5CJ8A

Human osteoclast associated receptor (oscar) extracellular domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
185
structure length
179
Chain Sequence
PKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Osteoclast-associated immunoglobulin-like receptor
publication title Structural basis of collagen recognition by human osteoclast-associated receptor and design of osteoclastogenesis inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 179
sequence length 185
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cj8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cj8A02
3O9WB 1QRKA 4PRPB 3W81A 3RZWA 1OP3H 5I18H 1Z2KA 4HUXB 4X8JA 2VXQL 1AO7D 3O9WC 4KMTH 3WFDH 5BMFL 3QO1B 1T5WB 3LKSA 5F9OH 3CH1B 4HGMA 1FZKA 3JSSA 5DUML 1NAMB 2F15A 3VI4E 1LWRA 2AJ3A 1TCRA 1NC4D 2H6PA 4XNMA 5JW5B 2OCFD 2BVPB 2IQAB 3GMRA 4P3WA 1I1AA 2HVKB 5DFVD 3T2PA 3ZDXF 1T66D 2LTQC 3GB7B 5CLTA 1BQSA 5DLML 5F7DA 2D7TL 1ZHNA 3B6SA 3KYOB 5JPMB 1OAYL 1OD7A 3MLWL 3SDYH 1I7UB 2YD6A 3NA4A 3PNWB 4KJYB 4OCSL 2R1WA 3P4NB 5F1OB 1Q94B 4XNUH 4CBPA 3REVA 1MCWM 4NRYB 4KQ4L 2NY6D 1F42A 2C3XA 2DI7A 3MRKA 1G9EA 3GUTB 1IMHC 5EU6B 2NY0B 4BQ9A 1ZHBB 2CDGA 3LN9A 5C9JA 3V6OA 1TVBB 2ZG2A 1IJ9A 3EFFA 4XC3H 1FYTE 3MROB 5CUSL 1L7IL 1INDH 4PJIA 1GHFH 3JTSA 2VE6A 3FO2B 4X99B 4PJFB 2YUVA 1MY7A 2FO4B 5B38A 4DUXA 4PV9A 2DICA 5FKAA 5DWUL 4M43H 1V05A 3HRPA 2ENYA 4WW2A 3FQXA 3M45A 3RAJH 1JGDB 4G8GE 1KTRL 1IM3B 1IGFL 3M1BA 3WJLA 5I74B 1ETZA 2A1WH 3MA9L 3ARYA 4DEPB 3RRQA 3DSFH 4HIXL 5DJDA 5TDNA 2B1HH 4WTXA 3MJ9L 4X0KB 4NN7B 1DFBH 4G6KH 3U9UA 4DEPC 1NGXA 3C2SA 1ZLUH 2E9IA 4Z18A 2BVUA 4N0FB 4ZAKA 2EDBA 3W5MA 4NN7C 1SY6H 2QR0A 4LEOB 3X3GL 1AD0B 3SGKC 3L5WB 4C4KT 4AIZB 1B2WL 3VXRA 1RJCA 5BW7A 4B7IA 3QISA 4P3CH 3CMOL 5DHYB 2WIIB 4QRPD 3LDBC 3Q0HA 1YDPA 5F7YC 1UADC 2KBGA 3P9LA 1U92B 4XAKE 3BVNB 2G75A 5KVGL 4KTDH 1QR1B 3I6KB 1NEZA 2CXGA 1ZOXA 2G2RA 2BNRD 5IW6B 2QTEA 5F6HJ 2XTJE 1OAKH 3DRQA 2FJFB 2D7QA 3KXFA 1DL7H 5DJXA 3PWPB 4Z76A 4M6ML 4KH2A 4N8VA 3I2CH 2AVGA 5C08D 1RZFL 1JTPA 4JLRA 3WMSA 1RUAL 2VXSH 4OZHF 2Q6WA 1KPRB 3L7EB 4K9EL 3Q6GH 1GC1H 1FCGA 5SWZD 3B9VA 4WI2A 2B2XH 3MGOB 3LEYL 3KVQA 3KPNB 1CWVA 3QUML 3GSNA 4Y5XB 3FKUS 4ORGB 4JKMA 4K2UH 5BOPA 1P4IH 1GJIA 4JB9L 4KKNA 3T77B 2Q76A 3LQAH 5DURB 2OL3L 4PJCB 4Y5XC 5HGAA 2DM3A 5D5MF 4NOFA 3MUGB 2FEEL 1E4KA 5T3ZE 3GIZH 4X6DB 5JHLL 3B43A 4ZOCA 4AL8L 4PGDA 1DE4B 2VDMH 1JWSA 3U0WL 1W8OA 1OF2A 4ZPVA 2QQNH 5E6YA 1AQDA 1QFUL 4JQIL 1LO4H 1NFIA 1KEGH 4EVNB 4PTTB 1CD8A 4JZJC 3D69B 2EIZA 1IGJA 1KYOK 4PJGF 3IDXH 1JI1A 4YHIA 3KPQA 7CGTA 4RFEB 2JIXD 3SE4C 3LPFA 4KK9D 3OPZH 2R0KL 2L7UA 2VLKA 5HTSA 3ARDB 2GTZB 2VWEE 3ZKQD 3P0YL 3BRDA 5JXAH 4L9LB 1I9JL 3SDXF 3TNMB 3HPJB 3RWGA 4S1QL 2FJHA 5IKCB 2FL5A 2MJWA 2XZQL 5C71A 4L9LC 1I8KA 4PTUB 1UM6L 4X6EA 4QT5B 1FNHA 1KCVL 3HMWL 1D5IH 1T1ZA 4JDVA 4RGNE 5FUCC 5SV4A 4UTAH 4YHPB 1LNUA 3CFEB 1LO0L 5F7UA 2UWEA 4WTZG 5D7LE 4TQEH 4WTWA 4EKXA 4KY1H 4BH8A 4G7YL 3ESVF 3SDDA 1OCWH 4KROB 3G04A 2MCG1 2CQVA 3MMEB 2P5WE 4HCRA 4TNVF 5H94B 3QUXC 4KROC 1WGOA 5EORL 3RGVD 1CGUA 4M7LL 3F6IA 4MA8H 1FAKT 4P2RE 3V4UH 4X4YB 4M6AA 1KGCD 1S3KH 3FB7A 4HLJA 4NO3A 4U1MA 2OK0H 4ZPTB 4HJJL 2AXJA 5FXCH 3EHBC 4XCYA 3SKJH 3BKMH 5CEZL 2WSKA 3IFLH 3RWHA 3BZEB 3DRTB 3MX0A 1CE6B 3QG7L 4CADB 1KN4L 4JHAL 5EPMA 1KELL 2XN9D 5GGRY 3RWJB 3I50L 3H0TB 5SX5K 3QZWA 3SQBA 4J3OC 4XTRC 4PUBL 4TULH 3DNKA 3JTTA 2J8UE 4PJDA 5DMGD 3FN0H 2X4QB 1E0OB 1HKLH 2LVEA 5E99L 4HQQH 3QULB 4OLVL 4CNIB 4L8SA 3RVVC 4UBDC 3S88L 2FB4H 5I1AA 4MNQD 1J05A 3ARBB 5HXMA 1QLFB 4M9OA 4XXDA 1HXYB 4S0SD 1PKQA 4DKFH 5JW4M 3O11B 3ARBC 3SE8L 3T3PE 2XV6B 4O2EA 5EOCJ 4OFIA 4F57L 4X83A 3Q3GA 4PJ5D 3VH8A 4LCYB 1D5ZA 4HKJB 1J1OL 2IAND 5JLZB 4KJPD 5IROA 1FIEA 3PWVB 1U3HB 1UJTA 3GJFB 5MP6L 2E6JA 4G42A 2UVFA 5KSBE 2VYRE 5D1XA 4NKIH 1TPXB 1U3HC 5AZEH 4YXKL 3M17A 2HLAA 4L4TA 4Y16A 2IALB 5E8OB 3ULUE 3EYVB 2R23A 5F7EL 3HLAB 3ZKMC 4XP5L 2V7HA 1A6UL 4D0CB 2XQBH 3NCMA 1TNMA 2W9LA 3BT2H 3ULVE 4I0CC 1QLRA 1A6ZB 2H26B 1S7RB 1NCCH 4RAHA 3FFDB 4Q7DA 1IILE 4YBQD 5GRJL 5C6PB 3S8WA 1MI5A 3F7YB 4JQVA 3ZDZF 4OLUH 5I8CA 1WBYB 1X4XA 2H32A 4XP9H 3JUYA 2IFFL 3ARGB 5IVXE 1FFPA 1H8SA 4I77L 1UZ6E 3QUZD 4JREB 3NZ8B 5DYOB 3CSGA 3CCHB 2D9QB 5EULV 3MGTA 3MREA 1AC0A 5LWYH 3FTGB 3E6FB 3KYNA 5MENA 1MLCA 3T0EE 1DQTA 5GJSH 4ZXBB 3OG4B 2F53B 3LN5A 1P5VA 3QNZB 2VAAB 1BVLA 5GS0D 4KI5C 3FT2B 4M1DH 5IF0A 3U1SH 1J7VR 4RCAA 1J8HB 4PGBB 2P48B 3V4PH 4OV5B 4XNZB 1TMCB 3BEVA 1MJUH 2EECA 3CLEH 1RSFA 3FB8B 3W0WA 1LE5B 5A40E 4XNZC 1KTLB 4XAWL 3SDAC 3UJJH 5HSFA 2HG5B 4LOUD 5KVDL 4P2QB 1NBZA 2R39A 3DIFA 4ZNEE 3A0OA 1AGDB 4HJGA 3D2UA 1FO0A 1GOGA 2V5RA 3EJZC 1KSRA 2GAZB 2ZUSA 3QDJE 1MEXL 1B90A 4MA3B 2DKUA 2EYTA 1QP1A 4PJ8B 3EYUL 1JBJA 1S7XA 3QUYA 4M7KL 4PJ8C 3QI9D 4M5YH 4W6YB 3WLWD 1ULVA 2HRPH 4N1EA 1QVOB 3S97C 43C9A 1GGIH 3QSKB 3EYSL 4CUCA 3DHMA 4O2FA 2H1PH 4QHNA 2VUOA 4E42A 3BJLA 3AB0C 3ZTJG 1XF3B 4P57A 4IIQC 4OTXH 5CSZA 5E95B 5KW9H 3EDFA 5F21B 2ICES 4KHXL 2DJ4A 4U1GB 3LB6C 4ZSOB 1UC6A 1P7KA 4NBYB 2NPLX 1MCRA 5EZJB 2EO9A 4U1GC 2K9UA 5F3BB 4TVPL 1JWMA 2GEEA 