5CIVA

Sibling lethal factor precursor - dfsb
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
169
structure length
169
Chain Sequence
b'EYTSKEELKKTIHAAYLLLDGEFEGIDDSQKDNRVPEVDRTPAEIIAYQLGWLHLVMGWDRDELAGKPVIMPAPGYKWNQLGGLYQSFYAAYADLSLTELRRLFRDTERQWLDWIDTLSEEDLFTQSVRKWTGDKPNWPMARWIHINSAAPFKTFRAKIRKWKKHQRQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sibling bacteriocin
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
source organism Paenibacillus dendritiformis
molecule tags Unknown function
total genus 68
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2015-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5civA00
3CEXA 2NSGA 2F22A 4N6CA 2NSFA 2OQMA 2OU6A 5COGA 3QTHA 2RD9A 5COMA 5COFA 2P1AA 3GORA 2QE9A 5CIVA 3DI5A 2YQYA 1RXQA 3DKAA 2QNLA 2HKVA
chains in the Genus database with same CATH superfamily
5L0FA 1CGME 1XZQA 3KYJA 4OIQF 3T6JA 3ABLC 3W8HA 3S27A 3O55A 4JCHA 3ZC4A 5L0JA 2HSBA 4HFFB 4U5FE 3ZSUA 1OCZC 1HY5A 1C17M 4O79A 2D4UA 2ZXRA 1TKNA 2XLWA 3JYHA 3OWTA 3DWWA 3LEOA 1H9GA 1M2VA 4IRUA 4MW3A 1T6UA 4NC3A 4QDLA 1H7IA 2JX0A 2I15A 3IHUA 3FAJA 4BJ6C 4HFKB 4EIYA 5IY5C 1FTSA 1MNEA 1ST6A 2OJED 5AC5A 1K05A 3FXHA 1XWJA 3EJNA 4C3BA 5AC4A 1TWHA 2MWQA 5BQHA 1DOVA 4LDQA 3R2PA 4DJ9A 2XLDA 3G50A 3V7OA 1T5OA 4ANJA 2J46A 2H7VC 1LIHA 1OW8A 1T6QA 2CW0F 2R03A 2VCAA 4JW1A 4Z9HA 3FVYA 4DVYP 1Z63A 4U5CE 1OR2A 2HJMA 1CPQA 1YAUO 4WGYA 4MNDA 3Q6MA 1Z5ZA 4N6HA 2O9XA 1HE1A 4YJWA 5JSLA 2Q00A 2A1DD 3UGPA 5JRAA 3ABKC 3X1OA 3WODF 2P1AA 3QW1A 2OEVA 3RKOF 1OCCC 3GWLA 1V54C 3GWNA 3IQ5A 4IJJA 3TJ5A 2L6FA 5DVWA 1ZU5A 5L3QA 2XLVA 3DAGA 4Z9JA 4E17A 2CDQA 2HJ3A 5L0CA 4CS7A 1PV3A 4Q4ZF 1G4WR 2PX0A 1V74B 4GEHA 1ORYA 4JTAB 3EGXB 4DRHB 5JS5A 4C7OA 2J9VA 4CDYA 4OIRF 2MHRA 1ZW2A 2HV7A 1TFOB 2XM0A 1K04A 3EGDA 5B1BC 4YT2A 4D4NA 1BR4A 3DE8A 1KU2A 2I8BA 4YT8A 3HTKC 1OKKA 3AG1C 3M4CA 4LLCA 1D1BA 2A0UA 2IXPA 2X51A 3KYIA 1JMWA 1VB5A 2GA0A 3EFOB 3LS0A 4YWQA 4GQHA 2R7XA 4YL0A 1D0YA 4IAOA 3UR3C 2Q3TA 3M15A 1A7VA 3RH3A 1EI7A 3C7JA 5T3TA 1ZHZA 2ASRA 2VASA 3EGXA 1FNTc 3S84A 4CBEA 5EHHA 3ATPA 1SR2A 2QE9A 3ITFA 3K1IC 1PD1A 2R7OA 1AUEA 4W8KA 3RQEA 4R32A 2A0BA 3SXYA 4JCZA 3S0XA 4H4KC 1VYIA 3L8JA 3WHNA 4F4BA 2R9RB 3DM9B 1BZ4A 2HS5A 2P61A 2VCBA 3K33A 1Y4CA 5A69A 5KYNA 3FHDA 1VK5A 1FFHA 2XSEA 4BJ5A 3ECSA 1T9KA 2EPLX 1JOGA 2GFHA 4C3EA 3QMKA 3ABMC 3ZTZA 1G4US 4KC9A 4CDAA 3LEVA 4KBLA 3RFYA 1OXKA 2R7VA 1A7DA 5T1DB 2NUTB 2IXNA 3C63A 3RF3A 4JC7A 3RIPA 