8A 4ZE8A 4DXUA 5ICTA 2X7QA 2WKYA 5CMCA 2A5TB 4JWYA 2YJPA 1Q35A 3FVOA 2D5WA 4FJPA 2KLFA 1MPDA 3MBPA 5CMBA 3SKPA 4I9DA 5IAIA 1Z7NE 4NF8B 1PBQA 1AL3A 2B3BA 4MLQA 2QS1A 4KQPA 4LVQA 3K1PA 2ONRA 3I3VA 4G77A 4NF5B 4YZZA 4EQ7A 3OEKA 3IO6A 2F78A 3R26A 4XKRA 3FXRA 2V93A 1N7XA 3K0VA 1TXFA 1B3LA 4H8IA 3D4CA 3C33A 3K00A 4QFNA 1IIWA 1USYH 1NNPA 4OYVA 3H7MA 4F29A 1A8EA 1MXVA 1FW0A 3N6UA 2QPQA 3IB2A 1EZOA 3FZVA 3TEPA 4C1TA 4QHQA 1YCJA 3OOAA 4KD5A 4RJZA 3I5OA 3RLFE 1B3GA 1SW1A 4TLMB 4DLDA 2ZYNA 3O28A 4YKPA 3A3UA 3DP4A 3IOWA 3EN3A 4R2FA 1FQCA 2I4CA 1B6HA 3IORA 3M3KA 4P0IA 2P2AA 3K02A 4H6DA 3OXNA 1AOVA 1YAEA 2XD3A 3GBBA 1O7TA 4QRZA 4FEBA 4PETA 4RA1A 2PVUA 4PQJA 1A99A 3DP8A 1POY1 3E13X 3O9PA 4R74A 2M8CA 4H65A 2X26A 2RKMA 3KOSA 2QL3A 4KR5A 4JBZA 3OD7A 1RYOA 3H6WA 4TOZA 1QUIA 2QSXA 1PC3A 4ELOA 1TWYA 1I6AA 3CIJA 2O51A 3OEMA 4IO2A 1IXGA 4H5FA 1MQDA 3G3KA 1POTA 3DM0A 5CMKA 1SI1A 3RQTA 2HZKA 2D3IA 5K2YA 4MH5A 3TODA 4EQBA 3T66A 4KCDA 2VHAA 4OERA 3FJMA 3LC8A 3H06B 1R9LA 3K4UA 1BP5A 4OEVA 4JDFA 5FHNA 3PV0E 3DP6A 3B6TA 3TCHA 3C36A 4NF4B 2OWSA 2UVGA 1SYIA 4O3AA 4FORA 3PUZE 1P1WA 3FJ7A 3N26A 4K3FA 5I2KB 4GL0A 1MQHA 1B5IA 2GHBA 2XXRA 1QW0A 2Y7IA 3LR1A 1ANFA 1QJMA 4BLAA 2OK2A 2P0SA 4F18A 3K1NA 2DQVA 4THIA 1Y3NA 1SBPA 2Q9TA 4BDQA 1M5DA 2DOJA 4ZE9A 2XHDA 2Q2AA 1LFHA 2O69A 5LOMA 4KFQA 3N94A 3CSGA 2XXVA 4EXLA 3MJNA 4ZEFA 2DS9A 3M3LA 4UA8A 1SW2A 2VD2A 4IY5A 4IY6A 4N13A 5F1QA 1N0TA 1B1XA 2UYFA 5FHMA 4BDNA 3W15C 2DVCA 2GRVA 1SQYA 2I3WA 4DCXA 4LZ5A 2G29A 4YMAA 4HS7A 1M5FA 3Q29A 2DE4A 5IKBA 3A09A 4ZEIA 1LCFA 2UYEA 2RF1A 5DEXB 4GL8A 3AXFA 3THIA 3IOUA 1Y3PA 2NVUB 1P1NA 2AYSA 4DDDA 4F2QA 2OZZA 3IB0A 2V25A 3MZBA 2I49A 3TMGA 4H67A 5CI5A 3MPKA 4LQ5A 3T9VA 3SEWA 2ZYMA 3G3FA 3V8XB 1AIVA 3FVGA 4F31B 4Q0CA 2ZMBA 3VXCA 1EH3A 2F7AA 5CBRA 1MS7A 1B1HA 5TP9B 4F3PA 4RK9A 3GXAA 4LUBA 5I58B 1FTKA 1FTLA 3FXQA 4H8JA 4H0WA 3OENA 1KWHA 3OO9A 2XXTA 1DTZA 3MPLA 4F19A 2I48A 1B0LA 1GVCA 3FUZA 2Q8JA 2NXOA 3ZS6A 5KZTA 3UK4A 1SD3A 2DSFA 3TTLA 3PGFA 1MXZA 2QJEA 4F3BA 2QS4A 5EHSA 3O6GA 3S9EA 2UVHA 3ILTB 4H5GA 1O64A 3TCGA 3O66A 3UA8A 2Y7PA 3QYTA 1GR2A 4POXA 1RKMA 3N5LA 2R6GE 3H03A 4DCYA 1AMFA 5AA2B 4ESXA 4NF5A 1IUDA 1H43A 5TU0A 3Q27A 1JW5A 3L6HA 4U2RA 4OETA 2I0BA 3L6GA 3K2DA 1AH5A 3PUXE 5CC2A 3G3IA 1NNFA 3KSXA 1LFIA 5ELVA 3VVEA 5DVIA 2RCAA 1MM7A 2UXAA 4TLLB 3CSBA 1LGBC 3KJ7A 2DWAA 4KYDA 2ZYOA 4P0GA 5AE4A 4OFOA 2OCUA 3CR9A 2PYYA 1QULA 3WAEA 3TAJA 4L17A 4FATA 1FCKA 3K6WA 1MXUA 1IXHA 2B65A 1Z7ME 1ZLQA 4AB5A 2O1LA 3VLWA 1UQWA 1JEVA 3C4MA 2DYXA 3UIFA 4G68C 3HPIA 3IJOB 4ZECA 4Z7EA 1H45A 3B6QA 3KN7A 1HSEA 4M4GA 4YB6A 3UGWA 1B4HA 3MQ9A 2VOZA 4GRKA 3KBRA 2HEUA 3UN6A 2OBGA 4OFLA 2DWJA 2HQ0A 1LB9A 5M2VA 3HSTA 4F39A 1MY3A 4EUOA 1QKBA 2ZNSA 4F2OA 1YTVA 1MH3A 4JXIA 4QSCA 3C31A 1IZ1A 4X1BA 4MFIA 5I2NB 3A3CA 4BDMA 1MPBA 1CE2A 3T93B 1A54A 4F22A 1R1NA 1SI0A 2Q2CA 4R9GA 1M5EA 4YKKA 2Z22A 4TQUQ 2OLBA 4Q5TA 1H44A 2PMSA 2FA7A 3W9WA 3BBRA 4PFWA 3KJTA 3LSXA 3OO6A 3IR1A 2E1SA 5B7DA 4ND9A 3U72A 5F7VA 3O29A 2XX7A 5ITOA 4NF4A 5AA1A 3MWBA 3LSWA 1B7ZA 2Q88A 3EHSA 1Y9UA 4RYAA 4HCWA 4KPTA 4YB7A 2VGQA 3FASA 4OZ9A 5I2KA 2D21A 1VE4A 2XXUA 2X7PA 2ZNTA 4YU0A 3IO4A 4ELPA 4IO4A 3DELB 3PD8A 4RPOA 3TYHA 1N3WA 1ZIUA 3OMBA 4X1DA 1QUKA 4EF1A 4IO5A 1MQGA 1MXXA 1UTBA 1LAHE 3MZ1A 3IOTA 3PUWE 4GD5A 4LA9A 2NOOA 3GLBA 3RNNA 1IEJA 2YLNA 3USDA 1XOCA 4GIZA 4X9TA 3PPPA 1B9JA 4R9FA 3VV5A 5FHOA 2R9JA 2Z8DA 3TCFA 3KN8A 4IGRA 3I6VA 4ZZAA 1D9VA 3W9VA 5CBSA 3TTKA 1I6QA 1B3HA 3H6UA 2HAVA 5DEXA 3IK6B 4JSOA 1LAFE 3RT8A 4P11A 3BFTA 3TZAA 1N04A 3IX1A 4EXKA 4JWXA 3U94A 4MLVA 2QMWA 3H4ZA 3P7IA 3TTNA 1NMUA 3KOTA 1Y1MA 3MVWA 3FV1A 4G8NA 4HW8A 5H8NA 5TP9A 3ZKKA 4F3GA 1PDAA 4JSDA 3VXBA 4OFJA 1MQIA 1JW1A 3VLVA 5I58A 3TKDA 4AB6A 3T9XB 2Z8FA 2HCAA 3O6HA 1O63A 3PMXA 3MC2A 3EHTA 1M5BA 4NF6B 4XIGQ 1NKXA 1A7LA 3RGYA 1FQAA 5I56B 1SYHA 3TFLA 3IOVA 3Q25A 1FQDA 1UTBB 3HHGA 1JVYA 4F3SA 4BDLA 4NWCA 1MY4A 5JTYB 1MY1A 5ISUA 2F6PA 3C9HA 1MDQA 2O84X 1B7HA 4WEPA 1I6BA 5CRYA 2Y84A 3K1MA 5KCJA 1LLSA 1NH7A 4YKIA 3PPNA 5AA2A 1P99A 1B7UA 1OLCA 3FJGA 1ZTYA 1ZJLA 4F1VA 2ESNA 4C1UA 3JZJA 5B70A 4OENA 1EZ9A 1Y4CA 3V83A 1VSOA 3SESA 3RN8A 2HZLA 3RT6B 4U23A 4G68B 4ZS9A 1II5A 2F8DA 4R73A 4LQ2A 4GLIA 3CG3A 2F5XA 3Q28A 4GVOA 3PPRA 3RUMA 4G8HA 1ATGA 4N07A 1BKAA 5H8NB 2FYIA 3K6UA 1Y20A 3RTWB 4BDOA 1ZKBA 4QFPA 1MXYA 1FTOA 3UP9A 3EF7A 1JQFA 4ESWA 3KG2A 5DT6A 4GXSB 2FNCA 1OVTA 3FVNA 3OO7A 1B3EA 4EQ9A 2RCBA 2PT1A 4LATA 3K01A 1R6ZA 4RPNA 3TQLA 4XKQA 1UTHA 5BWJA 4RNSA 4QFKA 1OMPA 5H8QA 3O6IA 2OJTA 1LSTA 4IB2A 1R9QA 4ONYA 2XXXA 4QFOA 3O97A 1B46A 4XTCQ 4I8CA 2GFEA 3E3KA 3O2AA 4FECA 4FAJA 4NTLA 3K6XA 4IO3A 1NFTA 3G3HA 3GBAA 5EHMA 5L9OA 3KGCA 5I2NA 5KCJB 4DIGA 1ZBMA 4E0XA 1L5TA 1D3KA 1N7WA 2ONKE 4G4PA 4YMBA 3LBSA 1D9YA 4RXLA 1A55A 1GTKA 2XXYA 1WODA 3M3FA 4MF3A 1IITA 4WXJA 2Y7WA 4FEDA 2Z23A 4PP0A 2ZNUA 1B58A 3ODBA 1WDNA 3SERA 3PU5A 3FXUA 2GH9A 5EYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIR A;  5H8H A;  1WVJ A;  3T9H B;  5L9M A;  4DE8 A;  4BDR A;  3WAF A;  3QUF A;  2E0S A;  2ALU A;  4WED A;  3MVZ A;  2G93 A;  1DTG A;  1MY2 A;  4U4X A;  1IQ7 A;  2DXY A;  2R71 A;  4R6Y A;  2ANJ A;  2AL4 A;  2ABH A;  5DVF A;  3SEV A;  1TFD A;  1BIY A;  4QFL A;  1OQH A;  2LAO A;  3U8Q A;  4PFT A;  1BLF A;  4OWD A;  2AIX A;  2PT2 A;  3H3G A;  2YPN A;  2XX9 A;  1NH8 A;  4PE5 B;  1Y3Q A;  1URD A;  2V84 A;  4LON B;  3S9L C;  2XD2 A;  4HTG A;  1UTH B;  2QRY A;  2F97 A;  3LUY A;  1RYX A;  2DXR A;  5H8Q B;  3T96 B;  2Q89 A;  4XXU A;  2RC7 A;  3IJX B;  4R6K A;  3QUJ A;  2F36 A;  3OO8 