2R4SH 1W0WB 3HI6L 5E2WL 4FQ1H 5E6IC 3SDAD 5JHDE 1X7QB 2UV3A 2BY0A 1NANH 1KIQB 1FL5A 3RKPA 5JA8B 3DX7A 3E6HA 3OAUH 3H9SD 4ODUA 1C5DA 1W72A 3GSUA 4LSUH 4PJEF 4QHKJ 3LKQB 1U58A 5KSVA 3SGEH 2RFXA 2DQIH 1CGWA 4NZDA 1NUNB 4KQ3L 2AS5M 3T09A 1QD0A 5EUOF 1RHHB 1IKFH 3TYGH 3MLUL 3BE1H 5D6DC 1HNGA 3PV7A 3MRCA 2CGRL 3UZQA 5T1KA 3N06B 4IDJH 3HE7B 1ZWIA 1FVEA 5IFAH 2N1KA 3NIDF 3I84A 5HYEA 4G5ZL 1MNUH 5D1ZC 5HHME 3HE7C 3UDWA 5IBLD 2DDQH 4OCYH 5DD3H 3IS0X 1RUQH 5CZVH 5C0DB 4LSRL 2DM7A 4LLDB 1Q0XH 3UJIL 1XGRA 4R4FL 4D8PA 3TIDA 4NHCL 1CBVH 5E2UH 4AT6A 1BM3L 1LILA 2Y7QB 3BAEH 5CEYA 4GRLC 1JF6A 4RMWA 4ODSL 2AJUL 4HSQA 4MXVE 5C9KA 1VCAA 4CN6A 3NTCH 4Y2OA 1E4XH 5IBTH 3GSOA 3I02B 4U1NA 1WZLA 3D3VE 2Y72A 3D0LA 3PXJA 4NQDD 1XGQA 5GGVH 1B4RA 1NBYA 1SBSH 2XOTA 5EO1B 1A1OA 4R4BB 2Q20A 3OKLA 5I1IL 4TRPL 1KCUH 2H2SD 4JO2H 1IGYB 3GZKA 3NA9L 4LK4A 3MV7A 2PYEB 1B9ZA 1F4YL 3HRZA 4N1CA 4K3GA 4HK0A 5D4QA 1A3RH 4Y5VA 1NGYB 1YPZA 1ZGLA 1NAMH 1U8QB 1WIPA 5CBAA 1RULL 1PZ5B 1UH2A 3MRLB 5BVPH 3L1OL 3TV3H 4DZBB 1T5XA 25C8L 1NLDH 3QIBD 3VWJA 3RQ3A 2BY1A 2VXUL 4G8FB 3U9PH 1DBBL 3O8XB 1V3JA 4AK1A 1CK0H 3GDBA 5I75C 1ED3A 1X5AA 2BK8A 1KB5H 4Y8DC 4K71B 1SJXA 3WHXB 3OAYH 3O8XC 3UTPD 1AJ7H 5C07B 3BISA 4OZHA 4KVCL 1GYAA 1FRGL 4MXWH 2YC1A 3FO9B 3OKDB 4R90H 2PR4H 1AP2A 1WEJL 1K6QH 2PW2B 4D0BA 1TJGH 2ADFL 3O45B 1WCBB 5F1IB 5HHVL 3FZUD 4JZOA 3IAQA 2Z92A 3CFJB 4H20L 1BIIB 2O61A 3D25B 4L4JA 1IEAA 3IDIA 3PIQA 4QRUB 3DROB 5D5MA 4K07A 2ILLA 3G6JE 3T0DA 2YR3A 1MIEH 4JM2F 1YEGH 2OR9L 4P5MA 2DQJH 1WLHA 4ZUTA 1L0YA 4NQTA 4P5TA 1N5AA 5HI4C 3FO1B 1OHQA 3CFDB 4S0TD 4NKDB 4KKLD 3UC0L 1S7UB 4NP4L 4KK5C 2A77L 3UTSB 4QF1B 1CDIA 4LCWE 4QGYA 1JYWA 3O6FD 1YN7A 2AABL 1KB9K 1J87A 5T1LD 2GCYA 1WZKA 1H3XA 2QJDA 4LSTH 3WD5H 4DUWA 5IR1A 1V3KA 4X9FA 3IETA 4PJGA 5FDWB 2EDRA 3ILPA 4UIMB 5IMOA 5K9QG 3OR6B 5CIPB 3IRPX 3F5WB 2IEPA 2PNDA 4ZUSB 2OJZL 2B1AL 2W0FB 3KPSB 3SDXA 1MCBA 4X7SL 1IKNC 3GMLA 1DVFA 5J1SC 4O4YH 3MA7B 4C58B 4HEME 5BJTB 2AKRB 4O9HL 4KAQH 2VQ1B 4FA8A 5E00A 4G80A 5ALCL 3CX5K 1O0VA 5HYFA 1V7ML 4LHUB 5FO9A 3N1GC 1U8HB 5E2TH 1UVQB 5E94A 3ZZ1A 4YUEH 3GMNB 3HS0A 2XI9A 5EC2B 2X7LB 5JOFA 2PF6A 4IJ3B 1JUFB 4JDZB 3B9KB 4H0IA 4V1DD 2O93L 1B6DA 4RWYH 3NCJH 4ALAL 4IBLT 1NL0L 2J88L 3RUGA 2AP2A 2BSSA 1CICC 2VLLA 3PP4H 4X6FB 3O41B 3B9KC 3BKJL 4NC0B 4XBEH 4LVOC 5BOZG 1P53A 3MJ9A 3VMNA 2D0GA 1F3RB 4S2SA 2BVEA 3BO8A 3H7BB 1QBMH 4WHDA 1S7QB 2V2WB 2EIBA 5FYLH 1UQSA 5EC1B 3JV0A 4H8WL 3U4AA 2X89D 3QXWA 4U6YB 4MXQD 5E9DA 1A6PA 3DO3A 1DBJL 4EDXA 1I85C 1Z3GL 4ZNCD 4LVHB 4ONFL 3FQWB 3VWKA 4NO2B 1F4XL 5HI3C 2NYYD 4NQCB 5AYQA 3WSQL 3PWJB 4PJAE 1AXSB 3TFKC 2AV1B 1PLGL 4ZD3H 1BZ9B 5BV7L 2MCPL 1IVLA 1CDGA 2I60H 3K81A 4MZ3A 4P4RB 3MLYL 1Q1JL 4NO0B 4MQ7B 3UPAA 4CN1A 5JTWA 2A6IB 2XXCB 4ZUUA 2MHAA 5HHOB 1JYVA 2CR3A 1E28B 5JZ7C 4XNXH 5ICYB 4YPGA 1YN6B 2R56H 4L4VB 1AI1L 4YHKH 3V79C 3D5OF 1JWUA 1U8NB 1X9QA 5DJ0B 4TSBL 1G6RB 3C08L 3WFZA 4RMQA 1I3VA 1MHEA 4JM4H 5D2LE 2BJML 5HHNB 4NZTH 2DBLL 5DC4B 4EUPB 1KLGB 1S9VA 1I1YB 2R2HA 3QUMA 1MRDH 2C9AA 3DBXB 5DRWB 4XMKL 2AW2A 1OPGH 4RMRA 1LEKB 1V7NL 5E5RB 1IAIL 4QTIH 5CD5C 1XCQA 1RUPH 3QH3A 5GHWL 4OT1L 1ZK9A 1GGTA 3HG1A 4KJWC 4M6NH 4IOSD 1I7TA 4L8CB 4Y2DB 2VN4A 4NZUL 1FZOB 3WHE0 5C8JB 1CFBA 1AIFA 3QA3A 1NC2A 1F2XK 4X7FC 4Y2DC 3EDEA 2DJUA 3SBWC 3UTTD 4G6AC 4TUJB 3T8XB 5JZ7D 5C0IB 4MD5A 1JFQL 3IFNL 4HFWA 4ONHB 5F96L 1F4WH 4QRRE 3QJHB 4AMKL 4AG4H 3DUHA 4ODVH 1KLFA 4PGEA 5FUOL 2FYYB 3OWEA 3KLHC 1X4ZA 4QXUL 5I2IA 3FAXA 2O5XH 3GI8L 3FOMA 1A7RH 3UTQA 4NPYB 4YGVA 5L88H 4R0LC 2CIIA 4E5XA 4LCUB 3OAZK 1R5WB 3W2DL 5DK0B 3ARVA 4PR5A 4X4MA 2ZKHH 3RWDA 4LLUB 2BVYA 3MRJB 3BPOC 4X6CB 5CINH 2ATKA 1CXKA 4F7CA 1NANI 3BP6A 1CG9B 1OAUH 1P1ZB 3OKMA 3QWRD 4YEEA 3CC5A 3AVEA 3SGEI 2R1XA 3OB0H 2BVTA 4QOKD 2AEQL 2VR9A 3W9DB 4X9GA 1FZJB 5TE6H 4ODWA 2AJZB 5H37G 1OGAB 2AK4A 3T4AB 2Z9TA 3HKFA 1FFRA 1RD6A 1BJ8A 3HI5H 4QHUB 5IBUG 2HJLA 1YEDA 2GFBB 2P5EA 3T0XA 4GBXD 4JFEE 5DHVB 1GIGL 2AJSL 2G60L 3H3BC 4XP4H 1E4WL 3EO1B 1OD9A 2YD2A 2ERJC 4BZ1H 4MCYA 1MRCL 3HNSL 2AK1L 5IFHH 5EDXA 5FECA 3STZA 4PGCA 4WUUA 4ZUVA 4CVXA 1FJ1A 2DD8L 4WI6A 1E4XI 1HOCA 2SEBB 2FX9H 3R4DA 1A8JH 3FL7A 3STLB 4PP2A 4KZDL 2GIYA 4P59L 4W81A 1Z9SA 2QKIA 2D7MA 4JANB 1KEML 3GJFH 4FZ8L 1Q9LB 1CU4L 1OARL 3TJEL 4DCQB 4GG6E 4OI7A 1A6TA 3MCKA 4XPHL 5EN2B 3VXPB 1RZ8B 4Z7UB 2DMBA 5K9OB 1DP0A 5CKAA 3FQUA 1LDSA 3K8MA 3RJQB 2UYLA 4WUKH 2XY1A 2ESVE 4AY0A 2R2EA 2ARJA 4UILH 1YEHH 3A67H 2WWKO 4PJEA 3CAFA 2VLJD 2P47B 3TO4D 3VXQA 1PG7H 4H0GA 4DN4L 4NNXA 4QWWD 2FEDD 3R0MA 2IAMB 4CU7A 4F37K 5EUOA 3VJ6B 4DGVL 2ATPB 3QFDB 4LPCA 1FZMA 1YEFL 2L7JA 2IAMC 4LRNL 4FQHB 3U48A 2OXHA 1DEDA 1INQA 3VCLB 1JZ5A 1ZVSB 3K8LA 1I8IA 4EI6B 1XF2A 2GJ6D 3QHFH 3RWEB 1Y0LB 4OLXL 4MJIA 3WNLA 3P9MA 1NCWL 1AKJA 3L5XL 4HBCH 5GRVL 4JPVL 4WV1A 3PL6B 4FQLH 5ANME 5EO0B 5E5UB 3MV8E 5FK9A 4YDVA 4QRSB 4NCC2 3LH2H 4YO0A 1T03H 2A73B 1F8TL 3PL6C 3PGFH 4DZ8A 4Z95L 3MLTA 3G5VA 2A6JA 3NGBB 5GQBA 1KIRB 1S9XB 4LPYA 4OI9A 4PRPE 5CWSA 5I17A 4UV7H 1BFVH 1LK3L 4GKSA 4LCCB 3NPSC 5IJVA 1B0GA 3C8KB 1H0DA 3TO2A 2QSCL 1L0QA 3BOVA 4LCCC 