5CIVA

Sibling lethal factor precursor - dfsb
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
169
structure length
169
Chain Sequence
EYTSKEELKKTIHAAYLLLDGEFEGIDDSQKDNRVPEVDRTPAEIIAYQLGWLHLVMGWDRDELAGKPVIMPAPGYKWNQLGGLYQSFYAAYADLSLTELRRLFRDTERQWLDWIDTLSEEDLFTQSVRKWTGDKPNWPMARWIHINSAAPFKTFRAKIRKWKKHQRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
source organism Paenibacillus dendritiformis
molecule tags Unknown function
molecule keywords Sibling bacteriocin
total genus 68
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2015-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5civA00
2OU6A 4N6CA 2P1AA 2F22A 1RXQA 5COFA 2HKVA 2NSFA 2OQMA 3DI5A 5COGA 2QNLA 2QE9A 3GORA 2YQYA 5CIVA 3QTHA 2RD9A 3CEXA 3DKAA 5COMA 2NSGA
chains in the Genus database with same CATH superfamily
4AL0A 3RKOF 2Q9AA 3FHDA 2KC3A 2W45A 3KKBA 4MW8A 3W8IA 2M64A 2CGEA 1TFKB 1L3PA 3LAYA 4HE8D 1JOGA 2OJED 2HKVA 1Z3IX 2YL0A 1Q0DA 3HKKA 4FAPB 2NPUA 2Y39A 3L1MA 4PACA 2Q7RA 3VRCA 2EIKC 5E33A 3AQCA 3RQEA 5DQZA 3B71A 2R05A 2WVQA 3OA1A 2PP4A 2A69F 1VOMA 1T6QA 3FXHA 3L8JA 2WVNA 4O6MA 2J45A 1M2VB 2C04A 2CNWA 1R4TA 2EPKX 4A2NB 3I5PA 4XTKA 4ZLCA 4U5GA 1TKNA 3FVYA 3RIPA 3H2UA 1QVXA 3NRHA 4XEVA 2IXOA 3DM9B 2J0XA 3ZIBA 2EIJC 2WZGA 4N4WA 5KYUB 2YL3A 3U9JA 5HSWA 4P9TA 3G4XA 3C8GD 3VF0A 5KYXA 3MX3A 4AE4A 3PDMP 1WTYA 3HJCA 4DXWA 1EKYA 3C62A 3GWLA 4ER9A 1I4YA 2VC9A 3EGDB 2VH3A 3WHNA 1MNEA 5A6JA 3UGPA 2L6FA 4MVRA 4FESA 2XXAB 3F47A 4NTBA 5A69A 1IW7F 2UUHA 2J9UA 3DWWA 3HNJA 3QTHA 2HMZA 2R7VA 1LE4A 3OEOA 1M6TA 1APCA 1YA9A 2KGOA 1K40A 5E2QA 1RJ9A 3LNMB 4DBQA 1HMDA 1NFOA 1V54C 2AU5A 1VMAA 4OIRF 3V5ZA 1TQGA 2VB6A 3I4UA 1D1CA 1D0XA 4IAOA 1Q0MA 3ASOC 2XM0A 1NSGB 4CS8A 1QZXA 1YVIA 3U2MA 1EA8A 1O3UA 2GA0A 3JT1A 3M4CA 2A6HF 4CJGA 2OJQA 4P6IC 1FR0A 1ZW2A 2CW0F 1QQ3A 2XL8A 1SYQA 4DVYP 4PK4A 2EINC 2Q3TA 1BR4A 1NG1A 3DJUB 4NC3A 1K05A 2KSFA 2H7BA 2BC5A 3B29A 2YQYA 1KTMA 5EHHA 1YA7O 3SXMA 2XLDA 4QI0A 4EHPA 1Q0FA 4B6IA 3GM1A 4EWCA 5FCLA 1D0YA 3KYJA 4I3MA 5K0IA 3EGDA 1DOVA 3NKDA 2EPNA 2VASA 2XLOA 4OD5A 3GANA 4IJJA 2V26A 3GWNA 3E9VA 5KYUA 1H9GA 1V74B 3RYLA 3EFOB 4Z9JA 2R7RA 3JSEO 3L0IA 5KYWB 5L0GA 1OKKA 4IRUA 3C8GA 1ZZPA 1Z5ZA 5D91A 1BDJB 1ZU4A 1OCZC 2HMQA 1SF8A 2R25A 2YWAA 1BR2A 2OQMA 4RBNA 4D4NA 4EUKB 2XM4A 3DD7A 4OD4A 3RQGA 2QTVA 4CJOA 2R7WA 3CAXA 3WG7C 3SXZA 5GPGB 2G3VA 2ZXRA 4CBEA 3AG1C 2LD6A 2AWCA 4OIOF 1ST6A 1YLMA 3LJBA 4LLCA 1O87A 4O79A 3U2LA 4Q5SF 2R7UA 