5CI6A

Crystal structure of arabidopsis thaliana mpk6
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
335
Chain Sequence
GIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENIVAIRDIIPPPLRNAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNEEQMKELIYREALAFNPEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 6
publication title Analysis of crystal structure of Arabidopsis MPK6 and generation of its mutants with higher activity
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 98
structure length 335
sequence length 362
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ci6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ci6A01
4D1XA 4KUJA 2C6EA 4IB3A 5IQBA 1REJA 5LCJA 4PL4A 2CKPA 2BUJA 3TV6A 2QU6A 4AP7A 1NXKA 4ARKA 4HVDA 5KMNA 2OG8A 3DBDA 4Y95A 5JSMA 4Y46A 4BI2A 2WTVA 1QCFA 4AZTA 4EOPA 5M53A 3QBNA 1P4OA 3DTWA 5M4FA 5M51A 5HVJA 1FMOE 3ET7A 2JDTA 4MVFA 2WMBA 4U42A 1UWHA 4GU6A 3TKHA 3QC9A 1R3CA 4EOKA 3LLTA 1PMNA 2F49A 4WD5A 4WNPA 5L2WA 2XEZA 5M56A 2WOTA 3SOAA 1Q97A 4MX9A 4JBQA 5B2KA 5FWKK 3PWYA 4JBVA 1H0WA 5EFQA 3Q5IA 4FL1A 2YACA 1HCKA 3ALNA 3EJ1A 1VEBA 3IW5A 4FV2A 4M0ZA 4XG3A 3S95A 2IVSA 4O96A 1AD5A 2W1DA 3PJ3A 4H36A 3SLSA 1EH4A 5ITAA 4KIQA 1NW1A 4ZTNA 4QP7A 2XUUA 4TKSA 5IMEA 4IWDA 1H07A 2YN8A 4HPTE 4IVCA 4NFMA 4B99A 5B2MA 3OP5A 2RF9A 1BL7A 4NKAA 4X2GA 4MCVA 3S3IA 4UMUA 5F20A 1YI6A 2W5HA 3DK7A 3IDPA 4LMUA 1H1WA 2ZYBA 3G5DA 5CSWA 4BL1A 4UMRA 5EQEA 5L4QA 4O2ZA 5I3RA 2W1IA 3O0GA 5L8JA 5KCVA 2I6LA 5LCKA 1T46A 4EONA 4YJRA 5KBRA 2X6DA 3DB6A 1V0PA 4HYSA 4FK6A 4LOPA 1FVTA 4KS8A 2GFCA 1TQPA 5A4CA 2OH0E 3FMKA 3OVVA 3VS1A 4UXQA 4ASEA 4ZJVA 1M17A 4ZY5A 4EUTA 2A1AB 3FMDA 3EQFA 3GFEA 3OUKA 4BGHA 5KNJA 4LL0A 2GNGA 2YLEA 5A46A 4BYJA 2EXMA 4LGDA 3TDVA 4BZDA 3P78A 4G3DA 2BDJA 4YC3A 4Z16A 3REPA 3QHRA 1JSTA 3U9NA 3HVCA 3RPYA 5BYYA 5CXZA 3HX4A 3MSSA 4QTEA 3KY2A 4UB7A 1ZOGA 4X21A 4IVBA 5AUZA 5LWNA 4N57A 3QQGA 1A06A 4U43A 3PXKA 1B39A 1KSWA 4E4MA 2DQ7X 1URWA 4NUSA 3AD4A 3NS9A 3TV7A 2PY3A 3UIBA 1JWHA 3WF9A 3R6XA 4BBFA 5I9XA 1Y6BA 3KK8A 3PY1A 4OTPA 3PIYA 4FSRA 4IZYA 3ANRA 3EQIA 4CTCA 2W1ZA 3DJ5A 2J4ZA 4F9WA 1WBWA 1XH4A 4FKUA 3MY1A 5HLWA 4EHVA 4LMNA 5IF1A 1UU3A 4EHGA 3DK3A 3MBLA 2ITVA 2JDVA 5JQ5A 3VC4A 4ANQA 4UEUA 4BRXA 4C4IA 5FM3A 1Q99A 2YISA 2CGVA 3UNKA 4D55A 5AEPA 2R3OA 2C47A 3NGAA 4CD0A 4RFZA 4GCJA 3B8QA 3HKOA 3U8WA 2O63A 4ZK5A 5EW8A 2YDJA 1Y57A 5I9WA 4JLCA 1P4FA 2XMYA 4RFYA 3P5KA 5DR6A 2UW4A 3EN9A 3RCJA 3IGOA 1Q8TA 2I0YA 2PVRA 4BTMA 3FBVA 5HU9A 4ALWA 3OW3A 3R21A 4DTBA 2BRBA 4IM3A 4C57A 4M15A 4ZTLA 2WHBA 3DAKA 3DA6A 4CKIA 4BIEA 1H24A 2QR7A 3WF6A 5JFXA 4MNFA 4DHFA 4JDJA 2BMCA 3LM5A 2C68A 1OECA 3ZRKA 4B6LA 2QO7A 5EQYA 2UZEA 1E1VA 4U97A 3R28A 3KK9A 1VJYA 2JKKA 5DR2A 3BU3A 4FIIA 4WUNA 4LI5A 1YDRE 1GZKA 4NK9A 2XNMA 3PIZA 3Q96A 4EZ7A 4IAZA 3F5GA 3NUUA 2XK8A 3TV4A 1P14A 3QUEA 1JQHA 1XBAA 3Q2MA 5CT7A 2F2UA 4L7SA 4F6SA 3R9DA 2BFYA 4DEBA 2F7ZE 5AP5A 3EMGA 5TF9A 4RG0A 4C3RA 2E9OA 3QTQA 4AFJA 1OPJA 1Z5MA 1XH9A 3B2WA 4GU9A 4BDEA 4BI1A 5IA2A 3CY2A 3C7QA 2VTRA 4O81A 5IUIA 2BALA 4IEBA 4RVKA 3C0GA 2BAJA 5AIKA 3G9LX 3F5XA 4ZTHA 3ELJA 3QRTA 3O17A 2UZUE 5HCYA 5FEEA 2SRCA 4IAYA 4D2WA 5HX8A 3BX5A 2PZRA 3DNDA 3N4TA 2RFEA 3DAEA 3VQHA 1K3AA 3CGFA 4Y72A 1CKPA 5M44A 3L8SA 4QD6A 5CWZA 2J0JA 4GT3A 5L6PA 4RFMA 3T9TA 3GB2A 3BLQA 3QRKA 5A3XA 3UG1A 4FEWA 3OC1A 1BUHA 3BU6A 3D94A 2G2HA 3MB6A 5GNKA 1PXLA 3M1SA 5EDRA 4AZSA 3ZFYA 4PPBA 4XV3A 3DTCA 3ZO3A 3K3JA 4AXAA 4DEEA 3UQCA 4ORKA 3FUPA 3ZSHA 4TYIA 1KOBA 2ETKA 3QAME 4RVTA 5ACKA 2UZOA 3R8MA 4G31A 3UO4A 3FXZA 1JKSA 4WIHA 4I93A 5FEDA 3VUTA 4IVDA 2GNIA 4D0XA 3G33A 1B6CB 4XHKB 4YTHA 3EFJA 3UO5A 4O2PA 5AP0A 1CKIA 1BMKA 5CQUA 1NVQA 3D0EA 4FNYA 1ZY4A 2JIUA 3R73A 4A4LA 1PXIA 4GG7A 4CZYB 5HG8A 3GBZA 3RPVA 3V5JA 3GC8A 2BRHA 3VN9A 4QTDA 4ACHA 4D5KA 5HVKA 2EB2A 2A2AA 4I21A 4DTKA 3UZRA 4IDTA 3FLYA 4U80A 2WTDA 1OUKA 5AUWA 4BN1A 1O6LA 2W96B 4KB8A 4BTFA 5JK3A 3F66A 2A4LA 3OZ6A 5K4JA 3AT4A 4GMYA 3L9NA 4M12A 3ZBXA 4AZWA 1BL6A 4ERWA 3KGAA 4HVSA 4FT5A 4G17A 2WU6A 5JGDA 5IQCA 3LKMA 3VF9A 2VZ6A 5I9ZA 2R3MA 5IQEA 2QOQA 1WAKA 5AP6A 2FYSA 2YFXA 4ZP5A 1IR3A 5CAQA 3TNPC 4NT4A 1CKJA 2JD5A 4LL5A 4M69B 2R3PA 2YITA 4NZWB 1W7HA 3FMNA 4UXLA 5K4IA 4OBOA 4D2RA 4PDSA 2GCDA 4RJ5A 3D5VA 4WUAA 1G8SA 2VWZA 4XG7A 4I92A 4WG3A 5HHWA 4F1TA 5AR7A 4UMPA 3TIZA 4GT5A 4MNEB 3BEGA 4ITIA 4KRCA 4QP8A 1RDQE 3H9RA 4YNEA 4YMJA 1P2AA 3I0QA 3QWJA 3ZEPA 1BLXA 4ANNA 4EL9A 4ZSJA 4B4LA 2YM6A 3P7AA 4U3YA 4ENXA 3F7WA 5I4NA 3HAVA 2B53A 2YDKA 3CKXA 3AOXA 1WVXA 4O0VA 4Y5QA 1K2PA 4GSBA 3NUNA 3TCPA 4CQGA 4BIDA 5C8NA 3BLHA 5I9YA 4K6ZA 4MXAA 3H4JA 3KC3A 1PMVA 5L3AA 5BUJA 2C6LA 3JVSA 5D12A 3QQFA 2DYLA 4W9WA 4DH8A 3CCNA 5EW9A 3LCOA 1GJOA 2GHMA 4F6UA 4O7SA 3W33A 4BY9E 1M2RA 2B54A 2VRXA 4IANA 4M69A 2WTWA 2FH9A 4JXFA 3VBYA 3PVUA 4K0YA 2W4KA 2W1EA 1H00A 3FZPA 4HGTA 3V5PA 1L8TA 3VWAA 4ZAUA 2XK7A 4QP6A 3WYXA 4TW9A 4JAJA 5CSVA 4D4SA 3E8EA 4YHJA 5DFPA 3T3VA 4O91A 4MWIA 4RJ8A 5LXMA 2C3KA 3BIZA 5KHXA 2JEDA 3A4PA 4S33A 4YBJA 2OH4A 3OROA 4NH1A 4O86A 3QZIA 1FMKA 4QMPA 4BIBA 3KN5A 3LMGA 4HNFA 1ZARA 5KZIA 3GC9A 