5CIVA

Sibling lethal factor precursor - dfsb
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
169
structure length
169
Chain Sequence
EYTSKEELKKTIHAAYLLLDGEFEGIDDSQKDNRVPEVDRTPAEIIAYQLGWLHLVMGWDRDELAGKPVIMPAPGYKWNQLGGLYQSFYAAYADLSLTELRRLFRDTERQWLDWIDTLSEEDLFTQSVRKWTGDKPNWPMARWIHINSAAPFKTFRAKIRKWKKHQRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sibling bacteriocin
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
source organism Paenibacillus dendritiformis
molecule tags Unknown function
total genus 68
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2015-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5civA00
2RD9A 2OU6A 2NSFA 2NSGA 5COFA 5COMA 5COGA 2HKVA 3DI5A 2QNLA 2F22A 2QE9A 3DKAA 4N6CA 2OQMA 2P1AA 3GORA 3QTHA 1RXQA 5CIVA 3CEXA 2YQYA
chains in the Genus database with same CATH superfamily
2IXPA 2NUPA 4MVOA 3T6GB 3VAYA 3O55A 1NFNA 2Q00A 3SNHA 5L0CA 1LE2A 1B68A 2FFHA 1MNEA 3I5PA 3HTKC 3JCUQ 4O6MA 1T01A 3GWLA 1RCPA 4JTDB 4ULVA 3ZTMA 1BR4A 4BJ6A 5KYWA 5E3AA 2PP4A 5K0IA 1RMVA 4QI2A 2CYDA 5L3QA 4J7TA 1H7IA 3KYIA 4O6YA 3B0PA 3U2LA 1SMYF 1M57C 1LM3B 1FMVA 1FAPB 3LNMB 3UMIA 1Q0MA 4MQ9F 3LNRA 4NY3A 4K1OA 3SYNA 3HNIA 2OEVA 4L6RA 2H7VC 1CPQA 1SF8A 3EFOB 4JTCB 4KBLA 3C63A 3JZ0A 4HE8D 4IWBA 5T3WA 256BA 4O6NA 4E7ZA 4LLCA 4CBEA 2NSGA 1V74B 5COFA 2EPKX 3FAPB 1R4TA 2PNOA 4DXWA 1YDIA 3C18A 1T9KA 2HV6A 2V26A 2YEVA 2WZFA 1VYKA 2YVKA 3ABLC 2WVQA 3H2UA 5KYNA 4YT5A 1RJ9B 3HJCA 3L0IA 5F28E 2LD6A 4OIRF 2EIJC 2GFHA 2A6EF 2YLIA 4CSAC 2R7SA 3AQBA 3IQCA 2W45A 2NUPB 2OQMA 3DWWA 1H9GA 1OW7A 2Y3HA 3K1IC 2A69F 3HNKA 4MTGA 2X51A 1A0BA 4WGYA 3F46A 3E70C 3ZQVA 4YT2A 2R7UA 1Y4CA 2OEXA 3RVYA 4BG0A 4DRJB 1OW6A 2I15A 5DS4A 5KYWB 3JYHA 3LEOA 2D5RB 3K66A 2J9VA 2YQYA 2ZXOA 4KNVA 4PFOA 2CW0F 2KC3A 4XPYA 3EZHA 5IY5C 1MMDA 2BC5A 3GODA 2XS1A 2VH3A 3OA1A 4XPXA 3DM5A 1QZXA 1JAFA 3RW0A 4EKWA 4MVZA 4K0DA 4OIOF 3TK0A 2R7TA 4JRZA 3RVZA 2HKVA 3GWNA 4NC3A 4FAPB 3H65A 3QVZA 3U0CA 1FTSA 4RBNA 1TWAA 3CAXA 3U8PA 4DJ9A 2EIKC 5A6JA 3G4ZA 3L1MA 1EKYA 1HMOA 2EILC 2QY9A 3V5ZA 2KSFA 1KU2A 2L6GA 3TQOA 4A2NB 2EINC 3AG1C 1ST6A 4ER9A 4XEFA 3CQZA 3MYIA 3G50A 3US6A 2YL7A 1WATA 3DAFA 4E0HA 1Z63A 2HV7A 2UUIA 3C8GD 4JW1A 3AG3C 5B1AC 5B1BC 1U89A 1OCZC 5A6BA 1D1CA 4FESA 2AWCA 3SZRA 3EPVA 1WTYA 1VOMA 4U5GA 2M64A 1FFTC 2ZXRA 1PD1A 3UMKA 4E0IA 4Q7CA 1G4US 2VC9A 4ULWA 5KYUA 2Q7RA 3ZIBA 4C3EA 5JLIA 4UDVA 5A6AA 2HSBA 2P0NA 3L8IA 2O9XA 4MVQA 4Q4ZF 4N4WA 1TFKB 