1C03A 1M2OA 1T6IA 2WB7A 4DRJB 1RKCA 3E70C 3ABMC 2XLVA 4NTFA 2ICWG 3VYWA 2A6EF 4BJ5C 4OIQF 1D1BA 4FWVA 3LEOA 3JSZA 4IARA 3RVYA 4U5BE 3LS0A 2HSBA 2W9YA 3EGXB 2Q9BA 3FOPA 3AQBA 3GEIA 3H2VA 4L6RA 3SXYA 1CGME 2MYSA 2X0CA 1PD0A 3O6XA 1H9TA 4Q4ZF 4KBLA 3ZVRA 3GORA 1JAFA 4WGYA 2IXPA 4Z9IA 2GFHA 1FAPB 3K7DA 3W8HA 4LDKA 2FFHA 3B0VC 2H7VC 2EPMX 2OKUA 4O6YA 2J9WA 2D4UA 2P6VA 3HNIA 3CZ6A 4M63A 3NMJA 3X2QC 4BJTA 2AP3A 2HJMA 1A7VA 1ZYRF 2IOQA 1H7IA 1UG7A 3IPMO 3G4ZA 1RXQA 4AK9A 2ZPAA 4OIPF 4NQFA 4CS8C 2A68F 2BL2A 3IHUA 2L81A 4H54A 1XWJA 3ABKC 3Q7GA 3WAQA 2NSFA 3BRJA 2P7VA 2MWQA 4JTAB 3DZAA 2KW3C 2P0NA 3U9MA 1LM3B 4XQ1A 256BA 4OINF 3ZQYA 3ZTMA 1MMAA 2Q00A 4PFOA 2YRFA 2A0UA 2ZXOA 1VTMP 4G7OF 2Q4FA 4CIHA 2LP4A 3IQTA 4YWQA 2GAQA 3L34A 2Z15A 2E87A 5KYNA 3A9CA 2WVOA 2LFFA 4PJLA 3UMIA 2FGYA 1FFHA 4CS9A 3T6GB 1VLSA 2G3KA 3SXKA 4CDAA 2YEVA 3FDQA 1D1AA 3T6BA 3AGTA 4GEHA 4QDLA 1ZU5A 4QI2A 1RKEA 4JW1A 4DRHB 3NYMA 1OQCA 2KYHA 5DQTA 2Y3DA 2NUTA 1R5ID 2DI3A 3HNKA 4ULWA 3BEHA 4WGZA 5JS5A 1QPUA 4HFKB 4U9DA 1V55C 4XLNF 2IBFA 2XSEA 4BEMJ 3R7CA 3LESA 2YVKA 3NYJA 4ONSA 4JVSA 3MFNA 3KL4A 2FAPB 3DI5A 3IQ6A 2AVKA 2OEXA 3FAJA 3ZTZA 1JPJA 1ZHXA 2BE5F 4EBBA 3RF3A 5DS6A 1CGNA 3KMIA 3IQ5A 5L0CA 2V3CC 2PX3A 3K1IC 1U6HA 2PX0A 2R03A 3SZRA 4DOZA 3TOMA 4WJ0A 2QY9A 3ZSUA 5L0DA 3EZHA 1YYXA 4MVSA 1SR2A 4YT2A 2DB4A 4YK5A 3UR3C 2H8AA 3ZQVA 5A6KA 1G8XA 3U5SA 1HMOA 2JPUA 3DAFA 2VCAA 2YL1A 4JE9A 4MS2A 3EZIA 3RH3A 4CX9A 5EGYA 1LIHA 2A1DD 3DE9A 2R7QA 4E18A 5L3QA 3LS1A 2KK1A 3LEVA 1SMYF 3ZWIA 5B3IA 4PR9A 3O39A 4KI2A 1WASA 3TQOA 2CNWD 4XPXA 1YZAA 5L0IA 1Z7Qc 2HS5A 1FMWA 3MYIA 3N0TA 4IAQA 1LPEA 1YZCA 1IZMA 1T9KA 4JCZA 3M79A 2R7SA 3MYFA 4EBKA 4F4BA 2R7TA 3S28A 4E17A 4U9EA 3EGXA 3EG9B 3TD7A 3TJ5A 1C02A 1E2XA 5DVWA 4YT5A 1T5OA 3QW1A 5AC4A 1OCRC 4YN0B 3ZC4A 2XL6A 3NYLA 4XPYA 1LVKA 1Z6AA 2DYRC 3ZDLA 3GEEA 4XLPF 2EIMC 4YL3A 1B68A 1HY5A 3S27A 3UMHA 5T3TA 3U8VA 4JZAA 1TWAA 2XLEA 3T6JA 2JD3A 5EK0A 4C3EA 3TK0A 2J0WA 1PCXA 5DLJA 1S7ZA 1G5ZA 2B0HA 1ZW3A 3JRMO 2GWWA 4K7BA 1YDIA 1A0BA 3FOOA 2PF4E 4MNDA 3C18A 5E3AA 1E85A 4PFPA 5DS4A 3QMKA 4JEBA 1T6UA 5COGA 3NDBB 1WATA 1NLXA 2YZSA 4E7SA 1LI5A 4J30B 3B0PA 1MQVA 3TULA 2I15A 1Q0KA 2HV7A 1W2WA 3CEXA 2P61A 2J8WA 3DAGA 4C3DA 1UFBA 3JTLO 4KC9A 4E0IA 5KYWA 1YARO 1GS9A 2OU6A 5JP7A 1MMDA 3K1HA 3IEEA 4CDYA 2F22A 4K0DA 3I5QA 1F1MA 2XLWA 1A7EA 2VCBA 3TOLA 4U5DE 1PD1A 2QLAA 3N24A 4BJ5A 2OCCC 1ZVZA 2J7PA 1I4ZA 2IXNA 3C7JA 3DJNB 1C17M 3IQCA 