5CIVA

Sibling lethal factor precursor - dfsb
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
169
structure length
169
Chain Sequence
EYTSKEELKKTIHAAYLLLDGEFEGIDDSQKDNRVPEVDRTPAEIIAYQLGWLHLVMGWDRDELAGKPVIMPAPGYKWNQLGGLYQSFYAAYADLSLTELRRLFRDTERQWLDWIDTLSEEDLFTQSVRKWTGDKPNWPMARWIHINSAAPFKTFRAKIRKWKKHQRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
molecule keywords Sibling bacteriocin
source organism Paenibacillus dendritiformis
molecule tags Unknown function
total genus 68
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2015-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5civA00
2RD9A 1RXQA 2HKVA 3CEXA 2F22A 3QTHA 2OQMA 2YQYA 5CIVA 3DI5A 2QE9A 2NSFA 2QNLA 5COMA 3GORA 4N6CA 5COFA 2OU6A 2P1AA 5COGA 3DKAA 2NSGA
chains in the Genus database with same CATH superfamily
1ZW3A 3AGTA 3ZDLA 2HS5A 4WGYA 1IZMA 3AG1C 3U8PA 4Q5SF 3HNJA 1BR2A 2J9WA 3MBGA 1UFBA 1JMWA 4LDKA 4PJMA 2B0JA 3U3BA 4DXWA 1LVKA 3ASOC 2NUPA 3E70C 4G7ZF 3B0UX 1E83A 3EGXA 3QVZA 5JSLA 1A7VA 1YA7O 3UR3C 5D91A 5CIVA 3AGUA 5L0FA 4C3EA 1BDJB 1TWCA 3ABLC 4WJ0A 4CS8A 2Q3TA 5COMA 4MTGA 4Z9JA 4PJJA 1AEPA 2DYRC 4Q7CA 2R05A 2DGJA 4OD5A 2HJMA 1QPUA 1I4YA 1Z7Qc 4A4AA 3GEIA 5T1DB 1Y6DA 1T9KA 2VCCA 3UMIA 3TQOA 4DVZA 2G62A 2NSFA 2G3KA 1A7EA 2J9UA 3M4CA 2YL1A 4JE9A 3LLIA 1BR1A 2XLHA 3RVZA 2X51A 1JOGA 3U2LA 4C3BA 4CIPA 1RKCA 3LEOA 4OIPF 3TJ6A 1YLMA 1QZXA 3CSKA 4XLPF 1LKXA 3QTHA 4FESA 1QVXA 5CI9A 4BEMJ 1GQAA 2KK1A 2OG2A 3SEOA 3UMHA 4EBJA 5L0HA 3GM3A 5JRAA 2A69F 2KYHA 4LDQA 3NKEA 4CJOA 2KW3C 4CS9C 3ABMC 2QNLA 2YEVA 1VYKA 2G3VA 3HKKA 3M79A 3C18A 1J8YF 5BQGA 1ZYRF 4YJWA 2LFFA 2GWWA 2I8BA 5KYUA 2Q4FA 3O39A 3SYNA 1XWJA 1R5ID 1NU9C 3RH3A 4JTCB 3SXZA 5L0GA 4P6IC 4K1OA 3L1MA 1E86A 2BL2A 1QLEC 1ZHZA 2W9YA 4NC3A 5FZTA 5B3IA 3POVA 1C02A 3LJBA 5B1AC 3G4ZA 5HSWA 1U6HA 2JPUA 2L9JA 1KU2A 2W4BA 1NFOA 2AWCA 4XLNF 2XLVA 3BEHA 2LIGA 4OIOF 4E0HA 2XM4A 2UUIA 3JSZA 3RYLA 5JLIA 2OQMA 3RF3A 3Q7GA 4IRUA 2R7QA 4F4BA 3DI5A 5L3VA 2R7SA 2QE9A 3BRJA 2WVOA 4XWJA 4BJ5A 4YWQA 5JVEA 3GWNA 1O87A 3I4UA 1TFKB 3K33A 4JVSA 4IGGA 3FAPB 2CNWA 2YLIA 4U5FE 3U2MA 2EPNA 1WOLA 4DBQA 1D0ZA 3B29A 2IYLD 2OU6A 4RBNA 1ZVZA 2P7VA 2OOCA 4JKVA 4DRJB 1FNTc 3GEEA 1Z23A 5E3CA 3DKAA 1MMGA 3ITFA 3EG9A 3T9OA 3UGPA 5BQHA 4WABA 2OKUA 2XXAA 4ULVA 4XPWA 1Y4CA 4BPMA 3RQFA 1KNYA 3GM2A 4J32B 4O6NA 2C03A 3HNKA 1M57C 1MMAA 2CGEA 3DXJF 3MX3A 1OQCA 1ZHTA 4JJFA 3IEEA 1A0BA 3G4XA 2J7PA 4O7GA 2LCHA 1WGWA 2Q9AA 4ER9A 