5CIRE

Crystal structure of death receptor 4 (dr4; tnffrsf10a) bound to trail (tnfsf10)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
102
structure length
102
Chain Sequence
GELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSTGCPRGMVKVKDCTPWSDIECV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the death receptor 4-TNF-related apoptosis-inducing ligand (DR4-TRAIL) complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Tumor necrosis factor ligand superfamily member 10
total genus 13
structure length 102
sequence length 102
chains with identical sequence F, G
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00020 TNFR_c6 TNFR/NGFR cysteine-rich region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.10 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A, domain 2 5cirE01
2.10.50.10 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A, domain 2 5cirE02
3THMF 1D4VA 1FT4A 1ZA3R 3WVTA 4OD2S 1DU3A 4M4RA 3QO4A 3U3TA 5IHLA 5DMJA 3K51B 3QD6R 4M4PA 3ME2R 4GIQR 3U3QA 2HEVR 4BK5A 1JMAB 3ALQR 2H9GR 4KGGC 3MHDD 4MXWR 3IJ2X 3U3SA 5CIRE 3MI8D 3MBWA 5BNQR 4J6GC 2UWIA 4N90R 4BK4A 3QBQB 3BUKC 4KGQC 1EXTA 1D0GR 3X3FA 1SG1X 4YN0A 4I9XC 4FHQA 3ME4A 4MSVB 1NCFA 2HEYR 5L36B 3FL7A 2AW2B 3TJEF 3U3VA 2X10A 4E4DR 4RSUD 1TNRR 3U3PA 3URFZ
chains in the Genus database with same CATH superfamily
3THMF 1D4VA 1FT4A 1ZA3R 3WVTA 4OD2S 1DU3A 4M4RA 3QO4A 3U3TA 5IHLA 5DMJA 3K51B 3QD6R 4M4PA 3ME2R 2E4WA 2E4XA 2HEVR 4GIQR 1JMAB 3U3QA 4BK5A 2H9GR 3ALQR 2E4YA 2QR6A 3MHDD 4KGGC 4MXWR 3IJ2X 3U3SA 5CIRE 3MI8D 3MBWA 5BNQR 4J6GC 2UWIA 4N90R 4BK4A 3QBQB 3BUKC 4KGQC 1EXTA 1D0GR 3X3FA 1SG1X 4YN0A 4I9XC 2E4VA 4FHQA 3ME4A 4MSVB 1NCFA 2HEYR 5L36B 2E4UA 3FL7A 2AW2B 3TJEF 3U3VA 2X10A 4E4DR 4RSUD 1TNRR 3U3PA 3URFZ
chains in the Genus database with same CATH topology
3THMF 1D4VA 1FT4A 1ZA3R 3WVTA 4OD2S 1DU3A 4M4RA 3QO4A 3U3TA 5IHLA 5DMJA 3K51B 3QD6R 4M4PA 3ME2R 4GIQR 3U3QA 2HEVR 4BK5A 1JMAB 3ALQR 2H9GR 4KGGC 3MHDD 4MXWR 3IJ2X 3U3SA 5CIRE 3MI8D 3MBWA 5BNQR 4J6GC 2UWIA 4N90R 4BK4A 3QBQB 3BUKC 4KGQC 1EXTA 1D0GR 3X3FA 1SG1X 4YN0A 4I9XC 4FHQA 3ME4A 4MSVB 1NCFA 2HEYR 5L36B 3FL7A 2AW2B 3TJEF 3U3VA 2X10A 4E4DR 4RSUD 1TNRR 3U3PA 3URFZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THM F;  1D4V A;  1FT4 A;  1ZA3 R;  3WVT A;  4OD2 S;  1DU3 A;  4M4R A;  3QO4 A;  3U3T A;  5IHL A;  5DMJ A;  3K51 B;  3QD6 R;  4M4P A;  3ME2 R;  4GIQ R;  3U3Q A;  2HEV R;  4BK5 A;  1JMA B;  3ALQ R;  2H9G R;  4KGG C;  3MHD D;  4MXW R;  3IJ2 X;  3U3S A;  5CIR E;  3MI8 D;  3MBW A;  5BNQ R;  4J6G C;  2UWI A;  4N90 R;  4BK4 A;  3QBQ B;  3BUK C;  4KGQ C;  1EXT A;  1D0G R;  3X3F A;  1SG1 X;  4YN0 A;  4I9X C;  4FHQ A;  3ME4 A;  4MSV B;  1NCF A;  2HEY R;  5L36 B;  3FL7 A;  2AW2 B;  3TJE F;  3U3V A;  2X10 A;  4E4D R;  4RSU D;  1TNR R;  3U3P A;  3URF Z; 
#chains in the Genus database with same CATH topology
 3THM F;  1D4V A;  1FT4 A;  1ZA3 R;  3WVT A;  4OD2 S;  1DU3 A;  4M4R A;  3QO4 A;  3U3T A;  5IHL A;  5DMJ A;  3K51 B;  3QD6 R;  4M4P A;  3ME2 R;  2E4W A;  2E4X A;  2HEV R;  4GIQ R;  1JMA B;  3U3Q A;  4BK5 A;  2H9G R;  3ALQ R;  2E4Y A;  2QR6 A;  3MHD D;  4KGG C;  4MXW R;  3IJ2 X;  3U3S A;  5CIR E;  3MI8 D;  3MBW A;  5BNQ R;  4J6G C;  2UWI A;  4N90 R;  4BK4 A;  3QBQ B;  3BUK C;  4KGQ C;  1EXT A;  1D0G R;  3X3F A;  1SG1 X;  4YN0 A;  4I9X C;  2E4V A;  4FHQ A;  3ME4 A;  4MSV B;  1NCF A;  2HEY R;  5L36 B;  2E4U A;  3FL7 A;  2AW2 B;  3TJE F;  3U3V A;  2X10 A;  4E4D R;  4RSU D;  1TNR R;  3U3P A;  3URF Z; 
#chains in the Genus database with same CATH homology
 3THM F;  1D4V A;  1FT4 A;  1ZA3 R;  3WVT A;  4OD2 S;  1DU3 A;  4M4R A;  3QO4 A;  3U3T A;  5IHL A;  5DMJ A;  3K51 B;  3QD6 R;  4M4P A;  3ME2 R;  4GIQ R;  3U3Q A;  2HEV R;  4BK5 A;  1JMA B;  3ALQ R;  2H9G R;  4KGG C;  3MHD D;  4MXW R;  3IJ2 X;  3U3S A;  5CIR E;  3MI8 D;  3MBW A;  5BNQ R;  4J6G C;  2UWI A;  4N90 R;  4BK4 A;  3QBQ B;  3BUK C;  4KGQ C;  1EXT A;  1D0G R;  3X3F A;  1SG1 X;  4YN0 A;  4I9X C;  4FHQ A;  3ME4 A;  4MSV B;  1NCF A;  2HEY R;  5L36 B;  3FL7 A;  2AW2 B;  3TJE F;  3U3V A;  2X10 A;  4E4D R;  4RSU D;  1TNR R;  3U3P A;  3URF Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...