1E83A 4MVMA 3FAPB 4MVOA 4YT4A 2ZXWC 3LLIA 2WZLA 2KJGA 4MQ9F 4HFFB 1TWGA 5D92A 3NKEA 2B0JA 3V5XA 3EPVA 4Z9HA 2XLHA 2LIGA 1ZHWA 3HLZA 3Q7LA 1G4US 1H6GA 2AWYA 2YL7A 4JCHA 1LI7A 4W8PA 1ORSC 2LSEA 2WL8A 3VM6A 4BPMA 1BZ4A 3DKAA 3U3BA 1VLTA 2TMVP 4YL1A 3KH2A 4N06A 1PV3A 2NUPB 5TJ5E 3SYNA 5KYYA 1LE2A 3ATPA 4CSAC 3AJMA 4ANJA 4C7OB 4PJNA 4K1OA 4LDRA 3QW0A 2KNHA 5AGFA 1J8YF 4JJFA 4AL1A 1LKXA 4JKVA 5F28E 3B9QA 4MVUA 4BEJA 1NU9C 3AG3C 3K66A 1GGQA 1ORJA 3NMIA 4NY3A 1RJ9B 3N2ZB 5B1BC 3SNHA 3ASNC 1WGWA 2OOCA 1LS4A 1NU7D 3ZG1A 1E84A 2R7XA 4AX2A 2L9JA 1L7CA 4BG0A 1CGOA 1I5NA 3RVZA 4E0HA 3JCUQ 4ULVA 1NZEA 1N1CA 5B1AC 1JMWA 4MVQA 1MMNA 3EHNA 1EI7A 3EQLF 2G62A 1EQ1A 4O6NA 1XZQA 5JSLA 3TJ6A 3T4RA 2L6HA 1TWHA 1VYIA 3C63A 2DYSC 1LS1A 3AG2C 4RDAA 5COMA 4CDVA 1Z63A 1TR2A 1MMGA 3F46A 3GEHA 3SP1A 2QUPA 2M4EA 1V4AA 2NUTB 1Q0GA 3GODA 4AE4B 3FMSA 5HV9A 1FMVA 4A4AA 3LUTB 4N6CA 1RKEB 1VYKA 2Y3HA 2NG1A 2R02A 1NBBA 4BJ6A 3S29A 5T1DB 1ORYA 3EH1A 4DVZA 4ZLDA 3CSKA 4G7HF 3UNGC 4CSAA 1AEPA 4KNWA 3B0UX 3S0XA 5IY5C 4P9FA 1M2VA 3K6BA 1KU2A 1GM5A 1OR2A 3M4BA 2PFDA 4I1OB 5JT4A 1YYJA 3LLKA 4LLEA 2W4MA 2MHRA 1O5HA 3DMDA 4WABA 4W8KA 5FZTA 1M57C 2Y3GA 3HTKC 2UUIA 1Y6DA 3U8PA 3U0CA 2ZD9A 4U5HA 1KNYA 4FX5A 4C3BA 3G50A 4MTOA 4PJJA 3EHMA 3L8IA 4JC7A 2YKZA 1VB5A 1A7DA 3O55A 4JTDB 2ZXPA 3PMRA 1Z23A 4PJMA 2XXAA 2YLDA 1S05A 2L7AA 3OWTA 1CPQA 5L0FA 3T9OA 3ABLC 4KNVA 3LNRA 4IGGA 4U5FE 3U3FA 4NTAA 2D5RB 3EG9A 4DRIB 1NFNA 4YL0A 2LK4A 3Q6MA 3WODF 3NG1A 4XEFA 3W4YA 4JJGA 4N6HA 2L6GA 1G4WR 5JRAA 2R9RB 1OXKA 3Q6NA 4J7YA 4X0RA 4HEAJ 4EKWA 3QVYA 4J7TA 3KYIA 4BJ1A 2GDCA 2YHSA 2O9XA 4CS7A 3JYYA 1U0BB 1A41A 4GYTA 2W4BA 4R32A 4D4XA 4E7ZA 1YAUO 5T3WA 5L3VA 1WN0A 3CQZA 1AUEA 3PCVA 4JURI 1Y4CA 1D0ZA 1OCOC 1ZHYA 4JRZA 5L0HA 3K33A 3ECSA 4XWJA 1E86A 1J8MF 5CI9A 2X51A 2OG2A 2RSEB 4JEAA 4G7ZF 3ITFA 1JPNA 2J7PD 3MLGA 5COFA 5DS5A 2OEVA 4DJ9A 4XPWA 2ASRA 1BR1A 4GQHA 4CIPA 2IXMA 2H7OA 5A6AA 1OW6A 2Y69C 2WZFA 2ETSA 1ZHZA 2JX0A 2XLMA 3M1CB 3AGUA 3AOUA 3JZ0A 3JYHA 2QNLA 4EIYA 5CIVA 1FTSA 2XS8A 4NCQA 2DGJA 2RD9A 3NMKA 2HUJA 4IB4A 1U89A 3C8GB 1GQAA 2LCHA 5JVEA 3V7OA 5A6BD 2KQ9A 2YLGA 3DM5A 1JR8A 2IM8A 2LFDA 4YT8A 5BQHA 4I1MA 5BUOA 3EFOA 3RQFA 3R2PA 2XL4A 5JLIA 2P1AA 3W2VA 3GM2A 1OW7A 4LACB 4BJ6C 4G0HA 1K04A 3POVA 5A6BA 3SEOA 3V5YA 2IYLD 2CDQA 2I8BA 3W2WA 1QSPA 1RCPA 5AC5A 3QZCA 2LQGA 1WOLA 3S84A 4DBRA 2EILC 3JRTA 3KPHA 4EBJA 4LDQA 3J06A 1M56C 3HNLA 4J32B 2J46A 2HJ3A 4XEKA 3DXJF 3H65A 5L0JA 