A;  4H1X A;  3CFX A;  3FVK A;  4GFR A;  1JW4 A;  3PUV E;  2W7Y A;  2Z8E A;  3SEY A;  3Q26 A;  3E9X A;  5HPQ A;  4LZ7 A;  1TFA A;  2QS2 A;  4O3C A;  4JWO A;  4POW A;  4GF8 A;  4OTE A;  5ICQ A;  3EQ1 A;  1QUJ A;  3PMW A;  4DXB A;  1FTM A;  1FQB A;  4IO7 A;  4DZ1 A;  1S9T A;  3V5A A;  1DPP A;  1URG A;  4ZEB A;  5JK4 A;  3TTM A;  1M5C A;  2DWI A;  1S7Y A;  2CMO A;  2NUV A;  1TT1 A;  3PUY E;  3G3J A;  2DE2 A;  3SDF A;  3SET A;  4RY1 A;  5DVJ A;  3VDF A;  1LAX A;  5AA4 B;  3C32 A;  2O68 A;  3ONM A;  5H8H B;  1XC1 A;  3U93 A;  3LSF B;  2OWT A;  1B4Z A;  3U1O A;  5I59 A;  1MDP 1;  2DE3 A;  1EU8 A;  4G8M A;  1NNK A;  3PMV A;  2QMX A;  4U4S A;  1DMB A;  1MG1 A;  4YIC A;  1GGG A;  4MBP A;  1XVX A;  4NF6 A;  5CM6 A;  1LAG E;  1HSL A;  5FTH A;  1H3D A;  4NE4 A;  3BKI B;  3VE1 B;  3RTF B;  4F1Y A;  3KSJ A;  1LBB A;  5I56 A;  1P1U A;  3OEL A;  4RK2 A;  3GZG A;  4ZED A;  3U92 A;  1SVX B;  1LBC A;  5KDT A;  3PPO A;  4I62 A;  4E0W A;  2REJ A;  2PBW A;  1B5J A;  3IL1 B;  1I69 A;  1DOT A;  3RY3 A;  4LP2 B;  4U1Z A;  4I1D A;  5JTY A;  3MUQ A;  1IXI A;  4GOT A;  4KI0 E;  5K2X A;  3C34 A;  1B0H A;  3QAX A;  3ZSF A;  4IGT A;  3CFZ A;  4R2B A;  3TEL A;  2A5S A;  4X48 A;  2ZXT A;  4U22 A;  1YPN A;  3KEI A;  1FTJ A;  5TPA A;  3D4G A;  2I0C A;  4QF9 A;  3UOR A;  2F34 A;  4ZZE A;  2DP8 A;  3JV9 A;  2QS3 A;  3S4U A;  2P1S A;  3OSR A;  3ZKL A;  3CI8 A;  3T9U A;  4G68 A;  3LSL A;  1MM6 A;  3HO7 A;  1DPE A;  4GWO A;  4FIM A;  2O7I A;  4R75 A;  2ZYK A;  2RIN A;  4YKJ A;  1P1O A;  3QSL A;  1PBP A;  4XKN A;  5I59 B;  2Y7K A;  2F7C A;  4Q8R A;  1CB6 A;  1N76 A;  1T0K A;  3JYR A;  3VVD A;  4KYE A;  3EPE A;  2ONS A;  2XX8 A;  4FE8 A;  2V3U A;  2BJJ X;  3HN0 A;  1UIU A;  3SEX A;  1B52 A;  2I3V A;  1B3F A;  4OEU A;  3B7D A;  3FGS A;  4ELQ A;  1ZU0 A;  1JEU A;  2XXQ A;  4UAC A;  1URS A;  3VFJ A;  4ECF A;  1B2H A;  2H25 A;  3KN3 A;  3MP6 A;  3MVY A;  4NWD A;  1ELJ A;  2HAU A;  1LFG A;  2XXI A;  1OVB A;  1JVX A;  4F1U A;  2I6E A;  5KDT B;  2CZL A;  2B3F A;  5FTI A;  2REG A;  1XVY A;  2XXP A;  2I58 A;  3CG1 A;  3S9M C;  3VVF A;  2UVI A;  2XXW A;  4Q30 B;  3BFU A;  1MH4 A;  3S9N C;  1LCT A;  1MXW A;  4HCY A;  1BTJ A;  1VR5 A;  3TPA A;  5ITP A;  4ZDM A;  1Q1K A;  1DSN A;  2HXW A;  2H4I A;  3R6U A;  1OLA A;  4GXA A;  2XXH A;  4WKM A;  3QXM A;  2I4B A;  4OMB A;  5H8F A;  3KFM A;  1OQG A;  3HCQ A;  3IAZ A;  5TPA B;  3RPW A;  4OXV A;  3G7W A;  3B6W A;  3PD9 A;  5DYH A;  4U1O A;  1PB7 A;  5J1D A;  5BUU A;  5I57 A;  4JB7 A;  4IO6 A;  5AA3 A;  5A5X A;  4OVJ A;  3S2V A;  1A40 A;  4AQ4 A;  1N84 A;  2H9B A;  4R6H A;  2H98 A;  1Y4T A;  3CRB A;  3KZG A;  4G2Z A;  1GV8 A;  1US5 A;  4LZ8 A;  4U21 A;  5HBC A;  1USY E;  2RC8 A;  5H8S A;  3T22 A;  4PFU A;  4QSE A;  2F7B A;  1JET A;  2VD3 A;  4OQO A;  1QVS A;  1FQE A;  3ECR A;  1B32 A;  5DTB A;  4ZEK A;  4PFY A;  4EF2 A;  1XHY A;  5JEI A;  3MAM A;  1F9B A;  1IXC A;  4YB5 A;  1MRP A;  3TUS A;  4N6P A;  2IA4 A;  2HFB A;  4OES A;  3QIM A;  3N6T A;  1MPC A;  5AA2 D;  1A8F A;  3MW0 A;  2THI A;  1PB9 A;  3SEU A;  3M8U A;  4GQO A;  3G3G A;  1XS5 A;  1D4N A;  1B5H A;  1B40 A;  4C0R A;  3OSQ A;  3TDJ A;  4KHZ E;  4NMY A;  2Y7R A;  3FD3 A;  4EDP A;  1JNF A;  4R72 A;  2H99 A;  3R7X A;  5L9S A;  1NNT A;  4ELR A;  1US4 A;  2A5T A;  1B05 A;  3F11 A;  3PPQ A;  4KCC A;  1VFE A;  1HSJ A;  1P1Q A;  3V89 B;  4XKP A;  5H8F B;  1ZMG A;  3H6V A;  1H76 A;  3ILU B;  4NF8 A;  3VLU A;  1B51 A;  4O3B A;  3CFL A;  4DXC A;  3IB1 A;  3MZ9 A;  3EHU A;  4QSD A;  2NWJ A;  3TTR A;  3E4R A;  4OHN A;  1MQJ A;  1N3X A;  5I57 B;  2O1M A;  3HV1 A;  2O7U A;  1EZP A;  3CVG A;  4ISU A;  5A5X B;  5AA4 A;  1OIB A;  1J1N A;  3MP1 A;  4Z0I A;  3K6V A;  1Y1Z A;  1NL5 A;  2O6A A;  3MP8 A;  5CMM A;  4KYS A;  5L8D A;  2AL5 A;  1QKA A;  2F35 A;  3C35 A;  3H6T A;  2F6G A;  3TQW A;  3MVX A;  1SDX A;  5HM4 B;  5I84 A;  2UVJ A;  3FV2 A;  1SW4 A;  2GHA A;  2DVZ A;  2IEE A;  1VFD A;  1FQF A;  4NED A;  2DWH A;  3DLN A;  2V3T A;  4YAH X;  1PB8 A;  2V3Q A;  1S50 A;  1LB8 A;  2H5Y A;  1PEB A;  2PX1 A;  1MY0 A;  3FAT A;  2RC9 A;  1SW5 A;  2VP1 A;  4M1V A;  1UIV A;  3QK6 A;  3HHF A;  1XT8 A;  4ZE8 A;  4DXU A;  5ICT A;  2X7Q A;  2WKY A;  5CMC A;  2A5T B;  4JWY A;  2YJP A;  1Q35 A;  3FVO A;  2D5W A;  4FJP A;  2KLF A;  1MPD A;  3MBP A;  5CMB A;  3SKP A;  4I9D A;  5IAI A;  1Z7N E;  4NF8 B;  1PBQ A;  1AL3 A;  2B3B A;  4MLQ A;  2QS1 A;  4KQP A;  4LVQ A;  3K1P A;  2ONR A;  3I3V A;  4G77 A;  4NF5 B;  4YZZ A;  4EQ7 A;  3OEK A;  3IO6 A;  2F78 A;  3R26 A;  4XKR A;  3FXR A;  2V93 A;  1N7X A;  3K0V A;  1TXF A;  1B3L A;  4H8I A;  3D4C A;  3C33 A;  3K00 A;  4QFN A;  1IIW A;  1USY H;  1NNP A;  4OYV A;  3H7M A;  4F29 A;  1A8E A;  1MXV A;  1FW0 A;  3N6U A;  2QPQ A;  3IB2 A;  1EZO A;  3FZV A;  3TEP A;  4C1T A;  4QHQ A;  1YCJ A;  3OOA A;  4KD5 A;  4RJZ A;  3I5O A;  3RLF E;  1B3G A;  1SW1 A;  4TLM B;  4DLD A;  2ZYN A;  3O28 A;  4YKP A;  3A3U A;  3DP4 A;  3IOW A;  3EN3 A;  4R2F A;  1FQC A;  2I4C A;  1B6H A;  3IOR A;  3M3K A;  4P0I A;  2P2A A;  3K02 A;  4H6D A;  3OXN A;  1AOV A;  1YAE A;  2XD3 A;  3GBB A;  1O7T A;  4QRZ A;  4FEB A;  4PET A;  4RA1 A;  2PVU A;  4PQJ A;  1A99 A;  3DP8 A;  1POY 1;  3E13 X;  3O9P A;  4R74 A;  2M8C A;  4H65 A;  2X26 A;  2RKM A;  3KOS A;  2QL3 A;  4KR5 A;  4JBZ A;  3OD7 A;  1RYO A;  3H6W A;  4TOZ A;  1QUI A;  2QSX A;  1PC3 A;  4ELO A;  1TWY A;  1I6A A;  3CIJ A;  2O51 A;  3OEM A;  4IO2 A;  1IXG A;  4H5F A;  1MQD A;  3G3K A;  1POT A;  3DM0 A;  5CMK