2D5RB 2V26A 2R05A 1M56C 3EG9A 3RQGA 4AK9A 1ZHTA 3DJNB 3IPMO 4MVOA 1Q0KA 4BJ5C 1RCPA 3U0CA 2LFFA 1YA7O 5EGYA 1LKXA 3RVZA 2CNWA 2IM8A 4EBKA 3DI5A 1D0ZA 4JTDB 4EBJA 2EPOA 3JRTA 4U5BE 1U6HA 3V5ZA 2HV6A 4MVUA 2EINC 2KQ9A 2M4EA 2XRHA 3I4UA 4MW8A 1G5ZA 5A6JA 2J0WA 2HZ8A 4NQFA 2XS8A 4PACA 4AL0A 3U2LA 4A4AA 1OW7A 1YDIA 4AL1A 1TWCA 1VYKA 4MVMA 2DGJA 1EQ1A 2UUIA 4X0RA 2PNOA 2QUPA 4A2NB 4G7ZF 3QVZA 4LDRA 5L0DA 3PCVA 1KTMA 4JVSA 2WB7A 3JSEO 2YZSA 4MS2A 4IARA 1LI5A 1D1CA 4MVQA 5E2QA 5KYYB 5JUAA 4EKWA 2AU5A 2XM4A 2Q7RA 3H65A 1T01A 4JTCB 3KKBA 3HNKA 5E3AA 1I4ZA 3IQ6A 3KPHA 3O39A 2PBEA 2XL4A 2WVQA 3L34A 1RKEB 3AJMA 1NFOA 2Y3DA 1Q0MA 3CQZA 3NKEA 2HMZA 4OD5A 5KYWA 4ULWA 4JEAA 3V5YA 3DJUB 2LP4A 3O10A 1NLXA 2FAPB 5KYYA 2Q9BA 4PFPA 2R7WA 1NU9C 3ZIBA 2XLMA 2X0CA 4N6CA 1UG7A 3VRCA 2R02A 2ZXOA 3LS1A 2W4MA 2C03A 4FAPB 3GM3A 3PDMP 1M57C 2ZPAA 1JPNA 2WZLA 4OD4A 4XPYA 1OCOC 5F5HA 1YA9A 3HJCA 2R25A 4J30B 3SNHA 3OA1A 4E7ZA 4XLNF 2YL1A 4OIPF 3FOPA 4AE4B 1OQCA 3WG7C 2QLAA 4MVSA 3HNJA 2DYRC 4PJLA 2OJQA 2E87A 3DAFA 2KK1A 4Q7CA 1VTMP 3LESA 4N06A 5GPGB 4MVRA 4G7OF 2R7QA 5B3SC 3FMSA 4XEVA 1RKCA 1C03A 3B9QA 1Q0FA 2H7BA 1OW6A 4C3DA 1YZAA 4AE4A 3S90A 3NYJA 4ER9A 3LNMB 4O7GA 3E70C 2A68F 4NTBA 3O6XA 3QTHA 3SXZA 3TK0A 4U9DA 2G3VA 1OKKD 1YARO 2B0HA 2FGYA 2L9JA 3C8ZA 1O5HA 1V55C 2YHSA 3LJBA 2ZXWC 2YWAA 2DB4A 2Q9AA 2EIMC 4O6YA 5A6BD 1QLEC 1LE4A 1WN0A 3EHNA 1LI7A 3S9OA 5CIVA 3JSZA 2ICWG 3ASOC 1D1AA 2YVKA 1A41A 2VB6A 4PR9A 1B68A 4P6IC 2YL3A 4PK4A 5CI8A 3SXMA 2LFDA 2IXOA 5T3WA 3W2WA 1K40A 3NMKA 1ZW3A 3K1IA 4CS8A 3NKDA 4PJMA 2IXMA 2PF4E 2XLOA 3ZQVA 2NG1A 4CS9C 3FDQA 1ORSC 2R7UA 1HMDA 2PFDA 2H8AA 3AQCA 3CSKA 1EKYA 1QVXA 1T6IA 1NFNA 4JEBA 4MTFA 4YT5A 4J32B 1E85A 3J06A 2OKUA 3C8GD 2YRFA 4UDVA 2W45A 3EQLF 3DD7A 2J45A 4JE9A 3W8IA 256BA 5A6KA 1ZHWA 4BPMA 4CS8C 4DOZA 4YT4A 4I44A 3EZHA 1RXQA 3AG4C 2EIJC 1YLMA 1YVIA 3CZ6A 3EFOA 1E2XA 2ZD9A 3IEEA 3NMJA 1FAPB 3AGTA 4JIOA 3M79A 1D0XA 2VH3A 1HE9A 3K6BA 4WJ0A 3UMHA 2CNWD 4D4XA 1OCRC 1F1MA 4M63A 4CJGA 4K1OA 2NSGA 3TOLA 5FCLA 3NDBB 4RBNA 1H9TA 3QZCA 2EPMX 4U5DE 4MTOA 2J9UA 2J9BA 4C7OB 1EA8A 5K0IA 1OXBA 5HV9A 3AOUA 3IQCA 1TWGA 2KNHA 1GS9A 1Z6AA 1L7CA 4L6RA 1TWAA 1ZVZA 2L6GA 2KW3C 4U5HA 4XEFA 1CPRA 4MQ9F 2Q9CA 2GDCA 3B0PA 1MQVA 3MX3A 3T6BA 2WZGA 4P9FA 2L81A 3NYMA 3T6GB 5L0IA 3C18A 3DE9A 3G4XA 3NRHA 3ZDLA 1Q0DA 2OOCA 3GM2A 3DKAA 1C02A 4CS9A 2Y3GA 2QNLA 2G3KA 2XS1A 1E84A 4WGZA 1S05A 2Y69C 4DXWA 2NUTA 1AEPA 1VMAA 1A0BA 2LIGA 