3QW1A 5HSWA 2P61A 4BEMJ 2BE5F 3TOMA 3Q7GA 3DKAA 2Q9CA 3LEVA 4YL3A 3CSKA 1OXKA 2HJ3A 2XLMA 3U3FA 4DBRA 2J46A 1O3UA 1KNYA 2P1AA 3EJNA 4G7HF 3NYLA 2GWWA 4OD5A 1T6UA 2PBEA 3AGTA 3GEHA 3L8JA 1C03A 2L81A 1M56C 1WGWA 3JTLO 1YYJA 4RDAA 2RD9A 5KYXA 3M4BA 1LKXA 2AP3A 5DQTA 4N06A 2H7BA 5EK0A 2EIMC 1L3PA 5JSLA 5E33A 2PX3A 2LQGA 1TKNA 2R7OA 1AVOB 3M4CA 1WWPA 2PFDA 3L34A 3FMSA 4A4AA 1LE4A 2J9UA 5D92A 1GGQA 2ZXWC 1EA8A 4CDYA 5JUAA 3RQEA 3TOLA 4G7ZF 3N24A 1ORSC 2GAQA 1T6IA 2KK1A 2MYSA 3UMHA 4AL0A 1M2OA 1MMNA 3K7DA 4O79A 1NBBA 2A68F 1AUEA 3G4XA 3S90A 3ZC4A 2M4EA 2CNWA 3ABKC 1QKRA 3E9VA 2ZPAA 3QZCA 4JTAB 3U2MA 5KYUB 1H9TA 1A41A 3WODF 1NZEA 1BBHA 1ORYA 3Q6NA 3M79A 1PD0A 3NG1A 5T3TA 2P6VA 1MNDA 2W4MA 3QVYA 1ZW2A 4CJGA 4EHPA 3AOUA 3EGXB 3IHUA 1MQVA 4EIYA 4KI2A 4ONSA 4GQHA 3H2VA 5E2QA 2G3VA 1Z3IX 1LVKA 3GEIA 2A0UA 4CS8A 1VLTA 1Q0GA 2YL1A 2WB7A 2J9WA 1V4AA 3FOPA 4W8KA 2Q4FA 4XLNF 2LSEA 2Y69C 2IXOA 2XM4A 3EH2A 4EWCA 4CDAA 3B0VC 1TR2A 5KYXB 1DOVA 3SXMA 3AGUA 4JZAA 3U8VA 4BJ1A 2GDCA 4N6HA 1CGME 5AC4A 1YA9A 3MBGA 4CJOA 3DD7A 1LIHA 4I44A 1VTMP 4E17A 4BJTA 3B9QA 2J7PA 4HFKB 4MVRA 3RYLA 3B29A 4CS8C 4BJ6C 1YLMA 3N2ZB 2R7VA 4HEAJ 2YWAA 1L7CA 2J9BA 1W2WA 1I5NA 2XRHA 4FWVA 5GPGB 4AK9A 4CS7A 3KH2A 1JPJA 3RKOF 3ZQYA 3DXJF 4DVZA 1HMDA 5AC5A 3IEEA 4H4KC 1KTMA 3DM9B 3LS0A 5EHHA 3EG9A 5FCLA 3W8HA 3K6BA 1SR2A 1E85A 1QQ3A 2XSEA 1V55C 3BEHA 3S28A 3ZVRA 1ZHYA 2EPNA 4IJJA 4EBJA 1N1CA 3B0UX 3IQ6A 3V5YA 4XTKA 4YN0B 2ICWG 3KMIA 2D4UA 4ANJA 2VCBA 4WGZA 5E3CA 2PF4E 5F5FA 2LIGA 2YL3A 5BUOA 1ZHWA 2WVOA 3RQFA 4G7OF 3O6XA 2L9JA 4I1MA 1VYIA 1Z23A 4LACB 2NUTB 1SZIA 1QPUA 3T6BA 3PDMP 2R7WA 2IXNA 4U5CE 4PR9A 4LDKA 3W2VA 1FR0A 4YWQA 2JPUA 5JT4A 4Q5SF 4J7YA 4JIOA 2OJQA 2Y3BA 1AEPA 1ORJA 2R7QA 3GANA 1OKKA 2QLAA 4GYTA 1Z6AA 5DLJA 4F4BA 1FNTc 2XXAA 3EHMA 2W9YA 1M2VA 3A11A 4I1OB 4XPWA 4JJGA 3C7JA 2WZGA 1C02A 1ZHTA 3QTHA 4Z9IA 4IGGA 1K40A 4MS2A 2E87A 3LUTB 5HV9A 1GM5A 1ZU4A 3HNJA 2L7AA 1FFHA 4BJ5A 3VM6A 1UFBA 1A7VA 2XLHA 5FZTA 2UUHA 4JVSA 4WABA 3ECSA 2G3KA 3S0XA 1WASA 2CDQA 1YAUO 2A1DD 2IOQA 1A7EA 3EG9B 4P6IC 4QDLA 3JRMO 4XEKA 3RFYA 3HKKA 3JYYA 3Q7LA 4Z9HA 1QVXA 2YRFA 2VCCA 2NG1A 2YLDA 1OR2A 3JT1A 2G62A 3S27A 2QNLA 1O5HA 2Y3GA 2CGEA 2F22A 3AG2C 2QE9A 4R32A 4U5FE 4CIHA 4QI0A 1YJGA 4YL0A 3EGXA 4DOZA 5B3SC 1S05A 3DMDA 2QTVA 2R05A 4MNDA 2WVNA 2R02A 3GORA 1J8YF 3GEEA 1A7DA 1RKEA 2GA0A 4NTAA 1CGNA 2HUJA 5A6BD 4PFPA 1SYQA 3NMKA 2B0HA 3VYWA 1H6GA 2R03A 4NTBA 4PJLA 1JOGA 2Q9AA 