2HJ3A 2R9RB 1V74B 2AP3A 3AJMA 4KNVA 2TMVP 2Y3BA 4CBEA 3IQ6A 2XSEA 4AE4B 2L81A 1EI7A 5HV9A 1JPNA 1J8MF 3V5ZA 4J7YA 5T3TA 2HMZA 4DJ9A 4JTAB 2L6FA 3A9CA 4N6CA 3S84A 1FMWA 4H4KC 5E3AA 4CSAA 1YARO 1BR4A 3IPMO 3JYYA 3LS0A 3WAQA 3IHUA 3LNMB 3R2PA 2ZXRA 3KYJA 1OCOC 2HV6A 2NUTB 5T3WA 3NKDA 1DOVA 4I44A 3KYIA 1D1CA 2NSGA 4BJ1A 1L7CA 3LS1A 3FVYA 4MS2A 2H7VC 3NDBB 5A6AA 4I1MA 3SNHA 3TOLA 3ABKC 5BUOA 3ZQVA 3F47A 4FAPB 3MLGA 5EGYA 4U5CE 3JTLO 1AUEA 1CGNA 1ST6A 3DZAA 4QDLA 2YQYA 5JT4A 1LE4A 5A6BD 5L0CA 1PD1A 1MMDA 3ZSUA 3GWLA 2YZSA 4MVMA 4U5EE 2LFDA 4IWBA 4O6YA 3NYJA 1LS1A 4NY3A 4Z9HA 4DVYP 2J0WA 4EWCA 2R7WA 2R7RA 2L6HA 4X0RA 5KYYA 2R7TA 3GORA 2KSFA 2XRHA 2CYDA 3DAFA 2KC3A 5JUAA 1RKEB 2XL8A 3N0TA 1Q0GA 4OINF 4E0IA 1IW7F 1RJ9B 2XLOA 2CDQA 4AL0A 4YT2A 1V4AA 3C7JA 1Z6AA 2Q9BA 3TK0A 1BZ4A 5L0DA 4KI2A 1OCRC 3G50A 1SYQA 3JSEO 4HFKB 2EPMX 3IQCA 5KYWB 1E2XA 3NG1A 4E18A 1OKKA 4ULWA 5DS4A 1TWGA 3MYFA 3KMIA 1MMNA 4YT8A 4JZAA 1HE9A 4XQ1A 3R7CA 3Q7LA 4OD4A 4MVZA 3L0IA 3O10A 3W4YA 1VB5A 5F28E 3RVYA 2IM8A 2EINC 3VAYA 1GM5A 2O9XA 1GGQA 4CJGA 2W45A 3EHNA 3V5XA 1UG7A 1V54C 5A69A 2B0HA 3FHDA 3O55A 1I4ZA 3C8ZA 4NQFA 4IB4A 4HE8D 1M6TA 1TKNA 3K1IC 1YYJA 2RD9A 1RXQA 2FAPB 2NUPB 5EHHA 3Q6NA 3S27A 3GANA 2OEVA 4HFFB 4Q4ZF 3V7OA 4W8PA 1CGME 2Y3GA 4QI0A 2LK4A 4CIHA 4YT4A 4XPXA 3L8IA 5TJ5E 4IAQA 4WGZA 4MW3A 2FGYA 1T6UA 3KKBA 4PFOA 1WWPA 1FAPB 2EPLX 2ZXWC 3M4BA 5FCLA 3AG4C 3RKOF 2GDCA 4PFPA 3HNIA 1D0YA 3JRTA 1EQ1A 1G4WR 1LPEA 3LNRA 1FMVA 1ORJA 4XEVA 1PCXA 5KYNA 2YL0A 4NCQA 4JCZA 4O79A 2VASA 4BG0A 2HKVA 3NYMA 1M2VB 4K0DA 3H65A 1YZCA 4J30B 3W2VA 5CI8A 2L6GA 5L0IA 5DQTA 4JRZA 1BBHA 2PFDA 2F22A 2QY9A 1U89A 3ZIBA 5IY5C 3PDMP 3IQ5A 4YK5A 3U5SA 3KL4A 5DLJA 4EIYA 2OEXA 3LLKA 3M15A 2D4UA 3PMRA 3DE9A 1TWAA 3WG7C 3V5YA 5BQIA 3KH2A 1NU7D 1YDIA 4IJJA 5AC4A 2A0UA 2YHSA 3ATPA 4YL3A 2DB4A 4J7TA 5EK0A 3SP1A 3FAJA 5F5HA 2XLDA 4PR9A 3VYWA 2X0CA 1QSPA 3N24A 4P9TA 1CGOA 1FTSA 2IXPA 3JYHA 3EQLF 2P1AA 2R7OA 2R02A 2CNWD 1LIHA 2IXNA 2LD6A 3DE8A 3C8GA 4CX9A 2QLAA 3F46A 4C7OB 1YVIA 1APCA 3B71A 3CQZA 1D0XA 3UMKA 1Q0FA 256BA 1ZU5A 1TFOB 3C8GD 4EHPA 3EFOB 3QW1A 4MQ9F 3AOUA 2GFHA 2M64A 1D1BA 2M4EA 1DOWA 4G0HA 4IAOA 3ZWIA 1YZAA 2HMQA 4CS7A 1OCCC 2WZLA 4CS8C 1VK5A 4PACA 4QI2A 1H9GA 4NTBA 3SXYA 2HV7A 3QMKA 2J7PD 3JT1A 3B9QA 2HUJA 1JPJA 2LP4A 2VH3A 3EGDA 2JD3A 3LEVA 3NMJA 3W8HA 3ZVRA 2XXAB 3EG9B 3GEHA 2NUTA 3K6BA 3JRMO 1V55C 1TQGA 2Y39A 3U9MA 5KYYB 3B0VC 2V26A 2VCBA 1CPRA 3FMSA 