2Y4IB 2GNLA 3ZUUA 4FTTA 4FIJA 4A9TA 5AA8A 4YZBA 4E5BA 3PDTA 3QX2A 1ZY5A 5A4EA 3TI1A 3R9HA 3LCKA 3FYJX 4U9AA 4DLIA 4IZAA 1GIJA 5IA5A 2WTKC 4J71A 5AIRA 5DT3A 1OI9A 2W1CA 3PE2A 5HO8A 1W84A 2YIRA 5AJQA 5IQHA 4FVRA 3LFEA 5CANA 2HYYA 4D2TA 3TKIA 4C4JA 2VO7A 1DI9A 4G3CA 4AQCA 2ZMDA 4DH7A 5D7AA 5HCZA 4DG0E 3DFAA 2BROA 5C8MA 3KCKA 1E1XA 3R1YA 4GFGA 4CSVA 3ZDIA 4BWPA 4XG4A 3MS9A 2ONLC 3ZH8A 2XZSA 3FSKA 3HNGA 3LQ5A 3W10A 5CEMA 2XNBA 5IQDA 3W32A 1DM2A 4YO6A 1OPKA 4AN9A 2HW7A 3O71A 3QQHA 3NYNA 3F3TA 1OB3A 2JKOA 4ZSGA 1NT2A 3C4ZA 1U5QA 3VQUA 4CCUA 2GQGA 2ZV7A 2R2PA 3QKLA 1PW2A 1NA7A 3FSFA 3P7BA 3ORKA 3BI6A 4G9CA 4CFMA 4F7LA 3SD0A 2W99B 3ZZEA 5KX8A 4FNWA 4O7TA 4LUEA 4D2SA 3CIKA 4QT1A 3ZXTA 3TUBA 4IWQA 3V3VA 4IC7A 4F0IA 1F0QA 2AYPA 4OTDA 2UW9A 4L01A 4YUQA 1YHWA 3A7GA 3C0HA 3FKNA 2C5XA 3BZ3A 5DBXA 3PXFA 3AC4A 3VO3A 3Q4UA 2HWPA 3G51A 4Q5HA 3ZYAA 3D9VA 2YCSA 5HVYA 2UZNA 5J9YA 2OJGA 4WRSA 5H8EA 4EH4A 1B38A 3WOWA 3W16A 4YLLA 5FBNC 2WU7A 3U4WA 4HYIA 5DE2A 1VYZA 1QPCA 4FT9A 2NNWB 5L2SA 4QMXA 3PLAE 3TNQB 3IK3A 4ITJA 4N70A 4OT5A 4YNOA 2CN8A 3KXHA 5HE2A 4FTNA 5CAUA 5D1JA 3P23A 3I5NA 3RM7A 3U6JA 2C6MA 3VS4A 3AD5A 3HP5A 2XK4A 3OEZA 3LE6A 4C3PA 4FA2A 3PLSA 4ID7A 1WBVA 1WBNA 2R4BA 5J9LA 3DY7A 4GVJA 3OUNB 4YZMA 5HO7A 4F7SA 2OLCA 2XKEA 3FJQE 4FV1A 4JQ8A 4DGMA 1XQZA 4PMPA 3AC2A 3H0ZA 4Z3VA 5LQFA 5HEZA 2G15A 4MXZA 2IZSA 4CXAA 2QO2A 3PWDA 5GHVA 4IZ7A 4U5JA 3ZLSA 1OKVA 4G5JA 5CAVA 4DF3A 4AOTA 4C4FA 4DA5A 2OF4A 1OKZA 4A06A 4D9UA 3P86A 1GNGA 2PHKA 5IMXA 4XMOA 2HIWA 4F7JA 2ZAZA 4GUEA 4J7BA 5BYZA 1H28A 2Y8OA 4HGEA 3TL8A 2XBAA 3LJ0A 2GSFA 4J52A 2W7XA 3F2NA 1K9AA 3R02A 1YHSA 4LV8A 4L9IA 1KE8A 2ZB0A 4M97A 4FKWA 1GY3A 4EI4A 4B8MA 4O7YA 4M68A 3PP1A 4EHEA 3FZTA 3OY3A 4X2NA 4BBEA 3FMMA 4EQUA 3AGMA 5ANEA 4IX6A 2QHMA 2CLXA 3GOPA 2I0VA 2QNJA 3IONA 4G6LA 3P08A 2REIA 4E1ZA 5HTCA 3LPBA 5C03A 3SHEA 4AT3A 4PDYA 4C58A 2AUHA 5M4UA 3PXRA 2XK9A 2B4SB 3GNIB 3MIAA 4QTAA 4EK8A 3V5TA 2QURA 5J9ZA 4I5HA 4ONAA 2C4GA 4WSYA 3GQLA 2OXDA 1MRYA 4EH3A 4YZ9A 4JX7A 4ZSAA 3SG9A 4NM7A 2UZVA 4FGRA 3BGQA 4PMMA 3SAYA 3QF9A 3JY9A 4AW0A 3NMUF 2OGVA 4YJTA 4E93A 3KEXA 4F4PA 4GFMA 5DI1A 5HE0A 5IISA 5KMOA 3RI1A 1WCCA 4WHZA 1QPDA 4ACDA 4GUBA 5HBJA 3CSVA 1KE7A 3CTHA 5C9CA 5E8WA 4LOOA 3QGWA 4HGSA 4L3PA 4RQKA 3O50A 3SQQA 4HPUE 3QQLA 4ZSLA 4UMQA 4AE6A 4IJ9A 2Z02A 3CXWA 2C0TA 3IQ7A 5K0XA 5E8ZA 4EWHA 3Q32A 5L2IA 3LM0A 3ZRMA 2YEXA 3ODYX 3LCSA 4FTAA 5EI6A 4CTBA 5LVMA 4PMSA 2XCKA 4F63A 1OUYA 5FBOA 3CD3A 2VO0A 4O0TA 5ANDA 3E8NA 4ASXA 4IAKA 1H0VA 4CEGA 4XOZA 4FYNA 3AT3A 3POOA 2R3GA 3GU5A 4GK3A 4DH5A 2VWUA 3VBXA 3IOKA 3OOMA 3Q9YA 4ERKA 4G3GA 2GFSA 3F3WA 4H58A 5DH3A 4EOMA 4P90A 3C5IA 1H27A 3GFWA 5EM5A 5T6KA 1E9HA 3MI9A 4EK4A 3KA0A 3E3PA 2R3QA 4H1MA 4FG8A 4OR5A 5C26A 4F6WA 3VRYA 1JSUA 2WQBA 4KWPA 5J5TA 2GHLA 3NCGA 4GG5A 1QPJA 5HLPA 4BC6A 3BPRA 4BDJA 3QQKA 2O2UA 2Z7SA 3RM6A 3TDWA 3UDBA 1X8BA 5CU4A 3AC5A 4YJOA 3CJGA 5CSHA 4YHTA 3ZC6A 3I81A 4CT2A 4FGBA 1YI3A 3L9PA 4Q5EA 3QHWA 4YJPA 3VBVA 3ZSGA 5HX6A 1J3HA 1KE9A 4JG6A 5AP3A 1I09A 4BCQA 1MQBA 5KHWA 4BR3A 3GCSA 5CYIA 2NPQA 3VHEA 3OT8A 3WZKA 5CEIA 4EH2A 4C2WA 4RA5A 4RWJA 5C27A 4CKJA 4GL9A 3RP9A 4GK4A 4LFIA 3RZFA 5TKDA 3S1HA 2OWBA 3ODZX 3QCQA 5KKRB 2CHLA 2HZNA 2VU3A 3PZEA 3M2WA 4II5A 3V8SA 3WZUA 3LLAA 3PSBA 3ETAA 4EOIA 4QOXA 1J91A 3UBDA 4FTJA 2PVYA 5LVLA 4FNZA 4GK2A 4XOYA 3R7VA 3WZJA 3OT3A 2UVXA 4I4FA 5BVWA 3FMHA 3GCUA 5DWRA 5A4QA 4LV5A 3UYSA 4IW0A 3CP9A 3QD2B 5H8GA 2VV9A 4Q9SA 4V01A 4C59A 5BVFA 3E88A 3HV5A 4W4VA 5M4CA 2O64A 3FI8A 2PVNA 4YU2A 4AS0A 2WQMA 3PA4A 3ORNA 3QCSA 3RINA 4XUFA 4LGGA 5L6WL 5HZNA 5EYKA 2J7TA 3U4UA 3DZOA 2JITA 1H26A 1CTPE 3EIDA 2YIWA 3SGCA 2OW3A 4M7IA 3ZUTA 3FHIA 4TWOA 1Y91A 3BRBA 1XH8A 3DFCB 4RVLA 2PMOX 3MDYA 4KIKB 5E8SA 3TACA 4MD7E 2OXYA 2WEIA 5A6NA 2UZTA 3RK7A 2W5BA 4D4YA 3QLFA 4EZ3A 5BMSA 2VNWA 2PL0A 5EQPA 4RZWA 5AAGA 4KKGA 5EYDA 3C9WA 3KREA 5CF4A 2GS6A 4YHFA 3TG1A 4EEVA 3EN4A 4O0XA 2BRNA 3RK5A 2QKRA 1U4DA 5ANIA 3C4XA 3A7JA 4G6OA 5EI2A 2B1PA 3TZ9A 4PTGA 5CI6A 3VJOA 3R01A 4C62A 3FLSA 2PZIA 3I7CA 5CF8A 3PXZA 2JIIA 5C4KA 3OWKA 1UKIA 3ZSIA 4EJ7A 2RSVA 3HMOA 3DJ6A 2FSOX 5IDPA 1RW8A 2RFDA 2FUMA 3SOCA 3BQCA 4Y5HA 4W4YA 1DI8A 4ANMA 4BDBA 1TQMA 5EHOA 4KIOA 3T9IA 4E4XA 4IH8A 4W8DA 3TEIA 4KIKA 3VIDA 2OIQA 1TKIA 4CCBA 2ITZA 4AGCA 3DLSA 4IM2A 5K5NA 2UZBA 3A61A 2X9EA 4ITHA 1ZYLA 4WOVA 5CQWA 5FDXA 3BWFA 5HESA 4O21A 1YWVA 4AGDA 2XA4A 3A4OX 3CTJA 3IECA 4RC4A 4E8AA 3D15A 1YXVA 3EHAA 3ERKA 2EXEA 2CKQA 3LFBA 2WMVA 4TYEA 3LFNA 3QQUA 3HMIA 4KINA 1ZRZA 4FX3A 4F1OA 3N9XA 4NU1A 5E9EA 1LR4A 4CKRA 2IG7A 3DS6A 3LIJA 1GZOA 1OVEA 2JKMA 4X3FC 2X7GA 2YAAA 3KN6A 3MH1A 2X0GA 3SW4A 3ZLXA 5ICPA 4XH6A 5J1WA 2RG5A 2UUEA 3BEAA 5TO8A 2YZLA 4DH1A 2YHVA 4DGOA 2YIQA 4PY1A 3ZM4A 3EL7A 3QZHA 3FKOA 1PXKA 3UGCA 1ZOEA 3E8CA 4DT9A 4DFYA 4PL5A 4EC9A 4EKLA 3QC4A 1ATPE 3R9RA 4I3ZA 4O27B 4ZEGA 4FEUA 4I6BA 5D10A 3UZTA 4ZOGA 2P0CA 2Y4PA 2ITQA 1XWSA 2YAKA 1KWPA 3DKFA 3EZRA 4AW5A 3KRJA 3AD6A 2JFLA 3DBEA 4MH7A 5E8YA 3RGFA 3ZCLA 1Q8UA 5ANOA 1SNUA 4ASZA 4GJ3A 3Q9WA 1OKWA 5DRDA 1XBCA 5KE0A 4O0WA 3VW8A 4YJUA 4DEHA 3MVMA 4XG2A 