2W4BA 3U3BA 3EPVA 2CCYA 2QTVA 2XLEA 3UMKA 3LAYA 4DRJB 1E86A 1Z7Qc 2NUPB 3WAQA 1MMNA 5D91A 5JT4A 2CYDA 3TD7A 5BUOA 2HUJA 2LD6A 1NSGB 2NPUA 2KYHA 1VLSA 1SZIA 3HNIA 3HNLA 1Z23A 3RQFA 3NYLA 3KL4A 3C62A 1J8YF 2C04A 5COFA 3GORA 1U0BB 3SYNA 2R7RA 3G4ZA 3JYYA 1S7ZA 4U5EE 3MYFA 3MFNA 2A6EF 2JPUA 1LPEA 3JTLO 3K66A 1MMDA 3LUTB 4LLEA 5HSWA 5FZTA 5D92A 4E7SA 1JRAA 2YLGA 4B6IA 1ZHXA 2Z15A 4U5GA 2XXAB 2CGEA 2IBFA 4KNVA 2OCCC 2QY9A 3DM5A 4CJOA 2ZXPA 3A11A 3K1HA 1M2OA 1MMGA 4O6MA 2EIKC 2LK4A 4MVZA 1JPJA 3AGUA 1LS1A 4HE8D 4YL3A 5CI9A 2L7AA 5F28E 4DBRA 2J0XA 1CGNA 2RD9A 1RKEA 3GEHA 3H2VA 3JT1A 2UUHA 3HKKA 5L3VA 1WATA 1NZEA 1GGQA 1Z3IX 2AVKA 3B29A 1J8MF 3HLZA 4P9TA 4XQ1A 4DBQA 4WABA 5DS6A 1TR2A 4JURI 3FAPB 3LLKA 2OEXA 4J7YA 5KYXB 3ZWIA 3U8VA 2MYSA 2Y39A 2YQYA 3KH2A 3KMIA 3S29A 3H2UA 4H54A 1YJGA 4K0DA 1VOMA 2J8WA 3S28A 4ZLDA 3DZAA 3E9VA 2XLHA 4CIPA 1NG1A 1U89A 1WTYA 1ZZPA 3ASNC 3GANA 2ETSA 2YL7A 4FX5A 3BRJA 2EILC 3OEOA 2F22A 2J7PA 3EHMA 1QZXA 3U9JA 3ZQYA 3U9MA 4BEMJ 4BJ1A 2TMVP 3EH2A 2OU6A 3TJ6A 1R4TA 3Q7LA 1KNYA 5COGA 4G0HA 5BQIA 5KYXA 4LDKA 5DLJA 4E0HA 1MNDA 2HFIA 3K7DA 4U9EA 4XWJA 2IYLD 4I3MA 5TJ5E 1UFBA 5L0GA 2BL2A 2YLIA 4JKVA 3SXKA 4EWCA 4OIOF 4HEAJ 2LCHA 1M6TA 2LQGA 3T4RA 1NBBA 3VM6A 4GYTA 4MTGA 1A7EA 2JD3A 4JJFA 4XPXA 3GM1A 2AP3A 4YL1A 3UGOA 3M4BA 4DRIB 2KJGA 2R7TA 4E0IA 4EHPA 3DMDA 5E33A 3TQOA 3ZTMA 3B0VC 2LSEA 2GWWA 3GEIA 2VC9A 2YLDA 1BDJB 5F5FA 4PFOA 3MLGA 1MMAA 1GQAA 4JZAA 4KI2A 2HSQA 3EGDB 3NG1A 1OR3A 1BR2A 3L0IA 4RD9A 1QPUA 5COMA 3SP1A 5EK0A 4YK5A 4YN0B 4Z9IA 1ZYRF 5BQGA 5JLIA 4XPWA 3QVYA 4OINF 3DXJF 3F47A 4J7TA 3EZIA 3N24A 3ZVRA 1GM5A 2VCCA 2H7OA 2HMQA 3ZG1A 1L3PA 1APCA 2J9WA 3AG2C 2AWYA 3RYLA 1JR8A 3PMRA 4PJNA 3CEXA 5DS4A 3I5PA 2V3CC 2B0JA 2BC5A 1HW1A 4KNWA 4FESA 1PCXA 5DQZA 3Q6NA 3TOMA 3GEEA 3SZRA 2XL8A 2NSFA 3B71A 2OQMA 5A6BA 2M64A 3TULA 5A6AA 3U3FA 3BEHA 3N0TA 1R5ID 4I1OB 1WOLA 1HW2A 2L6HA 3JRMO 5B3IA 4O6NA 3AG3C 3QW0A 1BR1A 3GODA 1LE2A 1Q0GA 1WASA 4CSAA 3C8GB 1WWPA 2OG2A 1QQ3A 3UMIA 4ZLCA 1FR0A 2P0NA 2Q4FA 2P6VA 1BBHA 1TQGA 1SMYF 4IB4A 4NCQA 4XEKA 1SF8A 3MYIA 2KGOA 2YKZA 4QI2A 1WGWA 1V4AA 4XTKA 3EG9B 3U8PA 4BJTA 2WL8A 4CDVA 3L1MA 1IZMA 3RVYA 1O3UA 2GAQA 2Y3BA 4BG0A 1ZU4A 4LACB 4G7HF 2G62A 1N1CA 4LERA 3LNRA 3W4YA 2A6HF 1I5NA 4NTAA 3C8GA 4FWVA 4EBBA 3FOOA 3US6A 4CSAC 1E83A 4ONSA 2KC3A 2DYSC 3M1CB 4NY3A 2RSEB 1CGOA 2KSFA 1XZPA 5JVEA 5L0HA 3JZ0A 3T9OA 1HMOA 4NTFA 3I5QA 2WZFA 2W9YA 3CAXA 3JCUQ 1ZHYA 2DI3A 3A9CA 3R7CA 