1M71A 1IL1B 4RMUA 2ICEB 2M8XA 3PV6A 1EERB 1U8KB 2CXKA 1EA9C 4N90E 3FT4A 2NX5D 4ZFZB 1U3JA 2QADB 1KG0B 5EWIL 3MJ7B 1A14H 1WWAX 1YNLH 1C1EL 4GAGL 15C8L 1JHKL 1N59B 4O02H 4Z9KB 1FNEB 4UT7L 3H2WA 3O0RL 2QADC 4GUPA 3PHQB 3GMQA 4XXCA 4C55A 4R3SA 3IXTA 4PRHB 4E0RB 4G9FA 5C09A 1XGUA 5GS0L 5EUKA 1QSFB 2HP4A 1E27B 5DVMA 1CIUA 4JN1L 5I1DB 2Y6SD 5LGHH 3EYOA 4B7LA 2RGSA 1Q9KA 1SJEA 5KANG 1JV5A 3LAFA 3GMPB 4APQB 4UDTB 2FIKB 4U33A 4BUHA 5ACZB 2R0LH 1KNOB 3P9WB 4APQC 3I6LE 4FZEL 4K7PY 3UPRB 4B5EA 4JO4L 4LP5A 1P4BH 4PLJD 4U49A 5FHAH 3MRDA 2ICWJ 4WCYH 4ZO8A 4JM2A 1WUNT 3L3DB 3PQYB 5JQ6H 4PJFE 4HFUL 4AQOA 1UWEL 2N7AA 1BOYA 4CJ1A 2LU4A 2WINB 5AG8A 3CVIL 12E8H 4XBGB 4DGYH 4I0PB 2NCMA 4OKVB 3GSNH 4PG2A 1D5XB 4UINH 4R4ND 5D7JA 4PLKC 4GMTH 4I0PC 1AR1C 1HQ4B 1KJ2H 3TH3T 3AS0A 5T1DL 5E5MA 1DLFL 3H42H 5ALBL 4P23A 5TQ2H 1ODAA 4BSVA 1UB6A 4IRJC 3QCTL 3U0TA 4PJ9A 4FABL 1TCMA 4HGWB 1KCSH 4H1LA 2PYFB 3QIUA 4GAJL 5TGBA 4Z7VE 4YXLL 2R9HD 1IBGL 2DIJA 1CXIA 1Y6MR 2ZPKH 5CJQL 2BFVL 1YMMA 3CFCH 1MCEA 2DAVA 2J12B 3ULUL 3SDCA 1AQKH 3HE6D 3S5LG 2KKQA 3S37X 4G6FD 4IOIB 4FQ2H 5IOPB 5ICZA 2X4RB 3ZYOA 5F7HA 2X4SA 5HY9A 2XA8L 2CLVB 5F8QC 4PRPD 5AWNH 1OP5K 3BQUB 4R97B 3ZT6A 2D03L 1MVUA 3QDMD 2CK2A 3O6LL 5D71L 3KNBB 5L2JA 1S5IL 2ZCKH 3DV4A 1BEYH 2CSPA 1RZGB 3BKCL 2B4CH 1S9YB 1QG3A 2YKLL 3VXNA 3OXSA 3NOIA 5EBGA 3TN0B 5KSAD 3HR5B 4X5XB 1U8OA 1I8LA 1J5OL 2APVA 3TCLA 4I5BA 5I1GH 2XFXA 3O2VH 1L7TL 3Q5YA 3OKEB 1RZJL 4UAOB 1PEZA 3O4LB 4KGLA 3V4VL 4XMPL 4MX7A 3SKOB 43CAA 2IPKA 3CPLB 2VH5H 2BMKA 3IU3B 4HLZG 1P7QB 3TH4T 4PJCE 4ZDHA 4R26H 4P9HC 4Q9BA 3TWCH 1P4LA 4TOYH 4OF3A 4KMTL 3WFDL 1H8NA 3MXVH 4X98B 1HQRB 5F1NB 4L3EB 4X6DE 3IJYB 2NY0D 3KLAB 1MJ7H 5EU6D 2DYPD 4U6XB 4HUVA 1LEGA 3VXSD 5HYJD 1U8IB 5T33H 1LO5B 3L5JA 2BNQB 5SWQB 4P5KB 4Y88A 4N9GA 5IESH 4RAVA 3I6LD 1RMFH 2VOTA 2EZ0D 2FIRT 3GM0A 3TZVD 5HYSG 1YEEL 4G9DA 4G43A 2F54A 1N26A 1WZMA 3ILQD 1TTFA 2V7NA 3T1FA 3IDUA 3SDYL 1D3CA 2DQFA 5ISZB 5FCUH 1XCTA 2IBZY 5HHQA 4D2NA 1WQVT 4JJ5A 1AO7A 1VEOA 4QHLA 3EJJX 4IRSB 2DQGH 3GMOA 4JFYB 1RVFH 3PJSB 4FQXB 4FFVD 1K8DB 4XCCH 1HCVA 5ECJE 4IRSC 3X11B 5FUCE 3Q5OA 1EVTC 4FQXC 2UUDK 1EAJA 3Q6FB 5C0FA 5JW3H 3AU1B 4ZTPL 4L8DB 2GTWA 5KAQG 4XC3L 3SE9H 2FGWH 3MRPB 5KN5B 2CKBB 1UENA 1INDL 4P2OB 1GGBH 1GHFL 4Z77B 5KZCD 2JB6A 1C12B 4PJ7F 3RY4A 3VFNA 2DQDH 4P2OC 2VSCA 5ITBH 4WEBH 3DOSA 3A6CH 1FE8H 4M43L 4UOJA 1XGPA 1BFTA 2DKMA 5T3XE 1FVCB 2W92A 3ARED 3RAJL 4OF6A 5E8EB 5KSBF 1UJ3B 1EEYA 3QHZH 2A1WL 3IDNB 3DTXB 5FYLD 3D85D 3OTTA 1M7IB 3DSFL 1YYLL 3ULUF 2A9NH 1ES0B 4AM0B 1DFBL 4G6KL 4MMZC 3PWPD 4MQXD 4Y4FC 3TF7C 5FB8A 2R4RH 1N6QL 4KKAC 4WEMB 3MCG1 3DV6B 3LD8B 2H32H 2VIRA 2BZDA 1HN1A 1SY6L 5HHXH 3MRMB 4KMQA 2NZ9D 4JDTH 1Y6KR 1YA5A 3L3HA 3ZHLA 1ZHLB 1MCNA 4P3CL 2HN7B 2NR6D 1G7JB 4P99A 2DMKA 4TSCH 5IVXF 3PHOA 3X3FH 1NUGA 4TTGA 1FL6A 1CD1B 4HPOH 1RUMH 3E8UH 3U46A 5L8JB 4YE4H 5DURD 1JGEB 3QDGA 4G8EA 1MCCA 1PAMA 4KTDL 3D48R 3ULSA 1EFXD 3MBEB 3SY0A 4JY4A 2NXYD 1JNHA 3WKNA 2OS7A 4MQSB 4C54A 1G6RH 4OCNC 5IFJB 2V9QA 1C08A 3MBEC 1OAKL 1AXTH 5H2BB 3F58H 1DL7L 1HSAB 4WFGD 5J1AB 1RIHH 4J8RB 5FUZH 1TZIB 3I2CL 5E2JA 3BH9A 5IJKA 1SYSB 1U8LB 2VXSL 3VXMB 4NQXA 4OJFH 1FO0H 5F8RC 1EO5A 3ET9F 5C0BA 3Q6GL 1GC1L 4ISVA 3KS0J 4R9HA 4IM8A 3FMGH 2B2XL 3RL1B 2CDFA 3ARDD 3ESUF 4NKOA 1GVIA 4LNRB 4RQQB 4K2UL 1P4IL 3INUH 5K59E 1U0QA 5IEHB 3LQAL 4AZ8A 3QCVH 4FFZH 2VLRD 2XWBB 2X70A 1ZA3A 4GXVH 3GIZL 2Q3AA 2O26U 3GSRB 4JY6A 2NY2B 2JJTC 3HZYA 2EEDA 4UUJA 2VDML 4BYHA 4BZ2H 3OX8B 1QEWB 2MKLC 3VFTA 2QQNL 1VFAA 2W65A 5SWZA 1CF8L 4D0DB 3FFCD 3PWNA 3GBMH 1LO4L 2BCKA 1KEGL 4KI5E 5F44A 3BW9A 1XZ0A 2EDTA 2F53E 4K3HA 4MWFB 3IDXL 3QEQB 2YEZA 5E7BA 5B3JE 1NCAL 3OPZL 3HC0A 3QFJB 1TLKA 4GS7B 1DQDH 2LQRA 4HC1H 4PJHF 1J8HE 3F8UB 1A4JB 4OF7A 4JAMB 5JXAL 3ZE1E 4F7TB 4GS7C 5FO7A 5IIEB 4P2YA 3WFBH 4F7MB 2P46B 1MQKH 3GMRB 3EYQD 2BNUB 3X12B 5J6HB 4YBLB 1R24A 3E1F1 3T08A 3NIFF 3H3PH 4P2QE 5AD0A 3K4AA 4HPYH 1D5IL 1I1AC 1MY5A 5GRUH 1S7VA 1UXWB 2VUYA 2XY2A 3O3DB 5F9WB 3ARFA 4UTAL 4YBLC 4HH9B 4JRXB 4LSVL 1T0MA 1PVHA 1YNTB 5HYQA 4TQEL 2R1WB 2DQUH 2W1NA 4QY8B 5F9WC 4IMKA 4KY1L 4ZFFA 5TQ0H 5DHVH 1FPTH 1OCWL 2JIXA 4M3KB 3FQRB 4N8PA 4M3JA 4PJXB 5EZOH 4WI8A 2DN7A 4PRNA 4YDJB 1RJLA 4G8GA 1I1FB 5EU4B 3FB5A 3C5JA 2WUBH 4NQEE 1I3RA 5CZXC 1AGBA 4MA8L 3V4UL 1S3KL 2JJSC 4U4BA 2OK0L 1ORQA 2DTML 1C8PA 2CK0H 1JPFB 4F58H 1NKOA 3BKML 2ZUQB 4FTVB 3RVUD 2KDGA 3V6OC 1UA6H 3IFLL 2CRIA 3SO5A 2ZUQC 4I2XB 4IRZH 5DZLA 5FKAB 5D2NA 3L3GB 5EOTB 2L0DA 3NZHH 3ABZA 3OGCA 4GXUM 4TULL 6FABL 2YD9A 2HRLA 4JRYB 3FN0L 1OWRM 3S3JA 5DDHA 1HKLL 1KCLA 2OSLB 3UX9B 4HQQL 4FNLH 4NWTH 3RGVA 5CEXA 5TDNB 2FB4L 5DJYA 2FECI 4HBQA 4FQIL 2NXZB 3HZMB 4JN2A 3ALWA 1HHJB 1QNZH 5K9KB 5I66A 4OGXH 1VADA 5EIIB 3VXUE 4DKFL 4LVEA 2OQJB 1I7ZB 4ZAKC 5C1MB 5INCB 3ARGD 3VRLF 2E8YA 3PWUA 5J9PA 3KDMB 1EGJH 1OGTB 5L6YH 4WFFE 2OX5A 1ONQB 2EKJA 3C5ZA 3L5IA 3ZTNH 5DC0A 4LDEB 4NQVB 3LN4B 2OBGA 4NKIL 4ZXBD 4RRPA 4N0UB 5AZEL 2QV2A 4YFEA 2PO6B 1YY8B 4C83B 3QNYB 3JWNC 1JPSH 4HUUA 3V5KA 1LP9B 2PO6C 4XGZA 5GRYA 2XQBL 4C56E 5MHSD 4DVBB 4N0CC 1TFHA 3BT2L 