4FSWA 3RAHA 5HBEA 4U8ZA 4XV2A 3WYYA 4JAIA 5DMZA 3ZO4A 4UALA 2OIDA 2GNJA 2R64A 2JAVA 5DG5A 4QTCA 2DS1A 3F5PA 3F82A 2QHNA 4N6YA 4ZLOA 3ID6C 4IDVA 2WMXA 5AV4A 4G16A 2X6EA 2UW3A 5EKOA 3WILA 1WBSA 4EBWA 4E3CA 4M14A 4OTFA 4XG9A 4TNDA 3TT0A 3CD8A 5CNNA 3RALA 4TYGA 2WEVA 2B9HA 1SZMA 2CSNA 3UE4A 5KMKA 2FSMX 2E9UA 1ZYJA 5H8BA 1UNHA 4R7IA 1IEPA 2XK3A 2VX1A 3HV3A 4TWCA 3MW1A 3ROYA 3UVPA 3VAPA 2ZV2A 2IJMA 4BDCA 4OTQA 4RX8A 3ACKA 5FTOA 3I79A 4KBKA 4ANOA 2OZAB 3GT8A 3EKNA 4FF8A 2PVHA 3IW7A 2BTSA 4QP9A 5DIAA 3F9NA 4ENYA 3HV6A 3KXMA 1H1QA 4I5CA 1RQQA 1YHVA 3NUYA 2VTOA 3BYSA 3ENHA 4AA4A 3VULA 3PSCA 4U6RA 4TT7A 2B52A 4C35A 5GJDA 4M84A 4XP0A 2OIBA 3LXKA 3LFAA 5EKNA 4WNOA 4J96A 5CVHA 5FXSA 5CT0A 4R7HA 4FV5A 4UWCA 4UYAA 3ULIA 5HD4A 1H01A 2Y9QA 3CQWA 2YZAA 3S4QA 2Y7JA 5HTIA 5IQGA 2GS2A 2F7XE 4G3EA 4RA4A 4EHZA 4F09A 4BTJA 5JH6A 2NP8A 4G9RA 2GS7A 4I5PA 4O83A 2R0IA 2OO8X 5M08A 3SKCA 2R3NA 3QZGA 4FICA 3IDCA 1OM1A 3OXTA 3VJNA 4P7EA 2PUPA 3QU0A 2G2FA 4JI9A 4KAOA 4GW8A 4J53A 4WA9A 5HD7A 2CCHA 2FGIA 3D7ZA 4PV0A 3BV3A 1WMKA 2OZAA 3JXWA 4G2FA 4FSTA 3FY0A 3DKOA 3QWKA 3R7YA 5AA9A 4ZLZA 3EB0A 4IFCA 4DBXA 2R7BA 3KXNA 3NSZA 3U87A 3NUPA 4QPSA 4RX9A 5TE0A 3H10A 2UW6A 3QRUA 3MESA 2OBJA 2C6KA 3KRRA 3R7OA 3R7IA 3AMAA 3W8QA 4OBPA 3RZBA 1YOJA 2BIYA 3ZS5A 2YDIA 2QCSA 1UKHA 3AC8A 2BKKA 2NO3A 4TZRA 4V0GA 3VS0A 3GCQA 2VO6A 1ND4A 4S2ZA 4FL2A 2OFUA 4ZTSA 4IHPA 2Q83A 3QXOA 4L45A 3NEWA 3H0YA 2VX0A 2B0QA 3TJDA 3BGZA 2DUVA 4XS2A 4C37A 3MA6A 5ANGA 4FKOA 4JVGA 4I22A 4O7WA 2GMXA 2P3GX 3FV8A 2VO3A 4ANSA 3CJFA 3BHHA 3ORTA 3ORXA 4CZUA 2VX3A 3ZEWA 3FXXA 2BPMA 3TNHA 3QKMA 3O51A 2X8EA 2Y0AA 4EH7A 4RWIA 4WSQA 1YOLA 4FT0A 4NIFB 3ZOSA 1XH7A 4LGHA 4M67A 4AZFA 1CDKA 3OXZA 4YTIA 4MBLA 4IMYA 4R1VA 4YBKA 3Q2JA 2EWAA 1PXMA 4FV7A 1HCLA 3F7ZA 1R0EA 2O65A 3KRWA 3L8PA 3LW0A 5BMMA 4AN2A 1RJBA 5JMSA 2PWLA 4QQCA 4E5AX 2HW6A 1I44A 1S9IA 2B9JA 3QRJA 3POZA 4K33A 4L52A 4YPSA 4JQEA 1Q61A 4FKLA 5ETIA 4M13A 3DNEA 4D9TA 3GU4A 1KE6A 4FZFB 4WG5A 1ZZLA 1WBOA 2ITNA 4IACA 4S32A 3ROCA 3FC2A 3HMNA 3NWWA 3RMFA 1SVHA 4EH6A 3R1SA 5KMIA 1Q62A 2WTCA 2C1BA 4ALVA 4XNEA 1CM8A 2BHEA 3BE2A 4IB0A 4BZOA 4PTEA 4L7FA 2FB8A 3VS5A 3BYVA 3UOKA 3ZHPC 3ZXZA 1A48A 4YSMA 2CNUA 4D1SA 5IQAA 2UZLA 3FI3A 4NIFA 4QYHA 2IVUA 3MJ2A 5JKGA 1OPLA 4UY9A 3ENMA 4PP7A 3KMWA 2HZIA 4U7ZA 4O7LA 5H9BA 1TQIA 4FKRA 3GEQA 1FOTA 3FWQA 4RX7A 5AUVA 5C4LA 2YWVA 1H25A 4BHZA 2A27A 4K18A 4CT1A 3D2KA 4K9YA 1OL1A 1OITA 3PA3A 3QD0A 3Q3BA 4H39A 3DK6A 5BVKA 3UTOA 3I7BA 4MKCA 2IW6A 3G90X 4PMTA 3RAWA 2QOCA 3SDJA 4TWNA 5ETFA 4BTKA 3PXQA 4I6QA 3AC3A 4FSUA 3W2OA 4QRCA 4JS8A 4BVUA 4JG8A 4LQMA 3VUKA 2W4JA 2YM3A 4MBIA 3OCTA 4U44A 4O82A 1IASA 3CGOA 4IWPA 4CNHA 3RBWA 5HICA 2XEYA 4EOQA 3MA3A 1XBBA 3PFQA 5JRSA 1IAHA 5E1EA 2H8HA 5HU3A 2IPXA 2QLQA 4ACCA 3U54A 2J5FA 3FLQA 2WFYA 2W1HA 3DDPA 4MEDA 3P79A 1PYXA 3RJCA 4U81A 4FODA 4JNWA 3DJ7A 3B8RA 3NZ0A 3QTUA 3OWJA 2IWIA 2ITXA 4NKSA 2X7OA 5ACBC 3DV3A 4UX9A 4JR3A 1REKA 3WIKA 2JFMA 3MPAA 3LXNA 1JBPE 1O6YA 3MPMA 3QZFA 4NM0A 4UWBA 3UQGA 1VR2A 4GFOA 4RRVA 2G1TA 2VTMA 5KZ0A 5DA3A 3SC1A 4CLIA 3IW8A 4U41A 3CS9A 1OZ1A 2UV2A 3PIXA 3GENA 4QQJA 2IVVA 2QKWB 1IG1A 2YLFA 4C36A 4ZTQA 4I94A 4F9AA 4FSMA 3VRZA 4DG2E 4FI1A 4FR4A 5KBQA 4CV9A 3NNUA 4FSYA 2R3IA 4BCMA 3QGYA 4FKJA 4F0FA 4ZS4A 3IS5A 2WAJA 5DEYA 3PSDA 5HO6A 4QMVA 2W1GA 3HP2A 5DNRA 2HZ0A 3MH0A 4L43A 5L8KA 3FPMA 2JAMA 2W4OA 4FMQA 4LM5A 2QOLA 2QODA 3OCGA 3PJ2A 3C51A 3LMIA 3LJ1A 3IOPA 1R1WA 5BVEA 1Q41A 3C4FA 5AM7A 4FT3A 4GEOA 2CGXA 3EWHA 4FVPA 4RJ4A 4TY1A 1XH5A 4L67A 5HKMA 5BX0A 3MFUA 4FIFA 3ZRLA 3NPCA 2ESMA 4HZSA 4IB1A 3T8OA 3WF8A 2ETRA 3VVHA 4CFUA 4YPDA 2BDWA 4E73A 3BWJA 4RIYB 2J5EA 2VGOA 3C4CA 3F3ZA 5AR8A 3WARA 4A9RA 1UU7A 3VW6A 3F5UA 4QMQA 2GQRA 1G5SA 4MXXA 5J7HA 5DVRA 4OTRA 3FL4A 3K54A 4FEXA 3NX8A 2VNYA 2WO6A 2QOBA 2BZJA 4R5YA 4C4HA 5FQDC 2C3LA 4BCJA 3FHRA 4YJSA 4G1WA 4UZDA 2X8IA 2YCQA 4RJ7A 3DBQA 3WBLA 2OI4X 2WQEA 3OY1A 4L44A 5J1VA 3UZPA 1LUFA 2CPKE 3MY5A 3QUPA 3S0OA 3R00A 3WF5A 4R3PA 3W2QA 3HUCA 2ZVAA 4A4OA 3RAKA 3DPKA 3UIMA 3SXSA 3UIXA 4FKIA 1UVRA 2X81A 2UVZA 2JBOA 4AZVA 2A0CX 2BDFA 3MFRA 4IM0A 3H9OA 4YTCA 4FIEA 4ASDA 4DT8A 2WELA 1V0OA 2WMAA 1URCA 4IB5A 5AV0A 3OTUA 4RIYA 3Q04A 2Z2WA 4GJ2A 3DKCA 4E26A 4CMOA 2J2IB 2OJIA 2C3JA 4IC8A 3NYXA 4AX8A 5IA3A 3KKVA 1J7LA 3TTJA 3NAYA 4O7RA 3QKKA 2CNVA 5IQIA 4CYIA 4EQCA 2YM8A 4GS6A 2PU8A 3FZOA 5FTQA 5CASA 4RIXB 4QYYA 1KOAA 3WZDA 3THBA 5IU2A 5AV2A 3PY3A 2YWPA 4MK0A 2HWOA 1OL6A 2J0IA 2YCRA 3RWPA 5CVFA 4EH9A 3NUAA 3MTFA 5JRQA 2OICA 2WKMA 3MVLA 3OF0A 4P5QA 4AOJA 3NYOA 3KF7A 4R6VA 3V6SA 4TYJA 2C30A 5I9VA 2PUIA 3GGFA 3I6UA 3LXLA 3QA0A 3K2LA 4D1ZA 4QP2A 5CU3A 3VF8A 4O38A 4BB4A 4EKKA 3MPTA 2W17A 3FZRA 2QOOA 3HV7A 3H30A 5BUIA 4BKYA 1H1PA 2XJ1A 1ZMWA 5T68A 4CG8A 3QUDA 2X9FA 3F61A 3NAXA 4NCTC 2GTMA 3MH3A 3EOCA 4WBOA 4FEVA 3I4BA 1H08A 1OL5A 3EQRA 2BTRA 3FKLA 3QTSA 3DZQA 4HNIA 3BLRA 2ZM3A 5L2QA 4EK6A 1CMKE 4J95A 3KULB 5A4LA 4AUAA 4EH8A 5AX9A 3RNYA 2R3KA 2E9VA 4JOAA 5L8LA 4RIXA 2AC5A 4GKIA 5HIDA 3D5UA 2HAKA 4RJ6A 3RTPA 5IDNA 2CN5A 3F88A 3DQWA 4IAFA 4FBXA 5LWMA 4S34A 3ZFXA 4CZTA 4DITA 1R78A 