3VYWA 1LS4A 3VAYA 1FMVA 1FFTC 3NMIA 5JP7A 1YYJA 3MBGA 1RMVA 3POVA 4XLPF 1AVOB 1LVKA 3L8IA 4IWBA 4BEJA 4Q5SF 1NU7D 1RJ9B 2NUPA 2AWCA 2P7VA 2PX3A 2YL0A 1G8XA 4JRZA 1JAFA 3AQBA 4QI0A 3F46A 3Q7GA 3VF0A 5AGFA 3V5XA 4DVZA 3W2VA 2HKVA 1QSPA 3LLIA 5B1AC 3IQTA 2EPKX 2EPNA 4E18A 4CX9A 4ULVA 3N2ZB 4CIHA 2WVNA 3B0UX 1YYXA 3X2QC 1VLTA 2PP4A 1QKRA 1SYQA 1DOWA 4RDAA 2WVOA 2XL6A 1Y6DA 3RW0A 2FFHA 1YZCA 3U5SA 4K7BA 5DQTA 5KYUB 5KYWB 2YEVA 1RJ9A 1I4YA 2J7PD 1O87A 1LM3B 1IW7F 3U2MA 3UNGC 3PHF2 1ORJA 4EUKB 1W2WA 2IOQA 2XXAA 4I1MA 5E3CA 4IGGA 4AX2A 3SEOA 4G78A 3EH1A 4N4WA 1H6GA 2R7SA 2A69F 4PJJA 5DS5A 1PD0A 4JJGA 5KYUA 1TFKB 1M2VB 2BE5F 4IAQA 4BJ6A 4W8PA 1FMWA 2Y3HA
chains in the Genus database with same CATH topology
3CEXA 2NSGA 2F22A 4N6CA 2NSFA 2OQMA 2OU6A 5COGA 3QTHA 2RD9A 5COMA 5COFA 2P1AA 3GORA 2QE9A 5CIVA 3DI5A 2YQYA 1RXQA 3DKAA 2QNLA 2HKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEX A;  2NSG A;  2F22 A;  4N6C A;  2NSF A;  2OQM A;  2OU6 A;  5COG A;  3QTH A;  2RD9 A;  5COM A;  5COF A;  2P1A A;  3GOR A;  2QE9 A;  5CIV A;  3DI5 A;  2YQY A;  1RXQ A;  3DKA A;  2QNL A;  2HKV A; 
#chains in the Genus database with same CATH topology
 5L0F A;  1CGM E;  1XZQ A;  3KYJ A;  4OIQ F;  3T6J A;  3ABL C;  3W8H A;  3S27 A;  3O55 A;  4JCH A;  3ZC4 A;  5L0J A;  2HSB A;  4HFF B;  4U5F E;  3ZSU A;  1OCZ C;  1HY5 A;  1C17 M;  4O79 A;  2D4U A;  2ZXR A;  1TKN A;  2XLW A;  3JYH A;  3OWT A;  3DWW A;  3LEO A;  1H9G A;  1M2V A;  4IRU A;  4MW3 A;  1T6U A;  4NC3 A;  4QDL A;  1H7I A;  2JX0 A;  2I15 A;  3IHU A;  3FAJ A;  4BJ6 C;  4HFK B;  4EIY A;  5IY5 C;  1FTS A;  1MNE A;  1ST6 A;  2OJE D;  5AC5 A;  1K05 A;  3FXH A;  1XWJ A;  3EJN A;  4C3B A;  5AC4 A;  1TWH A;  2MWQ A;  5BQH A;  1DOV A;  4LDQ A;  3R2P A;  4DJ9 A;  2XLD A;  3G50 A;  3V7O A;  1T5O A;  4ANJ A;  2J46 A;  2H7V C;  1LIH A;  1OW8 A;  1T6Q A;  2CW0 F;  2R03 A;  2VCA A;  4JW1 A;  4Z9H A;  3FVY A;  4DVY P;  1Z63 A;  4U5C E;  1OR2 A;  2HJM A;  1CPQ A;  1YAU O;  4WGY A;  4MND A;  3Q6M A;  1Z5Z A;  4N6H A;  2O9X A;  1HE1 A;  4YJW A;  5JSL A;  2Q00 A;  2A1D D;  3UGP A;  5JRA A;  3ABK C;  3X1O A;  3WOD F;  2P1A A;  3QW1 A;  2OEV A;  3RKO F;  1OCC C;  3GWL A;  1V54 C;  3GWN A;  3IQ5 A;  4IJJ A;  3TJ5 A;  2L6F A;  5DVW A;  1ZU5 A;  5L3Q A;  2XLV A;  3DAG A;  4Z9J A;  4E17 A;  2CDQ A;  2HJ3 A;  5L0C A;  4CS7 A;  1PV3 A;  4Q4Z F;  1G4W R;  2PX0 A;  1V74 B;  4GEH A;  1ORY A;  4JTA B;  3EGX B;  