1EHAA 4ERSH 4KK8D 1NBVH 5DJXB 3ZLQC 1FH5H 3UYOD 1NCCL 4EN3A 1ZS8A 5JA9A 4OGZA 1T1WA 3B2VH 2IANA 3QNXB 4P9MH 4U1LB 5E03A 5C0CB 3AGVA 2FATH 4P2QD 1KLUB 3QQ9C 4XP9L 1QRNB 3WFHB 3SKMA 4EUPG 3BXNA 1ND0B 5FFLA 3HNVH 4R7DB 3B3IA 2H2PD 3L9RA 1LD9A 5LWYL 1MCLA 3BKYH 5HGAB 1TJHH 4NBZB 5GJSL 4ELKB 2I07A 3MRIA 1M6OA 3WDIA 1IQDA 5C07E 3H9YA 4EEEA 3NH7H 2OMNA 4M1DL 2WZPD 3U1SL 3E2HB 1E4KC 1SEBB 4NSKA 4LPVA 3V4PL 3QPXH 2E5EA 4XB7A 1LK2A 4XCEA 1CLYH 1MJUL 4Y4KB 3CLEL 2AQ2A 4LMQE 3ECBB 3UJJL 5BXFA 5DVNA 5EFIA 5IW1A 3QUZA 2HTKC 1CLZH 2VL4A 5FGCB 5KG9A 4ELMB 4B0MM 2A74A 2IADA 2DLHA 3RTQB 2VLKB 5CBEA 5HPMB 3AC0A 1RIUH 2P5WA 5F70A 3RTQC 5FF6B 3F12A 1HILA 2R0WH 4M5YL 1K85A 2HRPL 1H9VA 1GGIL 4OD1H 4Y5YB 2H1PL 1EEUA 3OXRB 3P73A 1MH5A 4WHTA 3T0BA 2ICCA 2VERN 4NKMB 4JDVB 4Y5YC 3MNZA 2ZCHH 5LJYH 4DGIH 3L3IA 2ICWA 4YHNB 5KW9L 2YD8A 1VESA 4X7TB 2W0PA 2IH3B 4LU5H 5HDLA 1RK1A 3LKOA 3RPIA 2NTFA 1OWWA 5JIPA 3PABB 3U30B 3W39B 4JG0H 3BP4B 2R4SL 3SDDC 1ZVYA 3U30C 2JJWA 2RQ8A 5DRZB 3VXOA 4YHZH 3IFOA 3QI9A 4FQ1L 4L8BA 3HPLA 2XPGA 1R3KA 2AJYL 3D0VB 5IQ7H 3MRFB 1MFEH 3OAUL 3B4NA 3UTOA 1H8OA 2DQIL 5EU7C 1DBKH 4PV8A 5CJXA 4GAYA 3FT3B 3I6GB 1IKFL 1MWAB 3TYGL 2A6DA 1CFTA 3BE1L 2E7LC 1WC7B 3KLDA 4PJ7A 8FABB 4IDJL 2PYED 4PGZA 3F7QA 3KPRB 2VR4A 5IFAL 5IB1A 3EZJB 3MRHB 2HAZA 3UBXG 1HZHH 1MNUL 2HKHL 1K8IA 2DDQL 1OTSD 1INEH 5DD3L 3RZCB 1RUQL 1JL8A 4M48H 5CZVL 1UCBH 4TSAH 4DK6A 2DWEB 3AY4A 3MR9A 4U1IA 5KSBA 1Q0XL 3BGFB 1CBVL 4JFQA 2JB5H 5E2UL 3MO1B 4S1DC 5ESAB 1ZHKA 1CIDA 3H9SA 3ARZA 4NQCE 3UP1A 1HEZA 3BGFC 5I15H 3OV6A 3NTCL 5C6WH 5IBTL 2EKSA 2NY5H 1JNJA 5C0JB 1HNFA 1U3YA 3CX2A 1NGWA 2PW1B 1QYGH 2I9TB 3RDTB 4IOFC 1JZ7A 1Q0YH 5JO5B 1CVSC 1KPVA 5GGVL 5HHOE 5EBMA 5TJWK 1SBSL 1K9TA 3RDTC 4P46B 5GGUA 3SO3B 1J0ZA 3M07A 3IGAB 3RWCA 4GKZA 2X10A 4JO2L 3G08B 4PRDA 2GITA 4L4VE 1SJVA 5IVXA 3B9DA 5IROC 1LDPH 5JNYA 3KWWB 4OSUH 1A3RL 1XR8B 3E0GA 2HLAB 3FOLB 2FWOA 5EBWA 5D1XC 2R23B 1HIMH 4OFPA 3VG9C 4D9RD 5CHNB 4LLVA 1HE7A 1EMTH 3MV9E 3S36H 4Y16C 5BVPL 3FRUA 3AM8C 3T0EA 3TV3L 1FYTB 1T3FB 1NLDL 5DD6A 3U9PL 3UTSD 5BRZB 1CK0L 3KYAA 1KB5L 3D18A 3MOBH 5T5NG 2Z35B 2Z31B 3IKCB 3WIFB 2NY3D 1AJ7L 1FDLH 1LVEA 5J7CC 2Z31C 5AUMA 4JQVC 5CMAA 4WWKB 1I8MA 5IUSA 4MXWL 1JF5A 3S4SG 3WYRA 2EE6A 4R90L 4LQFL 2VNCA 4WWKC 1K6QL 1TJGL 2QHRH 4OZFG 3UEZA 1G7PA 1IAOA 3MREB 4ZNEA 4DJMA 2GSGA 3LHPH 3KPSD 5MENB 3QDJA 4FXKA 3ZE2F 3HC3H 4MJ6A 3JV4B 1T20B 1XAUA 2QBWA 2W60A 3LN5B 5D7IB 1BX2A 5IWLA 1MIEL 2WUCH 1YEGL 2DQJL 4CU8A 3H9HA 3KJ4B 5ERWB 2E9JA 5IEKB 5DRXB 4BELD 1AD9B 1E4JA 4PY8I 5LBSH 2CKBH 3HAEB 3KJ4C 1J1PH 4GKNA 4X80H 4K55A 3PUCA 4G6JH 1TTUA 2APTA 3U36A 5EOCH 2J6EH 3LZFH 4QEGA 4LLAA 4LSTL 3WD5L 2AJVH 2WQRA 5F9JB 1NBZB 3IVKB 4OQTA 3RU8H 3U7YH 2F58H 4X6CE 35C8H 3NAAH 5I30H 3D2UB 3R06B 1NLBH 2HLFD 4KXZH 4U6HB 2VKWA 2F74A 2NW2A 2J1KA 1DLHA 4F80A 4M8QA 3QBTB 2XTJB 1MI5D 1BVKA 4G6MH 1F11A 1OGAE 4U7MA 4MAYA 5JHDA 4QXWA 3KYMA 4LIQE 2C3VB 3QUYC 2BVQA 1FFOB 3IKKA 4QHNB 4LLYB 4KAQL 1MQ8A 5ILTH 4L29B 1U8JB 2Z93A 2X4NB 3VRIB 2JCCE 4HAGA 4BKLA 2COQA 5E2TL 4YH6A 1J86A 3BUTA 5E7FA 3SKNB 3NMEA 4HIIA 2BC4B 3EUUA 3T65A 4HIHA 2BOBA 3GMMB 2F19H 1JF1A 4RWYL 3NCJL 4FXGA 3PP4L 3OJDA 3LIZH 2N56A 3CLFL 5L2KB 4XBEL 5CJ5A 3PGDB 2EIEA 4Y19B 3BH8A 5I1CH 2WLZA 2X4OA 3MFFA 3AXLB 1Y18A 5FYLL 5DI8B 1R3HB 3W0WD 2YD5A 3BP7B 1C5DB 3THMH 1T21A 1OSPH 1SY6A 1MFCH 5DUPH 2P8MA 1JRHH 2BSTB 1G7HB 2IPUG 1BP3B 3F6LA 3QXDA 1EVUA 3EGSB 4PRBA 3MODH 1NGPH 3RVWC 4ZD3L 4PREA 4UU9B 1CN4A 2HYMA 2I60L 3A6BH 4V1DA 4LKCB 4H88H 3BHBA 3RIAK 1T04A 1IGCH 2P49B 3KLSA 2X5PA 4CDHA 3REWA 1QFWM 5FA4A 5JIIA 3Q1SH 3P77B 1BQHA 4LDLB 3TIDB 4XNXL 3DX9B 4AT6B 3SKUD 1X3DA 4NC2B 3QJFA 3BMVA 1PY9A 3SOBH 3PDDA 4YHKL 5KVFH 2X89A 3QXTA 2V17H 4G8IA 3MYJB 4NQUA 2IGFH 4M4RA 1EUTA 3C6LB 3D0LB 3IJHA 1EX0A 1G7IB 1ZSDB 1QA9B 3BIKB 4JM4L 4RFNB 4A6YH 2HT4C 2HTLC 4NZTL 2XQYG 1T7WA 4GRMA 1A1OB 4JCLA 4MZ2A 1GAFH 3K1DA 1ACYL 2KQMA 5TF1H 2X1QA 2I9LB 4KKBC 4MDIA 3RVTD 5DTFB 1BJ1J 3KPOA 1OPGL 3GSWA 1DZBA 3T4YB 3UTZA 4MJ2A 3RX8A 4HDIA 4QTIL 5GIRB 4JFXB 1ZGLB 1RUPL 4I9WE 4P2RB 5DJZA 4FRWA 4M6NL 1RZKC 4RAUA 4HWZA 4D9LH 2ZJSH 4XX1G 2PTTA 5FOBA 1ED3B 1JTTA 3KHOA 4PJFF 3GSQB 1NDMA 4PRIB 1OGAD 3IDMA 1S7TA 3VWJC 2VITB 2DQHH 4Y4HB 5F6HI 1RPQA 4Y89A 2VXVH 1F4WL 4PY7A 4AG4L 4ODVL 2ED7A 2WWKT 4ODTH 2WBWB 3OMZA 3MV01 3S34H 2ZOKA 2O5XL 4D0BB 4OIIL 3WFEH 1O5DT 1A7RL 3MRNA 1OTTD 5L88L 4PRHE 4N0YH 2YPVH 2Z92B 1IGMH 1QSFE 3BIAX 5D5MB 2ZKHL 4CVZB 2B0SH 5CINL 1KACB 4GAFB 3MLPA 1OAUL 5E0QA 4W6WB 1N5AB 3VFPB 2HVJA 3MV7D 3L3KA 4LPWA 3MRRB 3IF1A 5DVKA 2VDQH 4UOW0 1BZQK 4P5TC 4JFFB 5TE6L 3RNKB 2APWA 2CLRB 4R96A 1XIWB 3P4MA 5ID0A 5D6CB 1LE9A 1IQWH 3HI5L 5BQ7A 3DO7B 1UB5A 2R0ZH 5ESVA 3IXAA 5KS9B 5A16A 2H8PA 4ZS6D 4XP4L 2E7BA 1N0XH 4YNYA 2G5BA 4BZ1L 3LEVH 1OP5H 4J12A 2HMID 1EXUA 3WL9B 1A1MA 5IFHL 4MNGB 1LEIB 5J6GB 1KF9B 2FLBT 3QWRA 1XEDA 1CDHA 3VE0B 4LGRB 2GK0B 3ZYZA 4QOKA 5EO9A 2IMMA 5E00B 4RBPH 1DN0A 4G80B 5IVZA 1F6AA 1TJIH 2FX9L 3QQ4A 5HGDB 1YUHB 1J88A 4G7VH 4ODXB 4LLWA 4UDUB 2ZNWA 3TNNA 2KPNA 4HG4K 3ME0A 1ZANH 5JW4R 4OB5H 3VW3H 3DVIA 