2XL6A 3T4RA 4CS9A 1ZHZA 2OU6A 1ZZPA 4M63A 3MFNA 2W4BA 3IPMO 1CGOA 1LS4A 1D0XA 2XL4A 3I4UA 4RD9A 2XXAB 3FOOA 3FAJA 2DYRC 1M2VB 1NSGB 3IQTA 4JE9A 4MW8A 4XEVA 3U3BA 4OIQF 1EQ1A 4DRIB 5DS5A 2V3CC 1HY5A 3B71A 1JMWA 1GS9A 1BZ4A 1O87A 2OG2A 1IZMA 2Y3DA 3KYJA 4MVUA 4E18A 1XZPA 2TMVP 2OJED 5D91A 4AE4A 4CX9A 3F47A 3HLZA 1PV3A 2H7OA 3QMKA 5L0FA 1LPEA 2LCHA 1TFOB 5CI8A 2ETSA 3W4YA 3MYFA 4P9FA 4ZLCA 1J8MF 2LFDA 2DB4A 4HFFB 1HE9A 3FXHA 3LLIA 2EPOA 4PJNA 2IYLD 3X1OA 2KJGA 2KQ9A 1LS1A 5DS6A 1WN0A 2RSEB 5JP7A 1EI7A 2L6FA 3AG4C 2YKZA 3DE9A 3K1HA 3ZDLA 4G0HA 1UG7A 4JEAA 2YHSA 3U9MA 3RIPA 1LI5A 3GM2A 3ASOC 1RKEB 4JKVA 4PK4A 2IXMA 1FMWA 1G4WR 2J0XA 1BDJB 1APCA 5A6KA 1BR1A 2NUTA 4D4NA 2EPLX 2HZ8A 2Y39A 4YK5A 2XLEA 2XLVA 4C3BA 2CNWD 3NKEA 4OIPF 4EBKA 1VLSA 5DVWA 2AU5A 4MTFA 5BQIA 4KNWA 3V5XA 3LJBA 3R2PA 2QUPA 2YLGA 4JCZA 4U9DA 1HW2A 4O7GA 3JRTA 1E2XA 4WJ0A 2Q3TA 3UGOA 4IAQA 2LFFA 1NU9C 3KKBA 4AL1A 3EGDA 4BEJA 5JS5A 4MVMA 1G8XA 1I4ZA 2KW3C 3JSZA 1Q0KA 2DYSC 2LK4A 2OCCC 3Q6MA 1QSPA 1ZHXA 5COMA 4JJFA 3I5QA 2KYHA 4AE4B 1QLEC 1TWHA 3DJUB 3ZTZA 1Q0DA 3FVYA 4YT8A 4XLPF 1LI7A 1OCOC 2OOCA 3NMJA 3U5SA 2XL8A 1YZCA 3SXYA 3HNLA 4CSAA 3W2WA 5F5HA 1XWJA 4W8PA 2AVKA 4XWJA 5DQZA 3RF3A 4C7OA 3K1IA 2YZSA 2ZXPA 3KPHA 3LLKA 2OKUA 3EZIA 4XQ1A 3POVA 1MMAA 2EPMX 2HFIA 2ASRA 5CI9A 3FDQA 1D0YA 2J7PD 1ZU5A 3PCVA 1E86A 1G5ZA 4BPMA 2C04A 2VASA 3OWTA 4JEBA 4P9TA 2A6HF 2B0JA 2WZLA 3FHDA 3WHNA 4U5HA 1MMGA 1XZQA 5JVEA 3SXZA 1YYXA 1T6QA 1ZW3A 1D1AA 5L0HA 4I3MA 1ZYRF 3M1CB 1GQAA 1F1MA 4JC7A 3ZG1A 1Q0FA 3EGDB 2DGJA 2J45A 2Q9BA 4EBBA 2Z15A 4LDRA 4K7BA 1WOLA 3WAQA 1VMAA 1TWGA 2AWYA 4E7SA 1JRAA 3T9OA 3TJ6A 3ZWIA 4DRHB 3J06A 3VRCA 4YT4A 3VF0A 2XLOA 2XM0A 3NYJA 3DE8A 1YVIA 4FX5A 3C8GA 1YARO 3TULA 4J30B 1U0BB 3NMIA 2WL8A 1K04A 2J0WA 2NSFA 3ZSUA 3LAYA 4YL1A 4CDVA 4DVYP 3A9CA 2R7XA 5COGA 2FGYA 1OQCA 1YZAA 3DZAA 1U6HA 1K05A 2JD3A 3EQLF 3DI5A 3S9OA 1OKKD 4DBQA 4C7OB 2DI3A 4J32B 3AJMA 1NFOA 1TQGA 2HMQA 3BRJA 3CZ6A 4NQFA 3TD7A 4MVSA 4D4XA 3ABMC 4IAOA 1HE1A 1HW1A 1NG1A 4U5EE 5JRAA 1IW7F 1NLXA 4KC9A 3NRHA 3GM3A 5L0JA 4U5DE 3X2QC 3MX3A 4H54A 4BJ5C 4PACA 3NYMA 2KGOA 3KL4A 5CIVA 3W8IA 3CEXA 3M15A 3DAGA 3ATPA 2PX0A 2R9RB 1D1BA 3S84A 4PJJA 5KYYB 2MWQA 1BR2A 2VCAA 5T1DB 3SP1A 3UR3C 2CCYA 5AGFA 5KYYA 1JR8A 1PCXA 2P7VA 1YA7O 5L0GA 1OXBA 1Y6DA 3U9JA 4U9EA 2XS8A 3QW0A 3N0TA 1JPNA 4ZLDA 1CPRA 3V7OA 1Z7Qc 1OR3A 3MLGA 1VB5A 1R5ID 4AX2A 1E84A 1NU7D 5EGYA 3LESA 1DOWA 3JSEO 3C8GB 2HJMA 2A0BA 