4DRH B;  5JS5 A;  4C7O A;  2J9V A;  4CDY A;  4OIR F;  2MHR A;  1ZW2 A;  2HV7 A;  1TFO B;  2XM0 A;  1K04 A;  3EGD A;  5B1B C;  4YT2 A;  4D4N A;  1BR4 A;  3DE8 A;  1KU2 A;  2I8B A;  4YT8 A;  3HTK C;  1OKK A;  3AG1 C;  3M4C A;  4LLC A;  1D1B A;  2A0U A;  2IXP A;  2X51 A;  3KYI A;  1JMW A;  1VB5 A;  2GA0 A;  3EFO B;  3LS0 A;  4YWQ A;  4GQH A;  2R7X A;  4YL0 A;  1D0Y A;  4IAO A;  3UR3 C;  2Q3T A;  3M15 A;  1A7V A;  3RH3 A;  1EI7 A;  3C7J A;  5T3T A;  1ZHZ A;  2ASR A;  2VAS A;  3EGX A;  1FNT c;  3S84 A;  4CBE A;  5EHH A;  3ATP A;  1SR2 A;  2QE9 A;  3ITF A;  3K1I C;  1PD1 A;  2R7O A;  1AUE A;  4W8K A;  3RQE A;  4R32 A;  2A0B A;  3SXY A;  4JCZ A;  3S0X A;  4H4K C;  1VYI A;  3L8J A;  3WHN A;  4F4B A;  2R9R B;  3DM9 B;  1BZ4 A;  2HS5 A;  2P61 A;  2VCB A;  3K33 A;  1Y4C A;  5A69 A;  5KYN A;  3FHD A;  1VK5 A;  1FFH A;  2XSE A;  4BJ5 A;  3ECS A;  1T9K A;  2EPL X;  1JOG A;  2GFH A;  4C3E A;  3QMK A;  3ABM C;  3ZTZ A;  1G4U S;  4KC9 A;  4CDA A;  3LEV A;  4KBL A;  3RFY A;  1OXK A;  2R7V A;  1A7D A;  5T1D B;  2NUT B;  2IXN A;  3C63 A;  3RF3 A;  4JC7 A;  3RIP A;  2D5R B;  2V26 A;  2R05 A;  1M56 C;  3EG9 A;  3RQG A;  4AK9 A;  1ZHT A;  3DJN B;  3IPM O;  4MVO A;  1Q0K A;  4BJ5 C;  1RCP A;  3U0C A;  2LFF A;  1YA7 O;  5EGY A;  1LKX A;  3RVZ A;  2CNW A;  2IM8 A;  4EBK A;  3DI5 A;  1D0Z A;  4JTD B;  4EBJ A;  2EPO A;  3JRT A;  4U5B E;  1U6H A;  3V5Z A;  2HV6 A;  4MVU A;  2EIN C;  2KQ9 A;  2M4E A;  2XRH A;  3I4U A;  4MW8 A;  1G5Z A;  5A6J A;  2J0W A;  2HZ8 A;  4NQF A;  2XS8 A;  4PAC A;  4AL0 A;  3U2L A;  4A4A A;  1OW7 A;  1YDI A;  4AL1 A;  1TWC A;  1VYK A;  4MVM A;  2DGJ A;  1EQ1 A;  2UUI A;  4X0R A;  2PNO A;  2QUP A;  4A2N B;  4G7Z F;  3QVZ A;  4LDR A;  5L0D A;  3PCV A;  1KTM A;  4JVS A;  2WB7 A;  3JSE O;  2YZS A;  4MS2 A;  4IAR A;  1LI5 A;  1D1C A;  4MVQ A;  5E2Q A;  5KYY B;  5JUA A;  4EKW A;  2AU5 A;  2XM4 A;  2Q7R A;  3H65 A;  1T01 A;  4JTC B;  3KKB A;  3HNK A;  5E3A A;  1I4Z A;  3IQ6 A;  3KPH A;  3O39 A;  2PBE A;  2XL4 A;  2WVQ A;  3L34 A;  1RKE B;  3AJM A;  1NFO A;  2Y3D A;  1Q0M A;  3CQZ A;  3NKE A;  2HMZ A;  4OD5 A;  5KYW A;  4ULW A;  4JEA A;  3V5Y A;  3DJU B;  2LP4 A;  3O10 A;  1NLX A;  2FAP B;  5KYY A;  2Q9B A;  4PFP A;  2R7W A;  1NU9 C;  3ZIB A;  2XLM A;  2X0C A;  4N6C A;  1UG7 A;  3VRC A;  2R02 A;  2ZXO A;  3LS1 A;  2W4M A;  2C03 A;  4FAP B;  3GM3 A;  3PDM P;  1M57 C;  2ZPA A;  1JPN A;  2WZL A;  4OD4 A;  4XPY A;  1OCO C;  