5CIVA

Sibling lethal factor precursor - dfsb
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
169
structure length
169
Chain Sequence
EYTSKEELKKTIHAAYLLLDGEFEGIDDSQKDNRVPEVDRTPAEIIAYQLGWLHLVMGWDRDELAGKPVIMPAPGYKWNQLGGLYQSFYAAYADLSLTELRRLFRDTERQWLDWIDTLSEEDLFTQSVRKWTGDKPNWPMARWIHINSAAPFKTFRAKIRKWKKHQRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sibling bacteriocin
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
source organism Paenibacillus dendritiformis
molecule tags Unknown function
total genus 68
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2015-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5civA00
5COMA 2YQYA 3GORA 2NSGA 3DI5A 2HKVA 2RD9A 2QNLA 5COGA 4N6CA 5CIVA 3DKAA 2P1AA 3QTHA 5COFA 2OU6A 2OQMA 2QE9A 3CEXA 2F22A 2NSFA 1RXQA
chains in the Genus database with same CATH superfamily
5COMA 2XLDA 3C8GA 5JUAA 2BL2A 3ZQYA 3PDMP 3B71A 2V26A 5A6BD 1YARO 2A6EF 4I44A 1ZU4A 1YYJA 1WATA 5K0IA 1Q0KA 2XLEA 1RJ9A 3L8IA 5A69A 2H8AA 2MWQA 1T6IA 3QZCA 1TWAA 2O9XA 3SYNA 2HUJA 3RFYA 2HJ3A 4N6CA 4YWQA 3KPHA 4U5GA 3K1IA 2GWWA 3DWWA 1MMNA 2LD6A 2MHRA 3QMKA 4Z9IA 2EPKX 2R9RB 3E9VA 2GA0A 4F4BA 4BEMJ 4DRHB 1J8MF 5BQGA 4CIHA 3TOLA 2YLDA 1Y6DA 1MMGA 2A0BA 2LSEA 2MYSA 2KYHA 3I5PA 4CIPA 2F22A 4GYTA 4CS8C 5L0FA 2OG2A 4CDVA 2EIMC 1NFNA 2LFDA 3HNIA 2EIKC 3HNKA 5JLIA 3GORA 4U5CE 3ZWIA 2R7QA 4RDAA 1E83A 1KNYA 3U9JA 3DAFA 2XL6A 4CDAA 2J9UA 1OR2A 5DQTA 3SZRA 3SXMA 1T9KA 3G50A 1WOLA 3VF0A 3AJMA 1VLTA 3K33A 2ZXOA 4AE4A 2EILC 2CCYA 3JSEO 3W8IA 2P61A 1Q0MA 1C03A 1CPQA 1D1CA 1G8XA 3JZ0A 4K1OA 4KNVA 3GWNA 3H65A 3K6BA 4YJWA 4DBRA 1K05A 1NG1A 3VM6A 3U0CA 2KK1A 2Q9CA 1PD0A 4KC9A 3WODF 3RW0A 3CEXA 4C3BA 2NUTB 4MTOA 3WHNA 1HY5A 2C04A 4JRZA 4E7SA 5HV9A 1RKEA 2W45A 2J0XA 4J7TA 4JCZA 1Q0FA 1ORJA 3CSKA 4JE9A 4O7GA 5E33A 1NLXA 4W8PA 2YQYA 3OA1A 1NZEA 2XM0A 2NUPB 2KSFA 3C8GD 3LESA 3HTKC 1AVOB 1FTSA 2D4UA 3T6GB 2L6FA 3ABLC 4QI0A 4U5BE 1OXBA 2RD9A 3EZHA 3GEIA 5KYXB 1A7DA 2Q4FA 1MNEA 1LPEA 2VASA 2R7OA 3M1CB 4EKWA 4IRUA 4LDRA 1QKRA 3EG9A 3DE8A 3POVA 1QVXA 1QLEC 1XZPA 2X0CA 4U5DE 2VH3A 3X2QC 2JX0A 2OQMA 3EGDB 1FNTc 1FMWA 2DYSC 3SEOA 3FAPB 4W8KA 3UMKA 4LDKA 2EPMX 4Q7CA 4A2NB 4BJ6C 1PCXA 1BR1A 4IWBA 4PK4A 3RQFA 4DVZA 5B3SC 1BZ4A 5L0DA 5KYNA 1B68A 1LS1A 1ORYA 1PV3A 2ZXWC 3FOPA 1YDIA 2ZPAA 3B29A 4A4AA 5A6BA 2LCHA 2J9BA 1ZW2A 2G3KA 2L9JA 3OWTA 2Q9AA 4MTFA 3R7CA 3W2WA 3C7JA 4YK5A 2H7VC 4AX2A 4BPMA 2XL8A 4P9FA 3BRJA 3EH2A 1O3UA 1OCOC 