2KQ9A 4P9FA 1NLXA 2LSEA 3LAYA 5GPGB 5DS5A 3A11A 3MFNA 3HJCA 3ZQYA 3AQCA 3EJNA 3NMIA 4LERA 1E85A 4CS9A 1B68A 3VF0A 3TOMA 2YLDA 2YLGA 1RMVA 1LM3B 1ZHXA 3VRCA 1FR0A 3WODF 5A6KA 3L8JA 2HZ8A 1PV3A 3K66A 2WVNA 1RKEA 4RDAA 4EUKB 3VM6A 4MVOA 4LLEA 4LLCA 4RD9A 2YVKA 2R7VA 2R7UA 1ZHYA 3Q6MA 5JP7A 1RJ9A 4JIOA 3EZIA 1Z63A 1A7DA 1K40A 2A6HF 3J06A 2HSBA 1NZEA 2WZFA 2Y3DA 3DM9B 2P61A 3OEOA 1CPQA 4G78A 4PK4A 2MWQA 2YL3A 2LQGA 4DRHB 5KYWA 2GAQA 2UUHA 2Q00A 3U9JA 3SZRA 1WTYA 1Z5ZA 3LESA 1ZU4A 2C04A 4KNWA 4N4WA 4JEAA 4MTOA 4XTKA 3W2WA 3DJUB 3C62A 5KYXB 2W4MA 2J8WA 3N2ZB 4PJNA 4BJ6A 1VMAA 4BJ5C 1OKKD 3FXHA 3FOOA 4MVUA 4BEJA 3TJ5A 2XL4A 1NG1A 1G8XA 4A2NB 1HMDA 3TULA 4AK9A 4AX2A 1LI5A 1ZHWA 1M56C 1ORYA 2OCCC 2QTVA 4NTAA 4N06A 3RQGA 2HFIA 4N6HA 3S9OA 3CZ6A 3S29A 4GYTA 1Q0DA 3DD7A 4MTFA 4OIQF 3LUTB 1R4TA 5A6JA 3EH1A 2Q7RA 1TR2A 3AG2C 1H7IA 2A1DD 2XM0A 1O3UA 2IBFA 4LACB 4MNDA 5E2QA 2KJGA 4XEKA 3T6JA 2R7XA 4I3MA 4OIRF 1D1AA 3H2UA 3H2VA 5E33A 3EGXB 4CDYA 2ETSA 2R25A 2ICWG 2DYSC 4U5GA 1SZIA 2Z15A 2BE5F 2IXMA 2XS8A 4LDRA 5F5FA 3GM1A 4DRIB 2NPUA 3L34A 1S05A 1T6QA 1TWHA 3RFYA 2IXOA 2ZD9A 2Q9CA 2WZGA 2VC9A 3ZC4A 5B3SC 1OR2A 2GA0A 3K7DA 2EPKX 4JEBA 4CSAC 3S28A 1E84A 2ZPAA 3ZTMA 4U5DE 1NSGB 2Y69C 3CAXA 2AVKA 1OW7A 1MNEA 3T6GB 3US6A 4U5HA 1I5NA 3AG3C 3S0XA 1M2VA 1O5HA 2EPOA 5L0JA 1T01A 2RSEB 3SXKA 2H7BA 1ORSC 4E7ZA 1C17M 4PJLA 4YN0B 4Z9IA 5D92A 2D5RB 4G7HF 1OW8A 3EPVA 1FFHA 4I1OB 4BJ6C 3QW0A 3NRHA 4O6MA 3T6BA 4UDVA 2FFHA 1C03A 1GS9A 5AGFA 2XS1A 3FDQA 2PNOA 1Z3IX 1OXKA 3HNLA 4NTFA 3QVYA 5KYUB 4XEFA 1G4US 3DAGA 4EBKA 3X1OA 1FFTC 2BC5A 3EHMA 2A6EF 3NYLA 1OR3A 3JZ0A 4GQHA 1HE1A 1L3PA 2ZXPA 2NG1A 2XLEA 2WL8A 3PHF2 1H9TA 4G7OF 3K1HA 1T5OA 1OW6A 2EILC 1MNDA 2YL7A 2EIMC 2YKZA 4C7OA 4L6RA 1Q0KA 3U3FA 1JAFA 1G5ZA 1HW1A 2CW0F 2J46A 3RW0A 1WASA 3CEXA 5DVWA 2CCYA 1M2OA 3EFOA 5B1BC 3ZTZA 2XL6A 1NFNA 1LI7A 2ASRA 4W8KA 2WVQA 2KNHA 3ECSA 2J9BA 3HLZA 2EIKC 4KBLA 3UNGC 2A0BA 1XZQA 2VB6A 4GEHA 3X2QC 1HMOA 2PX3A 4E17A 3DM5A 4EBBA 1YA9A 3I5PA 4R32A 2EIJC 4AE4A 2OJED 3DWWA 1SF8A 1VOMA 3HTKC 4MVRA 2J0XA 4FWVA 2I15A 2P6VA 4D4NA 1HW2A 3S90A 3C8GB 2A68F 2YWAA 2PX0A 1HY5A 2V3CC 4JC7A 3E9VA 2MHRA 4AL1A 1S7ZA 2Y3HA 3K1IA 2L7AA 4ZLCA 1N1CA 3U8VA 4DBRA 1XZPA 3KPHA 4ONSA 1SMYF 3IQTA 1VLTA 5DQZA 1JR8A 3PCVA 3C63A 2H7OA 3T4RA 3UGOA 1QQ3A 4M63A 3OA1A 2J9VA 5JS5A 1VTMP 2VCAA 2R03A 4CDAA 1LS4A 2AU5A 2XLMA 4MVQA 1Q0MA 3RQEA 3JCUQ 5DS6A 4ZLDA 3EGDB 2QUPA 3DJNB 3M1CB 4JURI 3EH2A 