5F5H A;  1YA9 A;  3HJC A;  2R25 A;  4J30 B;  3SNH A;  3OA1 A;  4E7Z A;  4XLN F;  2YL1 A;  4OIP F;  3FOP A;  4AE4 B;  1OQC A;  3WG7 C;  2QLA A;  4MVS A;  3HNJ A;  2DYR C;  4PJL A;  2OJQ A;  2E87 A;  3DAF A;  2KK1 A;  4Q7C A;  1VTM P;  3LES A;  4N06 A;  5GPG B;  4MVR A;  4G7O F;  2R7Q A;  5B3S C;  3FMS A;  4XEV A;  1RKC A;  1C03 A;  3B9Q A;  1Q0F A;  2H7B A;  1OW6 A;  4C3D A;  1YZA A;  4AE4 A;  3S90 A;  3NYJ A;  4ER9 A;  3LNM B;  4O7G A;  3E70 C;  2A68 F;  4NTB A;  3O6X A;  3QTH A;  3SXZ A;  3TK0 A;  4U9D A;  2G3V A;  1OKK D;  1YAR O;  2B0H A;  2FGY A;  2L9J A;  3C8Z A;  1O5H A;  1V55 C;  2YHS A;  3LJB A;  2ZXW C;  2YWA A;  2DB4 A;  2Q9A A;  2EIM C;  4O6Y A;  5A6B D;  1QLE C;  1LE4 A;  1WN0 A;  3EHN A;  1LI7 A;  3S9O A;  5CIV A;  3JSZ A;  2ICW G;  3ASO C;  1D1A A;  2YVK A;  1A41 A;  2VB6 A;  4PR9 A;  1B68 A;  4P6I C;  2YL3 A;  4PK4 A;  5CI8 A;  3SXM A;  2LFD A;  2IXO A;  5T3W A;  3W2W A;  1K40 A;  3NMK A;  1ZW3 A;  3K1I A;  4CS8 A;  3NKD A;  4PJM A;  2IXM A;  2PF4 E;  2XLO A;  3ZQV A;  2NG1 A;  4CS9 C;  3FDQ A;  1ORS C;  2R7U A;  1HMD A;  2PFD A;  2H8A A;  3AQC A;  3CSK A;  1EKY A;  1QVX A;  1T6I A;  1NFN A;  4JEB A;  4MTF A;  4YT5 A;  4J32 B;  1E85 A;  3J06 A;  2OKU A;  3C8G D;  2YRF A;  4UDV A;  2W45 A;  3EQL F;  3DD7 A;  2J45 A;  4JE9 A;  3W8I A;  256B A;  5A6K A;  1ZHW A;  4BPM A;  4CS8 C;  4DOZ A;  4YT4 A;  4I44 A;  3EZH A;  1RXQ A;  3AG4 C;  2EIJ C;  1YLM A;  1YVI A;  3CZ6 A;  3EFO A;  1E2X A;  2ZD9 A;  3IEE A;  3NMJ A;  1FAP B;  3AGT A;  4JIO A;  3M79 A;  1D0X A;  2VH3 A;  1HE9 A;  3K6B A;  4WJ0 A;  3UMH A;  2CNW D;  4D4X A;  1OCR C;  1F1M A;  4M63 A;  4CJG A;  4K1O A;  2NSG A;  3TOL A;  5FCL A;  3NDB B;  4RBN A;  1H9T A;  3QZC A;  2EPM X;  4U5D E;  4MTO A;  2J9U A;  2J9B A;  4C7O B;  1EA8 A;  5K0I A;  1OXB A;  5HV9 A;  3AOU A;  3IQC A;  1TWG A;  2KNH A;  1GS9 A;  1Z6A A;  1L7C A;  4L6R A;  1TWA A;  1ZVZ A;  2L6G A;  2KW3 C;  4U5H A;  4XEF A;  1CPR A;  4MQ9 F;  2Q9C A;  2GDC A;  3B0P A;  1MQV A;  3MX3 A;  3T6B A;  2WZG A;  4P9F A;  2L81 A;  3NYM A;  3T6G B;  5L0I A;  3C18 A;  3DE9 A;  3G4X A;  3NRH A;  3ZDL A;  1Q0D A;  2OOC A;  3GM2 A;  3DKA A;  1C02 A;  4CS9 A;  2Y3G A;  2QNL A;  2G3K A;  2XS1 A;  1E84 A;  4WGZ A;  1S05 A;  2Y69 C;  4DXW A;  2NUT A;  1AEP A;  1VMA A;  1A0B A;  2LIG A;  2W4B A;  3U3B A;  3EPV A;  2CCY A;  2QTV A;  2XLE A;  3UMK A;  3LAY A;  4DRJ B;  1E86 A;  1Z7Q c;  2NUP B;  3WAQ A;  