3EHNA 2HS5A 4C3EA 4Z9JA 3T6JA 5E2QA 1HW1A 1Z3IX 2PP4A 1NBBA 2XLMA 2KC3A 3KKBA 4JKVA 1OCCC 1Z23A 4JCHA 3DKAA 4XEVA 3SXKA 1Q0GA 2FGYA 1FR0A 2YHSA 5D92A 1K40A 4BJ1A 2G3VA 3LNMB 1ST6A 1AEPA 1WTYA 5FZTA 2EPNA 1ZHYA 5AGFA 3K1HA 1EQ1A 4PACA 3VYWA 3JRMO 1HW2A 3NDBB 3ITFA 2YL1A 3SNHA 3SXYA 4XLNF 1JR8A 5KYWA 1LE2A 4E0HA 4MVOA 1VK5A 3L34A 2YZSA 4JTAB 1VOMA 3RKOF 4JVSA 4LACB 3HLZA 2IXPA 1JPJA 5HSWA 1GS9A 1IW7F 1D0YA 2JPUA 1TKNA 1U6HA 2WZGA 2EINC 2XLWA 3GM3A 3NKDA 3U3FA 4X0RA 1EA8A 4AE4B 2HSQA 3DE9A 4MVMA 1SZIA 3LLKA 2IXNA 2ZXPA 3B0VC 4CSAA 2R7XA 2OJED 4XTKA 4U5FE 1Q0DA 1WGWA 2PNOA 2WVOA 3ZTMA 4BEJA 3JYYA 4UDVA 4XQ1A 4DRJB 3RVYA 4O6MA 1RKEB 1WASA 1KU2A 2JD3A 3N24A 3S90A 1VLSA 3L1MA 2NG1A 2X51A 1TWHA 2XLHA 1D0ZA 3I4UA 4BJTA 1Z63A 4WGYA 1HE1A 3ABMC 2W9YA 3US6A 2L7AA 4B6IA 4U9EA 3S9OA 2OOCA 2HJMA 1L3PA 1QSPA 2J7PA 3KH2A 1LE4A 4MVQA 3NRHA 2IYLD 5DVWA 1Z7Qc 3R2PA 3J06A 2DI3A 3AOUA 1LI7A 1YJGA 2DYRC 4D4XA 1NSGB 4JC7A 1SYQA 3EG9B 5CIVA 2GFHA 2Y39A 3UGOA 3DJNB 1O87A 1CPRA 3IQ5A 2IBFA 4XPYA 3QTHA 4C7OA 3CAXA 4ULVA 3EFOB 2H7BA 3M4BA 3O6XA 1LI5A 2BC5A 4Z9HA 3DM5A 5DS5A 3NYJA 3B0PA 3U2LA 1E85A 2W4MA 3GEEA 1LIHA 3PHF2 1GQAA 3FHDA 3FVYA 3EPVA 2KJGA 2VCAA 4N06A 3DZAA 3G4ZA 5F28E 2Q7RA 3RVZA 2Y69C 4N6HA 3L8JA 2Q3TA 2R7TA 3RH3A 3C63A 4BJ5C 2HV6A 3JYHA 4OIRF 2R7SA 4I3MA 5DLJA 3ZQVA 4BG0A 5L0JA 3F46A 2OJQA 4CS9A 4PFOA 5DQZA 1FMVA 1EI7A 3JSZA 5D91A 2PFDA 1OQCA 2W4BA 3IPMO 4YT5A 2KW3C 4E18A 4NY3A 3TD7A 4YT8A 2QUPA 1HE9A 2I8BA 1MNDA 3ASNC 3GM1A 3JT1A 3T4RA 3EGXA 1RMVA 1CGME 2ETSA 3A11A 2AWCA 5AC4A 1H9GA 1C17M 3ASOC 3GM2A 3Q7LA 1G4US 4J30B 3S29A 1D0XA 5JVEA 2V3CC 4ZLDA 1QZXA 2XLOA 3QVYA 4R32A 3IQTA 4ONSA 1OR3A 1F1MA 3TOMA 3EJNA 4O6YA 4EBJA 5A6JA 2AU5A 1I4YA 1NFOA 2KQ9A 2XS8A 2YLIA 4IJJA 5JS5A 4YL3A 4EHPA 2J7PD 2QNLA 2VC9A 5DS6A 5EHHA 3M79A 3V7OA 4P9TA 3C62A 2YWAA 2YL3A 3IHUA 4JEBA 4JZAA 4PJLA 4NTAA 5FCLA 3KMIA 5L0IA 2L81A 1I5NA 1A7EA 5KYYB 3UR3C 1E84A 3DAGA 2OU6A 1YZCA 4H4KC 2ZXRA 4H54A 3C8ZA 1ZHWA 1R4TA 4JTCB 1OCRC 2LK4A 4GQHA 3KYIA 2YLGA 2HSBA 3LLIA 3RQGA 1FFTC 1OW8A 3C8GB 1Y4CA 4G7OF 1WWPA 2Q9BA 3NMIA 1OKKA 4EUKB 1ZZPA 2ICWG 1V55C 2XL4A 5JT4A 1LS4A 4EBBA 2HZ8A 1U0BB 3DD7A 3S84A 1RJ9B 2J9WA 3H2VA 4JJFA 4L6RA 5L0GA 1E86A 3RQEA 3H2UA 3FMSA 5JRAA 3ZG1A 4PJNA 2NPUA 1VMAA 2M64A 3E70C 5GPGB 1JAFA 2R02A 1UG7A 2UUHA 3AQCA 3G4XA 1TWGA 4NTBA 4PR9A 1HMDA 4JEAA 1BR4A 3K1IC 4CS8A 1TQGA 4LLCA 2A69F 2B0HA 3X1OA 5TJ5E 4EIYA 3L0IA 2R05A 2GDCA 4O79A 3PCVA 