A;  1SI1 A;  3RQT A;  2HZK A;  2D3I A;  5K2Y A;  4MH5 A;  3TOD A;  4EQB A;  3T66 A;  4KCD A;  2VHA A;  4OER A;  3FJM A;  3LC8 A;  3H06 B;  1R9L A;  3K4U A;  1BP5 A;  4OEV A;  4JDF A;  5FHN A;  3PV0 E;  3DP6 A;  3B6T A;  3TCH A;  3C36 A;  4NF4 B;  2OWS A;  2UVG A;  1SYI A;  4O3A A;  4FOR A;  3PUZ E;  1P1W A;  3FJ7 A;  3N26 A;  4K3F A;  5I2K B;  4GL0 A;  1MQH A;  1B5I A;  2GHB A;  2XXR A;  1QW0 A;  2Y7I A;  3LR1 A;  1ANF A;  1QJM A;  4BLA A;  2OK2 A;  2P0S A;  4F18 A;  3K1N A;  2DQV A;  4THI A;  1Y3N A;  1SBP A;  2Q9T A;  4BDQ A;  1M5D A;  2DOJ A;  4ZE9 A;  2XHD A;  2Q2A A;  1LFH A;  2O69 A;  5LOM A;  4KFQ A;  3N94 A;  3CSG A;  2XXV A;  4EXL A;  3MJN A;  4ZEF A;  2DS9 A;  3M3L A;  4UA8 A;  1SW2 A;  2VD2 A;  4IY5 A;  4IY6 A;  4N13 A;  5F1Q A;  1N0T A;  1B1X A;  2UYF A;  5FHM A;  4BDN A;  3W15 C;  2DVC A;  2GRV A;  1SQY A;  2I3W A;  4DCX A;  4LZ5 A;  2G29 A;  4YMA A;  4HS7 A;  1M5F A;  3Q29 A;  2DE4 A;  5IKB A;  3A09 A;  4ZEI A;  1LCF A;  2UYE A;  2RF1 A;  5DEX B;  4GL8 A;  3AXF A;  3THI A;  3IOU A;  1Y3P A;  2NVU B;  1P1N A;  2AYS A;  4DDD A;  4F2Q A;  2OZZ A;  3IB0 A;  2V25 A;  3MZB A;  2I49 A;  3TMG A;  4H67 A;  5CI5 A;  3MPK A;  4LQ5 A;  3T9V A;  3SEW A;  2ZYM A;  3G3F A;  3V8X B;  1AIV A;  3FVG A;  4F31 B;  4Q0C A;  2ZMB A;  3VXC A;  1EH3 A;  2F7A A;  5CBR A;  1MS7 A;  1B1H A;  5TP9 B;  4F3P A;  4RK9 A;  3GXA A;  4LUB A;  5I58 B;  1FTK A;  1FTL A;  3FXQ A;  4H8J A;  4H0W A;  3OEN A;  1KWH A;  3OO9 A;  2XXT A;  1DTZ A;  3MPL A;  4F19 A;  2I48 A;  1B0L A;  1GVC A;  3FUZ A;  2Q8J A;  2NXO A;  3ZS6 A;  5KZT A;  3UK4 A;  1SD3 A;  2DSF A;  3TTL A;  3PGF A;  1MXZ A;  2QJE A;  4F3B A;  2QS4 A;  5EHS A;  3O6G A;  3S9E A;  2UVH A;  3ILT B;  4H5G A;  1O64 A;  3TCG A;  3O66 A;  3UA8 A;  2Y7P A;  3QYT A;  1GR2 A;  4POX A;  1RKM A;  3N5L A;  2R6G E;  3H03 A;  4DCY A;  1AMF A;  5AA2 B;  4ESX A;  4NF5 A;  1IUD A;  1H43 A;  5TU0 A;  3Q27 A;  1JW5 A;  3L6H A;  4U2R A;  4OET A;  2I0B A;  3L6G A;  3K2D A;  1AH5 A;  3PUX E;  5CC2 A;  3G3I A;  1NNF A;  3KSX A;  1LFI A;  5ELV A;  3VVE A;  5DVI A;  2RCA A;  1MM7 A;  2UXA A;  4TLL B;  3CSB A;  1LGB C;  3KJ7 A;  2DWA A;  4KYD A;  2ZYO A;  4P0G A;  5AE4 A;  4OFO A;  2OCU A;  3CR9 A;  2PYY A;  1QUL A;  3WAE A;  3TAJ A;  4L17 A;  4FAT A;  1FCK A;  3K6W A;  1MXU A;  1IXH A;  2B65 A;  1Z7M E;  1ZLQ A;  4AB5 A;  2O1L A;  3VLW A;  1UQW A;  1JEV A;  3C4M A;  2DYX A;  3UIF A;  4G68 C;  3HPI A;  3IJO B;  4ZEC A;  4Z7E A;  1H45 A;  3B6Q A;  3KN7 A;  1HSE A;  4M4G A;  4YB6 A;  3UGW A;  1B4H A;  3MQ9 A;  2VOZ A;  4GRK A;  3KBR A;  2HEU A;  3UN6 A;  2OBG A;  4OFL A;  2DWJ A;  2HQ0 A;  1LB9 A;  5M2V A;  3HST A;  4F39 A;  1MY3 A;  4EUO A;  1QKB A;  2ZNS A;  4F2O A;  1YTV A;  1MH3 A;  4JXI A;  4QSC A;  3C31 A;  1IZ1 A;  4X1B A;  4MFI A;  5I2N B;  3A3C A;  4BDM A;  1MPB A;  1CE2 A;  3T93 B;  1A54 A;  4F22 A;  1R1N A;  1SI0 A;  2Q2C A;  4R9G A;  1M5E A;  4YKK A;  2Z22 A;  4TQU Q;  2OLB A;  4Q5T A;  1H44 A;  2PMS A;  2FA7 A;  3W9W A;  3BBR A;  4PFW A;  3KJT A;  3LSX A;  3OO6 A;  3IR1 A;  2E1S A;  5B7D A;  4ND9 A;  3U72 A;  5F7V A;  3O29 A;  2XX7 A;  5ITO A;  4NF4 A;  5AA1 A;  3MWB A;  3LSW A;  1B7Z A;  2Q88 A;  3EHS A;  1Y9U A;  4RYA A;  4HCW A;  4KPT A;  4YB7 A;  2VGQ A;  3FAS A;  4OZ9 A;  5I2K A;  2D21 A;  1VE4 A;  2XXU A;  2X7P A;  2ZNT A;  4YU0 A;  3IO4 A;  4ELP A;  4IO4 A;  3DEL B;  3PD8 A;  4RPO A;  3TYH A;  1N3W A;  1ZIU A;  3OMB A;  4X1D A;  1QUK A;  4EF1 A;  4IO5 A;  1MQG A;  1MXX A;  1UTB A;  1LAH E;  3MZ1 A;  3IOT A;  3PUW E;  4GD5 A;  4LA9 A;  2NOO A;  3GLB A;  3RNN A;  1IEJ A;  2YLN A;  3USD A;  1XOC A;  4GIZ A;  4X9T A;  3PPP A;  1B9J A;  4R9F A;  3VV5 A;  5FHO A;  2R9J A;  2Z8D A;  3TCF A;  3KN8 A;  4IGR A;  3I6V A;  4ZZA A;  1D9V A;  3W9V A;  5CBS A;  3TTK A;  1I6Q A;  1B3H A;  3H6U A;  2HAV A;  5DEX A;  3IK6 B;  4JSO A;  1LAF E;  3RT8 A;  4P11 A;  3BFT A;  3TZA A;  1N04 A;  3IX1 A;  4EXK A;  4JWX A;  3U94 A;  4MLV A;  2QMW A;  3H4Z A;  3P7I A;  3TTN A;  1NMU A;  3KOT A;  1Y1M A;  3MVW A;  3FV1 A;  4G8N A;  4HW8 A;  5H8N A;  5TP9 A;  3ZKK A;  4F3G A;  1PDA A;  4JSD A;  3VXB A;  4OFJ A;  1MQI A;  1JW1 A;  3VLV A;  5I58 A;  3TKD A;  4AB6 A;  3T9X B;  2Z8F A;  2HCA A;  3O6H A;  1O63 A;  3PMX A;  3MC2 A;  3EHT A;  1M5B A;  4NF6 B;  4XIG Q;  1NKX A;  1A7L A;  3RGY A;  1FQA A;  5I56 B;  1SYH A;  3TFL A;  3IOV A;  3Q25 A;  1FQD A;  1UTB B;  3HHG A;  1JVY A;  4F3S A;  4BDL A;  4NWC A;  1MY4 A;  5JTY B;  1MY1 A;  5ISU A;  2F6P A;  3C9H A;  1MDQ A;  2O84 X;  1B7H A;  4WEP A;  1I6B A;  5CRY A;  2Y84 A;  3K1M A;  5KCJ A;  1LLS A;  1NH7 A;  4YKI A;  3PPN A;  5AA2 A;  1P99 A;  1B7U A;  1OLC A;  3FJG A;  1ZTY A;  1ZJL A;  4F1V A;  2ESN A;  4C1U A;  3JZJ A;  5B70 A;  4OEN A;  1EZ9 A;  1Y4C A;  3V83 A;  1VSO A;  3SES A;  3RN8 A;  2HZL A;  3RT6 B;  4U23 A;  4G68 B;  4ZS9 A;  1II5 A;  2F8D A;  4R73 A;  4LQ2 A;  4GLI A;  3CG3 A;  2F5X A;  3Q28 A;  4GVO A;  3PPR A;  3RUM A;  4G8H A;  1ATG A;  4N07 A;  1BKA A;  5H8N B;  2FYI A;  3K6U A;  1Y20 A;  3RTW B;  4BDO A;  1ZKB A;  4QFP A;  1MXY A;  1FTO A;  3UP9 A;  3EF7 A;  1JQF A;  4ESW A;  3KG2 A;  5DT6 A;  4GXS B;  2FNC A;  1OVT A;  3FVN A;  3OO7 A;  1B3E A;  4EQ9 A;  2RCB A;  2PT1 A;  4LAT A;  3K01 A;  1R6Z A;  4RPN A;  3TQL A;  4XKQ A;  1UTH A;  5BWJ A;  4RNS A;  4QFK A;  1OMP A;  5H8Q A;  3O6I A;  2OJT A;  1LST A;  4IB2 A;  1R9Q A;  4ONY A;  2XXX A;  4QFO A;  3O97 A;  1B46 A;  4XTC Q;  4I8C A;  2GFE A;  3E3K A;  3O2A A;  4FEC A;  4FAJ A;  4NTL A;  3K6X A;  4IO3 A;  1NFT A;  3G3H A;  3GBA A;  5EHM A;  5L9O A;  3KGC A;  5I2N A;  5KCJ B;  4DIG A;  1ZBM A;  4E0X A;  1L5T A;  1D3K A;  1N7W A;  2ONK E;  4G4P A;  4YMB A;  3LBS A;  1D9Y A;  4RXL A;  1A55 A;  1GTK A;  2XXY A;  1WOD A;  3M3F A;  4MF3 A;  1IIT A;  4WXJ A;  2Y7W A;  4FED A;  2Z23 A;  4PP0 A;  2ZNU A;  1B58 A;  3ODB A;  1WDN A;  3SER A;  3PU5 A;  3FXU A;  2GH9 A;  5EYF A; 