4GBXA 4LFHD 4DTGH 4WNQB 3CVHB 4B41A 3NCEB 1UFUA 4HV8B 3D39B 4FP8H 4KTYA 5DJ6A 4BFBD 4PJCF 4DKEH 1WT5A 2YRZA 1XGTA 4JFDB 3KYKH 5GISH 3ZKXB 2N4IA 3NIGF 4X6DF 3L6FB 3VGAC 2YA0A 4K7FA 5DS8A 4WUKL 4U6TA 3S35H 4UILL 1YEHL 3A67L 3D87B 1CL7H 3T2QA 2VDPH 4KK6C 2EDYA 3OKOA 1F58H 4XHJC 4ZO6A 1S78C 3W11C 1MF2H 1QFOA 2CDEA 4GW1B 1DBMH 2EO1A 3S36X 1Z5LB 3S7GA 1T83C 3BN3B 5D2LA 1J10A 3VWKC 3OL2A 3CUPA 1G7LA 3QO0A 1FAIH 1PGRB 3O3EA 5E24E 4MJ5A 4NNPH 2BOCB 3TBTA 5KBNC 1DVFD 3QHFL 1BQLH 3HZVA 3LPWA 5M94B 2K7PA 4EZMA 5C2UB 5IHBA 1A6VH 4FFWD 3TA3A 5EG6C 4H26B 3U2SA 2FSEB 4JFPA 5F72S 1FC2D 2AV7A 1JWUB 3OGOE 4FQLL 3MXWL 5E8NB 3O4LE 1D9KB 5DQ9A 5GSRB 3LH2L 1T03L 2DQCH 3PGFL 5DEFA 4E9LA 4Z7QE 1VKXA 1JYXA 2CH8A 4Q6IA 3WN5A 1BFVL 4NRXA 1WV7T 2XYCA 3ZE0F 3OKNA 4AEIH 4K9EC 5MERA 1AE6H 2Z91A 4L3EE 1NCDH 1F3JB 4NFDA 3WIHH 3ARXA 3DMMB 2GJ6A 2CJUH 1NDGB 1IEBB 1CGYA 2VDNH 2VL5A 2BNQE 2OL3B 5MEPA 3DMMC 4S1RH 1A02N 2RR3A 2FR4B 1X5JA 5JUEH 1EAPA 5JR1H 4X7CC 32C2A 4KXZI 1KTKE 1ZTXH 5IV2A 3PQYD 2FZ3A 1UZ8B 1A14L 3RHWK 1YNLL 1OOAA 4GOSA 4Z7OE 4ZS7L 1OB1B 1KC5H 3X14B 4LPTA 3T0WA 3D6GA 1PG7W 3ARQA 3MUY1 1A1NA 5D9SA 4MD5B 1H5BA 1SYVB 4I18B 3LEXB 2XG4A 3V8CA 1CFQA 1P69B 3DVNB 4POZD 3C87A 1KJMA 1DQQB 2EYRB 4NT6A 5CP3H 5FO8A 1TVHA 4IS6B 5HHMB 2DLEA 4M1CC 4MSWA 1L9NA 3ROLA 5C0AE 5LGHL 4OM1H 2X9YA 5E1AA 4DK3A 1X5GA 2VISB 2YPKB 4E41B 2VZOA 2IQ9H 5I1HH 2NX5A 3QPQD 1SVCP 5F7LB 3L7FA 1Z9LA 4JFEA 2R0LL 1UEYA 4OM0H 5FYJH 4POYA 4YAQA 3D9AH 4ETQA 1HHHA 3NABH 1P4BL 5FHAL 3FB6B 5EOQH 2XWJB 1C16A 1HXMB 4F7CB 5C86A 3LSOB 3BP6B 4OCMC 3IDJB 2EDOA 3D3VB 5H8DA 5JQ6L 3CFBA 3SCMA 3BRGC 2C3HA 3IFPB 3LCYA 1JGUH 1W2KT 1JRHI 4JFHD 1S8DA 1B6UA 1O7VA 1WFUA 1A3QA 1MWAH 5FA3A 3PP3K 12E8L 3BQUD 4P4KB 4XH2B 4DGYL 3WUWA 2YRLA 1FN4A 3L3JA 1HHIB 3GSNL 2BY2A 1CFSB 4P4KC 3HG1D 2G9HB 4U1JB 4UINL 4GMTL 3V5HB 5B38G 1KJ2L 2H41A 2APFA 4OLEA 1H3TA 4Z6AT 1ORSB 4EN3B 2AXFB 4HIJB 2EE2A 1RJZB 3H42L 3QRGH 4XI5C 4YEFA 4X6BB 5SWSB 5BO1H 4F9PC 3TN0D 1HK6A 4XVSH 4LKXA 1KCSL 1BMGA 3M8OH 3S4SA 1NH6A 1QSED 4ZUVB 3MJGX 2ZPKL 4ETYA 3VRJB 3TLRA 5B3NA 1LO2H 3DUUA 1KOAA 2Q1EA 4FQ2L 1MFDH 1RI8A 3BPNB 4NDMA 1SJHB 2VAJA 5H35B 4PG9B 5AWNL 4PYGA 4TUOA 4C59B 3GEWB 2NY1C 3BPNC 5JXED 3EAKA 4WI7A 2FGZA 4WW1B 4Q0XH 4XWOC 4CN4A 3FCTA 1A6TB 4KI5F 2W59A 4X5LA 1CVRA 3C09B 2HFGH 4PRAB 2HFFA 1GCFA 1BEYL 4LBEB 2B4CL 2XNAB 2FECL 3BESR 3C09C 1WIUA 3FQUB 4EI5A 2UYLB 2HT2C 2AK4D 2QEJA 5GJTH 1NEZG 4MCZB 3DYOA 3C8DA 4EDWH 3VXME 5J12C 3HE6A 4J1UB 1ZT1B 4NNXB 2OTUB 1UWGH 5I1GL 3O2VL 4QHKI 3TIEB 4MA7H 3O9WA 1V3LA 3G6DH 4PRPA 5ISZD 3B2UC 4N8VG 4EQ3A 4HUXA 1KYOJ 1NSNH 4P3DB 1OQOA 2VH5L 3QO1A 1T5WA 2W0KA 5I1LB 3CH1A 4YLQT 1KTDB 4WUUD 4R26L 2E9WA 1NAMA 3TWCL 4TOYL 3ZL4H 1P9MA 3MXVL 3OR7B 5JW5A 3KPLA 1PQZA 2BVPA 2IQAA 3LQMA 2HVKA 5GS3A 5T33L 4BH7B 4Y1AB 1KB5A 5IESL 3GB7A 5FK9B 3VFVB 1RMFL 5J0BA 3FQTA 5DEZA 1BBJB 3MLTB 3DETD 5JPMA 3HAEH 1QBAA 1QTYT 1DANU 1I7UA 3PNWA 4KJYA 3W9EB 2NTSP 3P4NA 5FOJA 5IJVB 4UQ3B 4O51B 1Q94A 2FHFA 1W0VB 1HH9B 4YXHH 1DQMH 1SM3H 1A47A 1WBXB 4NRYA 3K80A 5FCUL 1HSBA 2X44D 3GUTA 1QZ1A 2DQGL 5EU6A 5ICXB 2BDNH 1ZHBA 4RMTA 4XCCL 2VTFA 5ID1B 2FDBP 2ZP0T 2R15A 4HKBB 4PB0H 5DD1L 3O6KH 1TVBA 2VSDA 5HYIA 2E7CA 2J3SA 3MROA 2I5YL 5MEQB 4GUPB 3U4EB 5JW3L 1N6VA 1PSKH 1XMWA 3FO2A 4JRXE 3SGDI 1JTOA 3GNMH 4R7NB 4X99A 4PJAB 4PJFA 3SE9L 2FO4A 4XXCC 2FGWL 4EOWH 1QPXA 1MHHB 1GGBL 1LQSR 4WDIB 1H3GA 5GGSY 3LQZB 4PJXE 1AKJD 1IC1A 2DQDL 2NY4B 5ITBL 4WEBL 1IM3A 3A6CL 1FE8L 4FOMA 3P2TA 4ESKA 1HHGB 2W9DH 1HYSD 3KPMB 2NY4C 3H3KA 5BS0B 4CL7A 2D0HA 3UPCA 3V6OE 4X0KA 1J0IA 4V2BA 1HYRC 1VEMA 3WS3B 4J4PD 5T3ZH 3QHZL 3SGKA 2P7TA 4Q2ZB 4PJIE 1MOEA 4N0FA 3MUHL 2A9NL 1F4HA 3V5DB 4LEOA 2P8PB 4GSDH 1AD0A 3L5WA 4I2XE 4OLZH 4OCXH 3O6MH 2CKNA 2R4RL 5JDSB 2VR5A 3BGMB 2C3WA 1CL7I 2ZZUT 4JM2C 4WO4B 4BJLA 3MCLH 2EE3A 5EIQA 3JWOH 3QXAB 5DHYA 1PYWB 3VXMD 5HHXL 3NCYP 2WIIA 4JDTL 4WO4C 4UNVA 4JRYE 3S35X 1MCFA 3HTLX 5CJBA 3CU1A 4IHOB 4M5ZH 4N5EC 4PLOB 3QEUA 2YWYA 3BVNA 3AREA 4PG2C 4KDVA 3I6KA 4TSCL 4R2GB 4BQ6A 5FGSA 3V6ZB 3X3FL 3QZWG 4HPOL 1RUML 3E8UL 5C0ND 5EU5B 4G9FD 4YE4L 2B7DT 5C09D 1FVDB 5IW6A 4R2GC 1JNLH 1N5YH 1BF8A 1TDQA 3EO0B 4P23C 1P2CB 5KOMC 2FJFA 2NY2D 3PWPA 3VXRE 1KBGH 5HVFB 1IAMA 1X5ZA 3QIUC 1AXTL 3V8OA 4O5LH 1MCIA 3F58L 1WTGT 1GGCH 1KPRA 3L7EA 1RIHL 5FUZL 3SDCC 3O4OB 4LAQH 1IM9D 3N1QC 4HMCA 3MGOA 4OJFL 4YDLB 4O2CB 1FO0L 2YPLB 3KPNA 4N0UE 3EOBB 3VH8G 2LU7A 5D93C 4JO1H 1EEQA 3O4OC 5C0GB 3BX7C 4ORGA 4S11A 3QEQD 2CO7B 4XVUC 5FYJU 4YDLC 3T77A 3FMGL 3QFJD 4PJCA 2PCPB 1HDMB 3KXFE 4HKXB 4X6DA 5DJ2B 2ADGB 3QCVL 3OXSB 2VDRH 4FFZL 1DE4A 4JGJA 1AGEB 1SVZA 4GXVL 3AS3A 2XACC 2EH7H 1HKFA 4GKOA 5I8EB 1U91B 4XPTH 5D7JD 1CGXA 1QRNE 2EDXA 1OAXH 4ENEC 1J9CT 2XFXB 3GM8A 3B9EA 3HI1B 4Q9RH 5TH2B 4BZ2L 1I8LC 4JRXD 3VDAA 4EVNA 5J13B 5D1QB 3S96B 3D69A 4MX7B 1CZ8L 4PIRF 1EJ6A 4PJ9D 4DKAA 2PXYB 2LABA 4RFEA 2YHGA 3GBML 2XXMB 1DCLA 1G7MB 5DUMH 3ARDA 4AENB 5JORB 2EYSA 2PXYC 4I13B 4L9LA 3TNMA 3HPJA 1W72L 5IKCA 5JPNB 4HJ0C 3TBYB 1DQDL 3UAJD 4HUVB 1LEGB 4HC1L 1FIGH 4JPIB 4QT5A 1G7QB 2GSIB 4FTVD 3SPVB 5JW4N 