2WZLA 4XEFA 1TR2A 3HKKA 5A6AA 2R03A 3EH1A 3EZIA 5L0CA 3ZC4A 2PBEA 2Q00A 4NQFA 2YVKA 3BEHA 4EWCA 5B3IA 3U8PA 1A7VA 1OW6A 2IOQA 1TWCA 4OIQF 2I15A 1LM3B 1PD1A 1LVKA 3TJ5A 4QDLA 3FDQA 4PJJA 2WL8A 1ZVZA 1D1BA 3CQZA 5CI9A 1VYKA 1BBHA 4NTFA 5E3AA 4XLPF 1ZHXA 3DXJF 4CJOA 2XXAA 3NYMA 2C03A 4AK9A 1Z5ZA 3AG3C 3HNLA 4U5HA 2M4EA 5E3CA 5COFA 4HE8D 3V5ZA 2R7UA 2WZFA 3LS0A 4XWJA 3N2ZB 2Y3DA 1G4WR 1M2VA 2EPOA 4J7YA 4RBNA 1JPNA 1J8YF 1FAPB 2Y3HA 2Z15A 2A6HF 2ZD9A 3O10A 2G62A 3LAYA 2KGOA 2P0NA 4E7ZA 2FFHA 4AL1A 2PX0A 2L6HA 3Q7GA 2HV7A 3JCUQ 2J46A 3S0XA 2NUPA 3Q6MA 4HFFB 5B1BC 4OINF 2EIJC 3FOOA 2R25A 2Y3GA 4ZLCA 4YL1A 4I1MA 2NSGA 3ABKC 3GWLA 4K0DA 1L7CA 2GAQA 3DI5A 1OKKD 4WGZA 5KYXA 4G0HA 1ZU5A 3HJCA 2CYDA 5COGA 2E87A 4OIPF 4DOZA 3TQOA 1GGQA 3UMHA 3MFNA 5T3WA 4BJ6A 2LIGA 2CDQA 3EGDA 3AGTA 3RYLA 1A0BA 3AG2C 1K04A 3AGUA 1OCZC 3UNGC 1VTMP 2R7VA 1HMOA 2OCCC 2QE9A 1SF8A 4J32B 4IGGA 4WJ0A 1S7ZA 1H9TA 1RXQA 2YL7A 4DVYP 3ATPA 2EPLX 5KYUA 4ANJA 1BR2A 4RD9A 1BDJB 3LUTB 3DM9B 2WVQA 3W8HA 3FAJA 1NU7D 3NMJA 3LS1A 3U2MA 4OD5A 1AUEA 4NCQA 3S28A 2A1DD 2RSEB 4MW8A 1D1AA 4E0IA 4JJGA 1W2WA 1ZHTA 2XLVA 2CGEA 3HNJA 3MX3A 2VB6A 2ASRA 4CDYA 3B9QA 1CGOA 4MTGA 4NC3A 5BUOA 5L0HA 2CNWA 2IM8A 3W4YA 2TMVP 4JIOA 4M63A 5L3QA 1T5OA 1YA7O 1T6QA 2P1AA 4DXWA 5F5FA 4HEAJ 1VYIA 1FFHA 3RIPA 2B0JA 2YEVA 1A41A 4Q4ZF 2PF4E 1H6GA 3IQCA 1ZYRF 3QW0A 3SP1A 4YL0A 2NSFA 1RCPA 1XZQA 1YYXA 2YRFA 3LEVA 3M15A 3NMKA 4LERA 3QVZA 4PFPA 4U5EE 4E17A 1M2OA 3NYLA 4XPWA 1M57C 1ORSC 1N1CA 3TJ6A 3U9MA 2XS1A 4FX5A 3ECSA 3MYFA 4IAQA 1Z6AA 2KNHA 4PJMA 1ZHZA 5KYWB 1WN0A 1ZW3A 1YAUO 4D4NA 4K7BA 1JMWA 3B0UX 1M6TA 2WVNA 1RKCA 2XXAB 1VB5A 3JTLO 3CZ6A 3Q6NA 5F5HA 4KNWA 3U5SA 3U3BA 2HMQA 1NU9C 3ZSUA 3EHMA 2HFIA 3IEEA 4G78A 1DOVA 4CSAC 4IAOA 1M2VB 2AWYA 4HFKB 4LLEA 2H7OA 2OKUA 1V4AA 3AG4C 4JTDB 4MS2A 1UFBA 3MBGA 4MVSA 4MVRA 1OXKA 4P6IC 5JSLA 3VAYA 2CW0F 3KYJA 2PX3A 3C18A 4U9DA 2A68F 3V5YA 4YN0B 4QI2A 2QLAA 1CGNA 3M4CA 1JOGA 1T6UA 1QPUA 4WABA 4G7HF 4G7ZF 2UUIA 4DRIB 4JURI 4AL0A 1YVIA 3ZDLA 2HKVA 2QY9A 4LDQA 4XEKA 4XPXA 1TFKB 3AG1C 2J45A 3UGPA 3K66A 3TK0A 3S27A 256BA 1V54C 1APCA 3IQ6A 5DS4A 3ZVRA 2CNWD 1U89A 1SR2A 4C7OB 3GEHA 3EFOA 3K7DA 4FESA 2VCBA 4ER9A 3ZIBA 2Y3BA 1M56C 1I4ZA 4OD4A 2DB4A 2R7WA 2BE5F 2WB7A 1MMAA 2XSEA 4CBEA 5KYUB 4JW1A 1SMYF 2J9VA 3OEOA 4DJ9A 4MQ9F 3WG7C 2L6GA 3N0TA 5JP7A 4N4WA 4BJ5A 4YT4A 4I1OB 3EQLF 2LQGA 3F47A 1IZMA 3FXHA 3LJBA 4MW3A 5CI8A 4C3DA 3LEOA 3MLGA 3TULA 2LP4A 2P6VA 