4YJWA 1TWCA 3C8ZA 1VK5A 2ZD9A 4GEHA 5BQGA 1D0ZA 3O39A 3UNGC 4B6IA 4IARA 5L0IA 1E83A 3S29A 2XLWA 5L3VA 2XLDA 3SXKA 1S7ZA 2BL2A 1V54C 1T5OA 2L6HA 4OD4A 3EH1A 4CIPA 4IRUA 3R7CA 5TJ5E 4CS9C 1RXQA 3SEOA 3C62A 3WG7C 3AQCA 2HMZA 3PMRA 2IM8A 3ASNC 3RQGA 1ZVZA 4PJMA 1I4YA 3IQ5A 1OCRC 2KNHA 2LP4A 1OCCC 3OEOA 4LLEA 1RKCA 4NCQA 2FAPB 3K33A 5L0DA 4MTOA 4LERA 2HS5A 4Z9JA 4OINF 2VB6A 2H8AA 3EFOA 4LDQA 5BQHA 3O10A 3LS1A 1C17M 2NPUA 4NTFA 1M6TA 3PHF2 2C03A 5A69A 2X0CA 2IBFA 1OW8A 2MHRA 4G78A 2YL0A 4N6CA 3TJ5A 4MW3A 4IB4A 3RH3A 3T6JA 3NDBB 3UGPA 2J8WA 2JX0A 3EHNA 2R7RA 4EUKB 1RJ9A 3GM1A 4JCHA 4X0RA 4C3DA 2HSQA 1Z5ZA 3DJNB 3NKDA 5B3IA 2I8BA 3ITFA 4JURI 2R25A 4U5BE
chains in the Genus database with same CATH topology
2RD9A 2OU6A 2NSFA 2NSGA 5COFA 5COMA 5COGA 2HKVA 3DI5A 2QNLA 2F22A 2QE9A 3DKAA 4N6CA 2OQMA 2P1AA 3GORA 3QTHA 1RXQA 5CIVA 3CEXA 2YQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RD9 A;  2OU6 A;  2NSF A;  2NSG A;  5COF A;  5COM A;  5COG A;  2HKV A;  3DI5 A;  2QNL A;  2F22 A;  2QE9 A;  3DKA A;  4N6C A;  2OQM A;  2P1A A;  3GOR A;  3QTH A;  1RXQ A;  5CIV A;  3CEX A;  2YQY A; 
#chains in the Genus database with same CATH topology
 2IXP A;  2NUP A;  4MVO A;  3T6G B;  3VAY A;  3O55 A;  1NFN A;  2Q00 A;  3SNH A;  5L0C A;  1LE2 A;  1B68 A;  2FFH A;  1MNE A;  3I5P A;  3HTK C;  3JCU Q;  4O6M A;  1T01 A;  3GWL A;  1RCP A;  4JTD B;  4ULV A;  3ZTM A;  1BR4 A;  4BJ6 A;  5KYW A;  5E3A A;  2PP4 A;  5K0I A;  1RMV A;  4QI2 A;  2CYD A;  5L3Q A;  4J7T A;  1H7I A;  3KYI A;  4O6Y A;  3B0P A;  3U2L A;  1SMY F;  1M57 C;  1LM3 B;  1FMV A;  1FAP B;  3LNM B;  3UMI A;  1Q0M A;  4MQ9 F;  3LNR A;  4NY3 A;  4K1O A;  3SYN A;  3HNI A;  2OEV A;  4L6R A;  2H7V C;  1CPQ A;  1SF8 A;  3EFO B;  4JTC B;  4KBL A;  3C63 A;  3JZ0 A;  4HE8 D;  4IWB A;  5T3W A;  256B A;  4O6N A;  4E7Z A;  4LLC A;  4CBE A;  2NSG A;  1V74 B;  5COF A;  2EPK X;  3FAP B;  1R4T A;  2PNO A;  4DXW A;  1YDI A;  3C18 A;  1T9K A;  2HV6 A;  2V26 A;  2YEV A;  2WZF A;  1VYK A;  2YVK A;  3ABL C;  2WVQ A;  3H2U A;  5KYN A;  4YT5 A;  1RJ9 B;  3HJC A;  3L0I A;  5F28 E;  2LD6 A;  4OIR F;  2EIJ C;  2GFH A;  2A6E F;  2YLI A;  4CSA C;  2R7S A;  3AQB A;  3IQC A;  2W45 A;  2NUP B;  2OQM A;  3DWW A;  1H9G A;  1OW7 A;  2Y3H A;  3K1I C;  2A69 F;  3HNK A;  4MTG A;  2X51 A;  1A0B A;  4WGY A;  3F46 A;  3E70 C;  3ZQV A;  4YT2 A;  2R7U A;  1Y4C A;  2OEX A;  3RVY A;  4BG0 A;  4DRJ B;  1OW6 A;  2I15 A;  