1MMN A;  5D91 A;  5JT4 A;  2CYD A;  3TD7 A;  5BUO A;  2HUJ A;  2LD6 A;  1NSG B;  2NPU A;  2KYH A;  1VLS A;  1SZI A;  3HNI A;  3HNL A;  1Z23 A;  3RQF A;  3NYL A;  3KL4 A;  3C62 A;  1J8Y F;  2C04 A;  5COF A;  3GOR A;  1U0B B;  3SYN A;  2R7R A;  3G4Z A;  3JYY A;  1S7Z A;  4U5E E;  3MYF A;  3MFN A;  2A6E F;  2JPU A;  1LPE A;  3JTL O;  3K66 A;  1MMD A;  3LUT B;  4LLE A;  5HSW A;  5FZT A;  5D92 A;  4E7S A;  1JRA A;  2YLG A;  4B6I A;  1ZHX A;  2Z15 A;  4U5G A;  2XXA B;  2CGE A;  2IBF A;  4KNV A;  2OCC C;  2QY9 A;  3DM5 A;  4CJO A;  2ZXP A;  3A11 A;  3K1H A;  1M2O A;  1MMG A;  4O6M A;  2EIK C;  2LK4 A;  4MVZ A;  1JPJ A;  3AGU A;  1LS1 A;  4HE8 D;  4YL3 A;  5CI9 A;  2L7A A;  5F28 E;  4DBR A;  2J0X A;  1CGN A;  2RD9 A;  1RKE A;  3GEH A;  3H2V A;  3JT1 A;  2UUH A;  3HKK A;  5L3V A;  1WAT A;  1NZE A;  1GGQ A;  1Z3I X;  2AVK A;  3B29 A;  1J8M F;  3HLZ A;  4P9T A;  4XQ1 A;  4DBQ A;  4WAB A;  5DS6 A;  1TR2 A;  4JUR I;  3FAP B;  3LLK A;  2OEX A;  4J7Y A;  5KYX B;  3ZWI A;  3U8V A;  2MYS A;  2Y39 A;  2YQY A;  3KH2 A;  3KMI A;  3S29 A;  3H2U A;  4H54 A;  1YJG A;  4K0D A;  1VOM A;  2J8W A;  3S28 A;  4ZLD A;  3DZA A;  3E9V A;  2XLH A;  4CIP A;  1NG1 A;  1U89 A;  1WTY A;  1ZZP A;  3ASN C;  3GAN A;  2ETS A;  2YL7 A;  4FX5 A;  3BRJ A;  2EIL C;  3OEO A;  2F22 A;  2J7P A;  3EHM A;  1QZX A;  3U9J A;  3ZQY A;  3U9M A;  4BEM J;  4BJ1 A;  2TMV P;  3EH2 A;  2OU6 A;  3TJ6 A;  1R4T A;  3Q7L A;  1KNY A;  5COG A;  4G0H A;  5BQI A;  5KYX A;  4LDK A;  5DLJ A;  4E0H A;  1MND A;  2HFI A;  3K7D A;  4U9E A;  4XWJ A;  2IYL D;  4I3M A;  5TJ5 E;  1UFB A;  5L0G A;  2BL2 A;  2YLI A;  4JKV A;  3SXK A;  4EWC A;  4OIO F;  4HEA J;  2LCH A;  1M6T A;  2LQG A;  3T4R A;  1NBB A;  3VM6 A;  4GYT A;  4MTG A;  1A7E A;  2JD3 A;  4JJF A;  4XPX A;  3GM1 A;  2AP3 A;  4YL1 A;  3UGO A;  3M4B A;  4DRI B;  2KJG A;  2R7T A;  4E0I A;  4EHP A;  3DMD A;  5E33 A;  3TQO A;  3ZTM A;  3B0V C;  2LSE A;  2GWW A;  3GEI A;  2VC9 A;  2YLD A;  1BDJ B;  5F5F A;  4PFO A;  3MLG A;  1MMA A;  1GQA A;  4JZA A;  4KI2 A;  2HSQ A;  3EGD B;  3NG1 A;  1OR3 A;  1BR2 A;  3L0I A;  4RD9 A;  1QPU A;  5COM A;  3SP1 A;  5EK0 A;  4YK5 A;  4YN0 B;  4Z9I A;  1ZYR F;  5BQG A;  5JLI A;  4XPW A;  3QVY A;  4OIN F;  3DXJ F;  3F47 A;  4J7T A;  3EZI A;  3N24 A;  3ZVR A;  1GM5 A;  2VCC A;  2H7O A;  2HMQ A;  3ZG1 A;  1L3P A;  1APC A;  2J9W A;  3AG2 C;  2AWY A;  3RYL A;  1JR8 A;  3PMR A;  4PJN A;  3CEX A;  5DS4 