1DOWA 4O6NA 3LNRA 2XRHA 3NKEA 1GM5A 1EKYA 3V5XA 1YA9A 4KBLA 1G5ZA 3VRCA 4CS9C 1S05A 1YLMA 2QTVA 4CX9A 4Q5SF 3GANA 3QW1A 2R7RA 5IY5C 1C02A 4MVUA 2J8WA 3GODA 4IB4A 3NG1A 2YKZA 1LKXA 2NUTA 3O39A 1TFOB 1R5ID 2YL0A 3EGXB 1O5HA 5BQIA 1QQ3A 4MVZA 3ZTZA 3MYIA 3DJUB 3PMRA 2P7VA 2AP3A 4FWVA 4ULWA 4YT2A 4OIOF 2OEXA 4GEHA 2DGJA 3U8VA 2IXOA 2VCCA 3DMDA 3T6BA 4EBKA 5L3VA 3T9OA 1E2XA 1JRAA 3W2VA 2XM4A 5AC5A 1V74B 3RF3A 1OW7A 4CJGA 4DBQA 2HMZA 3I5QA 3KL4A 1T01A 2LFFA 1YZAA 1XWJA 3O55A 3AQBA 2J0WA 5KYYA 3SXZA 5EK0A 5T3TA 1MMDA 4FAPB 1H7IA 2AVKA 5EGYA 5BQHA 4KI2A 4CS7A 3A9CA 5A6KA 2D5RB 3UMIA 4MNDA 1KTMA 3JRTA 2FAPB 4IARA 1MQVA 5B1AC 3WAQA 2A0UA 5T1DB 2IXMA 2OEVA
chains in the Genus database with same CATH topology
5COMA 2YQYA 3GORA 2NSGA 3DI5A 2HKVA 2RD9A 2QNLA 5COGA 4N6CA 5CIVA 3DKAA 2P1AA 3QTHA 5COFA 2OU6A 2OQMA 2QE9A 3CEXA 2F22A 2NSFA 1RXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COM A;  2YQY A;  3GOR A;  2NSG A;  3DI5 A;  2HKV A;  2RD9 A;  2QNL A;  5COG A;  4N6C A;  5CIV A;  3DKA A;  2P1A A;  3QTH A;  5COF A;  2OU6 A;  2OQM A;  2QE9 A;  3CEX A;  2F22 A;  2NSF A;  1RXQ A; 
#chains in the Genus database with same CATH topology
 5COM A;  2XLD A;  3C8G A;  5JUA A;  2BL2 A;  3ZQY A;  3PDM P;  3B71 A;  2V26 A;  5A6B D;  1YAR O;  2A6E F;  4I44 A;  1ZU4 A;  1YYJ A;  1WAT A;  5K0I A;  1Q0K A;  2XLE A;  1RJ9 A;  3L8I A;  5A69 A;  2H8A A;  2MWQ A;  1T6I A;  3QZC A;  1TWA A;  2O9X A;  3SYN A;  2HUJ A;  3RFY A;  2HJ3 A;  4N6C A;  4YWQ A;  3KPH A;  4U5G A;  3K1I A;  2GWW A;  3DWW A;  1MMN A;  2LD6 A;  2MHR A;  3QMK A;  4Z9I A;  2EPK X;  2R9R B;  3E9V A;  2GA0 A;  4F4B A;  4BEM J;  4DRH B;  1J8M F;  5BQG A;  4CIH A;  3TOL A;  2YLD A;  1Y6D A;  1MMG A;  2A0B A;  2LSE A;  2MYS A;  2KYH A;  3I5P A;  4CIP A;  2F22 A;  4GYT A;  4CS8 C;  5L0F A;  2OG2 A;  4CDV A;  2EIM C;  1NFN A;  2LFD A;  3HNI A;  2EIK C;  3HNK A;  5JLI A;  3GOR A;  4U5C E;  3ZWI A;  2R7Q A;  4RDA A;  1E83 A;  1KNY A;  3U9J A;  3DAF A;  2XL6 A;  4CDA A;  2J9U A;  1OR2 A;  5DQT A;  3SZR A;  3SXM A;  1T9K A;  3G50 A;  1WOL A;  3VF0 A;  3AJM A;  1VLT A;  3K33 A;  2ZXO A;  4AE4 A;  2EIL C;  2CCY A;  3JSE O;  3W8I A;  2P61 A;  1Q0M A;  1C03 A;  1CPQ A;  1D1C A;  1G8X A;  3JZ0 A;  4K1O A;  4KNV A;  3GWN A;  3H65 A;  3K6B A;  4YJW A;  4DBR A;  1K05 A;  1NG1 A;  3VM6 A;  3U0C A;  2KK1 A;  2Q9C A;  1PD0 A;  4KC9 A;  3WOD F;  3RW0 A;  3CEX A;  4C3B A;  2NUT B;  4MTO A;  3WHN A;  1HY5 A;  2C04 A;  4JRZ A;  4E7S A;  5HV9 A;  1RKE A;  2W45 A;  2J0X A;  4J7T A;  4JCZ A;  1Q0F A;  1ORJ A;  3CSK A;  4JE9 A;  4O7G A;  5E33 A;  1NLX A;  4W8P A;  2YQY A;  3OA1 A;  1NZE A;  2XM0 A;  2NUP B;  2KSF A;  3C8G D;  3LES A;  3HTK C;  1AVO B;  1FTS A;  2D4U A;  3T6G B;  2L6F A;  3ABL C;  4QI0 A;  4U5B E;  1OXB A;  2RD9 A;  3EZH A;  3GEI A;  5KYX B;  1A7D A;  2Q4F A;  1MNE A;  1LPE A;  2VAS A;  2R7O A;  3M1C B;  4EKW A;  4IRU A;  4LDR A;  1QKR A;  3EG9 A;  3DE8 A;  3POV A;  1QVX A;  1QLE C;  1XZP A;  2X0C A;  4U5D E;  2VH3 A;  3X2Q C;  2JX0 A;  2OQM A;  3EGD B;  1FNT c;  1FMW A;  2DYS C;  3SEO A;  3FAP B;  4W8K A;  3UMK A;  4LDK A;  2EPM X;  4Q7C A;  4A2N B;  4BJ6 C;  1PCX A;  1BR1 A;  4IWB A;  4PK4 A;  3RQF A;  4DVZ A;  5B3S C;  1BZ4 A;  5L0D A;  5KYN A;  1B68 A;  1LS1 A;  1ORY A;  1PV3 A;  2ZXW C;  3FOP A;  1YDI A;  2ZPA A;  3B29 A;  4A4A A;  5A6B A;  2LCH A;  2J9B A;  1ZW2 A;  2G3K A;  2L9J A;  3OWT A;  2Q9A A;  4MTF A;  3R7C A;  3W2W A;  3C7J A;  4YK5 A;  2H7V C;  4AX2 A;  4BPM A;  2XL8 A;  4P9F A;  3BRJ A;  3EH2 A;  1O3U A;  1OCO C;  3EHN A;  2HS5 A;  4C3E A;  4Z9J A;  3T6J A;  5E2Q A;  1HW1 A;  1Z3I X;  2PP4 A;  1NBB A;  2XLM A;  2KC3 A;  3KKB A;  4JKV A;  1OCC C;  1Z23 A;  4JCH A;  3DKA A;  4XEV A;  3SXK A;  1Q0G A;  2FGY A;  1FR0 A;  2YHS A;  5D92 A;  1K40 A;  4BJ1 A;  2G3V A;  3LNM B;  1ST6 A;  1AEP A;  1WTY A;  5FZT A;  2EPN A;  1ZHY A;  5AGF A;  3K1H A;  1EQ1 A;  4PAC A;  3VYW A;  3JRM O;  1HW2 A;  3NDB B;  3ITF A;  2YL1 A;  3SNH A;  3SXY A;  4XLN F;  1JR8 A;  5KYW A;  1LE2 A;  4E0H A;  4MVO A;  1VK5 A;  3L34 A;  2YZS A;  4JTA B;  1VOM A;  3RKO F;  4JVS A;  4LAC B;  3HLZ A;  2IXP A;  1JPJ A;  5HSW A;  1GS9 A;  1IW7 F;  1D0Y A;  2JPU A;  1TKN A;  1U6H A;  2WZG A;  2EIN C;  2XLW A;  3GM3 A;  3NKD A;  3U3F A;  4X0R A;  1EA8 A;  4AE4 B;  2HSQ A;  3DE9 A;  4MVM A;  1SZI A;  3LLK A;  2IXN A;  2ZXP A;  3B0V C;  4CSA A;  2R7X A;  2OJE D;  4XTK A;  4U5F E;  1Q0D A;  1WGW A;  2PNO A;  2WVO A;  3ZTM A;  4BEJ A;  3JYY A;  4UDV A;  4XQ1 A;  4DRJ B;  3RVY A;  4O6M A;  1RKE B;  1WAS A;  1KU2 A;  2JD3 A;  3N24 A;  3S90 A;  1VLS A;  3L1M A;  2NG1 A;  2X51 A;  1TWH A;  2XLH A;  1D0Z A;  3I4U A;  4BJT A;  1Z63 A;  4WGY A;  1HE1 A;  3ABM C;  2W9Y A;  3US6 A;  2L7A A;  4B6I A;  4U9E A;  3S9O A;  2OOC A;  2HJM A;  1L3P A;  1QSP A;  2J7P A;  3KH2 A;  1LE4 A;  4MVQ A;  3NRH A;  2IYL D;  5DVW A;  1Z7Q c;  