5DS4 A;  5KYW B;  3JYH A;  3LEO A;  2D5R B;  3K66 A;  2J9V A;  2YQY A;  2ZXO A;  4KNV A;  4PFO A;  2CW0 F;  2KC3 A;  4XPY A;  3EZH A;  5IY5 C;  1MMD A;  2BC5 A;  3GOD A;  2XS1 A;  2VH3 A;  3OA1 A;  4XPX A;  3DM5 A;  1QZX A;  1JAF A;  3RW0 A;  4EKW A;  4MVZ A;  4K0D A;  4OIO F;  3TK0 A;  2R7T A;  4JRZ A;  3RVZ A;  2HKV A;  3GWN A;  4NC3 A;  4FAP B;  3H65 A;  3QVZ A;  3U0C A;  1FTS A;  4RBN A;  1TWA A;  3CAX A;  3U8P A;  4DJ9 A;  2EIK C;  5A6J A;  3G4Z A;  3L1M A;  1EKY A;  1HMO A;  2EIL C;  2QY9 A;  3V5Z A;  2KSF A;  1KU2 A;  2L6G A;  3TQO A;  4A2N B;  2EIN C;  3AG1 C;  1ST6 A;  4ER9 A;  4XEF A;  3CQZ A;  3MYI A;  3G50 A;  3US6 A;  2YL7 A;  1WAT A;  3DAF A;  4E0H A;  1Z63 A;  2HV7 A;  2UUI A;  3C8G D;  4JW1 A;  3AG3 C;  5B1A C;  5B1B C;  1U89 A;  1OCZ C;  5A6B A;  1D1C A;  4FES A;  2AWC A;  3SZR A;  3EPV A;  1WTY A;  1VOM A;  4U5G A;  2M64 A;  1FFT C;  2ZXR A;  1PD1 A;  3UMK A;  4E0I A;  4Q7C A;  1G4U S;  2VC9 A;  4ULW A;  5KYU A;  2Q7R A;  3ZIB A;  4C3E A;  5JLI A;  4UDV A;  5A6A A;  2HSB A;  2P0N A;  3L8I A;  2O9X A;  4MVQ A;  4Q4Z F;  4N4W A;  1TFK B;  3QW1 A;  5HSW A;  2P61 A;  4BEM J;  2BE5 F;  3TOM A;  3Q7G A;  3DKA A;  2Q9C A;  3LEV A;  4YL3 A;  3CSK A;  1OXK A;  2HJ3 A;  2XLM A;  3U3F A;  4DBR A;  2J46 A;  1O3U A;  1KNY A;  2P1A A;  3EJN A;  4G7H F;  3NYL A;  2GWW A;  4OD5 A;  1T6U A;  2PBE A;  3AGT A;  3GEH A;  3L8J A;  1C03 A;  2L81 A;  1M56 C;  1WGW A;  3JTL O;  1YYJ A;  4RDA A;  2RD9 A;  5KYX A;  3M4B A;  1LKX A;  2AP3 A;  5DQT A;  4N06 A;  2H7B A;  5EK0 A;  2EIM C;  1L3P A;  5JSL A;  5E33 A;  2PX3 A;  2LQG A;  1TKN A;  2R7O A;  1AVO B;  3M4C A;  1WWP A;  2PFD A;  3L34 A;  3FMS A;  4A4A A;  1LE4 A;  2J9U A;  5D92 A;  1GGQ A;  2ZXW C;  1EA8 A;  4CDY A;  5JUA A;  3RQE A;  3TOL A;  4G7Z F;  3N24 A;  1ORS C;  2GAQ A;  1T6I A;  2KK1 A;  2MYS A;  3UMH A;  4AL0 A;  1M2O A;  1MMN A;  3K7D A;  4O79 A;  1NBB A;  2A68 F;  1AUE A;  3G4X A;  3S90 A;  3ZC4 A;  2M4E A;  2CNW A;  3ABK C;  1QKR A;  3E9V A;  2ZPA A;  3QZC A;  4JTA B;  3U2M A;  5KYU B;  1H9T A;  1A41 A;  3WOD F;  1NZE A;  1BBH A;  1ORY A;  3Q6N A;  3M79 A;  1PD0 A;  3NG1 A;  5T3T A;  2P6V A;  1MND A;  2W4M A;  3QVY A;  1ZW2 A;  4CJG A;  4EHP A;  3AOU A;  3EGX B;  3IHU A;  1MQV A;  4EIY A;  4KI2 A;  4ONS A;  4GQH A;  3H2V A;  5E2Q A;  2G3V A;  1Z3I X;  1LVK A;  3GEI A;  2A0U A;  4CS8 A;  1VLT A;  1Q0G A;  2YL1 A;  2WB7 A;  2J9W A;  1V4A A;  3FOP A;  