2CYDA 1CPRA 1OCCC 1AVOB 2PBEA 4MTFA 1XZPA 3K1IA 3M15A 4YJWA 3MBGA 5BQGA 1HE9A 1TWCA 3UMKA 2XRHA 4Q7CA 1ZHTA 2A0BA 2R7OA 4MVZA 1HW1A 1FNTc 1RMVA 2XS1A 3A11A 3US6A 2J9BA 4JIOA 1VK5A 3S90A 2J9VA 2HSQA 4U5EE 2HV6A 1FFTC 4C7OA 2EPOA 4H4KC 1BBHA 3EH2A 5KYYB 1SZIA 4LERA 2C03A 2NUPA 4O7GA 5BQIA 3C8ZA 5B3SC 1YJGA 1QKRA 2CCYA 5JUAA 2EPLX 1TFOB 1OKKD 4I44A 3RW0A 1JRAA 4UDVA 3RFYA 1WWPA 4IWBA 2YLIA 2Y3BA 3EJNA 1T01A 4JTCB 3GM3A 3AG4C 1QLEC 3PHF2 4MW3A 1OR3A 2VCCA 3QVZA 2QE9A 1HW2A 2PNOA 3O10A 4G78A 5CI8A 2Q9CA 1OW8A 1MNDA 1OXBA 2HFIA 2HZ8A 4MTGA 4U5CE 3S9OA 3VAYA 5F5FA 3DE8A 3X1OA 1HE1A 3UGOA 2NSGA 1DOWA 4CS9C 5KYXB 4RD9A 5F5HA 5E3CA
chains in the Genus database with same CATH topology
2OU6A 4N6CA 2P1AA 2F22A 1RXQA 5COFA 2HKVA 2NSFA 2OQMA 3DI5A 5COGA 2QNLA 2QE9A 3GORA 2YQYA 5CIVA 3QTHA 2RD9A 3CEXA 3DKAA 5COMA 2NSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OU6 A;  4N6C A;  2P1A A;  2F22 A;  1RXQ A;  5COF A;  2HKV A;  2NSF A;  2OQM A;  3DI5 A;  5COG A;  2QNL A;  2QE9 A;  3GOR A;  2YQY A;  5CIV A;  3QTH A;  2RD9 A;  3CEX A;  3DKA A;  5COM A;  2NSG A; 
#chains in the Genus database with same CATH topology
 4AL0 A;  3RKO F;  2Q9A A;  3FHD A;  2KC3 A;  2W45 A;  3KKB A;  4MW8 A;  3W8I A;  2M64 A;  2CGE A;  1TFK B;  1L3P A;  3LAY A;  4HE8 D;  1JOG A;  2OJE D;  2HKV A;  1Z3I X;  2YL0 A;  1Q0D A;  3HKK A;  4FAP B;  2NPU A;  2Y39 A;  3L1M A;  4PAC A;  2Q7R A;  3VRC A;  2EIK C;  5E33 A;  3AQC A;  3RQE A;  5DQZ A;  3B71 A;  2R05 A;  2WVQ A;  3OA1 A;  2PP4 A;  2A69 F;  1VOM A;  1T6Q A;  3FXH A;  3L8J A;  2WVN A;  4O6M A;  2J45 A;  1M2V B;  2C04 A;  2CNW A;  1R4T A;  2EPK X;  4A2N B;  3I5P A;  4XTK A;  4ZLC A;  4U5G A;  1TKN A;  3FVY A;  3RIP A;  3H2U A;  1QVX A;  3NRH A;  4XEV A;  2IXO A;  3DM9 B;  2J0X A;  3ZIB A;  2EIJ C;  2WZG A;  4N4W A;  5KYU B;  2YL3 A;  3U9J A;  5HSW A;  4P9T A;  3G4X A;  3C8G D;  3VF0 A;  5KYX A;  3MX3 A;  4AE4 A;  3PDM P;  1WTY A;  3HJC A;  4DXW A;  1EKY A;  3C62 A;  3GWL A;  4ER9 A;  1I4Y A;  2VC9 A;  3EGD B;  2VH3 A;  3WHN A;  1MNE A;  5A6J A;  3UGP A;  2L6F A;  4MVR A;  4FES A;  2XXA B;  3F47 A;  4NTB A;  5A69 A;  1IW7 F;  2UUH A;  2J9U A;  3DWW A;  3HNJ A;  3QTH A;  2HMZ A;  2R7V A;  1LE4 A;  3OEO A;  1M6T A;  1APC A;  1YA9 A;  2KGO A;  1K40 A;  5E2Q A;  1RJ9 A;  3LNM B;  4DBQ A;  1HMD A;  1NFO A;  1V54 C;  2AU5 A;  1VMA A;  4OIR F;  3V5Z A;  1TQG A;  2VB6 A;  3I4U A;  1D1C A;  1D0X A;  