3R2P A;  3J06 A;  2DI3 A;  3AOU A;  1LI7 A;  1YJG A;  2DYR C;  4D4X A;  1NSG B;  4JC7 A;  1SYQ A;  3EG9 B;  5CIV A;  2GFH A;  2Y39 A;  3UGO A;  3DJN B;  1O87 A;  1CPR A;  3IQ5 A;  2IBF A;  4XPY A;  3QTH A;  4C7O A;  3CAX A;  4ULV A;  3EFO B;  2H7B A;  3M4B A;  3O6X A;  1LI5 A;  2BC5 A;  4Z9H A;  3DM5 A;  5DS5 A;  3NYJ A;  3B0P A;  3U2L A;  1E85 A;  2W4M A;  3GEE A;  1LIH A;  3PHF 2;  1GQA A;  3FHD A;  3FVY A;  3EPV A;  2KJG A;  2VCA A;  4N06 A;  3DZA A;  3G4Z A;  5F28 E;  2Q7R A;  3RVZ A;  2Y69 C;  4N6H A;  3L8J A;  2Q3T A;  2R7T A;  3RH3 A;  3C63 A;  4BJ5 C;  2HV6 A;  3JYH A;  4OIR F;  2R7S A;  4I3M A;  5DLJ A;  3ZQV A;  4BG0 A;  5L0J A;  3F46 A;  2OJQ A;  4CS9 A;  4PFO A;  5DQZ A;  1FMV A;  1EI7 A;  3JSZ A;  5D91 A;  2PFD A;  1OQC A;  2W4B A;  3IPM O;  4YT5 A;  2KW3 C;  4E18 A;  4NY3 A;  3TD7 A;  4YT8 A;  2QUP A;  1HE9 A;  2I8B A;  1MND A;  3ASN C;  3GM1 A;  3JT1 A;  3T4R A;  3EGX A;  1RMV A;  1CGM E;  2ETS A;  3A11 A;  2AWC A;  5AC4 A;  1H9G A;  1C17 M;  3ASO C;  3GM2 A;  3Q7L A;  1G4U S;  4J30 B;  3S29 A;  1D0X A;  5JVE A;  2V3C C;  4ZLD A;  1QZX A;  2XLO A;  3QVY A;  4R32 A;  3IQT A;  4ONS A;  1OR3 A;  1F1M A;  3TOM A;  3EJN A;  4O6Y A;  4EBJ A;  5A6J A;  2AU5 A;  1I4Y A;  1NFO A;  2KQ9 A;  2XS8 A;  2YLI A;  4IJJ A;  5JS5 A;  4YL3 A;  4EHP A;  2J7P D;  2QNL A;  2VC9 A;  5DS6 A;  5EHH A;  3M79 A;  3V7O A;  4P9T A;  3C62 A;  2YWA A;  2YL3 A;  3IHU A;  4JEB A;  4JZA A;  4PJL A;  4NTA A;  5FCL A;  3KMI A;  5L0I A;  2L81 A;  1I5N A;  1A7E A;  5KYY B;  3UR3 C;  1E84 A;  3DAG A;  2OU6 A;  1YZC A;  4H4K C;  2ZXR A;  4H54 A;  3C8Z A;  1ZHW A;  1R4T A;  4JTC B;  1OCR C;  2LK4 A;  4GQH A;  3KYI A;  2YLG A;  2HSB A;  3LLI A;  3RQG A;  1FFT C;  1OW8 A;  3C8G B;  1Y4C A;  4G7O F;  1WWP A;  2Q9B A;  3NMI A;  1OKK A;  4EUK B;  1ZZP A;  2ICW G;  1V55 C;  2XL4 A;  5JT4 A;  1LS4 A;  4EBB A;  2HZ8 A;  1U0B B;  3DD7 A;  3S84 A;  1RJ9 B;  2J9W A;  3H2V A;  4JJF A;  4L6R A;  5L0G A;  1E86 A;  3RQE A;  3H2U A;  3FMS A;  5JRA A;  3ZG1 A;  4PJN A;  2NPU A;  1VMA A;  2M64 A;  3E70 C;  5GPG B;  1JAF A;  2R02 A;  1UG7 A;  2UUH A;  3AQC A;  3G4X A;  1TWG A;  4NTB A;  4PR9 A;  1HMD A;  4JEA A;  1BR4 A;  3K1I C;  4CS8 A;  1TQG A;  4LLC A;  2A69 F;  2B0H A;  3X1O A;  5TJ5 E;  4EIY A;  3L0I A;  2R05 A;  2GDC A;  4O79 A;  3PCV A;  2WZL A;  4XEF A;  1TR2 A;  3HKK A;  5A6A A;  2R03 A;  3EH1 A;  3EZI A;  5L0C A;  3ZC4 A;  2PBE A;  2Q00 A;  