#chains in the Genus database with same CATH topology
 3FIR A;  5H8H A;  1WVJ A;  3T9H B;  2ZZV A;  5L9M A;  4DE8 A;  4BDR A;  4GX4 A;  1NUY A;  3WAF A;  3QUF A;  1BK4 A;  2E0S A;  2ALU A;  4WED A;  3MVZ A;  2G93 A;  4N17 A;  1DTG A;  1MY2 A;  4OVS A;  3SZP A;  4U4X A;  1IQ7 A;  2DXY A;  2R71 A;  4R6Y A;  2ANJ A;  2AL4 A;  2ABH A;  5DVF A;  3SEV A;  1TFD A;  1BIY A;  4QFL A;  1OQH A;  2LAO A;  3U8Q A;  4PFT A;  1BLF A;  4OWD A;  2AIX A;  2PT2 A;  3H3G A;  4MMP A;  2YPN A;  2XX9 A;  1NH8 A;  4PE5 B;  1Y3Q A;  1URD A;  2V84 A;  4LON B;  2XWK A;  3S9L C;  2XD2 A;  4PFB A;  4HTG A;  2XWO A;  1UTH B;  2QRY A;  2F97 A;  3LUY A;  1RYX A;  2DXR A;  5H8Q B;  3T96 B;  2Q89 A;  4XXU A;  2RC7 A;  3IJX B;  4R6K A;  3QUJ A;  2F36 A;  3OO8 A;  4H1X A;  4XFE A;  3CFX A;  3FVK A;  4GFR A;  1JW4 A;  3PUV E;  2W7Y A;  1NUW A;  2Z8E A;  3SEY A;  3Q26 A;  3E9X A;  5HPQ A;  4LZ7 A;  1TFA A;  2QS2 A;  4O3C A;  1NV3 A;  4JWO A;  4POW A;  4GF8 A;  1FBP A;  4OTE A;  4HE2 A;  2Q8M A;  5ICQ A;  3EQ1 A;  1QUJ A;  3PMW A;  4DXB A;  1FTM A;  1FQB A;  4IO7 A;  4DZ1 A;  1S9T A;  3V5A A;  1DPP A;  1URG A;  4ZEB A;  1FTA A;  5JK4 A;  3TTM A;  1M5C A;  3MST A;  4MNP A;  2DWI A;  1S7Y A;  2CMO A;  2NUV A;  1TT1 A;  3PUY E;  3G3J A;  2DE2 A;  3SDF A;  3SET A;  4RY1 A;  5DVJ A;  3VDF A;  2BJI A;  1LAX A;  4H45 A;  5AA4 B;  3C32 A;  4GWY A;  2O68 A;  3ONM A;  5H8H B;  1XC1 A;  3U93 A;  3LSF B;  3BIG A;  2OWT A;  1IMB A;  1B4Z A;  3U1O A;  3KC0 A;  5I59 A;  4PAI A;  1MDP 1;  2DE3 A;  1EU8 A;  4G8M A;  4MCO A;  1NNK A;  3PMV A;  2VPO A;  2ZZX A;  2QMX A;  4U4S A;  4HE1 A;  1DMB A;  1MG1 A;  4YIC A;  1GGG A;  4MBP A;  1XVX A;  2KQZ A;  4NF6 A;  5CM6 A;  1LAG E;  1HSL A;  5FTH A;  1H3D A;  4NE4 A;  4OVT A;  3BKI B;  3VE1 B;  3RTF B;  4F1Y A;  3KSJ A;  1LBB A;  5I56 A;  1SPI A;  1P1U A;  3OEL A;  4RK2 A;  3GZG A;  4ZED A;  3U92 A;  1FPE A;  1SVX B;  1LBC A;  5KDT A;  3PPO A;  4I62 A;  3B8B A;  4E0W A;  2REJ A;  2PBW A;  1B5J A;  3IL1 B;  2PCR A;  1I69 A;  1DOT A;  3RY3 A;  4LP2 B;  4U1Z A;  4I1D A;  5JTY A;  3MUQ A;  1IXI A;  4GOT A;  4KI0 E;  5K2X A;  3C34 A;  1B0H A;  3QAX A;  3ZSF A;  1FPF A;  4IGT A;  3CFZ A;  4R2B A;  3TEL A;  2A5S A;  4PFI A;  4X48 A;  2ZXT A;  2XA5 A;  4U22 A;  1YPN A;  3KEI A;  1FTJ A;  5TPA A;  3D4G A;  4PBQ A;  1NV4 A;  2I0C A;  4QF9 A;  3UOR A;  3FBP A;  2F34 A;  4ZZE A;  5ET6 A;  2DP8 A;  4NN3 A;  3JV9 A;  2QS3 A;  3S4U A;  2P1S A;  3OSR A;  3ZKL A;  3CI8 A;  3T9U A;  4G68 A;  3LSL A;  1INP A;  1MM6 A;  3HO7 A;  1DPE A;  4GWO A;  4FIM A;  5EQ8 A;  2O7I A;  4R75 A;  2ZYK A;  4AS4 A;  1KA1 A;  2RIN A;  4YKJ A;  1P1O A;  3QSL A;  1PBP A;  4PC9 A;  4XKN A;  5I59 B;  2OX3 A;  2Y7K A;  2F7C A;  4Q8R A;  1CB6 A;  4P8B A;  1N76 A;  1T0K A;  2FIE A;  3JYR A;  3VVD A;  4KYE A;  3EPE A;  2ONS A;  2XX8 A;  4FE8 A;  2V3U A;  3NOH A;  2B4L A;  2BJJ X;  3HN0 A;  1UIU A;  1IME A;  3CHG A;  3RPL A;  3SEX A;  1B52 A;  2I3V A;  1B3F A;  4OEU A;  3B7D A;  3FGS A;  5T3J A;  4ELQ A;  2B4M A;  1NI9 A;  1ZU0 A;  1JEU A;  2XXQ A;  4UAC A;  1URS A;  3VFJ A;  4QBA A;  3U65 A;  4ECF A;  4PTK A;  1B2H A;  4GX6 A;  2H25 A;  3KN3 A;  3MP6 A;  3MVY A;  4NWD A;  1ELJ A;  2HAU A;  1LFG A;  2XXI A;  1OVB A;  1JVX A;  4F1U A;  2I6E A;  5KDT B;  2CZL A;  2B3F A;  5FTI A;  2REG A;  4NGU A;  3FXB A;  1XVY A;  2XXP A;  2I58 A;  3CG1 A;  3S9M C;  3VVF A;  2UVI A;  2XXW A;  4Q30 B;  3BFU A;  5IZZ A;  1MH4 A;  3S9N C;  1LCT A;  1MXW A;  4HCY A;  1BTJ A;  5ET7 A;  1VR5 A;  1FBH A;  3TPA A;  5ITP A;  4ZDM A;  1Q1K A;  1DSN A;  2HXW A;  2H4I A;  3R6U A;  1OLA A;  4GXA A;  2XXH A;  4WKM A;  3QXM A;  2I4B A;  4OMB A;  5H8F A;  5EYG A;  3KFM A;  1OQG A;  3HCQ A;  4O8M A;  3IAZ A;  5TPA B;  3RPW A;  4OXV A;  5A5L A;  3G7W A;  3B6W A;  3PD9 A;  5DYH A;  4U1O A;  2WX9 A;  1PB7 A;  5J1D A;  5BUU A;  5I57 A;  4JB7 A;  3ISP A;  2P3N A;  4IO6 A;  5AA3 A;  5A5X A;  4OVJ A;  3S2V A;  1A40 A;  4AQ4 A;  1N84 A;  2H9B A;  4R6H A;  2H98 A;  1Y4T A;  3CRB A;  5J16 A;  3KZG A;  4G2Z A;  1GV8 A;  1US5 A;  4LZ8 A;  4U21 A;  5HBC A;  1USY E;  2QVR A;  2RC8 A;  5H8S A;  3T22 A;  4PFU A;  4QSE A;  2VPN A;  2F7B A;  1JET A;  2VD3 A;  2V4C A;  4OQO A;  3KBZ A;  4LN5 A;  1QVS A;  1FQE A;  3ECR A;  1B32 A;  5DTB A;  4ZEK A;  4PFY A;  4EF2 A;  1XHY A;  1EYK A;  5JEI A;  3MAM A;  1F9B A;  1IXC A;  4YB5 A;  1MRP A;  3TUS A;  1RDY A;  4N6P A;  2IA4 A;  4PE3 A;  2HFB A;  4OES A;  3QIM A;  1JP4 A;  3N6T A;  3HFU A;  4DI4 B;  1MPC A;  4NHB A;  5AA2 D;  1A8F A;  3MW0 A;  2THI A;  1PB9 A;  3SEU A;  3M8U A;  4GQO A;  2QVU A;  3G3G A;  1XS5 A;  1D4N A;  1B5H A;  5EYH A;  1B40 A;  4C0R A;  3OSQ A;  3TDJ A;  4KHZ E;  4NMY A;  2Y7R A;  3FD3 A;  4PFR A;  4EDP A;  1JNF A;  4R72 A;  2H99 A;  1EYI A;  3R7X A;  1DCU A;  5L9S A;  4P1L A;  1AWB A;  1LBV A;  1NNT A;  4ELR A;  1US4 A;  4NX1 A;  2A5T A;  1B05 A;  2PFZ A;  3F11 A;  3PPQ A;  4KCC A;  1VFE A;  1HSJ A;  1P1Q A;  3V89 B;  4XKP A;  2FHY A;  5H8F B;  1ZMG A;  3H6V A;  1H76 A;  3ILU B;  4NF8 A;  3VLU A;  3PTY A;  1B51 A;  4O3B