4IAO A;  1Q0M A;  3ASO C;  2XM0 A;  1NSG B;  4CS8 A;  1QZX A;  1YVI A;  3U2M A;  1EA8 A;  1O3U A;  2GA0 A;  3JT1 A;  3M4C A;  2A6H F;  4CJG A;  2OJQ A;  4P6I C;  1FR0 A;  1ZW2 A;  2CW0 F;  1QQ3 A;  2XL8 A;  1SYQ A;  4DVY P;  4PK4 A;  2EIN C;  2Q3T A;  1BR4 A;  1NG1 A;  3DJU B;  4NC3 A;  1K05 A;  2KSF A;  2H7B A;  2BC5 A;  3B29 A;  2YQY A;  1KTM A;  5EHH A;  1YA7 O;  3SXM A;  2XLD A;  4QI0 A;  4EHP A;  1Q0F A;  4B6I A;  3GM1 A;  4EWC A;  5FCL A;  1D0Y A;  3KYJ A;  4I3M A;  5K0I A;  3EGD A;  1DOV A;  3NKD A;  2EPN A;  2VAS A;  2XLO A;  4OD5 A;  3GAN A;  4IJJ A;  2V26 A;  3GWN A;  3E9V A;  5KYU A;  1H9G A;  1V74 B;  3RYL A;  3EFO B;  4Z9J A;  2R7R A;  3JSE O;  3L0I A;  5KYW B;  5L0G A;  1OKK A;  4IRU A;  3C8G A;  1ZZP A;  1Z5Z A;  5D91 A;  1BDJ B;  1ZU4 A;  1OCZ C;  2HMQ A;  1SF8 A;  2R25 A;  2YWA A;  1BR2 A;  2OQM A;  4RBN A;  4D4N A;  4EUK B;  2XM4 A;  3DD7 A;  4OD4 A;  3RQG A;  2QTV A;  4CJO A;  2R7W A;  3CAX A;  3WG7 C;  3SXZ A;  5GPG B;  2G3V A;  2ZXR A;  4CBE A;  3AG1 C;  2LD6 A;  2AWC A;  4OIO F;  1ST6 A;  1YLM A;  3LJB A;  4LLC A;  1O87 A;  4O79 A;  3U2L A;  4Q5S F;  2R7U A;  1C03 A;  1M2O A;  1T6I A;  2WB7 A;  4DRJ B;  1RKC A;  3E70 C;  3ABM C;  2XLV A;  4NTF A;  2ICW G;  3VYW A;  2A6E F;  4BJ5 C;  4OIQ F;  1D1B A;  4FWV A;  3LEO A;  3JSZ A;  4IAR A;  3RVY A;  4U5B E;  3LS0 A;  2HSB A;  2W9Y A;  3EGX B;  2Q9B A;  3FOP A;  3AQB A;  3GEI A;  3H2V A;  4L6R A;  3SXY A;  1CGM E;  2MYS A;  2X0C A;  1PD0 A;  3O6X A;  1H9T A;  4Q4Z F;  4KBL A;  3ZVR A;  3GOR A;  1JAF A;  4WGY A;  2IXP A;  4Z9I A;  2GFH A;  1FAP B;  3K7D A;  3W8H A;  4LDK A;  2FFH A;  3B0V C;  2H7V C;  2EPM X;  2OKU A;  4O6Y A;  2J9W A;  2D4U A;  2P6V A;  3HNI A;  3CZ6 A;  4M63 A;  3NMJ A;  3X2Q C;  4BJT A;  2AP3 A;  2HJM A;  1A7V A;  1ZYR F;  2IOQ A;  1H7I A;  1UG7 A;  3IPM O;  3G4Z A;  1RXQ A;  4AK9 A;  2ZPA A;  4OIP F;  4NQF A;  4CS8 C;  2A68 F;  2BL2 A;  3IHU A;  2L81 A;  4H54 A;  1XWJ A;  3ABK C;  3Q7G A;  3WAQ A;  2NSF A;  3BRJ A;  2P7V A;  2MWQ A;  4JTA B;  3DZA A;  2KW3 C;  2P0N A;  3U9M A;  1LM3 B;  4XQ1 A;  256B A;  4OIN F;  3ZQY A;  3ZTM A;  1MMA A;  2Q00 A;  4PFO A;  2YRF A;  2A0U A;  2ZXO A;  1VTM P;  4G7O F;  2Q4F A;  4CIH A;  2LP4 A;  3IQT A;  4YWQ A;  2GAQ A;  3L34 A;  2Z15 A;  2E87 A;  5KYN A;  3A9C A;  2WVO A;  2LFF A;  4PJL A;  3UMI A;  2FGY A;  1FFH A;  4CS9 A;  3T6G B;  1VLS A;  2G3K A;  3SXK A;  4CDA A;  2YEV A;  3FDQ A;  1D1A A;  3T6B A;  3AGT A;  4GEH A;  4QDL A;  1ZU5 A;  4QI2 A;  1RKE A;  4JW1 A;  4DRH B;  3NYM A;  1OQC A;  2KYH A;  5DQT A;  2Y3D A;  2NUT A;  1R5I D;  2DI3 A;  3HNK A;  4ULW A;  3BEH A;  4WGZ A;  5JS5 A;  1QPU A;  4HFK B;  4U9D A;  1V55 C;  4XLN F;  2IBF A;  2XSE A;  4BEM J;  3R7C A;  3LES A;  2YVK A;  3NYJ A;  4ONS A;  4JVS A;  3MFN A;  3KL4 A;  2FAP B;  3DI5 A;  3IQ6 A;  2AVK A;  2OEX A;  3FAJ A;  3ZTZ A;  1JPJ A;  1ZHX A;  2BE5 F;  4EBB A;  3RF3 A;  5DS6 A;  1CGN A;  3KMI A;  3IQ5 A;  5L0C A;  2V3C C;  2PX3 A;  3K1I C;  1U6H A;  2PX0 A;  2R03 A;  3SZR A;  4DOZ A;  3TOM A;  4WJ0 A;  2QY9 A;  3ZSU A;  5L0D A;  3EZH A;  1YYX A;  4MVS A;  1SR2 A;  4YT2 A;  2DB4 A;  4YK5 A;  3UR3 C;  2H8A A;  3ZQV A;  5A6K A;  1G8X A;  3U5S A;  1HMO A;  2JPU A;  3DAF A;  2VCA A;  2YL1 A;  4JE9 A;  4MS2 A;  3EZI A;  3RH3 A;  4CX9 A;  5EGY A;  1LIH A;  2A1D D;  3DE9 A;  2R7Q A;  4E18 A;  5L3Q A;  3LS1 A;  2KK1 A;  3LEV A;  1SMY F;  3ZWI A;  5B3I A;  4PR9 A;  3O39 A;  4KI2 A;  1WAS A;  3TQO A;  2CNW D;  4XPX A;  1YZA A;  5L0I A;  1Z7Q c;  2HS5 A;  1FMW A;  3MYI A;  3N0T A;  4IAQ A;  1LPE A;  1YZC A;  1IZM A;  1T9K A;  4JCZ A;  3M79 A;  2R7S A;  3MYF A;  4EBK A;  4F4B A;  2R7T A;  3S28 A;  4E17 A;  4U9E A;  3EGX A;  3EG9 B;  3TD7 A;  3TJ5 A;  1C02 A;  1E2X A;  5DVW A;  4YT5 A;  1T5O A;  3QW1 A;  5AC4 A;  1OCR C;  4YN0 B;  3ZC4 A;  2XL6 A;  3NYL A;  4XPY A;  1LVK A;  1Z6A A;  2DYR C;  3ZDL A;  3GEE A;  4XLP F;  2EIM C;  4YL3 A;  1B68 A;  1HY5 A;  3S27 A;  3UMH A;  5T3T A;  3U8V A;  4JZA A;  1TWA A;  2XLE A;  3T6J A;  2JD3 A;  5EK0 A;  4C3E A;  3TK0 A;  2J0W A;  1PCX A;  5DLJ A;  1S7Z A;  1G5Z A;  2B0H A;  1ZW3 A;  3JRM O;  2GWW A;  4K7B A;  1YDI A;  1A0B A;  3FOO A;  2PF4 E;  4MND A;  3C18 A;  5E3A A;  1E85 A;  4PFP A;  5DS4 A;  3QMK A;  4JEB A;  1T6U A;  5COG A;  3NDB B;  1WAT A;  1NLX A;  2YZS A;  4E7S A;  1LI5 A;  4J30 B;  3B0P A;  1MQV A;  3TUL A;  2I15 A;  1Q0K A;  2HV7 A;  1W2W A;  3CEX A;  2P61 A;  2J8W A;  3DAG A;  4C3D A;  1UFB A;  3JTL O;  4KC9 A;  4E0I A;  5KYW A;  1YAR O;  1GS9 A;  2OU6 A;  5JP7 A;  1MMD A;  3K1H A;  3IEE A;  4CDY A;  2F22 A;  4K0D A;  3I5Q A;  1F1M A;  2XLW A;  1A7E A;  2VCB A;  3TOL A;  4U5D E;  1PD1 A;  2QLA A;  3N24 A;  4BJ5 A;  2OCC C;  1ZVZ A;  2J7P A;  1I4Z A;  2IXN A;  3C7J A;  3DJN B;  1C17 M;  3IQC A;  1E83 A;  4MVM A;  3FAP B;  4MVO A;  4YT4 A;  2ZXW C;  3LLI A;  2WZL A;  2KJG A;  