1MQKL 1AHWB 2RIKA 4H5SB 4J3SA 4YHPA 3CFEA 3TVMB 4JGMA 4BQCA 1R0AH 1U8PB 5GRVK 4Q9CA 3H3PL 5AZ2H 4HPYL 2Y5TB 5GRUL 1KFAH 2HT3D 4ELME 3TVMC 1YECH 1AGCB 3PG2A 4RZCB 2VLKE 2DQFB 2EDHA 3EOTH 3MMEA 4KQ4H 3LRGA 1TQBB 2DQUL 3BFOA 4JRYD 5HHQB 4ODHH 5K93A 5H94A 3C60B 1KPUB 4GQ9H 5DD0L 1OQXA 4HUKB 5TQ0L 1FPTL 4PBWD 1UKTA 5DZNA 5EZOL 2P8LB 4G3YH 2NXZD 2Z8WC 1XF5B 1NC4B 4ZPTA 3GRWH 3ULVH 4NN5B 2ORBH 2WUBL 1FORH 1CR9H 3G9AB 5I8OH 2V5MA 4FHBD 3BZEA 4I4WB 2VLME 4X5WB 4QTHB 4MVBD 1CE6A 4CADA 2CK0L 2FH6A 4F58L 1EPFA 5DFVC 3RWJA 4OZ4B 3H0TA 1T66C 1UA6L 5L9DH 3MV11 2F8XC 1D6VH 4GQPH 3CK0H 2EH8H 4IRZL 5F88B 2X4QA 1MHCB 4K8RH 4K94H 1QBBA 3NZHL 3CVHH 3QULA 4CNIA 4YK4C 1Q8MA 3SJVB 5EU7E 1KENH 2CLZB 5GGSB 5I1EH 3ARBA 4FNLL 2F54D 4JRWA 4NWTL 5E8PB 2NY6C 3VFGH 3S9DB 1QLFA 3MV8B 1BZ7A 1HXYA 4KMLB 2CMRH 2D3VA 3BGAA 3O11A 4MD4A 4HULB 1QNZL 3KPRE 5F1SA 4LCYA 3IDYB 4OGXL 4HKJA 5C0CD 5JLZA 1JIBA 2VQUA 3PWVA 1QRND 1U3HA 3F7VA 3IDYC 2HFEB 3GJFA 3HN3A 2X4PB 4J7RA 5A2LH 1ADQH 1MRFH 2Z4QB 1EGJL 1I9IH 1FV1B 1QFWH 5L6YL 1RURH 3ZTNL 2LTQB 5E8OA 3V0WH 1DDHB 4GRWE 5GS1B 3EYVA 3U46B 3HLAA 1PBYA 4UI2A 4D0CA 5GS1C 1U95B 1YEJH 3ULSB 2XA3A 1JPSL 2H26A 3UYRH 1S7RA 4H8WC 4KHTH 4L1DA 1FNFA 1OT2A 4I3SH 4UT9H 1NMCC 4M6OH 2GUOB 3F7YA 4ERSL 2NY7H 1NBVL 2VN7A 2OMBA 1WBYA 3BWAB 4Y4KD 1FH5L 3T2OA 2JF1A 4PJBF 3ARGA 4OQTH 5BV7C 3B2VL 4P9ML 4QRPB 1EZVY 2FATL 3NZ8A 4L4TE 5IJKC 3VU2A 1VFMA 1PX4A 2VDKH 3FTGA 3CJJA 3E6FA 1VHPA 2OL3H 2DWDA 2FJGB 3HNVL 4HKZB 4ZXBA 2YK1H 3EIFA 4X6CF 1R3IH 2F53A 3QNZA 5FKPB 2VAAA 3WIIH 5BRZE 2BNRB 5DRNB 3FT2A 5IBUB 4LSSH 3BKYL 1TJHL 1T7YA 2X70B 1J0YA 1J8HA 1J18A 5AEAA 3K2UH 3HHRB 2ZOLB 3NH7L 4XP1L 5GPRA 1KB9J 3FB8A 2JKXA 4I48B 1LE5A 5C08B 5FYKE 1B3JA 1KTLA 2V2TB 1H15A 1T0NB 3DUSB 4HK3N 1ZLWK 3QPXL 2HG5A 4ZUWB 1CLYL 4P2QA 3QDGD 1DEEB 3T04D 5IM7B 4Z5RB 1AGDA 2VKXA 5MENE 4NHUB 2GAZA 4MA3A 4PJ8A 4V2CB 5D70H 3R1GH 1CLZL 5CGYD 5D7IE 2EIDA 4X8XA 4Z7WB 5FYJD 4QNPE 2BRRH 5HGHB 3ZKND 1BWWA 4GO6B 4Z7VB 1N64H 1QVOA 2JK5A 5C3TA 1RIUL 1N6UA 1F02I 5IB3B 3LDBB 1OP3K 1CCZA 1GH7A 3O2DH 1UM6H 1BF2A 1NGZB 4I0KA 3CX5J 4FFYH 5C0BD 1SEQH 1XF3A 1U6AH 4OD1L 3PWLB 3IU4H 2VABB 1S7VB 4BFIB 4ZSOA 5C6TH 1NCUA 1YPZF 1AR2A 2ZCHL 3DPBA 4DGIL 2MQCA 2ZUUA 4HAFA 1BBDH 5F3BA 4LU5L 1W0WA 1JCKA 3RZCD 2RB8A 4QO1A 5CGTA 4Z7UF 1EK3A 2EXWD 3KS0H 3MNVB 1T4KB 4IMKC 1EHLH 4JG0L 2EDNA 1X7QA 5I71C 1K4CB 3WEXB 4PRNB 1KIQA 2OXGA 3ZDXE 4KKCD 3T0AA 1QO3A 1EZVX 4KK9C 3LKQA 4YHZL 4KI1A 5L0QB 5D6DA 3BUYB 3WHE1 1SMOA 3U0PB 5IQ7L 5GRWA 4MDJB 3LS5H 1MFEL 1FFNB 2AI0H 5DC9B 5L0QC 1RHHA 4U05A 3JXAA 4RGMB 4DN3H 1DBKL 2Y23A 3G5ZB 3HR6A 5D8JH 3WV0A 4RGMC 4K23H 3EJYD 4P46D 4RGOH 1KJ2A 4OD2B 5L2KE 4Y19E 3FRPA 2J4WH 4M8VA 4LLDA 1HZHL 1FL3B 5CP7B 5D2NC 4A2MA 2IG2H 4M7LT 5DSCB 2Y7QA 1INEL 1YY9D 4WFEE 4M48L 1UCBL 4TSAL 2K1MA 3DI3B 4QRQB 3VGHA 1FYTD 5DMYA 2JB5L 3I02A 4JZJB 3ARFD 3RGVC 3VMOA 2C4XA 4ZOEA 4BSWB 4PGJA 4F57H 5I15L 5B21A 2NY5L 5EO1A 2ICWI 4R4BA 4U0RC 4GMSH 3QDAA 2XN9B 1IGYA 1Q0YL 2PYEA 4S10A 3NFPB 4NYLB 4G8GD 4NO5B 1A9BB 1ZLUK 4YXKH 5HHPB 4PD4K 2BRQA 4YZFE 1NGYA 4Q9QH 5HDQL 3ZTJH 1F90H 1LDPL 2ZG3A 1U8QA 4LPXA 4OSUL 1PZ5A 3IDGA 3MRLA 5DMGC 5HI5D 4DZBA 3FQNB 5LKNA 4G8FA 1TENA 4U1KB 1HIML 5F3HA 3O8XA 1UXSB 4MNQB 4QRTB 1EMTL 3S36L 4XGZB 3LRSB 5FM4A 4OGYH 3VFOB 3WHXA 4TUKH 3RUGF 5IMLB 1JYNA 3QUXB 5C07A 2OM5A 4HIEB 1IE5A 4PJ5B 5LAXB 1G9NH 5I6XC 4Y8AA 3FO9A 3OKDA 3MC0A 1G1YA 5IW3A 2FBJH 4XAKD 1FDLL 2PW2A 3O45A 2DM4A 1WCBA 4KJPC 1I4FB 1GGUA 5DR5H 2OTWB 3CFJA 1GZQA 1BIIA 4NUJB 1A6AB 3D25A 4MJ4A 4QRUA 1NJ9B 1A5FH 3DROA 2QHRL 4DVRH 3BP5B 4OZGB 3L9RB 1R3JB 2X6MA 2XTJD 1YJDH 1VENA 5DO2D 3LHPL 1RFDH 4PRIE 3HC3L 2ZUWA 3TBSB 3MRGB 3FO1A 3CFDA 4NKDA 2Q8BH 1S7UA 2WUCL 4JKWA 3UTSA 2G5RA 4QF1A 5A2IH 4UT6H 2GKIA 1IAKB 4HS3B 2L4OA 1X5KA 3C5ZD 5I19H 4WVRA 5E6ZA 5LBSL 2CKBL 1QR4A 1DQLH 3T3ME 1J1PL 4X80L 2EC8A 3RVXD 1MCDA 1MVFA 3JWDH 3TBWB 4YBQC 4G6JL 5EOCL 5FDWA 4UIMA 2J6EL 1XF1A 3LV3B 3LZFL 3OR6A 1WVZA 4U6VH 1REIA 3S5LB 2AJVL 5D5ME 3F5WA 1IKNA 3RU8L 4DW2H 4KJQD 5KG9B 3U7YL 2F58L 2BHUA 35C8L 2E9BA 3ELAT 3NAAL 4ZUSA 5I30L 1U93B 3QUZC 3B83A 3KPSA 4RIRA 1NLBL 5T3ZD 3EYSH 3MA7A 2Y5EA 1TZHA 3Q48A 5BJTA 2AKRA 4WFED 1IC5H 2VQ1A 4DQOH 4JFFE 3DX6A 4B53A 4G6ML 5D7KE 5DEGA 2OJEB 4L3CA 2ZNXA 4LHUA 5GS0C 1UVQA 4WU5B 5ITFB 5ILTL 2GJZB 5EC2A 2X7LA 1JUFA 4JDZA 4LLQB 4PJGE 3L3IB 5FV1L 5KS9E 5HJ3B 2BP3A 2NNAB 1NGQH 4X6FA 3O41A 3EOAB 1T7VA 2HJFB 1ERNA 2MKWA 2F19L 2DL9A 3H7BA 1QFWI 4LOUC 4MNGE 2B8OT 5IQ9B 3V6BR 3ARTA 4F2MB 1BJMA 3LIZL 2V2WA 4HX1B 3QR2A 5EC1A 1RK0B 5I1CL 3IFOB 5GXBB 4U6YA 1MREH 2V2XB 4D9QE 1IRAY 2XPGB 3OJVC 3RNQB 5A3ID 3FQWA 4NO2A 3THML 4NQCA 1OSPL 3QI9C 3PWJA 4RGND 3WLWC 1MFCL 5DUPL 1JRHL 4XC1H 5D7SH 5D7LD 1BZ9A 5TF0A 5KTEH 4P4RA 5B4MD 1T6VN 4NO0A 1J0KA 2XKNB 4MQ7A 3D39E 3FN9A 3MODL 1NGPL 4PJ7B 2A6IA 1F5WA 3WLBB 4JFDE 2GHWB 5LXGL 1XR9B 3A6BL 2P5WD 3RJDA 4H88L 1E28A 5HYSB 2A0LD 4B50A 4BSJA 5ICYA 1K8IB 1MLBA 2WBJD 1YN6A 2DTSA 1T7ZA 3UJTH 2DBJA 4HUNB 4L4VA 2YMXL 1IGCL 4P2RD 1JPTH 4ODSH 5E9DE 1ZLSH 1U8NA 4AH2B 3SDAB 3Q1SL 5DJ0A 4OAWB 1G6RA 5IVOA 1ZHKB 