5CJ8A

Human osteoclast associated receptor (oscar) extracellular domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
185
structure length
179
Chain Sequence
PKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Osteoclast-associated immunoglobulin-like receptor
publication title Structural basis of collagen recognition by human osteoclast-associated receptor and design of osteoclastogenesis inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 179
sequence length 185
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cj8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cj8A02
2N4IA 5KOVC 4GS7B 43CAB 2H32H 5SX5K 1B6UA 3EUUA 2JCCA 2VDNH 4GBXB 1R3LA 4YXLL 2IPTL 3O6ML 4C4KT 2H26B 5L2KA 3NCYS 4ZO7A 1J8HE 1F58H 5IHUH 3WJLA 5HHOA 3VW3H 3DI3B 2NY6D 3LKRA 3ZKND 5DR5L 5EBWA 4H8WL 3PGFH 1AGBB 3ET9F 3GSOB 5D2NA 2P1YA 3VFRB 1MLCA 3D25A 5HGHB 4KUCF 3HPJA 4U4BA 3C9NB 4JR9H 3HUJE 1SEQH 4YHPA 3KYOB 2X4OB 3UTPD 4P46A 5DJXB 3ARDD 5ISZA 3EHBD 4WIQA 2DBJA 2PW1A 5JLZA 4JZNA 2IANB 1VFAB 3KYNB 3VFTA 1BQLH 1DANT 3D85D 4D9LL 5E9DB 3KPMB 3EOTH 1C16B 2BOCA 3BUYB 1IAIH 3VFOB 3O6FD 4WTZG 4K7FB 1CE6B 4IRJD 2YPKA 3F6IA 4LLVA 1NDMB 4U3HA 4Q58C 5FYJE 3MNWB 3VXQA 1GH7A 2CXKA 4JG0L 1S9VB 3KYKL 3PDGA 2FX9H 4PGDA 3QHZL 4JN1L 4MQ7A 1HE7A 4KRPC 2XKUA 1RJLB 5E2TL 1L9NA 1UM6L 1QFWI 4HJJL 4X7CC 2H2PC 4R2GB 1SY6A 4MA8L 4UQ3A 3ETBF 4X6CA 5HGAB 3HTLX 3BEVB 4QTHB 4RGNC 1QR4A 2ZCLL 4LPYA 3IAQA 4RZCB 5D5ME 1NGZB 3GKWL 3KPOB 4HJ0C 1YMME 3PL6A 3FRUB 2VSDA 5DMJB 5FGBC 2BVQB 3N85H 5IEHA 4JM4H 1P4IL 1U42A 3I6GA 3PDOA 4L3EA 1N2RB 5K9OA 1Q38A 3HC3L 3RFZC 3LZFH 3UX9B 1UA6L 3TBWA 1KT2B 3V79C 3RQ3A 1BQHA 5DJDA 4ONHB 4XB8A 2ZCKL 3TH3T 1D9KD 3M8OH 3NIFE 4JRYA 1S5HA 3UXFA 1NBZA 3BI9X 4DGVH 4YDLB 3VFUB 1T80A 3FQUB 4WNQB 3U0TB 3UYOD 2Z35A 1QFUL 5JXAL 4R0LA 3W9EA 1DVFC 4MD0A 4TQEL 3O8XC 4G8IB 2Y9RT 3FFCE 3L3IA 5J1AB 