4W8K A;  2Q4F A;  4XLN F;  2LSE A;  2Y69 C;  2IXO A;  2XM4 A;  3EH2 A;  4EWC A;  4CDA A;  3B0V C;  1TR2 A;  5KYX B;  1DOV A;  3SXM A;  3AGU A;  4JZA A;  3U8V A;  4BJ1 A;  2GDC A;  4N6H A;  1CGM E;  5AC4 A;  1YA9 A;  3MBG A;  4CJO A;  3DD7 A;  1LIH A;  4I44 A;  1VTM P;  4E17 A;  4BJT A;  3B9Q A;  2J7P A;  4HFK B;  4MVR A;  3RYL A;  3B29 A;  4CS8 C;  4BJ6 C;  1YLM A;  3N2Z B;  2R7V A;  4HEA J;  2YWA A;  1L7C A;  2J9B A;  1W2W A;  1I5N A;  2XRH A;  4FWV A;  5GPG B;  4AK9 A;  4CS7 A;  3KH2 A;  1JPJ A;  3RKO F;  3ZQY A;  3DXJ F;  4DVZ A;  1HMD A;  5AC5 A;  3IEE A;  4H4K C;  1KTM A;  3DM9 B;  3LS0 A;  5EHH A;  3EG9 A;  5FCL A;  3W8H A;  3K6B A;  1SR2 A;  1E85 A;  1QQ3 A;  2XSE A;  1V55 C;  3BEH A;  3S28 A;  3ZVR A;  1ZHY A;  2EPN A;  4IJJ A;  4EBJ A;  1N1C A;  3B0U X;  3IQ6 A;  3V5Y A;  4XTK A;  4YN0 B;  2ICW G;  3KMI A;  2D4U A;  4ANJ A;  2VCB A;  4WGZ A;  5E3C A;  2PF4 E;  5F5F A;  2LIG A;  2YL3 A;  5BUO A;  1ZHW A;  2WVO A;  3RQF A;  4G7O F;  3O6X A;  2L9J A;  4I1M A;  1VYI A;  1Z23 A;  4LAC B;  2NUT B;  1SZI A;  1QPU A;  3T6B A;  3PDM P;  2R7W A;  2IXN A;  4U5C E;  4PR9 A;  4LDK A;  3W2V A;  1FR0 A;  4YWQ A;  2JPU A;  5JT4 A;  4Q5S F;  4J7Y A;  4JIO A;  2OJQ A;  2Y3B A;  1AEP A;  1ORJ A;  2R7Q A;  3GAN A;  1OKK A;  2QLA A;  4GYT A;  1Z6A A;  5DLJ A;  4F4B A;  1FNT c;  2XXA A;  3EHM A;  2W9Y A;  1M2V A;  3A11 A;  4I1O B;  4XPW A;  4JJG A;  3C7J A;  2WZG A;  1C02 A;  1ZHT A;  3QTH A;  4Z9I A;  4IGG A;  1K40 A;  4MS2 A;  2E87 A;  3LUT B;  5HV9 A;  1GM5 A;  1ZU4 A;  3HNJ A;  2L7A A;  1FFH A;  4BJ5 A;  3VM6 A;  1UFB A;  1A7V A;  2XLH A;  5FZT A;  2UUH A;  4JVS A;  4WAB A;  3ECS A;  2G3K A;  3S0X A;  1WAS A;  2CDQ A;  1YAU O;  2A1D D;  2IOQ A;  1A7E A;  3EG9 B;  4P6I C;  4QDL A;  3JRM O;  4XEK A;  3RFY A;  3HKK A;  3JYY A;  3Q7L A;  4Z9H A;  1QVX A;  2YRF A;  2VCC A;  2NG1 A;  2YLD A;  1OR2 A;  3JT1 A;  2G62 A;  3S27 A;  2QNL A;  1O5H A;  2Y3G A;  2CGE A;  2F22 A;  3AG2 C;  2QE9 A;  4R32 A;  4U5F E;  4CIH A;  4QI0 A;  1YJG A;  4YL0 A;  3EGX A;  4DOZ A;  5B3S C;  1S05 A;  3DMD A;  2QTV A;  2R05 A;  4MND A;  2WVN A;  2R02 A;  3GOR A;  1J8Y F;  3GEE A;  1A7D A;  1RKE A;  2GA0 A;  4NTA A;  1CGN A;  2HUJ A;  5A6B D;  4PFP A;  1SYQ A;  3NMK A;  2B0H A;  3VYW A;  1H6G A;  2R03 A;  4NTB A;  4PJL A;  1JOG A;  2Q9A A;  2XL6 A;  3T4R A;  4CS9 A;  1ZHZ A;  2OU6 A;  1ZZP A;  4M63 A;  3MFN A;  2W4B A;  3IPM O;  1CGO A;  1LS4 A;  