4MQ9 F;  4HFF B;  1TWG A;  5D92 A;  3NKE A;  2B0J A;  3V5X A;  3EPV A;  4Z9H A;  2XLH A;  2LIG A;  1ZHW A;  3HLZ A;  3Q7L A;  1G4U S;  1H6G A;  2AWY A;  2YL7 A;  4JCH A;  1LI7 A;  4W8P A;  1ORS C;  2LSE A;  2WL8 A;  3VM6 A;  4BPM A;  1BZ4 A;  3DKA A;  3U3B A;  1VLT A;  2TMV P;  4YL1 A;  3KH2 A;  4N06 A;  1PV3 A;  2NUP B;  5TJ5 E;  3SYN A;  5KYY A;  1LE2 A;  3ATP A;  4CSA C;  3AJM A;  4ANJ A;  4C7O B;  4PJN A;  4K1O A;  4LDR A;  3QW0 A;  2KNH A;  5AGF A;  1J8Y F;  4JJF A;  4AL1 A;  1LKX A;  4JKV A;  5F28 E;  3B9Q A;  4MVU A;  4BEJ A;  1NU9 C;  3AG3 C;  3K66 A;  1GGQ A;  1ORJ A;  3NMI A;  4NY3 A;  1RJ9 B;  3N2Z B;  5B1B C;  3SNH A;  3ASN C;  1WGW A;  2OOC A;  1LS4 A;  1NU7 D;  3ZG1 A;  1E84 A;  2R7X A;  4AX2 A;  2L9J A;  1L7C A;  4BG0 A;  1CGO A;  1I5N A;  3RVZ A;  4E0H A;  3JCU Q;  4ULV A;  1NZE A;  1N1C A;  5B1A C;  1JMW A;  4MVQ A;  1MMN A;  3EHN A;  1EI7 A;  3EQL F;  2G62 A;  1EQ1 A;  4O6N A;  1XZQ A;  5JSL A;  3TJ6 A;  3T4R A;  2L6H A;  1TWH A;  1VYI A;  3C63 A;  2DYS C;  1LS1 A;  3AG2 C;  4RDA A;  5COM A;  4CDV A;  1Z63 A;  1TR2 A;  1MMG A;  3F46 A;  3GEH A;  3SP1 A;  2QUP A;  2M4E A;  1V4A A;  2NUT B;  1Q0G A;  3GOD A;  4AE4 B;  3FMS A;  5HV9 A;  1FMV A;  4A4A A;  3LUT B;  4N6C A;  1RKE B;  1VYK A;  2Y3H A;  2NG1 A;  2R02 A;  1NBB A;  4BJ6 A;  3S29 A;  5T1D B;  1ORY A;  3EH1 A;  4DVZ A;  4ZLD A;  3CSK A;  4G7H F;  3UNG C;  4CSA A;  1AEP A;  4KNW A;  3B0U X;  3S0X A;  5IY5 C;  4P9F A;  1M2V A;  3K6B A;  1KU2 A;  1GM5 A;  1OR2 A;  3M4B A;  2PFD A;  4I1O B;  5JT4 A;  1YYJ A;  3LLK A;  4LLE A;  2W4M A;  2MHR A;  1O5H A;  3DMD A;  4WAB A;  4W8K A;  5FZT A;  1M57 C;  2Y3G A;  3HTK C;  2UUI A;  1Y6D A;  3U8P A;  3U0C A;  2ZD9 A;  4U5H A;  1KNY A;  4FX5 A;  4C3B A;  3G50 A;  4MTO A;  4PJJ A;  3EHM A;  3L8I A;  4JC7 A;  2YKZ A;  1VB5 A;  1A7D A;  3O55 A;  4JTD B;  2ZXP A;  3PMR A;  1Z23 A;  4PJM A;  2XXA A;  2YLD A;  1S05 A;  2L7A A;  3OWT A;  1CPQ A;  5L0F A;  3T9O A;  3ABL C;  4KNV A;  3LNR A;  4IGG A;  4U5F E;  3U3F A;  4NTA A;  2D5R B;  3EG9 A;  4DRI B;  1NFN A;  4YL0 A;  2LK4 A;  3Q6M A;  3WOD F;  3NG1 A;  4XEF A;  3W4Y A;  4JJG A;  4N6H A;  2L6G A;  1G4W R;  5JRA A;  2R9R B;  1OXK A;  3Q6N A;  4J7Y A;  4X0R A;  4HEA J;  4EKW A;  3QVY A;  4J7T A;  3KYI A;  4BJ1 A;  2GDC A;  2YHS A;  2O9X A;  4CS7 A;  3JYY A;  1U0B B;  1A41 A;  4GYT A;  2W4B A;  4R32 A;  4D4X A;  4E7Z A;  1YAU O;  5T3W A;  5L3V A;  1WN0 