2AWYA 2IOQA 3DMDA 4EKWA 5COFA 1YYXA 1PD0A 1LE2A 1T6IA 2H8AA 1RCPA 2DI3A 2OJQA 3EZHA 1ZW2A 4IARA 4JCHA 4KC9A 4YL0A 3W8IA 1K05A 1EKYA 1F1MA 2KGOA 1MQVA 2E87A 4U9EA 5COGA 1QKRA 5K0IA 1A41A 4JTDB 4JJGA 4MVSA 5AC5A 3B0PA 4U5BE 3QZCA 2YRFA 1NBBA 2PP4A 3OWTA 5A6BA 1JRAA 4FX5A 4MW8A 3ASNC 2MYSA 4YT5A 3ZG1A 2ZXOA 4JW1A 1W2WA 1OCZC 4DOZA 1K04A 2J45A 3SXMA 1WN0A 1H6GA 1AVOB 1EA8A 1OXBA 2PBEA 1YAUO 1ZZPA 3I5QA 4C3DA 2JX0A 5L3QA 2XLWA 5KYXA 1U0BB 4U9DA 3FOPA 4HEAJ 1WATA 1YJGA 3NMKA 4K7BA 4XPYA 4YL1A 3MYIA 3RIPA 3TD7A 4H54A 3U0CA 2PF4E 1SR2A 1VLSA 4ANJA 4BJTA 2P0NA 3O6XA 1VYIA 2WB7A 4CDVA 3GODA 1KTMA 4D4XA 4B6IA 3AQBA 4E7SA 2HSQA 3WHNA
chains in the Genus database with same CATH topology
2RD9A 1RXQA 2HKVA 3CEXA 2F22A 3QTHA 2OQMA 2YQYA 5CIVA 3DI5A 2QE9A 2NSFA 2QNLA 5COMA 3GORA 4N6CA 5COFA 2OU6A 2P1AA 5COGA 3DKAA 2NSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RD9 A;  1RXQ A;  2HKV A;  3CEX A;  2F22 A;  3QTH A;  2OQM A;  2YQY A;  5CIV A;  3DI5 A;  2QE9 A;  2NSF A;  2QNL A;  5COM A;  3GOR A;  4N6C A;  5COF A;  2OU6 A;  2P1A A;  5COG A;  3DKA A;  2NSG A; 
#chains in the Genus database with same CATH topology
 1ZW3 A;  3AGT A;  3ZDL A;  2HS5 A;  4WGY A;  1IZM A;  3AG1 C;  3U8P A;  4Q5S F;  3HNJ A;  1BR2 A;  2J9W A;  3MBG A;  1UFB A;  1JMW A;  4LDK A;  4PJM A;  2B0J A;  3U3B A;  4DXW A;  1LVK A;  3ASO C;  2NUP A;  3E70 C;  4G7Z F;  3B0U X;  1E83 A;  3EGX A;  3QVZ A;  5JSL A;  1A7V A;  1YA7 O;  3UR3 C;  5D91 A;  5CIV A;  3AGU A;  5L0F A;  4C3E A;  1BDJ B;  1TWC A;  3ABL C;  4WJ0 A;  4CS8 A;  2Q3T A;  5COM A;  4MTG A;  4Z9J A;  4PJJ A;  1AEP A;  2DYR C;  4Q7C A;  2R05 A;  2DGJ A;  4OD5 A;  2HJM A;  1QPU A;  1I4Y A;  1Z7Q c;  4A4A A;  3GEI A;  5T1D B;  1Y6D A;  1T9K A;  2VCC A;  3UMI A;  3TQO A;  4DVZ A;  2G62 A;  2NSF A;  2G3K A;  1A7E A;  2J9U A;  3M4C A;  2YL1 A;  4JE9 A;  3LLI A;  1BR1 A;  2XLH A;  3RVZ A;  2X51 A;  1JOG A;  3U2L A;  4C3B A;  4CIP A;  1RKC A;  3LEO A;  4OIP F;  3TJ6 A;  1YLM A;  1QZX A;  3CSK A;  4XLP F;  1LKX A;  3QTH A;  4FES A;  1QVX A;  5CI9 A;  4BEM J;  1GQA A;  2KK1 A;  2OG2 A;  3SEO A;  3UMH A;  4EBJ A;  5L0H A;  3GM3 A;  5JRA A;  2A69 F;  2KYH A;  4LDQ A;  3NKE A;  4CJO A;  2KW3 C;  4CS9 C;  3ABM C;  2QNL A;  2YEV A;  1VYK A;  2G3V A;  3HKK A;  3M79 A;  3C18 A;  1J8Y F;  5BQG A;  1ZYR F;  4YJW A;  2LFF A;  2GWW A;  2I8B A;  5KYU A;  2Q4F A;  3O39 A;  3SYN A;  1XWJ A;  1R5I D;  1NU9 C;  