4NQF A;  2YVK A;  3BEH A;  4EWC A;  5B3I A;  3U8P A;  1A7V A;  1OW6 A;  2IOQ A;  1TWC A;  4OIQ F;  2I15 A;  1LM3 B;  1PD1 A;  1LVK A;  3TJ5 A;  4QDL A;  3FDQ A;  4PJJ A;  2WL8 A;  1ZVZ A;  1D1B A;  3CQZ A;  5CI9 A;  1VYK A;  1BBH A;  4NTF A;  5E3A A;  4XLP F;  1ZHX A;  3DXJ F;  4CJO A;  2XXA A;  3NYM A;  2C03 A;  4AK9 A;  1Z5Z A;  3AG3 C;  3HNL A;  4U5H A;  2M4E A;  5E3C A;  5COF A;  4HE8 D;  3V5Z A;  2R7U A;  2WZF A;  3LS0 A;  4XWJ A;  3N2Z B;  2Y3D A;  1G4W R;  1M2V A;  2EPO A;  4J7Y A;  4RBN A;  1JPN A;  1J8Y F;  1FAP B;  2Y3H A;  2Z15 A;  2A6H F;  2ZD9 A;  3O10 A;  2G62 A;  3LAY A;  2KGO A;  2P0N A;  4E7Z A;  2FFH A;  4AL1 A;  2PX0 A;  2L6H A;  3Q7G A;  2HV7 A;  3JCU Q;  2J46 A;  3S0X A;  2NUP A;  3Q6M A;  4HFF B;  5B1B C;  4OIN F;  2EIJ C;  3FOO A;  2R25 A;  2Y3G A;  4ZLC A;  4YL1 A;  4I1M A;  2NSG A;  3ABK C;  3GWL A;  4K0D A;  1L7C A;  2GAQ A;  3DI5 A;  1OKK D;  4WGZ A;  5KYX A;  4G0H A;  1ZU5 A;  3HJC A;  2CYD A;  5COG A;  2E87 A;  4OIP F;  4DOZ A;  3TQO A;  1GGQ A;  3UMH A;  3MFN A;  5T3W A;  4BJ6 A;  2LIG A;  2CDQ A;  3EGD A;  3AGT A;  3RYL A;  1A0B A;  3AG2 C;  1K04 A;  3AGU A;  1OCZ C;  3UNG C;  1VTM P;  2R7V A;  1HMO A;  2OCC C;  2QE9 A;  1SF8 A;  4J32 B;  4IGG A;  4WJ0 A;  1S7Z A;  1H9T A;  1RXQ A;  2YL7 A;  4DVY P;  3ATP A;  2EPL X;  5KYU A;  4ANJ A;  1BR2 A;  4RD9 A;  1BDJ B;  3LUT B;  3DM9 B;  2WVQ A;  3W8H A;  3FAJ A;  1NU7 D;  3NMJ A;  3LS1 A;  3U2M A;  4OD5 A;  1AUE A;  4NCQ A;  3S28 A;  2A1D D;  2RSE B;  4MW8 A;  1D1A A;  4E0I A;  4JJG A;  1W2W A;  1ZHT A;  2XLV A;  2CGE A;  3HNJ A;  3MX3 A;  2VB6 A;  2ASR A;  4CDY A;  3B9Q A;  1CGO A;  4MTG A;  4NC3 A;  5BUO A;  5L0H A;  2CNW A;  2IM8 A;  3W4Y A;  2TMV P;  4JIO A;  4M63 A;  5L3Q A;  1T5O A;  1YA7 O;  1T6Q A;  2P1A A;  4DXW A;  5F5F A;  4HEA J;  1VYI A;  1FFH A;  3RIP A;  2B0J A;  2YEV A;  1A41 A;  4Q4Z F;  2PF4 E;  1H6G A;  3IQC A;  1ZYR F;  3QW0 A;  3SP1 A;  4YL0 A;  2NSF A;  1RCP A;  1XZQ A;  1YYX A;  2YRF A;  3LEV A;  3M15 A;  3NMK A;  4LER A;  3QVZ A;  4PFP A;  4U5E E;  4E17 A;  1M2O A;  3NYL A;  4XPW A;  1M57 C;  1ORS C;  1N1C A;  3TJ6 A;  3U9M A;  2XS1 A;  4FX5 A;  3ECS A;  3MYF A;  4IAQ A;  1Z6A A;  2KNH A;  4PJM A;  1ZHZ A;  5KYW B;  1WN0 A;  1ZW3 A;  1YAU O;  4D4N A;  4K7B A;  1JMW A;  3B0U X;  1M6T A;  2WVN A;  1RKC A;  2XXA B;  1VB5 A;  3JTL O;  3CZ6 A;  3Q6N A;  5F5H A;  4KNW A;  3U5S A;  3U3B A;  2HMQ A;  1NU9 C;  3ZSU A;  