A;  3CQZ A;  1AUE A;  3PCV A;  4JUR I;  1Y4C A;  1D0Z A;  1OCO C;  1ZHY A;  4JRZ A;  5L0H A;  3K33 A;  3ECS A;  4XWJ A;  1E86 A;  1J8M F;  5CI9 A;  2X51 A;  2OG2 A;  2RSE B;  4JEA A;  4G7Z F;  3ITF A;  1JPN A;  2J7P D;  3MLG A;  5COF A;  5DS5 A;  2OEV A;  4DJ9 A;  4XPW A;  2ASR A;  1BR1 A;  4GQH A;  4CIP A;  2IXM A;  2H7O A;  5A6A A;  1OW6 A;  2Y69 C;  2WZF A;  2ETS A;  1ZHZ A;  2JX0 A;  2XLM A;  3M1C B;  3AGU A;  3AOU A;  3JZ0 A;  3JYH A;  2QNL A;  4EIY A;  5CIV A;  1FTS A;  2XS8 A;  4NCQ A;  2DGJ A;  2RD9 A;  3NMK A;  2HUJ A;  4IB4 A;  1U89 A;  3C8G B;  1GQA A;  2LCH A;  5JVE A;  3V7O A;  5A6B D;  2KQ9 A;  2YLG A;  3DM5 A;  1JR8 A;  2IM8 A;  2LFD A;  4YT8 A;  5BQH A;  4I1M A;  5BUO A;  3EFO A;  3RQF A;  3R2P A;  2XL4 A;  5JLI A;  2P1A A;  3W2V A;  3GM2 A;  1OW7 A;  4LAC B;  4BJ6 C;  4G0H A;  1K04 A;  3POV A;  5A6B A;  3SEO A;  3V5Y A;  2IYL D;  2CDQ A;  2I8B A;  3W2W A;  1QSP A;  1RCP A;  5AC5 A;  3QZC A;  2LQG A;  1WOL A;  3S84 A;  4DBR A;  2EIL C;  3JRT A;  3KPH A;  4EBJ A;  4LDQ A;  3J06 A;  1M56 C;  3HNL A;  4J32 B;  2J46 A;  2HJ3 A;  4XEK A;  3DXJ F;  3H65 A;  5L0J A;  2CYD A;  1CPR A;  1OCC C;  1AVO B;  2PBE A;  4MTF A;  1XZP A;  3K1I A;  3M15 A;  4YJW A;  3MBG A;  5BQG A;  1HE9 A;  1TWC A;  3UMK A;  2XRH A;  4Q7C A;  1ZHT A;  2A0B A;  2R7O A;  4MVZ A;  1HW1 A;  1FNT c;  1RMV A;  2XS1 A;  3A11 A;  3US6 A;  2J9B A;  4JIO A;  1VK5 A;  3S90 A;  2J9V A;  2HSQ A;  4U5E E;  2HV6 A;  1FFT C;  4C7O A;  2EPO A;  4H4K C;  1BBH A;  3EH2 A;  5KYY B;  1SZI A;  4LER A;  2C03 A;  2NUP A;  4O7G A;  5BQI A;  3C8Z A;  5B3S C;  1YJG A;  1QKR A;  2CCY A;  5JUA A;  2EPL X;  1TFO B;  1OKK D;  4I44 A;  3RW0 A;  1JRA A;  4UDV A;  3RFY A;  1WWP A;  4IWB A;  2YLI A;  2Y3B A;  3EJN A;  1T01 A;  4JTC B;  3GM3 A;  3AG4 C;  1QLE C;  3PHF 2;  4MW3 A;  1OR3 A;  2VCC A;  3QVZ A;  2QE9 A;  1HW2 A;  2PNO A;  3O10 A;  4G78 A;  5CI8 A;  2Q9C A;  1OW8 A;  1MND A;  1OXB A;  2HFI A;  2HZ8 A;  4MTG A;  4U5C E;  3S9O A;  3VAY A;  5F5F A;  3DE8 A;  3X1O A;  1HE1 A;  3UGO A;  2NSG A;  1DOW A;  4CS9 C;  5KYX B;  4RD9 A;  5F5H A;  5E3C A; 
#chains in the Genus database with same CATH homology
 2OU6 A;  4N6C A;  2P1A A;  2F22 A;  1RXQ A;  5COF A;  2HKV A;  2NSF A;  2OQM A;  3DI5 A;  5COG A;  2QNL A;  2QE9 A;  3GOR A;  2YQY A;  5CIV A;  3QTH A;  2RD9 A;  3CEX A;  3DKA A;  5COM A;  2NSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...