3F6XA 5E91A 4XG8A 4Z7GA 3DOGA 3BKBA 3FLWA 5HQ0A 2IZRA 1W8CA 2VTPA 5AUYA 4AG8A 5LMBA 1G8AA 1YOMA 2XRWA 4PUZA 3RPRA 2ONLA 2WQOA 2YJRA 3NR9A 3EYGA 2WIHA 4FYOA 3RPSA 4HYHA 4BZNA 3R8LA 2QO9A 4DFZE 2XKDA 2YM7A 3I60A 1XHAA 4I20A 4YURA 2F57A 2UW0A 3Q53A 4DYMA 4PX6A 5AR2A 3JY0A 4FG7A 4ZXTA 4QMLA 3KULA 4M8TA 4L53A 2QQ7A 5LVNA 5DT4A 2XIXA 3A60A 2G2IA 3NNXA 4ALUA 1Y8GA 1JKTA 1M7QA 3V04A 4DFNA 3WF7A 3GU6A 5I3OA 2R5TA 4J8NA 1JOWB 3OBJA 3L9MA 4C4GA 4ZLYA 4Y83A 3UMWA 3E87A 3ZMMA 4PNKA 4ZY4A 4Z9LA 3PY0A 2BAQA 4NFNA 5IPJA 2R9SA 3G0FA 4USFA 5IH5A 1WBPA 3HUBA 2E9PA 1OIYA 3AT2A 4FIGA 5IKWA 3UP7A 3R04A 5K9IA 2F4JA 4NSTA 5AWMA 1Q8ZA 1YWNA 4KKHA 4ANLA 2W5AA 3LCDA 2ITOA 4QP4A 4A07A 3ZBFA 3RVGA 1Q24A 4M0YA 3DQXA 4PPAA 3U9CA 3EKKA 4XRLA 5GZ9A 4CFFA 4I0TA 3HRCA 3BYMA 3EFKA 5I0BA 4TPTA 5FGKA 5GZ8A 3FLZA 2ITTA 1FGKA 4PP9A 5LOHA 4OAVB 3SA0A 3R7GA 3RCDA 3AC1A 2PVJA 2O8YA 3FMLA 3KXXA 3CQUA 4QMTA 3UYTA 3BELA 4AFEA 1JNKA 5LMKC 3DT1A 4FL3A 4QNYA 4APPA 5KMLA 4FT7A 3LOKA 2ZDUA 4KSQA 3E62A 1APME 4FTCA 3H3CA 3RNIA 4OTHA 2X2LA 5CXHA 3UNJA 4IADA 4IXPA 4V05A 5AP4A 5IZFA 3NUXA 3ATTA 2GU8A 4PRJA 5F95A 4BI0A 4LYNA 4ACGA 4XCUA 3MWUA 4NYEA 2HOGA 3SXRA 3VUDA 3PJ8A 4IBMA 4KD1A 4IVAA 4DEIA 3GI3A 3EFWA 3TN8A 1ZYCA 4AF3A 4O0YA 2I0EA 2IN6A 1GZNA 4NEUA 3D83A 1FGIA 4HZRA 2VTQA 4RPVA 5AP7A 3A7HA 1F5QA 5CU0A 1XH6A 2JDRA 2VWYA 3GXLA 4KABA 4YO4A 2ITYA 2QOKA 3VBWA 1Q4LA 3P7CA 5EOBA 2W1FA 4W4WA 3V5QA 3C4EA 2WD1A 2PUUA 4AA0A 2AC3A 5F4NA 1YQJA 5J79A 1Q5KA 3ANQA 3T3UA 3UC3A 5IH4A 3QL8A 3PVBA 4ZS0A 5CEQA 4KIPA 5CF5A 5CVGA 4L6QA 1H1RA 4I0RA 3QTXA 4MYGA 5EM6A 2ZDTA 4XBRA 2J0MB 1JAMA 4EZ5A 5CEPA 4OAUC 5FM2A 5IH6A 3PVWA 4EOOA 2ZJWA 4ZJJA 3QYWA 3F69A 1OIRA 2YJSA 4DN5A 3NCZA 1Q8WA 5HTBA 4DGGA 5H3QA 3KRXA 1MRUA 4NW5A 3UMXA 3HDMA 4YZNA 3WIGA 4F7NA 4Z55A 3BBWA 2QU5A 3U6HA 2V55A 4U79A 4F08A 3R9NA 2JKQA 4XP2A 1Q3DA 4RGJA 4QO9A 3VBQA 5F9EA 1QL6A 4XX9A 3PG1A 2VWVA 2Q0NA 3ALOA 5L2TA 3Q6UA 3EQPA 4DFBA 4NL0A 1T45A 2C1AA 3VUMA 4DGNA 1IAJA 2PMLX 3FQSA 5I5ZA 4XLIA 3PZHA 3S00A 4BGQA 4CFXA 4U45A 4R5SA 3VS3A 5DGZA 1BYGA 3K3IA 4O0RA 4LUDA 1YXTA 4HCUA 5CLPA 5FXQA 1HOWA 1J7IA 1J1CA 4WT6A 5IA4A 4RZVA 2ZB1A 2WNTA 3LJ2A 3O8UA 2X2MA 4WBBB 5DN3A 2R3RA 3NRMA 5HCXA 3LFSA 4IX4A 4C4EA 4H1JA 1A9UA 4HVHA 2BHHA 1M52A 2PTKA 4KA3A 4J98A 4CFNA 5HI2A 3V8WA 4XRJA 4AU8A 4JQ7A 2EU9A 5AAFA 5LMAA 5BQ0A 4LRJA 3PUPA 1U46A 2JBPA 2P4IA 5AFVA 4NM5A 2EUFB 5FRIA 2J51A 3OG7A 2V0DA 4FUXA 1MP8A 1PMUA 5FTGA 3LHJA 4RIWB 5GJFA 2JC6A 3QTIA 4JT3A 1FINA 5ETCA 2C6OA 3W55A 4EYJA 3DKGA 3LCTA 3PVGA 3IW6A 3ZTXA 4PL3A 3JPVA 4QMOA 3UIUA 1SYKA 4F9CA 3OBGA 3MH2A 2ZMCA 4A9SA 3LFFA 3EQCA 3WE4A 3HEGA 4I24A 4ZTRA 4P2KA 1Q3WA 4I4EA 4L42A 3ULZA 2X39A 5J8IA 3R1QA 4F64A 3NVKI 3KXGA 4XV1A 5CS6A 3I5ZA 3PXYA 3R7UA 1MQ4A 4OGRA 5B0XA 2XJ2A 4QTBA 3SRVB 4MTAA 2P2HA 3ZFMA 2UVYA 4AT5A 1AQ1A 4V04A 3V6RA 2WMUA 3TUDA 1NVSA 1M2PA 2XCHA 5J87A 1ZYDA 3W8LA 3V51A 5M07A 4FTMA 2ITUA 3W2CA 3FEGA 3EN7A 4MXYA 2OJJA 5E8TA 4ZZOA 1IA8A 4JBPA 4G5PA 5HBHA 5JGAA 3P9JA 4E6CA 3Q52A 2VAGA 4PTCA 3UP2A 2PK9A 3M11A 3NIZA 2Z60A 4RIWA 2VTLA 3QD4A 4FK3A 3Q4ZA 4CV8A 3LVPA 5CAPA 3FAAA 3JR1A 2Z7QA 4JR7A 4GIIA 4DTAA 2RIOA 2R3FA 1SNXA 4AW2A 2VTNA 3IW4A 1IA9A 3PJCA 3QTZA 4D28A 5EM8A 3UO6A 2W06A 4AN3A 4B0GA 3QCXA 2RFNA 4OLIA 2OKRA 5BNJA 3G9NA 4DINA 2YIYA 5KO1A 4UWYA 5HE1A 1JPAA 3BGPA 2ERKA 3FMJA 3O7LD 4K1BA 3UC4A 2R3JA 2W05A 2VN9A 3SRVA 4L00A 5EK7A 1UU9A 5JFWA 5FLFA 3ORIA 3FQHA 4YP8A 1JVPP 3MYGA 3EQHA 4QYEA 4BCOA 3TJCA 1ZWSA 3VS2A 3HECA 3EN6A 3MY0A 4AA5A 3O8PA 4NJDA 5TT7A 2CKEA 3GU8A 3KMMA 3KVXA 3II5A 1QMZA 3E3BX 3QYZA 3TNIA 3FI2A 5HORA 4OW8A 4TXCA 4USDA 2OK1A 3R83A 3E92A 3D5XA 5IEYA 4GKHA 4OBQA 1PKGA 3Q9XA 4ZJIA 4GH2A 3LXPA 3PTGA 3UODA 2QLUA 4D4VA 1ZLTA 2EB3A 2VTAA 3ZO1A 3W2RA 4EH5A 3UJGA 4Y85A 3UOJA 3ITZA 4EK3A 3ATSA 2PMIA 3ZLWA 1BI7A 4FEQA 3DBFA 4DEGA 3SX9A 2C6DA 4X3FB 3CR0A 3HA6A 5EI8A 5E4HA 4FV6A 2J9MA 2XNEA 4TNBA 3I0OA 4F99A 3Q4TA 3NVMB 4KBAA 4FV0A 1PXJA 1SM2A 2YCFA 2XM8A 3A8XA 4M3QA 2HELA 2XYUA 1WFCA 3D4QA 3AMBA 4BCHA 1H1SA 1KE5A 1P5EA 3UPXA 4FTLA 3VS7A 3SVVA 1PXNA 2RFSA 4FTIA 1W82A 4MD8E 5LARA 2PYWA 5E8VA 5BUEA 1V0BA 1ZOHA 3P0MA 3KU2A 3FQEA 3UOHA 2F2CB 4JIAA 1TVOA 4N6ZA 4BCNA 3TZ8A 4K11A 1W83A 2VWBA 3C5UA 4JBOA 4S31A 4RLKA 5GJGA 4F9BA 3MGYA 2P55A 2V5QA 4D0WA 3I6WA 4BF2A 4O7NA 5E90A 3FL5A 5CI7A 3G6GA 4HCTA 4TN6A 3QCYA 5JFVA 3KRLA 2BCJA 3IO7A 3LQ8A 4RC3A 4V0GB 4EORA 5J95A 4EYMA 2RL5A 1QPEA 4FIHA 3NNVA 4F1MA 3LQ3A 2JLDA 2ACXA 2V22A 4EOLA 4WRGA 4O22A 4C3FA 2NRUA 3DU8A 1O9UA 3CPBA 1OMWA 3U51A 2FSLX 4F9YA 4O1OA 4X3FA 5AR3A 3CBLA 4B8LA 4E6QA 2QONA 4J1RA 3IG7A 3HRFA 4FC0A 4RWKA 2BVAA 4Q9ZA 3GC7A 3BE9A 3DCVA 1OL7A 4FNXA 3BHUA 4NWMA 3FXWA 3TWJA 4FKGA 4BYIA 3D5WA 5K3YA 4QMWA 4D2PA 3FC1X 4JRVA 3AG9A 5A14A 5DLSA 5AP1A 4UV0A 4EJNA 2RGPA 4H3BA 3DB8A 3ZLYA 2PE0A 2F7EE 3FY2A 3O23A 4AGUA 5CEKA 2BRGA 3CTQA 1R0PA 3RWQA 4WNKA 3MFSA 1OGUA 4H3QA 4O7VA 2QOFA 3NW7A 1XO2B 4IJPA 4NM3A 2C69A 2UW8A 3HGKA 3PYYA 4XLVA 3ZO2A 4C61A 5CU2A 3PRIA 5AUXA 3R8PA 2GPHA 4I23A 1KUTA 4DCAA 3GQIA 2ZV8A 4BCIA 4UMTA 4DFLA 2V7OA 4O6LA 2XNNA 3N4VA 2C5YA 4IAAA 4CVAA 