A;  3E78 A;  3CFL A;  4DXC A;  3IB1 A;  3MZ9 A;  3EHU A;  4QSD A;  2NWJ A;  3TTR A;  3E4R A;  4OHN A;  1MQJ A;  1N3X A;  4NQ8 A;  5I57 B;  4OAN A;  2O1M A;  3HV1 A;  2O7U A;  1EZP A;  3CVG A;  4ISU A;  5A5X B;  5AA4 A;  1OIB A;  1J1N A;  2KR0 A;  5I5P A;  4I40 A;  3MP1 A;  4Z0I A;  3K6V A;  1Y1Z A;  1NL5 A;  2O6A A;  3MP8 A;  5CMM A;  4JVI A;  4KYS A;  5L8D A;  2AL5 A;  1QKA A;  2F35 A;  3C35 A;  4PCD A;  4P47 A;  3H6T A;  2F6G A;  3TQW A;  3MVX A;  4GWU A;  1SDX A;  5HM4 B;  5I84 A;  2UVJ A;  3FV2 A;  1SW4 A;  2GHA A;  2DVZ A;  2IEE A;  1VFD A;  5LTC A;  4GX3 A;  5LDZ A;  1FQF A;  4NED A;  2DWH A;  3DLN A;  2V3T A;  4YAH X;  1PB8 A;  1RDZ A;  2V3Q A;  1S50 A;  1LB8 A;  2H5Y A;  3D1R A;  1PEB A;  2PX1 A;  1MY0 A;  3FAT A;  2RC9 A;  4XEQ A;  1SW5 A;  2VP1 A;  4M1V A;  4I3E A;  1UIV A;  3QK6 A;  3HHF A;  2WEF A;  5IZ3 A;  1XT8 A;  4ZE8 A;  4DXU A;  5ICT A;  2X7Q A;  2WKY A;  5CMC A;  2A5T B;  3EKI A;  1FSA A;  4JWY A;  2YJP A;  1Q35 A;  3FVO A;  3GYY A;  2D5W A;  4FJP A;  2KLF A;  1MPD A;  3MBP A;  5CMB A;  3SKP A;  4I9D A;  2P3V A;  5IAI A;  1Z7N E;  4NF8 B;  1PBQ A;  1AL3 A;  1LEV A;  2B3B A;  4MLQ A;  2QS1 A;  4KQP A;  4LVQ A;  3K1P A;  2ONR A;  3I3V A;  4G77 A;  4NF5 B;  2FIX A;  4YZZ A;  4EQ7 A;  3OEK A;  3IO6 A;  4OVR A;  2F78 A;  3R26 A;  4XKR A;  3FXR A;  1CNQ A;  2V93 A;  1N7X A;  3K0V A;  4MEV A;  1TXF A;  1B3L A;  4H8I A;  3D4C A;  3C33 A;  3K00 A;  4QFN A;  1IIW A;  1USY H;  1NNP A;  4OYV A;  3H7M A;  4MNI A;  4F29 A;  1A8E A;  1MXV A;  1FW0 A;  3N6U A;  4NAP A;  2QPQ A;  3IB2 A;  1EZO A;  3FZV A;  3TEP A;  4C1T A;  4QHQ A;  1YCJ A;  3OOA A;  4KD5 A;  4RJZ A;  3I5O A;  3RLF E;  1B3G A;  1SW1 A;  4TLM B;  4DLD A;  2ZYN A;  4MIJ A;  4XF5 A;  3O28 A;  4YKP A;  3A3U A;  3DP4 A;  3IOW A;  3EN3 A;  4R2F A;  1FQC A;  2I4C A;  5IZ3 B;  1B6H A;  3IOR A;  3M3K A;  1FJ6 A;  4P0I A;  2P2A A;  3K02 A;  4H6D A;  4PGP A;  4OA4 A;  3OXN A;  1AOV A;  1YAE A;  4I3Y A;  1LBX A;  2XD3 A;  3GBB A;  1O7T A;  4QRZ A;  4FEB A;  4PET A;  4RA1 A;  1NV0 A;  2PVU A;  4PQJ A;  1A99 A;  2MKZ A;  3DP8 A;  1POY 1;  3E13 X;  2XXK A;  3O9P A;  4R74 A;  2CZK A;  2M8C A;  3A29 A;  2X26 A;  4H65 A;  2RKM A;  3KOS A;  2QL3 A;  4KR5 A;  4JBZ A;  3OD7 A;  1NV2 A;  1RYO A;  3H6W A;  4TOZ A;  1QUI A;  2QSX A;  1PC3 A;  4AS5 A;  4ELO A;  1TWY A;  1I6A A;  3CIJ A;  2O51 A;  3OEM A;  4IO2 A;  1IXG A;  1FPD A;  4H5F A;  1MQD A;  5I7I A;  3G3K A;  1POT A;  3DM0 A;  5CMK A;  1SI1 A;  3RQT A;  2HZK A;  1EYJ A;  2D3I A;  5K2Y A;  4MH5 A;  3TOD A;  4EQB A;  3T66 A;  4KCD A;  2VHA A;  4OER A;  3FJM A;  4N6K A;  3LC8 A;  3H06 B;  1R9L A;  3K4U A;  1BP5 A;  4OEV A;  4JDF A;  5FHN A;  3PV0 E;  3DP6 A;  3B6T A;  3TCH A;  3C36 A;  4NF4 B;  3E79 A;  2OWS A;  2UVG A;  1SYI A;  4O3A A;  4PF8 A;  4FOR A;  1LBZ A;  3PUZ E;  1P1W A;  3FJ7 A;  2CEY A;  3N26 A;  4K3F A;  2Y5L A;  5I2K B;  4GL0 A;  1MQH A;  1B5I A;  2GHB A;  2XXR A;  4PAF A;  1QW0 A;  2Y7I A;  3LR1 A;  1ANF A;  1QJM A;  4BLA A;  2OK2 A;  2P0S A;  4F18 A;  3K1N A;  2DQV A;  4THI A;  2Q74 A;  1Y3N A;  2XWV A;  1SBP A;  2Q9T A;  4BDQ A;  1M5D A;  2DOJ A;  4ZE9 A;  2XHD A;  2Q2A A;  1YZ0 A;  1LFH A;  2F3D A;  2O69 A;  5LOM A;  4KFQ A;  1FPL A;  2GQ1 A;  3N94 A;  3CSG A;  1RDX A;  2XXV A;  4UAB A;  4EXL A;  3MJN A;  4ZEF A;  2DS9 A;  3M3L A;  4UA8 A;  1SW2 A;  1VDW A;  2VD2 A;  4IY5 A;  4IY6 A;  4N13 A;  5F1Q A;  1N0T A;  1B1X A;  2UYF A;  5FHM A;  4BDN A;  3W15 C;  2DVC A;  2GRV A;  1SQY A;  2I3W A;  4DCX A;  4LZ5 A;  2G29 A;  4YMA A;  4HS7 A;  1M5F A;  3Q29 A;  2DE4 A;  5IKB A;  3A09 A;  4ZEI A;  1LCF A;  2CZI A;  2UYE A;  2RF1 A;  4G61 A;  2DDK A;  5DEX B;  4GL8 A;  3AXF A;  3THI A;  3IOU A;  1Y3P A;  4P9K A;  2NVU B;  1P1N A;  4KXP A;  1DK4 A;  2AYS A;  4P56 A;  4DDD A;  4F2Q A;  2OZZ A;  3IB0 A;  2V25 A;  3MZB A;  2I49 A;  5ET5 A;  5ESY A;  3TMG A;  4H67 A;  2CEX A;  5CI5 A;  3MPK A;  2ZZW A;  4LQ5 A;  3T9V A;  3SEW A;  2ZYM A;  3G3F A;  3V8X B;  1AIV A;  3FVG A;  4F31 B;  4Q0C A;  2ZMB A;  3VXC A;  1EH3 A;  2F7A A;  5CBR A;  1MS7 A;  1B1H A;  5TP9 B;  4F3P A;  2F3B A;  4RK9 A;  1XI6 A;  1IMC A;  3GXA A;  3LUZ A;  4LUB A;  5IGA A;  4MAG A;  5I58 B;  1FTK A;  1FTL A;  3FXQ A;  4H8J A;  4H0W A;  3OEN A;  1KWH A;  3OO9 A;  2XXT A;  1FPJ A;  1DTZ A;  3MPL A;  4F19 A;  1FPG A;  2I48 A;  1B0L A;  1GVC A;  3FUZ A;  2Q8J A;  2OWZ A;  2NXO A;  3ZS6 A;  5KZT A;  3UK4 A;  1SD3 A;  2DSF A;  3TTL A;  3PGF A;  1MXZ A;  1FRP A;  2QJE A;  4F3B A;  2QS4 A;  5EHS A;  3O6G A;  3T1B A;  3S9E A;  2UVH A;  3ILT B;  1YXI A;  4H5G A;  1O64 A;  3TCG A;  4MJO A;  3O66 A;  3UA8 A;  2WYK A;  3BIH A;  2QFL A;  2Y7P A;  3QYT A;  1GR2 A;  4POX A;  2WBB A;  1RKM A;  3N5L A;  1YYZ A;  2R6G E;  4JVD A;  3H03 A;  4DCY A;  1AMF A;  5AA2 B;  4ESX A;  4NF5 A;  2VT5 A;  1IUD A;  1H43 A;  5TU0 A;  3ROJ A;  3Q27 A;  1JW5 A;  3L6H A;  4U2R A;  2QVV A;  4OET A;  2WYP A;  2I0B A;  3L6G A;  3K2D A;  1AH5 A;  3PUX E;  5CC2 A;  3G3I A;  1NNF A;  3KSX A;  1LFI A;  5ELV A;  4GWW A;  3VVE A;  5DVI A;  2RCA A;  1MM7 A;  2UXA A;  4TLL B;  3CSB A;  1LGB C;  1FBF A;  3KJ7 A;  2DWA A;  4P3L A;  4KYD A;  2ZYO A;  4P0G A;  5AE4 A;  4OFO A;  2OCU A;  3CR9 A;  2PYY A;  1QUL A;  3WAE A;  3TAJ A;  4L17 A;  4FAT A;  1FCK A;  3K6W A;  1MXU A;  1IXH A;  3LV0 A;  5IM2 A;  2B65 A;  1Z7M E;  1ZLQ A;  4AB5 A;  2O1L A;  3VLW A;  1UQW A;  1JEV A;  3C4M A;  2DYX A;  3UIF A;  5IZ1 A;  4G68 C;  3HPI A;  3IJO B;  4ZEC A;  4Z7E A;  1NV1 