3RH3 A;  4JTC B;  3SXZ A;  5L0G A;  4P6I C;  4K1O A;  3L1M A;  1E86 A;  2BL2 A;  1QLE C;  1ZHZ A;  2W9Y A;  4NC3 A;  5FZT A;  5B3I A;  3POV A;  1C02 A;  3LJB A;  5B1A C;  3G4Z A;  5HSW A;  1U6H A;  2JPU A;  2L9J A;  1KU2 A;  2W4B A;  1NFO A;  2AWC A;  4XLN F;  2XLV A;  3BEH A;  2LIG A;  4OIO F;  4E0H A;  2XM4 A;  2UUI A;  3JSZ A;  3RYL A;  5JLI A;  2OQM A;  3RF3 A;  3Q7G A;  4IRU A;  2R7Q A;  4F4B A;  3DI5 A;  5L3V A;  2R7S A;  2QE9 A;  3BRJ A;  2WVO A;  4XWJ A;  4BJ5 A;  4YWQ A;  5JVE A;  3GWN A;  1O87 A;  3I4U A;  1TFK B;  3K33 A;  4JVS A;  4IGG A;  3FAP B;  2CNW A;  2YLI A;  4U5F E;  3U2M A;  2EPN A;  1WOL A;  4DBQ A;  1D0Z A;  3B29 A;  2IYL D;  2OU6 A;  4RBN A;  1ZVZ A;  2P7V A;  2OOC A;  4JKV A;  4DRJ B;  1FNT c;  3GEE A;  1Z23 A;  5E3C A;  3DKA A;  1MMG A;  3ITF A;  3EG9 A;  3T9O A;  3UGP A;  5BQH A;  4WAB A;  2OKU A;  2XXA A;  4ULV A;  4XPW A;  1Y4C A;  4BPM A;  3RQF A;  1KNY A;  3GM2 A;  4J32 B;  4O6N A;  2C03 A;  3HNK A;  1M57 C;  1MMA A;  2CGE A;  3DXJ F;  3MX3 A;  1OQC A;  1ZHT A;  4JJF A;  3IEE A;  1A0B A;  3G4X A;  2J7P A;  4O7G A;  2LCH A;  1WGW A;  2Q9A A;  4ER9 A;  2HJ3 A;  2R9R B;  1V74 B;  2AP3 A;  3AJM A;  4KNV A;  2TMV P;  2Y3B A;  4CBE A;  3IQ6 A;  2XSE A;  4AE4 B;  2L81 A;  1EI7 A;  5HV9 A;  1JPN A;  1J8M F;  3V5Z A;  4J7Y A;  5T3T A;  2HMZ A;  4DJ9 A;  4JTA B;  2L6F A;  3A9C A;  4N6C A;  3S84 A;  1FMW A;  4H4K C;  5E3A A;  4CSA A;  1YAR O;  1BR4 A;  3IPM O;  3JYY A;  3LS0 A;  3WAQ A;  3IHU A;  3LNM B;  3R2P A;  2ZXR A;  3KYJ A;  1OCO C;  2HV6 A;  2NUT B;  5T3W A;  3NKD A;  1DOV A;  4I44 A;  3KYI A;  1D1C A;  2NSG A;  4BJ1 A;  1L7C A;  3LS1 A;  3FVY A;  4MS2 A;  2H7V C;  3NDB B;  5A6A A;  4I1M A;  3SNH A;  3TOL A;  3ABK C;  5BUO A;  3ZQV A;  3F47 A;  4FAP B;  3MLG A;  5EGY A;  4U5C E;  3JTL O;  1AUE A;  1CGN A;  1ST6 A;  3DZA A;  4QDL A;  2YQY A;  5JT4 A;  1LE4 A;  5A6B D;  5L0C A;  1PD1 A;  1MMD A;  3ZSU A;  3GWL A;  2YZS A;  4MVM A;  4U5E E;  2LFD A;  4IWB A;  4O6Y A;  3NYJ A;  1LS1 A;  4NY3 A;  4Z9H A;  4DVY P;  2J0W A;  4EWC A;  2R7W A;  2R7R A;  2L6H A;  4X0R A;  5KYY A;  2R7T A;  3GOR A;  2KSF A;  2XRH A;  2CYD A;  3DAF A;  2KC3 A;  5JUA A;  1RKE B;  2XL8 A;  3N0T A;  1Q0G A;  4OIN F;  4E0I A;  1IW7 F;  1RJ9 B;  2XLO A;  2CDQ A;  4AL0 A;  4YT2 A;  1V4A A;  3C7J A;  1Z6A A;  2Q9B A;  3TK0 A;  1BZ4 A;  5L0D A;  4KI2 A;  1OCR C;  3G50 A;  1SYQ A;  3JSE O;  4HFK B;  2EPM X;  3IQC