1D0X A;  2XL4 A;  3I4U A;  4RD9 A;  2XXA B;  3FOO A;  3FAJ A;  2DYR C;  1M2V B;  1NSG B;  3IQT A;  4JE9 A;  4MW8 A;  4XEV A;  3U3B A;  4OIQ F;  1EQ1 A;  4DRI B;  5DS5 A;  2V3C C;  1HY5 A;  3B71 A;  1JMW A;  1GS9 A;  1BZ4 A;  1O87 A;  2OG2 A;  1IZM A;  2Y3D A;  3KYJ A;  4MVU A;  4E18 A;  1XZP A;  2TMV P;  2OJE D;  5D91 A;  4AE4 A;  4CX9 A;  3F47 A;  3HLZ A;  1PV3 A;  2H7O A;  3QMK A;  5L0F A;  1LPE A;  2LCH A;  1TFO B;  5CI8 A;  2ETS A;  3W4Y A;  3MYF A;  4P9F A;  4ZLC A;  1J8M F;  2LFD A;  2DB4 A;  4HFF B;  1HE9 A;  3FXH A;  3LLI A;  2EPO A;  4PJN A;  2IYL D;  3X1O A;  2KJG A;  2KQ9 A;  1LS1 A;  5DS6 A;  1WN0 A;  2RSE B;  5JP7 A;  1EI7 A;  2L6F A;  3AG4 C;  2YKZ A;  3DE9 A;  3K1H A;  3ZDL A;  4G0H A;  1UG7 A;  4JEA A;  2YHS A;  3U9M A;  3RIP A;  1LI5 A;  3GM2 A;  3ASO C;  1RKE B;  4JKV A;  4PK4 A;  2IXM A;  1FMW A;  1G4W R;  2J0X A;  1BDJ B;  1APC A;  5A6K A;  1BR1 A;  2NUT A;  4D4N A;  2EPL X;  2HZ8 A;  2Y39 A;  4YK5 A;  2XLE A;  2XLV A;  4C3B A;  2CNW D;  3NKE A;  4OIP F;  4EBK A;  1VLS A;  5DVW A;  2AU5 A;  4MTF A;  5BQI A;  4KNW A;  3V5X A;  3LJB A;  3R2P A;  2QUP A;  2YLG A;  4JCZ A;  4U9D A;  1HW2 A;  4O7G A;  3JRT A;  1E2X A;  4WJ0 A;  2Q3T A;  3UGO A;  4IAQ A;  2LFF A;  1NU9 C;  3KKB A;  4AL1 A;  3EGD A;  4BEJ A;  5JS5 A;  4MVM A;  1G8X A;  1I4Z A;  2KW3 C;  3JSZ A;  1Q0K A;  2DYS C;  2LK4 A;  2OCC C;  3Q6M A;  1QSP A;  1ZHX A;  5COM A;  4JJF A;  3I5Q A;  2KYH A;  4AE4 B;  1QLE C;  1TWH A;  3DJU B;  3ZTZ A;  1Q0D A;  3FVY A;  4YT8 A;  4XLP F;  1LI7 A;  1OCO C;  2OOC A;  3NMJ A;  3U5S A;  2XL8 A;  1YZC A;  3SXY A;  3HNL A;  4CSA A;  3W2W A;  5F5H A;  1XWJ A;  4W8P A;  2AVK A;  4XWJ A;  5DQZ A;  3RF3 A;  4C7O A;  3K1I A;  2YZS A;  2ZXP A;  3KPH A;  3LLK A;  2OKU A;  3EZI A;  4XQ1 A;  3POV A;  1MMA A;  2EPM X;  2HFI A;  2ASR A;  5CI9 A;  3FDQ A;  1D0Y A;  2J7P D;  1ZU5 A;  3PCV A;  1E86 A;  1G5Z A;  4BPM A;  2C04 A;  2VAS A;  3OWT A;  4JEB A;  4P9T A;  2A6H F;  2B0J A;  2WZL A;  3FHD A;  3WHN A;  4U5H A;  1MMG A;  1XZQ A;  5JVE A;  3SXZ A;  1YYX A;  1T6Q A;  1ZW3 A;  1D1A A;  5L0H A;  4I3M A;  1ZYR F;  3M1C B;  1GQA A;  1F1M A;  4JC7 A;  3ZG1 A;  1Q0F A;  3EGD B;  2DGJ A;  2J45 A;  2Q9B A;  4EBB A;  2Z15 A;  4LDR A;  4K7B A;  1WOL A;  3WAQ A;  1VMA A;  1TWG A;  2AWY A;  4E7S A;  1JRA A;  3T9O A;  3TJ6 A;  3ZWI A;  4DRH B;  3J06 A;  3VRC A;  4YT4 A;  3VF0 A;  2XLO A;  2XM0 A;  3NYJ A;  3DE8 A;  1YVI A;  