A;  1H45 A;  3B6Q A;  3KN7 A;  1HSE A;  4M4G A;  4YB6 A;  3UGW A;  1B4H A;  3MQ9 A;  2VOZ A;  4GRK A;  3KBR A;  5EQA A;  3T0J A;  2HEU A;  3UN6 A;  2OBG A;  4OFL A;  2DWJ A;  2HQ0 A;  1LB9 A;  5M2V A;  3HST A;  4F39 A;  1D9Q A;  1MY3 A;  4EUO A;  1QKB A;  1G0I A;  2ZNS A;  4F2O A;  1YTV A;  1MH3 A;  4JXI A;  4QSC A;  3C31 A;  1IZ1 A;  4PDH A;  4X1B A;  4MFI A;  5I2N B;  1FJ9 A;  3A3C A;  4BDM A;  1MPB A;  1CE2 A;  3T93 B;  2L5V A;  1A54 A;  4F22 A;  1FPK A;  1R1N A;  5DW8 A;  1SI0 A;  3IFA A;  2Q2C A;  4R9G A;  4GBV A;  1M5E A;  4YKK A;  2Z22 A;  4TQU Q;  4HE0 A;  2OLB A;  4Q5T A;  1H44 A;  2PMS A;  2FA7 A;  3BBR A;  3W9W A;  4PFW A;  3KJT A;  3LSX A;  3OO6 A;  3IR1 A;  2E1S A;  5B7D A;  4HXV A;  4ND9 A;  3U72 A;  4FBP A;  3O29 A;  5F7V A;  2XX7 A;  2Y5K A;  5ITO A;  4NF4 A;  5AA1 A;  3MWB A;  3LSW A;  4X8R A;  5EQ9 A;  1B7Z A;  2Q88 A;  3EHS A;  1Y9U A;  4RYA A;  4HCW A;  4KPT A;  4YB7 A;  2VGQ A;  1NV5 A;  3FAS A;  4O7M A;  4OZ9 A;  5I2K A;  2D21 A;  1VE4 A;  2XXU A;  2X7P A;  3QMF A;  2ZNT A;  4O7I A;  4YU0 A;  3IO4 A;  4ELP A;  2HHM A;  4IO4 A;  3DEL B;  3PD8 A;  4RPO A;  3TYH A;  4P1E A;  1N3W A;  1ZIU A;  3OMB A;  4X1D A;  1QUK A;  4EF1 A;  4IO5 A;  1MQG A;  2JJK A;  1MXX A;  1UTB A;  4N8Y A;  1LAH E;  3MZ1 A;  4O94 A;  3IOT A;  3PUW E;  4GD5 A;  4LA9 A;  2NOO A;  3GLB A;  4PAK A;  2R8T A;  1IEJ A;  2YLN A;  3RNN A;  3USD A;  1XOC A;  4GIZ A;  5FBP A;  4X9T A;  3PPP A;  1B9J A;  4R9F A;  3VV5 A;  5FHO A;  2R9J A;  2Z8D A;  3TCF A;  1LBW A;  3KN8 A;  4IGR A;  3I6V A;  4PDD A;  4ZZA A;  1D9V A;  3W9V A;  5CBS A;  1FBG A;  3TTK A;  1I6Q A;  1FBD A;  1B3H A;  3H6U A;  2HAV A;  5DEX A;  3IK6 B;  4JSO A;  4GWZ A;  1FBE A;  1LAF E;  4N4U A;  3RT8 A;  4P11 A;  1KZ8 A;  3BFT A;  3KC1 A;  3TZA A;  1N04 A;  3IX1 A;  4EXK A;  4JWX A;  3U94 A;  4MLV A;  2QMW A;  3H4Z A;  4N81 A;  3P7I A;  3TTN A;  1NMU A;  3KOT A;  1FPI A;  1Y1M A;  3MVW A;  3FV1 A;  4G8N A;  4HW8 A;  5H8N A;  1NUZ A;  3MYU A;  1NV7 A;  5TP9 A;  3ZKK A;  4F3G A;  4PBH A;  5F24 A;  1PDA A;  4OVQ A;  4JSD A;  3VXB A;  1FBC A;  1MQI A;  4OFJ A;  2FBP A;  1JW1 A;  3VLV A;  5I58 A;  1IMA A;  3TKD A;  4AB6 A;  3T9X B;  2Z8F A;  2HCA A;  3O6H A;  1O63 A;  3PMX A;  3MC2 A;  3EHT A;  1M5B A;  4NF6 B;  4XIG Q;  4MHF A;  1NKX A;  1A7L A;  3RGY A;  4GWS A;  1FQA A;  3IFC A;  1IMD A;  4IR8 A;  5EQ7 A;  5I56 B;  1SYH A;  3TFL A;  4QXD A;  4GBW A;  1NV6 A;  4PGN A;  3IOV A;  1Q9D A;  3Q25 A;  1FQD A;  1UTB B;  3HHG A;  1K9Y A;  4N15 A;  1JVY A;  4F3S A;  4BDL A;  4NWC A;  1MY4 A;  4MX6 A;  5JTY B;  1MY1 A;  4N8G A;  5ISU A;  5I3S A;  2F6P A;  3C9H A;  1MDQ A;  2O84 X;  1B7H A;  1G0H A;  4WEP A;  4MNC A;  1I6B A;  5CRY A;  2Y84 A;  3K1M A;  5KCJ A;  1LLS A;  1NH7 A;  4YKI A;  3PPN A;  5AA2 A;  1P99 A;  1B7U A;  1OLC A;  3FJG A;  1ZTY A;  3RYD A;  4DI3 D;  1K9Z A;  1ZJL A;  4F1V A;  1QGX A;  1IMF A;  1DBZ A;  2ESN A;  4C1U A;  3JZJ A;  5B70 A;  4OEN A;  1EZ9 A;  1Y4C A;  3V83 A;  1VSO A;  3SES A;  3RN8 A;  2HZL A;  4H46 A;  3RT6 B;  4U23 A;  4G68 B;  4ZS9 A;  1II5 A;  2F8D A;  4R73 A;  4LQ2 A;  4GLI A;  1NUX A;  2XWI A;  3CG3 A;  2F5X A;  2HXR A;  3Q28 A;  4GVO A;  3PPR A;  4X04 A;  4JVC A;  3RUM A;  4G8H A;  1ATG A;  4N07 A;  1BKA A;  5H8N B;  2FYI A;  3K6U A;  1Y20 A;  3RTW B;  4BDO A;  1ZKB A;  4QFP A;  1MXY A;  1FTO A;  3RPL B;  3UP9 A;  4NG7 A;  3EF7 A;  1JQF A;  2PFY A;  4ESW A;  3KG2 A;  5DT6 A;  4GXS B;  2FNC A;  1OVT A;  3FVN A;  3OO7 A;  1B3E A;  4EQ9 A;  2RCB A;  2PT1 A;  4LAT A;  2WBD A;  3K01 A;  1R6Z A;  4RPN A;  3B50 A;  3TQL A;  4XKQ A;  1UTH A;  5BWJ A;  4RNS A;  4QFK A;  1OMP A;  5H8Q A;  4NF0 A;  3O6I A;  1LBY A;  2OJT A;  1LST A;  4IB2 A;  1R9Q A;  4ONY A;  2XXX A;  4QFO A;  3O97 A;  1B46 A;  1FPB A;  4XTC Q;  4I8C A;  2GFE A;  3E3K A;  3O2A A;  4FEC A;  2CZH A;  2HPG A;  4FAJ A;  4NTL A;  4PF6 A;  3K6X A;  4IO3 A;  1NFT A;  3G3H A;  3GBA A;  5EHM A;  4N91 A;  5L9O A;  3KGC A;  5I2N A;  5KCJ B;  4DIG A;  1ZBM A;  4E0X A;  1L5T A;  1D3K A;  1N7W A;  4N6D A;  2ONK E;  4G4P A;  4YMB A;  3LBS A;  1D9Y A;  4OVP A;  4RXL A;  1A55 A;  1GTK A;  2XXY A;  1WOD A;  3M3F A;  4GWX A;  4MF3 A;  1IIT A;  4WXJ A;  2Y7W A;  4FED A;  2Z23 A;  4PP0 A;  2ZNU A;  1KA0 A;  1B58 A;  3ODB A;  5ET8 A;  1WDN A;  3SER A;  3PU5 A;  2FVZ A;  3FXU A;  2GH9 A;  5EYF A; 
#chains in the Genus database with same CATH homology
 3FIR A;  5H8H A;  1WVJ A;  3T9H B;  5L9M A;  4DE8 A;  4BDR A;  3WAF A;  3QUF A;  2E0S A;  2ALU A;  4WED A;  3MVZ A;  2G93 A;  1DTG A;  1MY2 A;  4U4X A;  1IQ7 A;  2DXY A;  2R71 A;  4R6Y A;  2ANJ A;  2AL4 A;  2ABH A;  5DVF A;  3SEV A;  1TFD A;  1BIY A;  4QFL A;  1OQH A;  2LAO A;  3U8Q A;  4PFT A;  1BLF A;  4OWD A;  2AIX A;  2PT2 A;  3H3G A;  2YPN A;  2XX9 A;  1NH8 A;  4PE5 B;  1Y3Q A;  1URD A;  2V84 A;  4LON B;  3S9L C;  2XD2 A;  4HTG A;  1UTH B;  2QRY A;  2F97 A;  3LUY A;  1RYX A;  2DXR A;  5H8Q B;  3T96 B;  2Q89 A;  4XXU A;  2RC7 A;  3IJX B;  4R6K A;  3QUJ A;  2F36 A;  3OO8 A;  4H1X A;  3CFX A;  3FVK A;  4GFR A;  1JW4 A;  3PUV E;  2W7Y A;  2Z8E A;  3SEY A;  3Q26 A;  3E9X A;  5HPQ A;  4LZ7 A;  1TFA A;  2QS2 A;  4O3C A;  4JWO A;  4POW A;  4GF8 A;  4OTE A;  5ICQ A;  3EQ1 A;  1QUJ A;  3PMW A;  4DXB A;  1FTM A;  1FQB A;  4IO7 A;  4DZ1 A;  1S9T A;  3V5A A;  1DPP A;  1URG A;  4ZEB A;  5JK4 A;  3TTM A;  1M5C A;  2DWI A;  1S7Y A;  2CMO A;  2NUV A;  1TT1 A;  3PUY E;  3G3J A;  2DE2 A;  3SDF A;  3SET A;  4RY1 A;  5DVJ A;  3VDF A;  1LAX