A;  5KYW B;  1E2X A;  3NG1 A;  4E18 A;  1OKK A;  4ULW A;  5DS4 A;  1TWG A;  3MYF A;  3KMI A;  1MMN A;  4YT8 A;  4JZA A;  1HE9 A;  4XQ1 A;  3R7C A;  3Q7L A;  4OD4 A;  4MVZ A;  3L0I A;  3O10 A;  3W4Y A;  1VB5 A;  5F28 E;  3RVY A;  2IM8 A;  2EIN C;  3VAY A;  1GM5 A;  2O9X A;  1GGQ A;  4CJG A;  2W45 A;  3EHN A;  3V5X A;  1UG7 A;  1V54 C;  5A69 A;  2B0H A;  3FHD A;  3O55 A;  1I4Z A;  3C8Z A;  4NQF A;  4IB4 A;  4HE8 D;  1M6T A;  1TKN A;  3K1I C;  1YYJ A;  2RD9 A;  1RXQ A;  2FAP B;  2NUP B;  5EHH A;  3Q6N A;  3S27 A;  3GAN A;  2OEV A;  4HFF B;  4Q4Z F;  3V7O A;  4W8P A;  1CGM E;  2Y3G A;  4QI0 A;  2LK4 A;  4CIH A;  4YT4 A;  4XPX A;  3L8I A;  5TJ5 E;  4IAQ A;  4WGZ A;  4MW3 A;  2FGY A;  1T6U A;  3KKB A;  4PFO A;  1WWP A;  1FAP B;  2EPL X;  2ZXW C;  3M4B A;  5FCL A;  3AG4 C;  3RKO F;  2GDC A;  4PFP A;  3HNI A;  1D0Y A;  3JRT A;  1EQ1 A;  1G4W R;  1LPE A;  3LNR A;  1FMV A;  1ORJ A;  4XEV A;  1PCX A;  5KYN A;  2YL0 A;  4NCQ A;  4JCZ A;  4O79 A;  2VAS A;  4BG0 A;  2HKV A;  3NYM A;  1M2V B;  4K0D A;  3H65 A;  1YZC A;  4J30 B;  3W2V A;  5CI8 A;  2L6G A;  5L0I A;  5DQT A;  4JRZ A;  1BBH A;  2PFD A;  2F22 A;  2QY9 A;  1U89 A;  3ZIB A;  5IY5 C;  3PDM P;  3IQ5 A;  4YK5 A;  3U5S A;  3KL4 A;  5DLJ A;  4EIY A;  2OEX A;  3LLK A;  3M15 A;  2D4U A;  3PMR A;  3DE9 A;  1TWA A;  3WG7 C;  3V5Y A;  5BQI A;  3KH2 A;  1NU7 D;  1YDI A;  4IJJ A;  5AC4 A;  2A0U A;  2YHS A;  3ATP A;  4YL3 A;  2DB4 A;  4J7T A;  5EK0 A;  3SP1 A;  3FAJ A;  5F5H A;  2XLD A;  4PR9 A;  3VYW A;  2X0C A;  1QSP A;  3N24 A;  4P9T A;  1CGO A;  1FTS A;  2IXP A;  3JYH A;  3EQL F;  2P1A A;  2R7O A;  2R02 A;  2CNW D;  1LIH A;  2IXN A;  2LD6 A;  3DE8 A;  3C8G A;  4CX9 A;  2QLA A;  3F46 A;  4C7O B;  1YVI A;  1APC A;  3B71 A;  3CQZ A;  1D0X A;  3UMK A;  1Q0F A;  256B A;  1ZU5 A;  1TFO B;  3C8G D;  4EHP A;  3EFO B;  3QW1 A;  4MQ9 F;  3AOU A;  2GFH A;  2M64 A;  1D1B A;  2M4E A;  1DOW A;  4G0H A;  4IAO A;  3ZWI A;  1YZA A;  2HMQ A;  4CS7 A;  1OCC C;  2WZL A;  4CS8 C;  1VK5 A;  4PAC A;  4QI2 A;  1H9G A;  4NTB A;  3SXY A;  2HV7 A;  3QMK A;  2J7P D;  3JT1 A;  3B9Q A;  2HUJ A;  1JPJ A;  2LP4 A;  2VH3 A;  3EGD A;  2JD3 A;  3LEV A;  3NMJ A;  3W8H A;  3ZVR A;  2XXA B;  3EG9 B;  3GEH A;  2NUT A;  3K6B A;  3JRM O;  1V55 C;  1TQG A;  2Y39 A;  3U9M A;  5KYY B;  3B0V C;  2V26 A;  2VCB A;  1CPR A;  3FMS A;  2KQ9 A;  4P9F A;  1NLX A;  2LSE A;  3LAY A;  5GPG B;  5DS5 A;  3A11 A;  3MFN A;  