3H9SB 1ACZA 3SOBL 5DMKB 5KVFL 1FNGB 3DLQR 2V17L 4OLYH 4Y4HD 2AJXL 2NQCA 4YFLI 4GFTB 1KLGA 3DURB 1FNAA 5FGBA 4A6YL 4RA0C 2ADIB 3DBXA 4OIBA 5DRWA 3ALPA 1GAFL 1LEKA 5TF1L 3GHEH 3CSPA 3SE3A 4Q74A 3ZDYE 4HZLB 4PRDB 5DD5H 2VDOH 3AB0B 5JNYB 5IBLC 4IIQB 4L8CA 3FONB 4JY5H 4Y2DA 3NN8B 1S7SB 3SBWA 5LQBH 1FZOA 4L9DA 4JQXA 5C8JA 4NQEB 4YHLH 4UQ2B 4OZIF 2E27H 4M61A 4ZQKB 2PKDA 3CZJA 4TUJA 5F97E 1X44A 3T8XA 5C0IA 1HHKA 2EXYD 1U2CA 4D9LL 4ONHA 4R8WH 5DD6B 2ZJSL 1VACB 1QOKA 4Y0GA 1D5MB 3QJHA 4NQDB 4IMLB 5F89B 4EXKA 4KRPD 5E6IB 2DQHL 2FBOJ 4PJBA 1RZJC 1XIWD 2VXVL 4I1NB 1ZEAH 2R2BB 4J6RL 3NCYS 1K5NB 4U1SB 5AUMB 4NPYA 3PGCB 1I8MB 3BPCB 4ODTL 2H2SC 3ULUD 4LCUA 1R5WA 5DK0A 3S34L 1BD2B 4HC1A 3JVGA 4LLUA 1GGYA 3PP3H 3WFEL 3MRJA 4X6CA 2GSGB 4OI8A 3ULVD 4N0YL 2YPVL 4CMMB 1GOHA 1PX3A 1CG9A 1P1ZA 3QIBB 1H3PH 5D1ZB 3U82B 3ZDZE 2A77H 5HD8D 2B0SL 3H9HB 3W9DA 3VXUB 2AJZA 3P0GB 3QIBC 1OGAA 1IT9H 2Z8VC 1KXQE 5EZIH 1VPOH 3T4AA 2ZSWB 2VDQL 3SEPA 4KV5F 4GRLB 5GGRB 4QHUA 2CIKB 4E41E 2GFBA 4NZRH 4K8RD 1NFDB 4I8DA 1A7NH 1KJVB 5DHVA 1MCPH 3LS4H 1NBQA 3RY5A 4X4ME 3EO1A 1IQWL 3T0ED 4XCNB 2R0ZL 1JN6B 4M93B 4YR6B 4ZFOB 4JGUA 4DOHB 1N0XL 3VD3A 3MNWB 3FZUC 5FGRA 3LEVL 4PJHB 2CPCA 1OSZB 4M93C 4C56B 2X2YA 2SEBA 3RY6A 5MEOB 1F11B 1DR9A 5L7XH 1SMAA 5LGKA 4JFZH 2W9EH 5LGJB 3O6FB 4OGAD 4JANA 2P5EE 1TJIL 4UB0H 4KKLC 4G7VL 1Q9LA 2IF7A 5T1LB 2VZ1A 4DCQA 3O6FC 2YD3A 1J1XH 5SWSE 3DVGB 3QDJD 3VXPA 5EN2A 5I75B 1S5HB 1ZANL 1JF1B 1TNNA 4OB5L 3VW3L 1RZ8A 4DTGL 2YXMA 4Z7UA 5K9OA 3OG6B 4FP8L 5CEZE 4DKEL 1G9MC 4KU1A 3KYKL 1EIBA 5BZWB 4BZYA 1UGNA 1D9KD 3JV5A 1ITBB 3AAZB 5CGMA 3S35L 4H1LG 5DK2B 1CL7L 3VJ6A 3DECA 2ATPA 2N7BA 2VDPL 3QFDA 1R3LB 1F58L 4FQHA 2Q86B 1MF2L 1DBML 1EGJA 1UM5L 3HB3D 1A9EB 3VCLA 4FQQB 1ZVSA 4EI6A 4NRZB 1AGFB 1NAKH 1FAIL 3WS6A 1Y0LA 1DQJB 2C1PB 4NNPL 1BWMA 5IK3B 4MAYD 5JHDD 5H37H 2M1KA 1HCFX 1BQLL 4YFDB 2NZIA 3REWB 3PL6A 5FA4B 5EO0A 1A6VL 1EHNA 4RNRB 4QRSA 3QJFB 1CGVA 3QWOB 2A73A 4FG6D 3K8KA 3RKDD 5J3HD 1WBZB 1S9XA 1YMHB 3NFSH 4HXAH 3U4BH 2KH2B 1OTUD 1T1YB 4LCCA 5DJ8B 1N8ZB 3C8KA 3NIDE 4MXQC 2RJMA 1YC7A 1B0RB 3ES6B 3BD4A 1L9MA 5HHMD 4NC1C 1IL1A 4MS8D 3VXTB 2NYYC 1P7HL 1GZPB 4Z8FH 2ICEA 2BSRB 4MJIE 4HS6B 1AE6L 4AEIL 1GC1C 1NCDL 1N3NB 3X13B 4PJXF 1U8KA 1N7MH 3WIHL 4OFYD 4MDIB 4ZFZA 1JK8A 2CJUL 1KG0A 1UWXH 2VDNL 4WHYH 3UTZB 2JE8A 3MJ7A 4Y1AE 4YDKH 1II4E 3NBNA 3MSPA 1N59A 4S1RL 1XH3B 5TE7H 1FNEA 2XT1B 5JUEL 3PHQA 5JR1L 5ESQB 3LQAC 4PRHA 4E0RA 1ZTXL 1ZT4B 3D3VD 5HDBE 4RAUB 1XF4B 1MCOH 4PBXA 5IB4B 1QSFA 1VB9A 1CICB 1CGSH 5GZND 4QHMB 1E27A 1KC5L 4LVOB 5DJCB 5I1DA 3U83A 1S7TB 4W70A 3VDCA 4MHHG 1OT1A 3GMPA 4APQA 4YWGH 4UDTA 2D4FA 1V8HA 2FIKA 4EN3D 2V6HA 3RBSA 4OM1L 5C70A 5IVNA 3MUJA 1KNOA 4WWID 1F6FB 3UPRA 1CD9B 1FLRH 4GW4B 2IQ9L 5I1HL 2NW3B 3BN9D 1AY1H 4XVTH 3L3DA 3PQYA 1IGIH 2IFGA 4OM0L 2YSSB 5FYJL 3AMLA 3D9AL 3GK8H 2C26A 3NABL 1UM4H 3DXAB 5EOQL 2NLJB 2WINA 2OYPA 3UTTB 4XBGA 3G9VA 5BVJB 2IPUK 4I0PA 1PD6A 4OKVA 1JGUL 4LASH 3J8F7 3PDOB 1D5XA 3W5NA 1MWAL 5BS0E 2X40A 4FMKA 3ZYJA 4D3CH 3P4MB 2ZWLT 2Y9RT 3VG0H 1H3WM 1BFSA 5CAYB 3EDJA 3CDCA 4BFGA 4HGWA 1LP9F 2PYFA 4KTEH 1BJ1H 3QRGL 3MV9B 1CDYA 4GG8B 5BO1L 2DD8H 1EXUB 4MNHB 4XVSL 2FLRT 1T22B 5ADOH 3O3BB 1X5XA 2C4FT 3M8OL 4LCWD 4IOIA 1N2RB 1YEKH 5MI0B 1ZVHA 5K9QI 1B4JH 4QOKB 4TVPE 2CLVA 3QCUL 2EC9T 1DUZB 1QQDA 3J7HA 1FLTX 3BQUA 1LO2L 3KG5A 3QQ4B 1RJYB 2XQYK 5MI0C 1Q9WA 4NFCA 1OARH 4TVSa 5D96B 1MFDL 3P4OB 2H3NB 4KVNH 2P24B 2Q3ZA 3KNBA 5EBLA 5F9AC 5D96C 4GBXB 2Y07H 4HMDA 4OD3H 2XICA 1RZGA 3LKPB 3BEWB 4Q0XL 5DJ6B 4PFEA 1O7SA 1S9YA 4F7PB 5F6IC 4GBXC 2K7QA 5EB9A 2HFGL 3TN0A 1YMME 4TTDD 1HINH 3WNOA 3HR5A 3EZ8A 4X5XA 5GGVY 4M9PA 3HUJF 1WT5C 4RSVA 5T1MA 4Y1AD 2E8ZA 3CXHK 1IGTB 1QSEA 4JKKA 3B8SA 5GJTL 3MLXH 5EU3B 3L3OB 4W4OC 5DQJB 4EDWL 2IWGA 4R0LB 3DYMA 1IFHH 1QLEH 2YPLE 3ZT5A 3VFRA 3O4LA 4H0HB 2V9RA 1UWGL 3SKOA 6CGTA 2BVOB 3BPOB 3IU3A 4MA7L 1P7QA 1E6OH 3G6DL 2Y36H 4OFVA 5T3XH 1Q9OB 1G7LB 4ELMF 1QFPA 5JXEA 1ZA6B 1DUYB 4HUWB 1G1CA 1NSNL 4Z7NE 1HQRA 2QQLH 5F1NA 4L3EA 4MJ5B 4NQSB 3IJYA 3KLAA 3NFNA 4U6XA 3L5XH 4ZYKB 1U8IA 3EYFA 3MACH 1LO5A 2BNQA 5SWQA 1ZLVH 4JHWH 3NCBB 2VLJB 3BD3A 3TO4B 2WWMD 2VMFA 3BZFB 5KSUB 2ERJB 5FM8A 2X09A 2JCCB 4RFOH 4MD0B 5DEFB 2X4TB 3TO4C 1L6XA 1M7DB 1VGEH 3F65A 5ISZA 4QWWC 2FEDC 1FBIH 4HWEH 1ZT7B 1R5VB 1UT9A 1DBAH 4HW6A 4IRSA 4YXHL 5AAWA 3GSXB 1DQML 1SM3L 3PJSA 4FQXA 4JFYA 4HHAB 1JZ3A 1K8DA 3GJEB 2ZUYA 4M7JH 3X11A 3ARSA 1L4IA 2CRZA 1JHKH 1CFNB 2AQ1A 2BDNL 2X42A 3GHBH 4L8DA 4PB0L 3UBXB 1F6LL 4OZIA 3GKWH 3O6KL 1BAFL 4F3FB 3MRPA 5KN5A 2CKBA 1P84J 2O5ZH 4P2OA 1PSKL 4Z77A 1WAAE 2OZ4H 1EBPA 1C12A 3GNML 3MLSH 4EOWL 1AO7E 2J6EA 3TPUB 3KPPB 3D1MC 4QKXB 4XNQB 4KUZH 1H5BC 1FVCA 3TA3D 4RMVA 5FO8B 1KULA 3VI4F 4H25B 5E8EA 1UJ3A 5GZOD 3LRHA 2W9DL 1YQ2A 3DTXA 3IDNA 1M7IA 1A7QH 3BMWA 4GW5B 1MPAH 3G5YB 1ES0A 4AM0A 3CFKB 3GBLA 5CJOH 2XZAH 4HLZH 5T3ZL 2KUTA 1HHHB 3DV6A 4JCMA 2AXGA 4GSDL 3MRMA 2Y1VA 5ETUB 4QRRD 4OLZL 4OCXL 3O6ML 3V0VA 1RQ5A 4MB5A 3MCLL 1ZHLA 1RZIB 3JWOL 1WWCA 1G7JA 3SJVE 1CT8B 1BECA 1MHPH 5IG7A 3L95B 4XPBH 2WANA 4PP1D 5GRXG 1CD1A 