5TR6A 4A7CA 4RMZA 1DAWA 3BHVA 4X2FA 4HJOA 2WPAA 1J1BA 3CY3A 5IA0A 1WVWA 3O2MA 4UBAA 1GIIA 1R39A 4TRLA 1PF8A 4Y8DA 5EHLA 2PVKA 3N4UA 4FOBA 4O84A 1AGWA 2J0KA 3TKUA 5IG1A 5JZJA 2WMQA 2YERA 3BBTB 5EDPA 4BKJA 2V62A 2Z7LA 5DHJA 4YLKA 2ITWA 2RG6A 3I1AA 3MJ1A 4IWOA 3A2CA 4YJNA 4HCVA 2GTNA 2R0UA 4RIOA 4GV1A 2WOUA 2X4ZA 3OS3A 3GCVA 4GT4A 5KMJA 3A7FA 5GINE 4G3FA 2VTIA 4S30A 3E93A 1IRKA 5J7BA 3ORLA 3KMUA 3NNWA 3A8WA 3NUSA 4DFUA 1U54B 1SVEA 4CGAA 4FTRA 3MN3A 2I1MA 3AGLA 2BFXA 2VUWA 3NW5A 3OCSA 1OIUA 4MD9E 4QYFA 4CYJA 5BYLA 3A7IA 3AXWA 2J90A 1FVRA 3TM0A 4APCA 3WI6A 3COKA 4FKSA 3E63A 5FEQA 1WBTA 2R3HA 3MVHA 4JDHA 4N4SA 3ORZA 2BRMA 2GHGA 3OXIA 3QQJA 2UZDA 3G2FA 4QPAA 3ZM9A 4DLJA 5G1XA 5LVPA 2W0JA 2DWBA 5FDPA 2GQSA 4E6AA 2E2BA 4JDKA 4P4CA 2A19B 3ACJA 2WQNA 4USEA 1PYEA 2PZPA 3P1AA 1YWRA 4U3ZA 3R71A 4G6NA 4DC2A 4HW7A 4ANBA 3R2YA 2ETMA 3O7LB 2QVSE 4K8AA 5CZIA 2OJ9A 5EH0A 4RJ3A 2CGWA 4FG9A 5AUTA 2C6IA 3CE3A 4J99A 3HRBA 4BDDA 1XJDA 5E7RA 3PP0A 5M55A 5EHYA 5HG5A 4O0UA 4E7WA 4TWPA 2OU7A 1F3MC 3KB7A 4GYGA 1U54A 2J6MA 1Z9XA 2IZTA 4LG4A 4YZCA 1NY3A 3E64A 4FSNA 4DG3E 3L8VA 4BCPA 4RX5A 3KCFA 5ANJA 3UVRA 2B9FA 3OHTA 5DOSA 5F94A 2CLQA 2VGPA 3Q9ZA 4C34A 4PQNA 2CJMA 3E5AA 3VUHA 3C13A 5HG7A 5DT0A 3W2PA 5AV1A 5AUUA 5FXRA 3CC6A 4ZMEA 4JDIA 2YIXA 3QXPA 5EOLA 5F1ZA 3R30A 2NRYA 1PRYA 1UU8A 3KQ7A 4UYNA 4W9XA 5AP2A 1KV2A 1UWJA 4I5MA 1Y6AA 4FKVA 3TZ7A 2VWIA 4I1ZA 4ZIMA 1U59A 4QMZA 4FZDB 5FD2A 2Y6MA 3TTIA 1LEZA 3GU7A 5FP6A 1SVGA 5AR4A 4EOSA 2RKUA 2X2KA 2YM5A 3LFDA 5HOAA 3DXPA 2Y4IC 4GVAA 2HY81 4QPMA 2CKOA 4H05A 2EVAA 4I41A 1LP4A 3D7TB 3MVJA 4K2RA 4F0GA 4JRNA 3W2SA 4G34A 3HL7A 4RQVA 4UZHA 5JGBA 1J7UA 4YJQA 3ZUVA 4BWXA 3PPZA 4XV9A 2LGCA 5FUTA 2JDOA 2XS0A 1OL2A 4J97A 4QP3A 3K5VA 4AGWA 1WVYA 4AOIA 3HMMA 5E8UA 3AQVA 4DH3A 1OIQA 1W0XC 2H96A 4BGGA 2HXQA 5M4IA 3FLNC 5JEBA 2B55A 4RC2A 3ORMA 2XNPA 4CQEA 3KXZA 1STCE 4X6QC 3KL8A 3LZBA 5DEWA 2BKZA 2H6DA 2P33A 4ZSEA 4I6FA 4KSPA 2X7FA 2QC6A 3IDBA 3NW6A 3ZU7A 1M7NA 2YA9A 1MUOA 2WMRA 3R8VA 2B7AA 3TUCA 2J0LA 2CNQA 1YDSE 2ERZE 3V5WA 5K0KA 5GIOE 3FI4A 5IEXA 2FSTX 3DGKA 3OD6X 4LRMA 1Q8YA 2WXVA 2XJ0A 3DAJA 4D4RA 1BX6A 3KFAA 4A9UA 4X3JA 4EUUA 4TL0A 5IUGA 3HLLA 1UNLA 1W98A 3D7TA 1ZMUA 2KTYA 2WMTA 5T3QA 3R9OA 4BDKA 4RBLA 3EQGA 3OFMA 3RK9A 4C0TA 4UN0C 3SG8A 3DBCA 3O96A 4WG4A 5J5SA 2QG5A 3EN5A 4MNEA 4FUYA 2C5OA 3FZSA 3JVRA 4MBJA 3CKWA 4OTWA 5CAOA 5KMMA 5JZNA 3OOGA 4FTKA 4FZAB 4X7QA 2HCKA 4BFMA 1M2QA 2PVFA 3A99A 5ANKA 4DGLC 5CALA 5K5XA 4DEDA 3VS6A 1PJKA 3HV4A 1PY5A 2UW5A 5HGIA 3V01A 2R3LA 4BDGA 5A6OA 2ZOQA 4FKTA 4EC8A 3NIEA 4NTSA 2WZJA 3GCPA 3DLZA 3G0EA 2QG7A 3PE1A 3EQBA 1BKXA 2OZOA 5BVOA 3S2PA 5EG3A 2QI8A 3LFQA 4QMUA 3F2RA 3CLYA 1VYWA 2BIKB 4FTQA 5HNIX 3BCEA 2VWXA 1O6KA 5IA1A 1GZ8A 3C4WA 4C02A 4YTFA 2HZ4A 1LEWA 3B2TA 4CMUA 4E20A 3GP0A 2WMWA 2Z8CA 2ZV9A 2HENA 1V1KA 2IZUA 4X0MA 2XIZA 2I40A 3OW4A 3EL8A 2GNHA 4U0IA 2Q0BA 3R1NA 3E8DA 3IPHA 4RT7A 1YRPA 5M06A 2QR8A 3UQFA 4O6EA 1WZYA 2Y6OA 1ZXEA 1XR1A 2OSCA 5B2LA 4AWIA 4CRLA 4L3LA 1UA2A 3VUGA 4BDHA 4EBVA 4AE9A 5CNOA 3F3UA 4QMSA 2BR1A 2WMSA 3ZONA 2WTKB 3ORPA 3W18A 4O1PA 3MV5A 4CRSA 3COIA 2XKCA 2C0OA 4FOCA 4Q2AA 4YC6A 4C33A 4PPCA 5AADA 2JGZA 4E4NA 2VTJA 5AMNA 4DCEA 4IAIA 4YC8A 4L3JA 3DXNA 2W9FB 1YXXA 3GVUA 2W9ZB 3AMYA 4C8BA 4BKZA 2BZIB 5JN2A 4X2JA 5BVDA 1DAYA 4E5WA 2FA2A 2H9VA 3LFCA 3D2IA 5EYMA 2C5VA 2PVMA 5HIEA 4XG6A 5C1QB 2X1NA 2XF0A 3F3VA 4R3CA 3MTLA 4BHNA 2VD5A 3L1SA 3SW7A 2XM9A 4FV3A 4QNAA 4ZZNA 4Z7HA 2FO0A 2HY0A 2F9GA 4DBNA 5M09A 2PUNA 2XIRA 5BVNA 3BHTA 4GYIA 4F65A 3QRIA 4GRBA 4R1YA 1Z57A 2CDZA 4KRDA 4MXCA 4R3RA 2XBJA 4X2KA 4Y73A 2JDSA 2XK6A 5E1SA 5L6OA 4FZ6A 4F70A 4A9YA 3PJ1A 5D9HA 1G3NA 4MQ2A 5M57A 2JIVA 5CTPA 2BZHB 3EFLA 3GUBA 5A4TA 3Q5ZA 4HYUA 2C0IA 4OUCA 5GZAA 4C2VA 2QD9A 3H9FA 5TOZA 4EWQA 4XJ0A 4AACA 3QX4A 3JS2A 2XNGA 1Y8YA 3F2AA 3FE3A 3NYVA 2C5NA 4PDPA 2OXXA 5IEVA 5H2UA 3NDMA 3V5LA 4U40A 3V8TA 1M14A 3IKAA 3SXFA 1FVVA 2BZKB 3DXQA 3MB7A 4PNIA 4BICA 4I0SA 3CEKA 2IW9A 2R7IA 3COHA 2UZWE 3LAUA 5AR5A 3JUHA 1GOLA 4FE2A 3GC0A 2Z7RA 1VZOA 3HDNA 4W4XA 3VHKA 1FQ1B 4JJRA 5CF6A 2OF2A 4L8MA 4E6DA 2PSQA 4O7ZA 1YXSA 4EK5A 2H34A 5AV3A 3Q6WA 4L46A 4TYHB 5A9UA 1SMHA 2I0HA 5BPYA 4IZ5A 3C1XA 2J50A 4HOKA 3R22A 4YLJA 3QTWA 1PXPA 2G01A 5DR9A 2WIPA 4TTHB 2PULA 1JSVA 2XNOA 5AAEA 4XP3A 2V7AA 4QMMA 3GOKA 4WNMA 3TIYA 3OEFX 4PDOA 1OKYA 3HMPA 3RAIA 4FTOA 4BWKA 2KULA 3QALE 3ZDUA 5HNBA 2P2IA 4FTUA 4IX5A 4WO5A 5FP5A 3L8XA 1DS5A 3R0TA 1JKKA 3D14A 4M66A 4MQ1A 4DE4A 2GNFA 5AX3A 3BV2A 4I6HA 1KV1A 4IIRA 2I7QA 2B9IA 2ZM1A 5EW3A 5LVOA 4OT6A 1OBGA 3FDNA 2XIYA 3RHXA 4D5HA 3R8UA 1XKKA 2CCIA 4N0SA 3VUIA 3MIYA 4IX3A 4JIKA 4EOJA 1YKRA 3E7OA 2O0UA 1YXUA 4PF4A 3RPOA 4BCFA 4KBCA 2FVDA 2VWWA 1YVJA 5IQFA 4B7TA 4YSJA 2PPQA 4MAOA 4R77A 2C3IB 4TYHA 2XYNA 1H8FA 4CG9A 4W8EA 5DPVA 2PZ5A 3N51A 4MXOA 1OBDA 5CEOA 4R78A 3G6HA 3RHKA 3CQEA 2PVLA 4C38A 1H4LA 3IGGA 3K5UA 3P4KA 4KNBA 5C8KA 3A62A 5EDQA 3M42A 2WTJA 4LOQA 4IE9A 5DRBA 1L3RE 1ZAOA 2X8DA 1UNGA 4JL9A 4HVGA 4E4LA 4NCTA 4NTTA 4MF0A 3UNZA 3WE8A 2WTIA 5KKRC 1YI4A 5DYJA 3R7EA 4PWNA 4XBUA 3UPZA 5LJJA 2XIKA 2XRUA 