4FX5 A;  3C8G A;  1YAR O;  3TUL A;  4J30 B;  1U0B B;  3NMI A;  2WL8 A;  1K04 A;  2J0W A;  2NSF A;  3ZSU A;  3LAY A;  4YL1 A;  4CDV A;  4DVY P;  3A9C A;  2R7X A;  5COG A;  2FGY A;  1OQC A;  1YZA A;  3DZA A;  1U6H A;  1K05 A;  2JD3 A;  3EQL F;  3DI5 A;  3S9O A;  1OKK D;  4DBQ A;  4C7O B;  2DI3 A;  4J32 B;  3AJM A;  1NFO A;  1TQG A;  2HMQ A;  3BRJ A;  3CZ6 A;  4NQF A;  3TD7 A;  4MVS A;  4D4X A;  3ABM C;  4IAO A;  1HE1 A;  1HW1 A;  1NG1 A;  4U5E E;  5JRA A;  1IW7 F;  1NLX A;  4KC9 A;  3NRH A;  3GM3 A;  5L0J A;  4U5D E;  3X2Q C;  3MX3 A;  4H54 A;  4BJ5 C;  4PAC A;  3NYM A;  2KGO A;  3KL4 A;  5CIV A;  3W8I A;  3CEX A;  3M15 A;  3DAG A;  3ATP A;  2PX0 A;  2R9R B;  1D1B A;  3S84 A;  4PJJ A;  5KYY B;  2MWQ A;  1BR2 A;  2VCA A;  5T1D B;  3SP1 A;  3UR3 C;  2CCY A;  5AGF A;  5KYY A;  1JR8 A;  1PCX A;  2P7V A;  1YA7 O;  5L0G A;  1OXB A;  1Y6D A;  3U9J A;  4U9E A;  2XS8 A;  3QW0 A;  3N0T A;  1JPN A;  4ZLD A;  1CPR A;  3V7O A;  1Z7Q c;  1OR3 A;  3MLG A;  1VB5 A;  1R5I D;  4AX2 A;  1E84 A;  1NU7 D;  5EGY A;  3LES A;  1DOW A;  3JSE O;  3C8G B;  2HJM A;  2A0B A;  4YJW A;  1TWC A;  3C8Z A;  1VK5 A;  2ZD9 A;  4GEH A;  5BQG A;  1D0Z A;  3O39 A;  3UNG C;  4B6I A;  4IAR A;  5L0I A;  1E83 A;  3S29 A;  2XLW A;  5L3V A;  2XLD A;  3SXK A;  1S7Z A;  2BL2 A;  1V54 C;  1T5O A;  2L6H A;  4OD4 A;  3EH1 A;  4CIP A;  4IRU A;  3R7C A;  5TJ5 E;  4CS9 C;  1RXQ A;  3SEO A;  3C62 A;  3WG7 C;  3AQC A;  2HMZ A;  3PMR A;  2IM8 A;  3ASN C;  3RQG A;  1ZVZ A;  4PJM A;  1I4Y A;  3IQ5 A;  1OCR C;  2KNH A;  2LP4 A;  1OCC C;  3OEO A;  4LLE A;  1RKC A;  4NCQ A;  2FAP B;  3K33 A;  5L0D A;  4MTO A;  4LER A;  2HS5 A;  4Z9J A;  4OIN F;  2VB6 A;  2H8A A;  3EFO A;  4LDQ A;  5BQH A;  3O10 A;  3LS1 A;  1C17 M;  2NPU A;  4NTF A;  1M6T A;  3PHF 2;  2C03 A;  5A69 A;  2X0C A;  2IBF A;  1OW8 A;  2MHR A;  4G78 A;  2YL0 A;  4N6C A;  3TJ5 A;  4MW3 A;  4IB4 A;  3RH3 A;  3T6J A;  3NDB B;  3UGP A;  2J8W A;  2JX0 A;  3EHN A;  2R7R A;  4EUK B;  1RJ9 A;  3GM1 A;  4JCH A;  4X0R A;  4C3D A;  2HSQ A;  1Z5Z A;  3DJN B;  3NKD A;  5B3I A;  2I8B A;  3ITF A;  4JUR I;  2R25 A;  4U5B E; 
#chains in the Genus database with same CATH homology
 2RD9 A;  2OU6 A;  2NSF A;  2NSG A;  5COF A;  5COM A;  5COG A;  2HKV A;  3DI5 A;  2QNL A;  2F22 A;  2QE9 A;  3DKA A;  4N6C A;  2OQM A;  2P1A A;  3GOR A;  3QTH A;  1RXQ A;  5CIV A;  3CEX A;  2YQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...