A;  3I5P A;  2V3C C;  2B0J A;  2BC5 A;  1HW1 A;  4KNW A;  4FES A;  1PCX A;  5DQZ A;  3Q6N A;  3TOM A;  3GEE A;  3SZR A;  2XL8 A;  2NSF A;  3B71 A;  2OQM A;  5A6B A;  2M64 A;  3TUL A;  5A6A A;  3U3F A;  3BEH A;  3N0T A;  1R5I D;  4I1O B;  1WOL A;  1HW2 A;  2L6H A;  3JRM O;  5B3I A;  4O6N A;  3AG3 C;  3QW0 A;  1BR1 A;  3GOD A;  1LE2 A;  1Q0G A;  1WAS A;  4CSA A;  3C8G B;  1WWP A;  2OG2 A;  1QQ3 A;  3UMI A;  4ZLC A;  1FR0 A;  2P0N A;  2Q4F A;  2P6V A;  1BBH A;  1TQG A;  1SMY F;  4IB4 A;  4NCQ A;  4XEK A;  1SF8 A;  3MYI A;  2KGO A;  2YKZ A;  4QI2 A;  1WGW A;  1V4A A;  4XTK A;  3EG9 B;  3U8P A;  4BJT A;  2WL8 A;  4CDV A;  3L1M A;  1IZM A;  3RVY A;  1O3U A;  2GAQ A;  2Y3B A;  4BG0 A;  1ZU4 A;  4LAC B;  4G7H F;  2G62 A;  1N1C A;  4LER A;  3LNR A;  3W4Y A;  2A6H F;  1I5N A;  4NTA A;  3C8G A;  4FWV A;  4EBB A;  3FOO A;  3US6 A;  4CSA C;  1E83 A;  4ONS A;  2KC3 A;  2DYS C;  3M1C B;  4NY3 A;  2RSE B;  1CGO A;  2KSF A;  1XZP A;  5JVE A;  5L0H A;  3JZ0 A;  3T9O A;  1HMO A;  4NTF A;  3I5Q A;  2WZF A;  2W9Y A;  3CAX A;  3JCU Q;  1ZHY A;  2DI3 A;  3A9C A;  3R7C A;  3VYW A;  1LS4 A;  3VAY A;  1FMV A;  1FFT C;  3NMI A;  5JP7 A;  1YYJ A;  3MBG A;  1RMV A;  3POV A;  4XLP F;  1AVO B;  1LVK A;  3L8I A;  4IWB A;  4BEJ A;  4Q5S F;  1NU7 D;  1RJ9 B;  2NUP A;  2AWC A;  2P7V A;  2PX3 A;  2YL0 A;  1G8X A;  4JRZ A;  1JAF A;  3AQB A;  4QI0 A;  3F46 A;  3Q7G A;  3VF0 A;  5AGF A;  3V5X A;  4DVZ A;  3W2V A;  2HKV A;  1QSP A;  3LLI A;  5B1A C;  3IQT A;  2EPK X;  2EPN A;  4E18 A;  4CX9 A;  4ULV A;  3N2Z B;  4CIH A;  2WVN A;  3B0U X;  1YYX A;  3X2Q C;  1VLT A;  2PP4 A;  1QKR A;  1SYQ A;  1DOW A;  4RDA A;  2WVO A;  2XL6 A;  1Y6D A;  3RW0 A;  2FFH A;  1YZC A;  3U5S A;  4K7B A;  5DQT A;  5KYU B;  5KYW B;  2YEV A;  1RJ9 A;  1I4Y A;  2J7P D;  1O87 A;  1LM3 B;  1IW7 F;  3U2M A;  3UNG C;  3PHF 2;  1ORJ A;  4EUK B;  1W2W A;  2IOQ A;  2XXA A;  4I1M A;  5E3C A;  4IGG A;  4AX2 A;  3SEO A;  4G78 A;  3EH1 A;  4N4W A;  1H6G A;  2R7S A;  2A69 F;  4PJJ A;  5DS5 A;  1PD0 A;  4JJG A;  5KYU A;  1TFK B;  1M2V B;  2BE5 F;  4IAQ A;  4BJ6 A;  4W8P A;  1FMW A;  2Y3H A; 
#chains in the Genus database with same CATH homology
 3CEX A;  2NSG A;  2F22 A;  4N6C A;  2NSF A;  2OQM A;  2OU6 A;  5COG A;  3QTH A;  2RD9 A;  5COM A;  5COF A;  2P1A A;  3GOR A;  2QE9 A;  5CIV A;  3DI5 A;  2YQY A;  1RXQ A;  3DKA A;  2QNL A;  2HKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...