2PE1A 3FZ1A 4FKQA 4FV4A 2WGJA 4JG7A 2YM4A 3PRFA 5JFSA 3Q60A 4AW1A 3G15A 4JX3A 3QFVA 4RLLA 2XVDA 5FG8A 2O3PA 5D11A 4NJ3A 4C7TA 4QP1A 4QYGA 3UOLA 3EQDA 2PZYA 4IQ6A 4FV9A 3TNWA 5GIPE 2OFVA 3C0IA 1NVRA 4DFXE 5JT2A 5IUHA 3BQRA 2HXLA 3JYAA 3MFTA 2XKFA 4GIHA 2X4FA 4QQ5A 5G6VA 3TZMA 3COMA 4XYFA 4BDIA 3W1FA 3PG3A 5AM6A 5CU6A 3PPJA 5HNGA 1FBNA 2C6TA 1CSNA 1MRVA 3VNTA 3WZEA 4BDFA 3C50A 4WKQA 4L68A 2IO6A 4J8MA 5E8XA 1BI8A 1PMEA 1ZYSA 4HVIA 1FPUA 2QOIA 5HE3A 4KS7A 4MWHA 3Q4CA 3SV0A 4D58A 4CFVA 3ZC5A 4LRKA 4ZTMA 3R2BA 5EYCA 4AT4A 2XB7A 2ITPA 5CZHA 3BYUA 4P5ZA 4RVMA 1S9JA 5CSPA 2XH5A 4D2VA 2WB8A 2YABA 4CMTA 3O8TA 3BHYA 2XP2A 1PKDA 3OCBA 2BILB 3KVWA 4NW6A 2G9XA 5KUPA 3EYHA 1U5RA 5B7VA 3VBTA 3OTVA 2EXCX 5CSXA 2IVTA 3FPQA 4MHAA 4CLJA 2O5KA 3OMVA 4QMYA 1PXOA 3HYHA 4FZ7A 5CY3A 3HAMA 2PMNX 4R8QA 3CPCA 3PA5A 3OWLA 4YGAA 4OTGA 3OWPA 1GAGA 4FSZA 4FVQA 4QQTA 2VTSA 3LMHA 4ZY6A 1YDTE 1GIHA 5A54A 4AZEA 3NLBA 4O0SA 4RSSA 4BCKA 3FYKX 3E7VA 5HLNA 4H3PA 3TXOA 4RWLA 5HIBA 4ZZMA 3UVQA 2UW7A 3EZVA 1RE8A 1ZZ2A 3QLGA 4FSQA 2IW8A 4BCGA 2CMWA 5ETAA 5CX9A 3UG2A 1ZMVA 4BBMA 4YJVA 3DDQA 1JLUE 3FMEA 2VTHA 3HZTA 3R8ZA 4DAWA 5D41A 4IFGA 5LMKA 2PE2A 4K77A 4QMNA 1PHKA 5JQ8A 3HA8A 1LPUA 4FV8A 3ZZWA 4EQMA 1UV5A 4AAAA 4A4XA 4YR8A 4DEAA 1JKLA 3EH9A 4ZMFA 5EM7A 5CENA 2CGUA 2QOHA 3BU5A 4KKEA 4ACMA 4B9DA 4XEYA 3U6IA 2LAVA 2BAKA 3BYOA 5I9UA 3RKBA 1YW2A 4HGLA 5HG9A 4R7BA 2HK5A 2GDOA 4CFWA 3PPKA 3L9LA 3QD3A 5D7VA 5C01A 3QA8A 2E9NA 1ERKA 2ZM4A 5E92A 4BDAA 4MF1A 3QTRA 2OJFE 2VTTA 4FKPA 3R63A 4OTIA 3U55A 4YZDA 4X6RA 3KF4A
chains in the Genus database with same CATH superfamily
4D1XA 4KUJA 2C6EA 4IB3A 5IQBA 1REJA 5LCJA 4PL4A 2CKPA 2BUJA 3TV6A 2QU6A 4AP7A 1NXKA 4ARKA 4HVDA 5KMNA 2OG8A 3DBDA 4Y95A 5JSMA 4Y46A 4BI2A 2WTVA 1QCFA 4AZTA 4EOPA 5M53A 3QBNA 1P4OA 3DTWA 5M4FA 5M51A 5HVJA 1FMOE 3ET7A 2JDTA 4MVFA 2WMBA 4U42A 1UWHA 4GU6A 3TKHA 3QC9A 3P5JC 1R3CA 4EOKA 3LLTA 1PMNA 2F49A 4WD5A 4WNPA 5L2WA 2XEZA 5M56A 2WOTA 3SOAA 1Q97A 4MX9A 4JBQA 5B2KA 5FWKK 3PWYA 4JBVA 1H0WA 5EFQA 3Q5IA 4FL1A 2YACA 1HCKA 3ALNA 3EJ1A 1VEBA 3IW5A 4FV2A 4M0ZA 4XG3A 3S95A 2IVSA 4O96A 1AD5A 2W1DA 3PJ3A 4H36A 3SLSA 1EH4A 5ITAA 4KIQA 1NW1A 4ZTNA 4QP7A 2XUUA 4TKSA 3NFFB 5IMEA 4IWDA 1H07A 2YN8A 4HPTE 4IVCA 4NFMA 4B99A 5B2MA 3OP5A 2RF9A 1BL7A 4NKAA 4X2GA 4MCVA 3S3IA 4UMUA 5F20A 1YI6A 2W5HA 3DK7A 3IDPA 4LMUA 1H1WA 2ZYBA 3G5DA 5CSWA 4BL1A 4UMRA 5EQEA 5L4QA 4O2ZA 5I3RA 2W1IA 3O0GA 4FRFA 5L8JA 5KCVA 2I6LA 5LCKA 1T46A 4EONA 4YJRA 5KBRA 2X6DA 3DB6A 1V0PA 4HYSA 4FK6A 4LOPA 1FVTA 4KS8A 2GFCA 1TQPA 5A4CA 2OH0E 3FMKA 3OVVA 3VS1A 4UXQA 4ASEA 4ZJVA 1M17A 4ZY5A 4EUTA 2A1AB 3BL9A 3FMDA 3EQFA 3GFEA 3OUKA 4BGHA 5KNJA 4LL0A 2GNGA 2YLEA 5A46A 4BYJA 2EXMA 4LGDA 3TDVA 4BZDA 3P78A 4G3DA 2BDJA 4YC3A 4Z16A 3REPA 3QHRA 1JSTA 3U9NA 3HVCA 3RPYA 5BYYA 5CXZA 3HX4A 3MSSA 4QTEA 3KY2A 4UB7A 1ZOGA 4X21A 4IVBA 5AUZA 5LWNA 4N57A 3QQGA 1A06A 4U43A 3PXKA 1B39A 1KSWA 4E4MA 2DQ7X 1URWA 4NUSA 3AD4A 3NS9A 3TV7A 2PY3A 3UIBA 1JWHA 3WF9A 3R6XA 4BBFA 5I9XA 1Y6BA 3KK8A 3PY1A 4OTPA 3PIYA 4FSRA 4IZYA 3ANRA 3EQIA 4CTCA 1W2CA 2W1ZA 3DJ5A 2J4ZA 4F9WA 1WBWA 1XH4A 4FKUA 3MY1A 5HLWA 4EHVA 4LMNA 5IF1A 1UU3A 4EHGA 3DK3A 3MBLA 2ITVA 2JDVA 5JQ5A 3VC4A 4ANQA 4UEUA 4BRXA 4C4IA 5FM3A 1Q99A 2YISA 2CGVA 3UNKA 4D55A 5AEPA 2R3OA 2C47A 3NGAA 1W2DA 4CD0A 4RFZA 4GCJA 3B8QA 3HKOA 3U8WA 2O63A 4ZK5A 5EW8A 2YDJA 1Y57A 5I9WA 4JLCA 1P4FA 2XMYA 4RFYA 3P5KA 5DR6A 2UW4A 3EN9A 3RCJA 3IGOA 1Q8TA 2I0YA 2PVRA 4BTMA 3FBVA 5HU9A 2X0PA 4ALWA 3OW3A 3R21A 4DTBA 2BRBA 4IM3A 4C57A 4M15A 4ZTLA 2WHBA 3DAKA 3DA6A 4CKIA 4BIEA 1H24A 2QR7A 3WF6A 5JFXA 4MNFA 4DHFA 4JDJA 2BMCA 3LM5A 2C68A 1OECA 3ZRKA 4B6LA 2QO7A 5EQYA 2UZEA 1E1VA 4U97A 3R28A 3KK9A 1VJYA 2JKKA 5DR2A 3BU3A 4FIIA 4WUNA 4LI5A 1YDRE 1GZKA 4NK9A 2XNMA 3PIZA 3Q96A 4EZ7A 4IAZA 3F5GA 3NUUA 2XK8A 3TV4A 1P14A 3QUEA 1JQHA 1XBAA 3Q2MA 5CT7A 2F2UA 4L7SA 4F6SA 3R9DA 2BFYA 4DEBA 2F7ZE 5AP5A 3EMGA 5TF9A 4RG0A 4C3RA 2E9OA 3QTQA 4AFJA 1OPJA 1Z5MA 1XH9A 3B2WA 4GU9A 4BDEA 4BI1A 5IA2A 3CY2A 3C7QA 2VTRA 4O81A 5IUIA 2BALA 4IEBA 4RVKA 3C0GA 2BAJA 5AIKA 3G9LX 3F5XA 4ZTHA 3ELJA 3QRTA 3O17A 2UZUE 5HCYA 5FEEA 2SRCA 4IAYA 4D2WA 5HX8A 3BX5A 2PZRA 3DNDA 3N4TA 2RFEA 3DAEA 3VQHA 1K3AA 3CGFA 4Y72A 1CKPA 5M44A 3L8SA 4QD6A 5CWZA 3W0NA 2J0JA 4GT3A 5L6PA 4RFMA 3T9TA 3GB2A 2XANA 3BLQA 3QRKA 5A3XA 3UG1A 4FEWA 3OC1A 4F78A 1BUHA 3BU6A 3D94A 2G2HA 3MB6A 5GNKA 1PXLA 3M1SA 5EDRA 4AZSA 3ZFYA 4PPBA 4XV3A 3DTCA 3ZO3A 3K3JA 4AXAA 4DEEA 3UQCA 4ORKA 3FUPA 3ZSHA 4TYIA 1KOBA 2ETKA 3QAME 4RVTA 5ACKA 2UZOA 3R8MA 4G31A 3UO4A 3FXZA 1JKSA 4WIHA 4I93A 5FEDA 3VUTA 4IVDA 2GNIA 4D0XA 3G33A 1B6CB 4XHKB 4YTHA 3EFJA 3UO5A 4O2PA 5AP0A 1CKIA 1BMKA 5CQUA 1NVQA 3D0EA 4FNYA 1ZY4A 2JIUA 3R73A 4A4LA 1PXIA 4GG7A 4CZYB 5HG8A 3GBZA 3RPVA 3V5JA 3GC8A 2BRHA 3VN9A 4QTDA 4ACHA 4D5KA 5HVKA 2EB2A 2A2AA 4I21A 4DTKA 3UZRA 4IDTA 3FLYA 4U80A 2WTDA 1OUKA 5AUWA 4BN1A 1O6LA 2W96B 4KB8A 4BTFA 5JK3A 3F66A 2A4LA 3OZ6A 5K4JA 3AT4A 4GMYA 3L9NA 4M12A 3ZBXA 4AZWA 1BL6A 4ERWA 3KGAA 4HVSA 4FT5A 4G17A 2WU6A 5JGDA 5IQCA 3LKMA 3VF9A 2VZ6A 5I9ZA 2R3MA 5IQEA 2QOQA 1WAKA 