2Y6SC 4M5ZL 1A2YB 5TDPB 2J7LA 4F15B 1JGEA 3OB0K 3TJHD 4XNYH 1WICA 1TTGA 2CR6A 4F15C 3HMXA 3NPSB 4ONOA 5AAMA 1C5BL 4J4PA 1K2DB 1JNLL 3CNKA 1P6FA 1N5YL 5IFJA 4LKXB 1ZXQA 4RDQF 2ZUTA 2Y06H 3S4SB 4XP6H 1HSAA 2MQ0A 5IB5B 4PLJC 1M05B 4LARH 5J1AA 4J8RA 1KBGL 4Q97A 1TZIA 5I9QB 4UMGA 4OZFB 1T2JA 3KR3H 1U8LA 3VXMA 4O5LL 1VFOA 3MJ8B 1GGCL 4AJ0A 5D1QD 5I9QC 1CS6A 1FGNH 3RBGA 2V5TA 3MJ6A 1MUJB 4A2LA 4LAQL 4X9HA 1CQKA 4JFED 1D6EB 3RL1A 1Z6JT 2J2ZA 3ETBF 2VO5A 4JO1L 4CVUA 2YD7A 4LNRA 2HFTA 2GW5A 4RQQA 3P30H 4R4NC 3GIVB 3QIWD 3MGAA 5IEHA 3VFWB 3SCMD 1K4DA 2FX8H 5D7IF 2JJTA 4LEXH 4KRNA 4QNPF 2A9MH 3C2AH 3GSRA 4RRPG 4EJ1C 2VDRL 3MRBB 3O3AB 4JFOB 4Z78B 5TDOB 1LO3H 1FG2B 2R9HC 1QEWA 4A6YA 2EH7L 3HE6B 4QRPE 3CZFA 4XPTL 1MCSA 1OAXL 3N1PC 4M62L 4D0DA 3C5SB 1IM9A 3HE6C 4Q9RL 3TCXA 5DJAB 4HEPG 3CIQA 3ISWA 3C60D 3QDMB 4MWFA 4GXUN 3VFSB 4ZG1A 3QEQA 1HWHB 4ODBD 5IHZA 2BNRE 3QFJA 3RWFA 4GH7B 5EZLB 1UACL 1WJ3A 1YYMH 2ESVD 3RL2B 1A4JA 4JAMA 4F7TA 1A4KB 3KPLB 4Z0XB 5IIEA 4XMLH 1PQZB 3JV6B 4F7MA 3C9NB 3K0WA 1P9MC 1RV6X 1VERA 3P4LA 5C08E 5KSAB 5INDB 2BNUA 3X12A 1FIGL 1YEEH 4K3JH 4F33B 5JOPE 5J6HA 4QCIB 1KB5B 5IMMB 3FQTB 4OUUB 5KSAC 4QXTB 1UXWA 5SWZE 2H9GA 3O3DA 4IRJB 3ROOA 4HH9A 1GXEA 4JRXA 1YNTA 1R0AL 5AZ2L 4QY8A 1JHTB 4HT1H 1KFAL 1YECL 4Z7WE 3FQRA 3SJVD 4PJXA 3EOTL 4EI5D 1HSBB 4YDJA 4QYOB 4ODHL 3TT3H 4PBVC 1I1FA 1KIPB 2CD0A 3WE6B 5EU4A 2HJKB 4N5UA 3FN3A 4GQ9L 2JJSA 4UIKH 2DYPB 3QEHB 4KDTC 3ALXA 3MV8D 1FGVH 4G3YL 3VXSB 4LRIC 4ZTPH 5HYJB 2NY0C 3GRWL 3ULVL 1JPFA 3O9WD 1EEZB 5C7XH 2ORBL 1M7XA 3UO1H 4FTVA 1FORL 3MRQB 2GK2A 1CR9L 5I8OL 3TZVB 1VEPA 2YN3A 4OUOA 2EDQA 1X5IA 2EZ0C 4I2XA 5IT2H 2ITDB 1RU9L 2C1OA 5TPWH 1JPGB 3TZVC 3L3GA 3V7AG 2M2DA 2Z8SA 5EOTA 5L9DL 3UCRA 1J11A 1D6VL 2WBKA 3ILQC 4XBPB 1T80A 5B22A 2ZUXA 5SX4H 3CK0L 4JRYA 4N90D 2EH8L 3G5XB 1G9MH 4K8RL 4K94L 2OSLA 3CVHL 2ADJB 3VFUA 2EDWA 4YZFF 3V6FA 1YYLH 1KENL 4WI4A 5I74C 3HZMA 3VFMB 1MJJB 5F7KC 3CDFA 5I1EL 2LV4A 4FFVC 1HHJA 3VFGL 2FH8A 1QPPA 2P7TB 5FAAA 1N6QH 3NCFB 5K9KA 3CXDH 2R69H 5EIIA 1TZGH 1BFOB 2CMRL 3QXUA 5KANI 2OQJA 1VFBB 3I3DA 4WJ5B 3GGWA 4NJ9H 1I7ZA 5INCA 5E2VH 3LKNA 5I18L 5D2NE 4HZAA 3CDGB 1KN2H 3KDMA 5KZCB 2ED9A 1A7PH 1OGTA 5JIKA 5JQHC 5F9OL 1ONQA 2FD6H 5C0EB 4NQVA 3LN4A 1S7WA 1ADQL 1MRFL 3QEUB 2QL1A 3MLRH 1I9IL 1A7OH 1QFWL 4N0UA 3AREB 1KGCE 1RURL 2PO6A 1YY8A 4C83A 4CMHB 3V0WL 4X7EC 3QNYA 2P43B 4JZNA 5JMRA 1LP9A 1Q38A 3AREC 3EO9H 1A6WH 4CMHC 3D85B 4DVBA 2CUIA 4NM4H 1YEJL 4M1GH 5CD3A 1HI6B 2R1YB 3UYRL 4KHTL 2XN9E 2EDFA 1KXTB 2XWTB 4I3SL 4UT9L 4M6OL 3TBVB 1LMKA 5JOPD 4MQXC 3QNXA 4U1LA 2NY7L 5C0CA 4XNUL 5CSBA 1G0YR 5CIPH 1KLUA 1U41A 1QRNA 3WFHA 2J8UF 2DRUA 1QKZH 4OQTL 1JNNH 3ZHKA 3T3MF 1ND0A 5C0AB 4LLMB 2NZ9C 2OP4H 4R7DA 4HWUA 4AIOA 3GO1H 3HCVB 5SX5H 4TPRH 4XZUA 3RX5A 3I3BA 5ACMA 2VDKL 2NR6C 4MNQE 1AH1A 3OSKA 5HPOA 5J4MA 4ELKA 2YK1L 3DGGB 3OQ3B 2YUXA 3MBXH 3NVQA 1R3IL 1MFBH 1EFXB 4ZFGH 3HUJA 2NXYB 3WIIL 3T3PF 3U6RA 2X4UB 4LSSL 4PJ5E 1NFKA 1SEBA 2IANE 4NGHH 4L5FH 2IH1B 2NXYC 2PETA 3K2UL 3RWIB 4HMEA 4Y4KA 1CF8H 1CXHA 3ECBA 3E3QC 1BLNB 3UMTA 1WZ1H 1K3IA 3WIHA 1F4AA 5DUBB 1BOGB 1EO8H 4BQBA 4LQ1A 5L8LB 1I7RB 4OZGE 4Y4FB 1UEMA 3EFDH 4JKLA 4ELMA 5KS9F 2B1HL 3OKKB 4CRPA 4ZODA 1NCAH 2ID5A 3RTQA 4UV4H 5HPMA 5D70L 1BGXH 2EYSB 3R1GL 5GGTA 4OF0A 1JHLH 3U79A 3ULVF 3OHXB 5FF6A 3O81A 3ARDC 2BRRL 2X9XA 2VLRB 1N64L 4CKVX 4Y5YA 2YS4A 4XRCB 5B8CB 3O2DL 3OXRA 1PG7X 1EBAA 4NKMA 1MCKA 4FFYL 1D5BB 1SEQL 5B8CC 1U8MA 1U6AL 3BZDA 4YHNA 4LSVH 1UZ6F 4X7TA 5IHUH 1A64A 3IU4L 3K3QA 2IH3A 5CP3A 3DWTA 2ITCB 5DGQA 5C6TL 3PABA 3FFCB 3X17A 5B39A 2YBRB 2JJVA 3W39A 3QUKB 1BBDL 5I73B 3BP4A 3C6SB 1S9WB 1KT2B 5DRZA 5I73C 3OKYA 1EHLL 1FCCA 3BIBX 3D0VA 5DFWH 1T1XB 3V7AE 3CU7A 3MRFA 2D31B 2DTMH 2GT9B 4OBRA 4EUPH 2MPAH 2KL6A 2E7LA 3WJJC 1R5IB 4I3GA 5A2KH 1R6VA 3LS5L 2AI0L 3FT3A 2C3GA 5DGRA 3I6GA 3CSYA 4LF3B 1MWAA 3N85H 4BA8A 4DN3L 5DHXB 1WC7A 8FABA 1Q72H 3WNPA 3EYQC 4U1HA 3G6AB 3KPRA 2YA2A 1PEWA 4X4XB 5D8JL 4K23L 3MRHA 3I75B 5EIVA 6FABH 4J3WA 2ENSA 4RGOL 3TYFB 5EA0H 1EO7A 5AYUH 3RZCA 1KCRH 2J4WL 2DWEA 1WWWX 4Z0BH 3ZDYF 3BZ4B 2BXYA 4FQIH 2IG2L 5DT1H 3MO1A 5I1KH 5ESAA 3RX7A 4DFIA 2I24N 5ACLA 2AERT 2Q7YB 4LHJB 5C0RH 1BZ7B 5C0JA 3ZMRA 3WKMH 3TT1H 2E6PA 2PW1A 4FQJH 3QUXD 2I9TA 2YZ8A 4KROD 3RDTA 4PJ7E 4MD4B 5JO5A 3BWUC 4NJAH 4X8JB 1L0XA 3QEGH 4NCDA 4P46A 1SHMA 3IB4A 4UOW1 1BPVA 3LKSB 3IGAA 3RVUC 4GMSL 5T3XD 3F7VB 3G08A 5HGGS 2XKUA 1FZKB 3EHBD 4WHCA 4DAGH 1ZKAA 2AJ3B 1TCRB 4U7KA 3KWWA 3N1MC 2H6PB 4XNMB 1XR8A 3MPCA 3FOLA 4Q9QL 3AM8A 3H9SE 4OBSA 1I1AB 1TPXC 5KJRH 5CHNA 2R8SH 1F90L 5JMOC 1G0XA 4KFZC 4XTRD 2XRAH 1FYTA 1T3FA 5F7DB 4LIQH 4YFLF 1ZHNB 3B6SB 3A6OA 5ENWA 5BRZA 2DIAA 1BQHG 5IHLB 1CXEA 4OGYL 3RVVD 4DWHA 4UBDD 2Z35A 1OAZH 2F5BH 2Z31A 3IKCA 4TUKL 3WIFA 3REVB 2IPTH 1G9NL 4WWKA 3MRKB 1FHGA 4F9LA 3ARBD 2QQKH 3ARGC 2FBJL 2CDGB 5C9JB 4JREC 2DWDB 5DR5L 4MXVF 4DUVA 3EFFB 3JV4A 1T20A 1J8KA 1A5FL 3SKJL 4DVRL 4CW1A 5D7IA 4PJIB 3K74B 3HC4H 1AFVH 3NACH 1YJDL 3JTSB 2VE6B 5DK3A 4ZXBC 4NQDE 5ERWA 1RFDL 5IEKA 3CD4A 5DRXA 5B38B 1U3HD 1AD9A 5DMIH 4PV9B 1KJ3H 4JO3H