3HJC A;  3ZQY A;  3AQC A;  3EJN A;  3NMI A;  4LER A;  1E85 A;  4CS9 A;  1B68 A;  3VF0 A;  3TOM A;  2YLD A;  2YLG A;  1RMV A;  1LM3 B;  1ZHX A;  3VRC A;  1FR0 A;  3WOD F;  5A6K A;  3L8J A;  2HZ8 A;  1PV3 A;  3K66 A;  2WVN A;  1RKE A;  4RDA A;  4EUK B;  3VM6 A;  4MVO A;  4LLE A;  4LLC A;  4RD9 A;  2YVK A;  2R7V A;  2R7U A;  1ZHY A;  3Q6M A;  5JP7 A;  1RJ9 A;  4JIO A;  3EZI A;  1Z63 A;  1A7D A;  1K40 A;  2A6H F;  3J06 A;  2HSB A;  1NZE A;  2WZF A;  2Y3D A;  3DM9 B;  2P61 A;  3OEO A;  1CPQ A;  4G78 A;  4PK4 A;  2MWQ A;  2YL3 A;  2LQG A;  4DRH B;  5KYW A;  2GAQ A;  2UUH A;  2Q00 A;  3U9J A;  3SZR A;  1WTY A;  1Z5Z A;  3LES A;  1ZU4 A;  2C04 A;  4KNW A;  4N4W A;  4JEA A;  4MTO A;  4XTK A;  3W2W A;  3DJU B;  3C62 A;  5KYX B;  2W4M A;  2J8W A;  3N2Z B;  4PJN A;  4BJ6 A;  1VMA A;  4BJ5 C;  1OKK D;  3FXH A;  3FOO A;  4MVU A;  4BEJ A;  3TJ5 A;  2XL4 A;  1NG1 A;  1G8X A;  4A2N B;  1HMD A;  3TUL A;  4AK9 A;  4AX2 A;  1LI5 A;  1ZHW A;  1M56 C;  1ORY A;  2OCC C;  2QTV A;  4NTA A;  4N06 A;  3RQG A;  2HFI A;  4N6H A;  3S9O A;  3CZ6 A;  3S29 A;  4GYT A;  1Q0D A;  3DD7 A;  4MTF A;  4OIQ F;  3LUT B;  1R4T A;  5A6J A;  3EH1 A;  2Q7R A;  1TR2 A;  3AG2 C;  1H7I A;  2A1D D;  2XM0 A;  1O3U A;  2IBF A;  4LAC B;  4MND A;  5E2Q A;  2KJG A;  4XEK A;  3T6J A;  2R7X A;  4I3M A;  4OIR F;  1D1A A;  3H2U A;  3H2V A;  5E33 A;  3EGX B;  4CDY A;  2ETS A;  2R25 A;  2ICW G;  2DYS C;  4U5G A;  1SZI A;  2Z15 A;  2BE5 F;  2IXM A;  2XS8 A;  4LDR A;  5F5F A;  3GM1 A;  4DRI B;  2NPU A;  3L34 A;  1S05 A;  1T6Q A;  1TWH A;  3RFY A;  2IXO A;  2ZD9 A;  2Q9C A;  2WZG A;  2VC9 A;  3ZC4 A;  5B3S C;  1OR2 A;  2GA0 A;  3K7D A;  2EPK X;  4JEB A;  4CSA C;  3S28 A;  1E84 A;  2ZPA A;  3ZTM A;  4U5D E;  1NSG B;  2Y69 C;  3CAX A;  2AVK A;  1OW7 A;  1MNE A;  3T6G B;  3US6 A;  4U5H A;  1I5N A;  3AG3 C;  3S0X A;  1M2V A;  1O5H A;  2EPO A;  5L0J A;  1T01 A;  2RSE B;  3SXK A;  2H7B A;  1ORS C;  4E7Z A;  1C17 M;  4PJL A;  4YN0 B;  4Z9I A;  5D92 A;  2D5R B;  4G7H F;  1OW8 A;  3EPV A;  1FFH A;  4I1O B;  4BJ6 C;  3QW0 A;  3NRH A;  4O6M A;  3T6B A;  4UDV A;  2FFH A;  1C03 A;  1GS9 A;  5AGF A;  2XS1 A;  3FDQ A;  2PNO A;  1Z3I X;  1OXK A;  3HNL A;  4NTF A;  3QVY A;  5KYU B;  4XEF A;  1G4U S;  3DAG A;  4EBK A;  3X1O A;  1FFT C;  2BC5 A;  3EHM A;  2A6E F;  3NYL A;  1OR3 A;  3JZ0 A;  4GQH A;  1HE1 A;  1L3P A;  2ZXP A;  2NG1 A;  2XLE A;  2WL8 A;  3PHF 2;  1H9T A;  4G7O F;  3K1H