5AP6A 2FYSA 2YFXA 4ZP5A 1IR3A 5CAQA 3TNPC 4NT4A 1CKJA 2JD5A 4LL5A 4M69B 2R3PA 2YITA 4NZWB 1W7HA 3FMNA 4UXLA 5K4IA 4OBOA 4D2RA 4PDSA 2GCDA 4RJ5A 3D5VA 4WUAA 1G8SA 2VWZA 4XG7A 4I92A 4WG3A 5HHWA 4F1TA 5AR7A 4UMPA 4FJVA 3TIZA 4GT5A 4MNEB 3BEGA 4ITIA 4KRCA 4QP8A 1RDQE 3H9RA 4YNEA 4YMJA 1P2AA 3I0QA 3QWJA 3ZEPA 1BLXA 4ANNA 4EL9A 4ZSJA 4B4LA 2YM6A 3P7AA 4U3YA 4ENXA 3F7WA 5I4NA 3HAVA 2B53A 2YDKA 3CKXA 3AOXA 1WVXA 4O0VA 4Y5QA 1K2PA 4GSBA 3NUNA 3TCPA 4CQGA 4BIDA 5C8NA 3BLHA 5I9YA 4K6ZA 4MXAA 3H4JA 3KC3A 1PMVA 5L3AA 5BUJA 2C6LA 3JVSA 5D12A 3QQFA 2DYLA 4W9WA 4DH8A 3CCNA 5EW9A 3LCOA 1GJOA 2GHMA 4F6UA 4O7SA 3W33A 4BY9E 1M2RA 2B54A 2VRXA 4IANA 4M69A 2WTWA 2FH9A 4JXFA 3VBYA 3PVUA 4K0YA 2W4KA 2W1EA 1H00A 3FZPA 4HGTA 3V5PA 1L8TA 3VWAA 4ZAUA 2XK7A 4QP6A 3WYXA 4TW9A 4JAJA 5CSVA 4D4SA 3E8EA 4YHJA 5DFPA 3T3VA 4O91A 4MWIA 4RJ8A 5LXMA 2C3KA 3BIZA 5KHXA 2JEDA 3A4PA 4S33A 4YBJA 2OH4A 3OROA 4NH1A 4O86A 3QZIA 1FMKA 4QMPA 4BIBA 3KN5A 3LMGA 4HNFA 1ZARA 5KZIA 3GC9A 2Y4IB 2GNLA 3ZUUA 4FTTA 4FIJA 4A9TA 5AA8A 3TYKA 4YZBA 4E5BA 3PDTA 3QX2A 1ZY5A 5A4EA 3TI1A 3R9HA 3LCKA 3FYJX 4U9AA 4DLIA 4IZAA 1GIJA 5IA5A 2WTKC 4J71A 5AIRA 5DT3A 1OI9A 2W1CA 3PE2A 5HO8A 1W84A 2YIRA 5AJQA 5IQHA 1ST0A 4FVRA 3LFEA 5CANA 2HYYA 4D2TA 3TKIA 4C4JA 2VO7A 1DI9A 4G3CA 4AQCA 2ZMDA 4DH7A 5D7AA 5HCZA 4DG0E 3DFAA 2BROA 2X0QA 5C8MA 3KCKA 1E1XA 3R1YA 4GFGA 4CSVA 3ZDIA 4BWPA 4XG4A 3MS9A 2ONLC 3ZH8A 2XZSA 3FSKA 3HNGA 3LQ5A 3W10A 5CEMA 2XNBA 5IQDA 3W32A 1DM2A 4YO6A 1OPKA 4AN9A 2HW7A 3O71A 3QQHA 3NYNA 3F3TA 1OB3A 2JKOA 4ZSGA 1NT2A 3C4ZA 1U5QA 3VQUA 4CCUA 2GQGA 2ZV7A 2R2PA 3QKLA 1PW2A 1NA7A 3FSFA 3P7BA 3ORKA 3BI6A 4G9CA 4CFMA 4F7LA 3SD0A 2W99B 3ZZEA 5KX8A 4FNWA 4O7TA 4LUEA 4D2SA 3CIKA 4QT1A 3ZXTA 3TUBA 4IWQA 3V3VA 4IC7A 4F0IA 1F0QA 2AYPA 4OTDA 2UW9A 4L01A 4YUQA 1YHWA 3A7GA 3C0HA 3FKNA 2C5XA 3BZ3A 5DBXA 3PXFA 3AC4A 3VO3A 3Q4UA 2HWPA 3G51A 4Q5HA 3ZYAA 3D9VA 2YCSA 5HVYA 2UZNA 5J9YA 2OJGA 4WRSA 5H8EA 4EH4A 1B38A 3WOWA 3W16A 4YLLA 5FBNC 2WU7A 3U4WA 4HYIA 5DE2A 1VYZA 1QPCA 4FT9A 2NNWB 5L2SA 4QMXA 3PLAE 3TNQB 3IK3A 4ITJA 4N70A 4OT5A 4YNOA 2CN8A 3KXHA 5HE2A 4FTNA 5CAUA 5D1JA 3P23A 3I5NA 3RM7A 3U6JA 2C6MA 3VS4A 3AD5A 3HP5A 2XK4A 3OEZA 3LE6A 4C3PA 4FA2A 3PLSA 4ID7A 1WBVA 1WBNA 2R4BA 5J9LA 3DY7A 4GVJA 3OUNB 4YZMA 5HO7A 4F7SA 2OLCA 2XKEA 3FJQE 4FV1A 4JQ8A 4DGMA 1XQZA 4PMPA 3AC2A 3H0ZA 4Z3VA 5LQFA 5HEZA 2G15A 4MXZA 2IZSA 4CXAA 2QO2A 3PWDA 5GHVA 4IZ7A 4U5JA 3ZLSA 1OKVA 4G5JA 5CAVA 4DF3A 4AOTA 4C4FA 4DA5A 2OF4A 1OKZA 4A06A 4D9UA 3P86A 1GNGA 2PHKA 5IMXA 4XMOA 2HIWA 4F7JA 2ZAZA 4GUEA 4J7BA 5BYZA 1H28A 2Y8OA 4HGEA 3TL8A 2XBAA 3LJ0A 2GSFA 4J52A 2W7XA 3F2NA 1K9AA 3R02A 1YHSA 4LV8A 4L9IA 1KE8A 2ZB0A 4M97A 4FKWA 1GY3A 4EI4A 4B8MA 4O7YA 4M68A 3PP1A 4EHEA 3FZTA 3OY3A 4X2NA 4BBEA 3FMMA 4EQUA 3AGMA 5ANEA 4IX6A 2QHMA 2CLXA 3GOPA 4AXFA 2I0VA 2QNJA 3IONA 4G6LA 3P08A 2REIA 4E1ZA 5HTCA 3LPBA 5C03A 3SHEA 4AT3A 4PDYA 4C58A 2AUHA 5M4UA 3PXRA 2XK9A 2B4SB 3GNIB 3MIAA 4QTAA 4EK8A 3V5TA 2QURA 5J9ZA 4I5HA 4ONAA 2C4GA 4WSYA 4QEBA 3GQLA 2OXDA 1MRYA 4EH3A 4YZ9A 4JX7A 4ZSAA 3SG9A 4NM7A 2UZVA 4FGRA 3BGQA 4PMMA 3SAYA 3QF9A 3JY9A 4AW0A 3NMUF 2OGVA 4YJTA 4E93A 3KEXA 4F4PA 4GFMA 5DI1A 5HE0A 5IISA 5KMOA 3RI1A 4LV7A 1WCCA 4WHZA 1QPDA 4ACDA 4GUBA 5HBJA 3CSVA 1KE7A 3CTHA 5C9CA 5E8WA 4LOOA 3QGWA 4HGSA 4L3PA 4RQKA 3O50A 3SQQA 3AKJA 4HPUE 3QQLA 4ZSLA 4UMQA 4AE6A 4IJ9A 2Z02A 3CXWA 2C0TA 3IQ7A 5K0XA 5E8ZA 4EWHA 3Q32A 5L2IA 3LM0A 4AAYA 3ZRMA 2YEXA 3ODYX 3LCSA 4FTAA 5EI6A 4CTBA 5LVMA 4PMSA 2XCKA 4F63A 1OUYA 5FBOA 3CD3A 2VO0A 4O0TA 5ANDA 3E8NA 4ASXA 4IAKA 1H0VA 4CEGA 4XOZA 4FYNA 3AT3A 3POOA 2R3GA 3GU5A 4GK3A 4DH5A 2VWUA 3VBXA 3IOKA 3OOMA 3Q9YA 4ERKA 4G3GA 2GFSA 3F3WA 4H58A 5DH3A 4EOMA 4P90A 3C5IA 1H27A 3GFWA 5EM5A 5T6KA 1E9HA 3MI9A 4O4CA 4EK4A 3KA0A 3E3PA 2R3QA 4H1MA 4FG8A 4OR5A 5C26A 4F6WA 3VRYA 1JSUA 2WQBA 4KWPA 5J5TA 2GHLA 3NCGA 4GG5A 1QPJA 5HLPA 4BC6A 3BPRA 4BDJA 3QQKA 2O2UA 2Z7SA 3RM6A 3TDWA 3UDBA 1X8BA 5CU4A 3AC5A 4YJOA 3CJGA 5CSHA 4YHTA 3ZC6A 3I81A 4CT2A 4FGBA 1YI3A 3L9PA 4Q5EA 3QHWA 4YJPA 3VBVA 4AXEA 3ZSGA 5HX6A 1J3HA 1KE9A 4JG6A 5AP3A 1I09A 4BCQA 1MQBA 5KHWA 4BR3A 3GCSA 5CYIA 2NPQA 3VHEA 3W0MA 3OT8A 3WZKA 5CEIA 4EH2A 4C2WA 4RA5A 4RWJA 5C27A 4CKJA 4GL9A 3RP9A 4GK4A 4LFIA 3RZFA 5TKDA 3S1HA 2OWBA 3ODZX 3QCQA 5KKRB 2CHLA 2HZNA 2VU3A 3PZEA 3M2WA 4II5A 3V8SA 3WZUA 3LLAA 3UDSA 3PSBA 3ETAA 4EOIA 4QOXA 1J91A 3UBDA 4FTJA 2PVYA 5LVLA 4FNZA 4GK2A 4XOYA 3R7VA 3WZJA 3OT3A 2UVXA 4I4FA 5BVWA 3FMHA 3GCUA 5DWRA 5A4QA 4LV5A 3UYSA 4IW0A 3CP9A 3QD2B 5H8GA 2VV9A 4Q9SA 4V01A 4C59A 5BVFA 3E88A 3HV5A 4W4VA 5M4CA 2O64A 3FI8A 4QDVA 2PVNA 4YU2A 4AS0A 2WQMA 3PA4A 3ORNA 3QCSA 3RINA 4XUFA 4LGGA 5L6WL 5HZNA 5EYKA 2J7TA 3U4UA 3DZOA 2JITA 1H26A 1CTPE 3EIDA 2YIWA 3SGCA 2OW3A 4M7IA 3ZUTA 3FHIA 4TWOA 1Y91A 3BRBA 1XH8A 3DFCB 4RVLA 2PMOX 3MDYA 4KIKB 5E8SA 3TACA 4MD7E 2OXYA 2WEIA 5A6NA 2UZTA 3RK7A 2W5BA 4D4YA 3QLFA 4EZ3A 5BMSA 2VNWA 2PL0A 5EQPA 4RZWA 5AAGA 4KKGA 5EYDA 3C9WA 3KREA 5CF4A 2GS6A 4YHFA 3TG1A 4EEVA 3EN4A 4O0XA 2BRNA 3RK5A 2QKRA 1U4DA 5ANIA 3C4XA 3A7JA 4G6OA 5EI2A 2B1PA 3TZ9A 4PTGA 5CI6A 