A;  5AA4 B;  3C32 A;  2O68 A;  3ONM A;  5H8H B;  1XC1 A;  3U93 A;  3LSF B;  2OWT A;  1B4Z A;  3U1O A;  5I59 A;  1MDP 1;  2DE3 A;  1EU8 A;  4G8M A;  1NNK A;  3PMV A;  2QMX A;  4U4S A;  1DMB A;  1MG1 A;  4YIC A;  1GGG A;  4MBP A;  1XVX A;  4NF6 A;  5CM6 A;  1LAG E;  1HSL A;  5FTH A;  1H3D A;  4NE4 A;  3BKI B;  3VE1 B;  3RTF B;  4F1Y A;  3KSJ A;  1LBB A;  5I56 A;  1P1U A;  3OEL A;  4RK2 A;  3GZG A;  4ZED A;  3U92 A;  1SVX B;  1LBC A;  5KDT A;  3PPO A;  4I62 A;  4E0W A;  2REJ A;  2PBW A;  1B5J A;  3IL1 B;  1I69 A;  1DOT A;  3RY3 A;  4LP2 B;  4U1Z A;  4I1D A;  5JTY A;  3MUQ A;  1IXI A;  4GOT A;  4KI0 E;  5K2X A;  3C34 A;  1B0H A;  3QAX A;  3ZSF A;  4IGT A;  3CFZ A;  4R2B A;  3TEL A;  2A5S A;  4X48 A;  2ZXT A;  4U22 A;  1YPN A;  3KEI A;  1FTJ A;  5TPA A;  3D4G A;  2I0C A;  4QF9 A;  3UOR A;  2F34 A;  4ZZE A;  2DP8 A;  3JV9 A;  2QS3 A;  3S4U A;  2P1S A;  3OSR A;  3ZKL A;  3CI8 A;  3T9U A;  4G68 A;  3LSL A;  1MM6 A;  3HO7 A;  1DPE A;  4GWO A;  4FIM A;  2O7I A;  4R75 A;  2ZYK A;  2RIN A;  4YKJ A;  1P1O A;  3QSL A;  1PBP A;  4XKN A;  5I59 B;  2Y7K A;  2F7C A;  4Q8R A;  1CB6 A;  1N76 A;  1T0K A;  3JYR A;  3VVD A;  4KYE A;  3EPE A;  2ONS A;  2XX8 A;  4FE8 A;  2V3U A;  2BJJ X;  3HN0 A;  1UIU A;  3SEX A;  1B52 A;  2I3V A;  1B3F A;  4OEU A;  3B7D A;  3FGS A;  4ELQ A;  1ZU0 A;  1JEU A;  2XXQ A;  4UAC A;  1URS A;  3VFJ A;  4ECF A;  1B2H A;  2H25 A;  3KN3 A;  3MP6 A;  3MVY A;  4NWD A;  1ELJ A;  2HAU A;  1LFG A;  2XXI A;  1OVB A;  1JVX A;  4F1U A;  2I6E A;  5KDT B;  2CZL A;  2B3F A;  5FTI A;  2REG A;  1XVY A;  2XXP A;  2I58 A;  3CG1 A;  3S9M C;  3VVF A;  2UVI A;  2XXW A;  4Q30 B;  3BFU A;  1MH4 A;  3S9N C;  1LCT A;  1MXW A;  4HCY A;  1BTJ A;  1VR5 A;  3TPA A;  5ITP A;  4ZDM A;  1Q1K A;  1DSN A;  2HXW A;  2H4I A;  3R6U A;  1OLA A;  4GXA A;  2XXH A;  4WKM A;  3QXM A;  2I4B A;  4OMB A;  5H8F A;  3KFM A;  1OQG A;  3HCQ A;  3IAZ A;  5TPA B;  3RPW A;  4OXV A;  3G7W A;  3B6W A;  3PD9 A;  5DYH A;  4U1O A;  1PB7 A;  5J1D A;  5BUU A;  5I57 A;  4JB7 A;  4IO6 A;  5AA3 A;  5A5X A;  4OVJ A;  3S2V A;  1A40 A;  4AQ4 A;  1N84 A;  2H9B A;  4R6H A;  2H98 A;  1Y4T A;  3CRB A;  3KZG A;  4G2Z A;  1GV8 A;  1US5 A;  4LZ8 A;  4U21 A;  5HBC A;  1USY E;  2RC8 A;  5H8S A;  3T22 A;  4PFU A;  4QSE A;  2F7B A;  1JET A;  2VD3 A;  4OQO A;  1QVS A;  1FQE A;  3ECR A;  1B32 A;  5DTB A;  4ZEK A;  4PFY A;  4EF2 A;  1XHY A;  5JEI A;  3MAM A;  1F9B A;  1IXC A;  4YB5 A;  1MRP A;  3TUS A;  4N6P A;  2IA4 A;  2HFB A;  4OES A;  3QIM A;  3N6T A;  1MPC A;  5AA2 D;  1A8F A;  3MW0 A;  2THI A;  1PB9 A;  3SEU A;  3M8U A;  4GQO A;  3G3G A;  1XS5 A;  1D4N A;  1B5H A;  1B40 A;  4C0R A;  3OSQ A;  3TDJ A;  4KHZ E;  4NMY A;  2Y7R A;  3FD3 A;  4EDP A;  1JNF A;  4R72 A;  2H99 A;  3R7X A;  5L9S A;  1NNT A;  4ELR A;  1US4 A;  2A5T A;  1B05 A;  3F11 A;  3PPQ A;  4KCC A;  1VFE A;  1HSJ A;  1P1Q A;  3V89 B;  4XKP A;  5H8F B;  1ZMG A;  3H6V A;  1H76 A;  3ILU B;  4NF8 A;  3VLU A;  1B51 A;  4O3B A;  3CFL A;  4DXC A;  3IB1 A;  3MZ9 A;  3EHU A;  4QSD A;  2NWJ A;  3TTR A;  3E4R A;  4OHN A;  1MQJ A;  1N3X A;  5I57 B;  2O1M A;  3HV1 A;  2O7U A;  1EZP A;  3CVG A;  4ISU A;  5A5X B;  5AA4 A;  1OIB A;  1J1N A;  3MP1 A;  4Z0I A;  3K6V A;  1Y1Z A;  1NL5 A;  2O6A A;  3MP8 A;  5CMM A;  4KYS A;  5L8D A;  2AL5 A;  1QKA A;  2F35 A;  3C35 A;  3H6T A;  2F6G A;  3TQW A;  3MVX A;  1SDX A;  5HM4 B;  5I84 A;  2UVJ A;  3FV2 A;  1SW4 A;  2GHA A;  2DVZ A;  2IEE A;  1VFD A;  1FQF A;  4NED A;  2DWH A;  3DLN A;  2V3T A;  4YAH X;  1PB8 A;  2V3Q A;  1S50 A;  1LB8 A;  2H5Y A;  1PEB A;  2PX1 A;  1MY0 A;  3FAT A;  2RC9 A;  1SW5 A;  2VP1 A;  4M1V A;  1UIV A;  3QK6 A;  3HHF A;  1XT8 A;  4ZE8 A;  4DXU A;  5ICT A;  2X7Q A;  2WKY A;  5CMC A;  2A5T B;  4JWY A;  2YJP A;  1Q35 A;  3FVO A;  2D5W A;  4FJP A;  2KLF A;  1MPD A;  3MBP A;  5CMB A;  3SKP A;  4I9D A;  5IAI A;  1Z7N E;  4NF8 B;  1PBQ A;  1AL3 A;  2B3B A;  4MLQ A;  2QS1 A;  4KQP A;  4LVQ A;  3K1P A;  2ONR A;  3I3V A;  4G77 A;  4NF5 B;  4YZZ A;  4EQ7 A;  3OEK A;  3IO6 A;  2F78 A;  3R26 A;  4XKR A;  3FXR A;  2V93 A;  1N7X A;  3K0V A;  1TXF A;  1B3L A;  4H8I A;  3D4C A;  3C33 A;  3K00 A;  4QFN A;  1IIW A;  1USY H;  1NNP A;  4OYV A;  3H7M A;  4F29 A;  1A8E A;  1MXV A;  1FW0 A;  3N6U A;  2QPQ A;  3IB2 A;  1EZO A;  3FZV A;  3TEP A;  4C1T A;  4QHQ A;  1YCJ A;  3OOA A;  4KD5 A;  4RJZ A;  3I5O A;  3RLF E;  1B3G A;  1SW1 A;  4TLM B;  4DLD A;  2ZYN A;  3O28 A;  4YKP A;  3A3U A;  3DP4 A;  3IOW A;  3EN3 A;  4R2F A;  1FQC A;  2I4C A;  1B6H A;  3IOR A;  3M3K A;  4P0I A;  2P2A A;  3K02 A;  4H6D A;  3OXN A;  1AOV A;  1YAE A;  2XD3 A;  3GBB A;  1O7T A;  4QRZ A;  4FEB A;  4PET A;  4RA1 A;  2PVU A;  4PQJ A;  1A99 A;  3DP8 A;  1POY 1;  3E13 X;  3O9P A;  4R74 A;  2M8C A;  4H65 A;  2X26 A;  2RKM A;  3KOS A;  2QL3 A;  4KR5 A;  4JBZ A;  3OD7 A;  1RYO A;  3H6W A;  4TOZ A;  1QUI A;  2QSX A;  1PC3 A;  4ELO A;  1TWY A;  1I6A A;  3CIJ A;  2O51 A;  3OEM A;  4IO2 A;  1IXG A;  4H5F A;  1MQD A;  3G3K A;  1POT A;  3DM0 A;  5CMK A;  1SI1 A;  3RQT A;  2HZK A;  2D3I A;  5K2Y A;  4MH5 A;  3TOD A;  4EQB A;  3T66 A;  4KCD A;  2VHA A;  4OER A;  3FJM A;  3LC8 A;  3H06 B;  1R9L A;  3K4U A;  1BP5 A;  4OEV A;  4JDF A;  5FHN A;  3PV0 E;  3DP6 A;  3B6T A;  3TCH A;  3C36 A;  4NF4 B;  2OWS A;  2UVG A;  1SYI A;  4O3A A;  4FOR A;  3PUZ E;  1P1W A;  3FJ7 A;  3N26 A;  4K3F A;  5I2K B;  4GL0 A;  1MQH A;  1B5I A;  2GHB A;  2XXR A;  1QW0 A;  2Y7I A;  3LR1 A;  1ANF A;  1QJM A;  4BLA A;  2OK2 A;  2P0S