A;  1T5O A;  1OW6 A;  2EIL C;  1MND A;  2YL7 A;  2EIM C;  2YKZ A;  4C7O A;  4L6R A;  1Q0K A;  3U3F A;  1JAF A;  1G5Z A;  1HW1 A;  2CW0 F;  2J46 A;  3RW0 A;  1WAS A;  3CEX A;  5DVW A;  2CCY A;  1M2O A;  3EFO A;  5B1B C;  3ZTZ A;  2XL6 A;  1NFN A;  1LI7 A;  2ASR A;  4W8K A;  2WVQ A;  2KNH A;  3ECS A;  2J9B A;  3HLZ A;  2EIK C;  4KBL A;  3UNG C;  2A0B A;  1XZQ A;  2VB6 A;  4GEH A;  3X2Q C;  1HMO A;  2PX3 A;  4E17 A;  3DM5 A;  4EBB A;  1YA9 A;  3I5P A;  4R32 A;  2EIJ C;  4AE4 A;  2OJE D;  3DWW A;  1SF8 A;  1VOM A;  3HTK C;  4MVR A;  2J0X A;  4FWV A;  2I15 A;  2P6V A;  4D4N A;  1HW2 A;  3S90 A;  3C8G B;  2A68 F;  2YWA A;  2PX0 A;  1HY5 A;  2V3C C;  4JC7 A;  3E9V A;  2MHR A;  4AL1 A;  1S7Z A;  2Y3H A;  3K1I A;  2L7A A;  4ZLC A;  1N1C A;  3U8V A;  4DBR A;  1XZP A;  3KPH A;  4ONS A;  1SMY F;  3IQT A;  1VLT A;  5DQZ A;  1JR8 A;  3PCV A;  3C63 A;  2H7O A;  3T4R A;  3UGO A;  1QQ3 A;  4M63 A;  3OA1 A;  2J9V A;  5JS5 A;  1VTM P;  2VCA A;  2R03 A;  4CDA A;  1LS4 A;  2AU5 A;  2XLM A;  4MVQ A;  1Q0M A;  3RQE A;  3JCU Q;  5DS6 A;  4ZLD A;  3EGD B;  2QUP A;  3DJN B;  3M1C B;  4JUR I;  3EH2 A;  2AWY A;  2IOQ A;  3DMD A;  4EKW A;  5COF A;  1YYX A;  1PD0 A;  1LE2 A;  1T6I A;  2H8A A;  1RCP A;  2DI3 A;  2OJQ A;  3EZH A;  1ZW2 A;  4IAR A;  4JCH A;  4KC9 A;  4YL0 A;  3W8I A;  1K05 A;  1EKY A;  1F1M A;  2KGO A;  1MQV A;  2E87 A;  4U9E A;  5COG A;  1QKR A;  5K0I A;  1A41 A;  4JTD B;  4JJG A;  4MVS A;  5AC5 A;  3B0P A;  4U5B E;  3QZC A;  2YRF A;  1NBB A;  2PP4 A;  3OWT A;  5A6B A;  1JRA A;  4FX5 A;  4MW8 A;  3ASN C;  2MYS A;  4YT5 A;  3ZG1 A;  2ZXO A;  4JW1 A;  1W2W A;  1OCZ C;  4DOZ A;  1K04 A;  2J45 A;  3SXM A;  1WN0 A;  1H6G A;  1AVO B;  1EA8 A;  1OXB A;  2PBE A;  1YAU O;  1ZZP A;  3I5Q A;  4C3D A;  2JX0 A;  5L3Q A;  2XLW A;  5KYX A;  1U0B B;  4U9D A;  3FOP A;  4HEA J;  1WAT A;  1YJG A;  3NMK A;  4K7B A;  4XPY A;  4YL1 A;  3MYI A;  3RIP A;  3TD7 A;  4H54 A;  3U0C A;  2PF4 E;  1SR2 A;  1VLS A;  4ANJ A;  4BJT A;  2P0N A;  3O6X A;  1VYI A;  2WB7 A;  4CDV A;  3GOD A;  1KTM A;  4D4X A;  4B6I A;  3AQB A;  4E7S A;  2HSQ A;  3WHN A; 
#chains in the Genus database with same CATH homology
 2RD9 A;  1RXQ A;  2HKV A;  3CEX A;  2F22 A;  3QTH A;  2OQM A;  2YQY A;  5CIV A;  3DI5 A;  2QE9 A;  2NSF A;  2QNL A;  5COM A;  3GOR A;  4N6C A;  5COF A;  2OU6 A;  2P1A A;  5COG A;  3DKA A;  2NSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...