3VJOA 3R01A 4C62A 3FLSA 2PZIA 3I7CA 5CF8A 3PXZA 2JIIA 5C4KA 3OWKA 1UKIA 3ZSIA 4EJ7A 2RSVA 3HMOA 3DJ6A 2FSOX 5IDPA 1RW8A 2RFDA 2FUMA 3SOCA 3BQCA 4Y5HA 4W4YA 1DI8A 4ANMA 4BDBA 1TQMA 5EHOA 4KIOA 3T9IA 4E4XA 4IH8A 4W8DA 3TEIA 4KIKA 3VIDA 2OIQA 1TKIA 4CCBA 2ITZA 4AGCA 3DLSA 4IM2A 5K5NA 2UZBA 3A61A 2X9EA 4ITHA 1ZYLA 4WOVA 5CQWA 5FDXA 3BWFA 5HESA 4O21A 1YWVA 4AGDA 2XA4A 3A4OX 3CTJA 3IECA 4RC4A 4E8AA 3D15A 1YXVA 3EHAA 3ERKA 2EXEA 2CKQA 3LFBA 2WMVA 4TYEA 3LFNA 3QQUA 3HMIA 4KINA 1ZRZA 4FX3A 4F1OA 2X0OA 3N9XA 4NU1A 5E9EA 1LR4A 4CKRA 2IG7A 3DS6A 3LIJA 1GZOA 1OVEA 2JKMA 4X3FC 2X7GA 2YAAA 3KN6A 3MH1A 2X0GA 3SW4A 3ZLXA 5ICPA 4XH6A 5J1WA 2RG5A 2UUEA 3BEAA 5TO8A 2YZLA 4DH1A 2YHVA 4DGOA 2YIQA 4PY1A 3ZM4A 3EL7A 3QZHA 3FKOA 1PXKA 3UGCA 1ZOEA 3E8CA 4DT9A 4DFYA 4PL5A 4EC9A 4EKLA 3QC4A 1ATPE 3R9RA 4I3ZA 4O27B 4ZEGA 4FEUA 4I6BA 5D10A 3UZTA 4ZOGA 2P0CA 2Y4PA 2ITQA 1XWSA 2YAKA 1KWPA 3DKFA 3EZRA 4AW5A 3KRJA 3AD6A 2JFLA 3DBEA 4MH7A 5E8YA 3RGFA 3ZCLA 1Q8UA 5ANOA 1SNUA 4ASZA 4GJ3A 3Q9WA 1OKWA 5DRDA 1XBCA 5KE0A 4O0WA 3VW8A 4YJUA 4DEHA 3MVMA 4XG2A 4FSWA 3RAHA 5HBEA 4U8ZA 4XV2A 3WYYA 4JAIA 5DMZA 3ZO4A 4UALA 2OIDA 2GNJA 2R64A 2JAVA 5DG5A 4QTCA 2DS1A 3F5PA 3F82A 2QHNA 4N6YA 4ZLOA 3ID6C 4IDVA 2WMXA 5AV4A 4G16A 2X6EA 2UW3A 5EKOA 3WILA 1WBSA 4EBWA 4E3CA 4M14A 4OTFA 4XG9A 4TNDA 3TT0A 3CD8A 5CNNA 3RALA 4TYGA 2WEVA 2B9HA 1SZMA 2CSNA 3UE4A 5KMKA 2FSMX 2E9UA 1ZYJA 5H8BA 2NYAA 1UNHA 4R7IA 1IEPA 2XK3A 2VX1A 3HV3A 4TWCA 3MW1A 3ROYA 3UVPA 3VAPA 2ZV2A 2IJMA 4BDCA 4OTQA 4RX8A 3ACKA 5FTOA 3I79A 4KBKA 4ANOA 2OZAB 3GT8A 3EKNA 4FF8A 2PVHA 3IW7A 2BTSA 4QP9A 5DIAA 3F9NA 4ENYA 3HV6A 3KXMA 1H1QA 4I5CA 1RQQA 1YHVA 3NUYA 2VTOA 3BYSA 3ENHA 4AA4A 3VULA 3PSCA 4U6RA 4TT7A 2B52A 4C35A 5GJDA 4M84A 4XP0A 2OIBA 3LXKA 3LFAA 5EKNA 4WNOA 4J96A 5CVHA 5FXSA 5CT0A 4R7HA 4FV5A 4UWCA 4UYAA 3ULIA 5HD4A 1H01A 2Y9QA 3CQWA 2YZAA 3S4QA 2Y7JA 5HTIA 5IQGA 2GS2A 2F7XE 4G3EA 4RA4A 4EHZA 4F09A 4BTJA 5JH6A 2NP8A 4G9RA 2GS7A 4I5PA 4O83A 2R0IA 2OO8X 5M08A 3SKCA 2R3NA 3QZGA 4FICA 3IDCA 1OM1A 3OXTA 3VJNA 4P7EA 2PUPA 3QU0A 2G2FA 4JI9A 4KAOA 4GW8A 4J53A 4WA9A 5HD7A 2CCHA 2FGIA 3D7ZA 4PV0A 3BV3A 1WMKA 2OZAA 3JXWA 4G2FA 4FSTA 3FY0A 3DKOA 3QWKA 3R7YA 5AA9A 4ZLZA 3EB0A 4IFCA 4DBXA 2R7BA 3KXNA 3NSZA 3U87A 3NUPA 4QPSA 4RX9A 5TE0A 3H10A 2UW6A 3QRUA 3MESA 2OBJA 2C6KA 3KRRA 3R7OA 3R7IA 3AMAA 3W8QA 4OBPA 3RZBA 1YOJA 2BIYA 3ZS5A 2YDIA 2QCSA 1UKHA 3AC8A 2BKKA 2NO3A 4TZRA 4V0GA 3VS0A 3GCQA 2VO6A 1ND4A 4S2ZA 4FL2A 2OFUA 4ZTSA 4IHPA 2Q83A 3QXOA 4L45A 3NEWA 3H0YA 2VX0A 2B0QA 3TJDA 3BGZA 2DUVA 4XS2A 4C37A 3MA6A 5ANGA 4FKOA 4JVGA 4I22A 4O7WA 2GMXA 2P3GX 3FV8A 2VO3A 4ANSA 3CJFA 3BHHA 3ORTA 3ORXA 4CZUA 2VX3A 3ZEWA 3FXXA 2BPMA 3TNHA 3QKMA 3O51A 2X8EA 2Y0AA 4EH7A 4RWIA 4WSQA 1YOLA 4FT0A 4NIFB 3ZOSA 1XH7A 4LGHA 4M67A 4AZFA 1CDKA 3OXZA 4YTIA 4MBLA 4IMYA 4R1VA 4YBKA 3Q2JA 2EWAA 1PXMA 4FV7A 1HCLA 2XALA 3F7ZA 1R0EA 2O65A 3KRWA 3L8PA 3LW0A 5BMMA 4AN2A 1RJBA 5JMSA 2PWLA 4QQCA 4E5AX 2HW6A 1I44A 1S9IA 2B9JA 3QRJA 3POZA 4K33A 4L52A 4YPSA 4JQEA 1Q61A 4FKLA 5ETIA 4M13A 3DNEA 4D9TA 3GU4A 1KE6A 4FZFB 4WG5A 1ZZLA 1WBOA 2ITNA 4IACA 4S32A 3ROCA 3FC2A 3HMNA 3NWWA 3RMFA 1SVHA 4EH6A 3R1SA 5KMIA 1Q62A 2WTCA 2C1BA 4ALVA 1G8JA 4XNEA 1CM8A 1XMLA 2BHEA 3BE2A 4IB0A 4BZOA 4PTEA 4L7FA 4DHIB 2FB8A 3VS5A 3BYVA 3UOKA 3ZHPC 3ZXZA 1A48A 4YSMA 2CNUA 4D1SA 5IQAA 2UZLA 3FI3A 4NIFA 4QYHA 2IVUA 3MJ2A 5JKGA 1OPLA 4UY9A 3ENMA 4PP7A 3KMWA 2HZIA 4U7ZA 4O7LA 5H9BA 1TQIA 4FKRA 3GEQA 1FOTA 3FWQA 4RX7A 5AUVA 5C4LA 2YWVA 1H25A 4BHZA 2A27A 4K18A 4CT1A 3D2KA 4K9YA 1OL1A 1OITA 3PA3A 3QD0A 3Q3BA 4H39A 3DK6A 5BVKA 3UTOA 3I7BA 4MKCA 2IW6A 3G90X 4PMTA 3RAWA 2QOCA 3SDJA 4TWNA 5ETFA 4BTKA 3PXQA 4I6QA 3AC3A 4FSUA 3W2OA 3AKKA 4QRCA 4JS8A 4BVUA 4JG8A 4LQMA 3VUKA 2W4JA 2YM3A 4MBIA 3OCTA 4U44A 4O82A 1IASA 3CGOA 4IWPA 4CNHA 3RBWA 5HICA 2XEYA 4EOQA 3MA3A 1XBBA 3PFQA 5JRSA 1IAHA 5E1EA 2H8HA 5HU3A 2IPXA 2QLQA 4ACCA 3U54A 2J5FA 3FLQA 2WFYA 2W1HA 3DDPA 4MEDA 3P79A 1PYXA 3RJCA 4U81A 4FODA 4JNWA 3DJ7A 3B8RA 3NZ0A 3QTUA 3OWJA 2IWIA 2ITXA 4NKSA 2X7OA 5ACBC 3DV3A 4UX9A 4JR3A 1REKA 3WIKA 2JFMA 3MPAA 3LXNA 1JBPE 1O6YA 3MPMA 3QZFA 4NM0A 4UWBA 3UQGA 1VR2A 4GFOA 4RRVA 2G1TA 2VTMA 5KZ0A 5DA3A 3SC1A 4CLIA 3IW8A 4U41A 3CS9A 1OZ1A 2UV2A 3PIXA 3GENA 4QQJA 2IVVA 2QKWB 1IG1A 2YLFA 4C36A 4ZTQA 4I94A 4F9AA 4FSMA 3VRZA 4DG2E 4FI1A 4FR4A 5KBQA 4CV9A 3NNUA 4FSYA 2R3IA 4BCMA 3QGYA 4FKJA 4F0FA 4ZS4A 3IS5A 2WAJA 5DEYA 3PSDA 5HO6A 3W0OA 4QMVA 2W1GA 3HP2A 5DNRA 2HZ0A 3MH0A 4L43A 5L8KA 3FPMA 2JAMA 2W4OA 4FMQA 4LM5A 2QOLA 2QODA 3OCGA 3PJ2A 3C51A 3LMIA 3LJ1A 1XMMA 3IOPA 1R1WA 5BVEA 1ST4A 1Q41A 3C4FA 5AM7A 4FT3A 4GEOA 2CGXA 3EWHA 4FVPA 4RJ4A 4TY1A 1XH5A 4L67A 5HKMA 5BX0A 3MFUA 4FIFA 3ZRLA 3NPCA 2ESMA 4HZSA 4IB1A 2A98A 3T8OA 2ETRA 3VVHA 3WF8A 4YPDA 2BDWA 4CFUA 3BWJA 4E73A 4RIYB 2J5EA 2VGOA 3C4CA 3F3ZA 5AR8A 3WARA 4A9RA 1UU7A 3VW6A 3F5UA 4QMQA 2GQRA 1G5SA 4MXXA 5J7HA 5DVRA 4OTRA 3FL4A 3K54A 4FEXA 3NX8A 2VNYA 2WO6A 2QOBA 2BZJA 4R5YA 4C4HA 5FQDC 2C3LA 4BCJA 3FHRA 4YJSA 4G1WA 4UZDA 2X8IA 2YCQA 4RJ7A 3DBQA 3WBLA 2OI4X 2WQEA 3OY1A 4L44A 5J1VA 3UZPA 1LUFA</