3EHM A;  2HFI A;  3IEE A;  4G78 A;  1DOV A;  4CSA C;  4IAO A;  1M2V B;  2AWY A;  4HFK B;  4LLE A;  2H7O A;  2OKU A;  1V4A A;  3AG4 C;  4JTD B;  4MS2 A;  1UFB A;  3MBG A;  4MVS A;  4MVR A;  1OXK A;  4P6I C;  5JSL A;  3VAY A;  2CW0 F;  3KYJ A;  2PX3 A;  3C18 A;  4U9D A;  2A68 F;  3V5Y A;  4YN0 B;  4QI2 A;  2QLA A;  1CGN A;  3M4C A;  1JOG A;  1T6U A;  1QPU A;  4WAB A;  4G7H F;  4G7Z F;  2UUI A;  4DRI B;  4JUR I;  4AL0 A;  1YVI A;  3ZDL A;  2HKV A;  2QY9 A;  4LDQ A;  4XEK A;  4XPX A;  1TFK B;  3AG1 C;  2J45 A;  3UGP A;  3K66 A;  3TK0 A;  3S27 A;  256B A;  1V54 C;  1APC A;  3IQ6 A;  5DS4 A;  3ZVR A;  2CNW D;  1U89 A;  1SR2 A;  4C7O B;  3GEH A;  3EFO A;  3K7D A;  4FES A;  2VCB A;  4ER9 A;  3ZIB A;  2Y3B A;  1M56 C;  1I4Z A;  4OD4 A;  2DB4 A;  2R7W A;  2BE5 F;  2WB7 A;  1MMA A;  2XSE A;  4CBE A;  5KYU B;  4JW1 A;  1SMY F;  2J9V A;  3OEO A;  4DJ9 A;  4MQ9 F;  3WG7 C;  2L6G A;  3N0T A;  5JP7 A;  4N4W A;  4BJ5 A;  4YT4 A;  4I1O B;  3EQL F;  2LQG A;  3F47 A;  1IZM A;  3FXH A;  3LJB A;  4MW3 A;  5CI8 A;  4C3D A;  3LEO A;  3MLG A;  3TUL A;  2LP4 A;  2P6V A;  1DOW A;  4O6N A;  3LNR A;  2XRH A;  3NKE A;  1GM5 A;  1EKY A;  3V5X A;  1YA9 A;  4KBL A;  1G5Z A;  3VRC A;  4CS9 C;  1S05 A;  1YLM A;  2QTV A;  4CX9 A;  4Q5S F;  3GAN A;  3QW1 A;  2R7R A;  5IY5 C;  1C02 A;  4MVU A;  2J8W A;  3GOD A;  4IB4 A;  3NG1 A;  2YKZ A;  1LKX A;  2NUT A;  3O39 A;  1TFO B;  1R5I D;  2YL0 A;  3EGX B;  1O5H A;  5BQI A;  1QQ3 A;  4MVZ A;  3ZTZ A;  3MYI A;  3DJU B;  3PMR A;  2P7V A;  2AP3 A;  4FWV A;  4ULW A;  4YT2 A;  4OIO F;  2OEX A;  4GEH A;  2DGJ A;  3U8V A;  2IXO A;  2VCC A;  3DMD A;  3T6B A;  4EBK A;  5L3V A;  3T9O A;  1E2X A;  1JRA A;  3W2V A;  2XM4 A;  5AC5 A;  1V74 B;  3RF3 A;  1OW7 A;  4CJG A;  4DBQ A;  2HMZ A;  3I5Q A;  3KL4 A;  1T01 A;  2LFF A;  1YZA A;  1XWJ A;  3O55 A;  3AQB A;  2J0W A;  5KYY A;  3SXZ A;  5EK0 A;  5T3T A;  1MMD A;  4FAP B;  1H7I A;  2AVK A;  5EGY A;  5BQH A;  4KI2 A;  4CS7 A;  3A9C A;  5A6K A;  2D5R B;  3UMI A;  4MND A;  1KTM A;  3JRT A;  2FAP B;  4IAR A;  1MQV A;  5B1A C;  3WAQ A;  2A0U A;  5T1D B;  2IXM A;  2OEV A; 
#chains in the Genus database with same CATH homology
 5COM A;  2YQY A;  3GOR A;  2NSG A;  3DI5 A;  2HKV A;  2RD9 A;  2QNL A;  5COG A;  4N6C A;  5CIV A;  3DKA A;  2P1A A;  3QTH A;  5COF A;  2OU6 A;  2OQM A;  2QE9 A;  3CEX A;  2F22 A;  2NSF A;  1RXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...