A;  4F18 A;  3K1N A;  2DQV A;  4THI A;  1Y3N A;  1SBP A;  2Q9T A;  4BDQ A;  1M5D A;  2DOJ A;  4ZE9 A;  2XHD A;  2Q2A A;  1LFH A;  2O69 A;  5LOM A;  4KFQ A;  3N94 A;  3CSG A;  2XXV A;  4EXL A;  3MJN A;  4ZEF A;  2DS9 A;  3M3L A;  4UA8 A;  1SW2 A;  2VD2 A;  4IY5 A;  4IY6 A;  4N13 A;  5F1Q A;  1N0T A;  1B1X A;  2UYF A;  5FHM A;  4BDN A;  3W15 C;  2DVC A;  2GRV A;  1SQY A;  2I3W A;  4DCX A;  4LZ5 A;  2G29 A;  4YMA A;  4HS7 A;  1M5F A;  3Q29 A;  2DE4 A;  5IKB A;  3A09 A;  4ZEI A;  1LCF A;  2UYE A;  2RF1 A;  5DEX B;  4GL8 A;  3AXF A;  3THI A;  3IOU A;  1Y3P A;  2NVU B;  1P1N A;  2AYS A;  4DDD A;  4F2Q A;  2OZZ A;  3IB0 A;  2V25 A;  3MZB A;  2I49 A;  3TMG A;  4H67 A;  5CI5 A;  3MPK A;  4LQ5 A;  3T9V A;  3SEW A;  2ZYM A;  3G3F A;  3V8X B;  1AIV A;  3FVG A;  4F31 B;  4Q0C A;  2ZMB A;  3VXC A;  1EH3 A;  2F7A A;  5CBR A;  1MS7 A;  1B1H A;  5TP9 B;  4F3P A;  4RK9 A;  3GXA A;  4LUB A;  5I58 B;  1FTK A;  1FTL A;  3FXQ A;  4H8J A;  4H0W A;  3OEN A;  1KWH A;  3OO9 A;  2XXT A;  1DTZ A;  3MPL A;  4F19 A;  2I48 A;  1B0L A;  1GVC A;  3FUZ A;  2Q8J A;  2NXO A;  3ZS6 A;  5KZT A;  3UK4 A;  1SD3 A;  2DSF A;  3TTL A;  3PGF A;  1MXZ A;  2QJE A;  4F3B A;  2QS4 A;  5EHS A;  3O6G A;  3S9E A;  2UVH A;  3ILT B;  4H5G A;  1O64 A;  3TCG A;  3O66 A;  3UA8 A;  2Y7P A;  3QYT A;  1GR2 A;  4POX A;  1RKM A;  3N5L A;  2R6G E;  3H03 A;  4DCY A;  1AMF A;  5AA2 B;  4ESX A;  4NF5 A;  1IUD A;  1H43 A;  5TU0 A;  3Q27 A;  1JW5 A;  3L6H A;  4U2R A;  4OET A;  2I0B A;  3L6G A;  3K2D A;  1AH5 A;  3PUX E;  5CC2 A;  3G3I A;  1NNF A;  3KSX A;  1LFI A;  5ELV A;  3VVE A;  5DVI A;  2RCA A;  1MM7 A;  2UXA A;  4TLL B;  3CSB A;  1LGB C;  3KJ7 A;  2DWA A;  4KYD A;  2ZYO A;  4P0G A;  5AE4 A;  4OFO A;  2OCU A;  3CR9 A;  2PYY A;  1QUL A;  3WAE A;  3TAJ A;  4L17 A;  4FAT A;  1FCK A;  3K6W A;  1MXU A;  1IXH A;  2B65 A;  1Z7M E;  1ZLQ A;  4AB5 A;  2O1L A;  3VLW A;  1UQW A;  1JEV A;  3C4M A;  2DYX A;  3UIF A;  4G68 C;  3HPI A;  3IJO B;  4ZEC A;  4Z7E A;  1H45 A;  3B6Q A;  3KN7 A;  1HSE A;  4M4G A;  4YB6 A;  3UGW A;  1B4H A;  3MQ9 A;  2VOZ A;  4GRK A;  3KBR A;  2HEU A;  3UN6 A;  2OBG A;  4OFL A;  2DWJ A;  2HQ0 A;  1LB9 A;  5M2V A;  3HST A;  4F39 A;  1MY3 A;  4EUO A;  1QKB A;  2ZNS A;  4F2O A;  1YTV A;  1MH3 A;  4JXI A;  4QSC A;  3C31 A;  1IZ1 A;  4X1B A;  4MFI A;  5I2N B;  3A3C A;  4BDM A;  1MPB A;  1CE2 A;  3T93 B;  1A54 A;  4F22 A;  1R1N A;  1SI0 A;  2Q2C A;  4R9G A;  1M5E A;  4YKK A;  2Z22 A;  4TQU Q;  2OLB A;  4Q5T A;  1H44 A;  2PMS A;  2FA7 A;  3W9W A;  3BBR A;  4PFW A;  3KJT A;  3LSX A;  3OO6 A;  3IR1 A;  2E1S A;  5B7D A;  4ND9 A;  3U72 A;  5F7V A;  3O29 A;  2XX7 A;  5ITO A;  4NF4 A;  5AA1 A;  3MWB A;  3LSW A;  1B7Z A;  2Q88 A;  3EHS A;  1Y9U A;  4RYA A;  4HCW A;  4KPT A;  4YB7 A;  2VGQ A;  3FAS A;  4OZ9 A;  5I2K A;  2D21 A;  1VE4 A;  2XXU A;  2X7P A;  2ZNT A;  4YU0 A;  3IO4 A;  4ELP A;  4IO4 A;  3DEL B;  3PD8 A;  4RPO A;  3TYH A;  1N3W A;  1ZIU A;  3OMB A;  4X1D A;  1QUK A;  4EF1 A;  4IO5 A;  1MQG A;  1MXX A;  1UTB A;  1LAH E;  3MZ1 A;  3IOT A;  3PUW E;  4GD5 A;  4LA9 A;  2NOO A;  3GLB A;  3RNN A;  1IEJ A;  2YLN A;  3USD A;  1XOC A;  4GIZ A;  4X9T A;  3PPP A;  1B9J A;  4R9F A;  3VV5 A;  5FHO A;  2R9J A;  2Z8D A;  3TCF A;  3KN8 A;  4IGR A;  3I6V A;  4ZZA A;  1D9V A;  3W9V A;  5CBS A;  3TTK A;  1I6Q A;  1B3H A;  3H6U A;  2HAV A;  5DEX A;  3IK6 B;  4JSO A;  1LAF E;  3RT8 A;  4P11 A;  3BFT A;  3TZA A;  1N04 A;  3IX1 A;  4EXK A;  4JWX A;  3U94 A;  4MLV A;  2QMW A;  3H4Z A;  3P7I A;  3TTN A;  1NMU A;  3KOT A;  1Y1M A;  3MVW A;  3FV1 A;  4G8N A;  4HW8 A;  5H8N A;  5TP9 A;  3ZKK A;  4F3G A;  1PDA A;  4JSD A;  3VXB A;  4OFJ A;  1MQI A;  1JW1 A;  3VLV A;  5I58 A;  3TKD A;  4AB6 A;  3T9X B;  2Z8F A;  2HCA A;  3O6H A;  1O63 A;  3PMX A;  3MC2 A;  3EHT A;  1M5B A;  4NF6 B;  4XIG Q;  1NKX A;  1A7L A;  3RGY A;  1FQA A;  5I56 B;  1SYH A;  3TFL A;  3IOV A;  3Q25 A;  1FQD A;  1UTB B;  3HHG A;  1JVY A;  4F3S A;  4BDL A;  4NWC A;  1MY4 A;  5JTY B;  1MY1 A;  5ISU A;  2F6P A;  3C9H A;  1MDQ A;  2O84 X;  1B7H A;  4WEP A;  1I6B A;  5CRY A;  2Y84 A;  3K1M A;  5KCJ A;  1LLS A;  1NH7 A;  4YKI A;  3PPN A;  5AA2 A;  1P99 A;  1B7U A;  1OLC A;  3FJG A;  1ZTY A;  1ZJL A;  4F1V A;  2ESN A;  4C1U A;  3JZJ A;  5B70 A;  4OEN A;  1EZ9 A;  1Y4C A;  3V83 A;  1VSO A;  3SES A;  3RN8 A;  2HZL A;  3RT6 B;  4U23 A;  4G68 B;  4ZS9 A;  1II5 A;  2F8D A;  4R73 A;  4LQ2 A;  4GLI A;  3CG3 A;  2F5X A;  3Q28 A;  4GVO A;  3PPR A;  3RUM A;  4G8H A;  1ATG A;  4N07 A;  1BKA A;  5H8N B;  2FYI A;  3K6U A;  1Y20 A;  3RTW B;  4BDO A;  1ZKB A;  4QFP A;  1MXY A;  1FTO A;  3UP9 A;  3EF7 A;  1JQF A;  4ESW A;  3KG2 A;  5DT6 A;  4GXS B;  2FNC A;  1OVT A;  3FVN A;  3OO7 A;  1B3E A;  4EQ9 A;  2RCB A;  2PT1 A;  4LAT A;  3K01 A;  1R6Z A;  4RPN A;  3TQL A;  4XKQ A;  1UTH A;  5BWJ A;  4RNS A;  4QFK A;  1OMP A;  5H8Q A;  3O6I A;  2OJT A;  1LST A;  4IB2 A;  1R9Q A;  4ONY A;  2XXX A;  4QFO A;  3O97 A;  1B46 A;  4XTC Q;  4I8C A;  2GFE A;  3E3K A;  3O2A A;  4FEC A;  4FAJ A;  4NTL A;  3K6X A;  4IO3 A;  1NFT A;  3G3H A;  3GBA A;  5EHM A;  5L9O A;  3KGC A;  5I2N A;  5KCJ B;  4DIG A;  1ZBM A;  4E0X A;  1L5T A;  1D3K A;  1N7W A;  2ONK E;  4G4P A;  4YMB A;  3LBS A;  1D9Y A;  4RXL A;  1A55 A;  1GTK A;  2XXY A;  1WOD A;  3M3F A;  4MF3 A;  1IIT A;  4WXJ A;  2Y7W A;  4FED A;  2Z23 A;  4PP0 A;  2ZNU A;  1B58 A;  3ODB A;  1WDN A;  3SER A;  3PU5 A;  3FXU A;  2GH9 A;  5EYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...