4HGWB 4CN6A 3D0LA 4QRQA 3CDGB 5KS9A 4LSVH 1FZOB 4J7RA 4NDMA 5KAQG 2P5EE 5TE7H 5K9QG 4W4NA 5T33H 4RGMB 4XXDB 3KJ4C 1IM9B 4JQIL 5DJ2B 2VXVL 1MCLA 2BERA 4PJ8A 1H15A 4ZUUB 3QCUL 1U0QA 1X5XA 4E5XA 5JORB 4UINH 4FP8H 4Z7WE 5DHXB 1KGCD 4HWEH 4KMTH 3C8KB 5DGRA 5BCAA 4YEEA 3T0EB 2E5EA 3BKCH 3MV9E 3P0VH 3TYFA 3MLVL 1J8HB 4LVEA 3HAEH 2XFXA 2JF1A 1N6QL 2PTUA 1UKQA 1YN7A 4JHBA 2XN9A 5DRZA 1F4WL 2HVJB 3B8SA 4MNHA 1WZMA 4F9LC 1ULVA 3WSQL 2VUOA 5EH1A 2EYTA 1OGAA 5FA4A 1R5WB 4QRUB 2JJVA 4KK5C 5JW3H 3HUJB 3FT2A 2OQJA 4M43H 5CJXC 5DT1L 3HLAB 3UROR 2FR4B 1YNKL 5IB3A 1MH5B 2J8HA 1FFNB 3P9LA 4XCEB 3STBA 1N7ML 4WUUD 3FHQA 2H6PA 2V2WA 1JFQH 3TA3D 2D7QA 3MLRH 4GT7A 1RZIB 1HIML 3VH8B 3PABB 3TM6A 4KROB 2UWEA 4PJ9B 4DTGL 5LG1A 1I9JH 5BXFB 3MV7E 5INDA 2E6PA 1FZKA 4GS7C 1IL1A 3LQMA 5E8DL 4GBXC 5A2LH 4FQ2H 5EFIB 4HKXA 4YXKL 2XPGA 3VWJD 4NNPH 2R29H 3K2MC 3UTSD 4TULL 4ZSOE 3V6OE 3TPUA 3ARGB 3UJIL 1TCRB 4HIHA 2BCKB 4NPYA 1CCZA 1N5AB 3MOQA 1ZGLA 3LKPB 1AR2A 4KVCL 5D5MB 2BNRD 1X6LA 3U7AA 4BQ8A 5HYJA 4RQQB 5GGVL 2BSRA 1NGXB 3OR6A 3WL9A 1S7UA 4R7NB 4TUOB 4JANB 2EH7L 3SKNA 4XC3L 1WAAA 4Q9RL 2Y5TB 4J1UA 2V9RA 4WW2B 5BJTA 3JZ7A 3JTSA 5T1KD 1QHOA 3O6KH 1KBGH 1CFQB 4Z0XA 5DJYB 1SY6L 4ZUSA 4DKFH 4QHUA 4F8QA 3QXAA 5TJWK 3GSWA 3IETB 1LVEA 2FGZA 1QSFE 2Q6WB 1BLNA 4JKPH 4EJ1C 4I5BA 3EOBB 5DQDH 3ARPA 3FFCB 1MCPL 5C0RH 5CFHA 3BP4A 4ZUVB 5EUKB 2CLZA 4F2MA 4XNZC 3MLPA 1LDPH 1BBJA 4R2GC 4XRCB 3BJ91 1T5XA 2FNBA 1IAOB 3WD5L 1GPOH 2VMFA 4KZDH 5IT2L 3W11C 3MZTA 2VQUA 3IDIA 2Z92B 1NFDB 1A2YA 4R90H 4ZQKA 3CXHK 5HHQA 3TH4T 4Z7WB 3MOBL 2GSGB 4PRAA 3DX9A 4NCDA 3X12A 4EUPB 1FV1A 1MHPL 3BWAA 4Z7NE 3MV9B 1M6OA 4HMEA 3E6HB 4P99A 1C5DB 3MA7A 2AJSL 1S78C 1S8DA 2ITCB 1VEOA 4I2XA 5I71B 1DQQB 25C8H 4XWGL 5EDXA 2P45B 3GIZH 4MWFA 4YDLC 3P73B 4C4KO 1D5BA 1KCUL 5KSUB 3ZE2F 1X7QA 3RU8H 4PY8I 1ORQA 4OLWH 4U1HB 1VESA 1GC1L 2MMXA 5I17B 2Y4SA 3HZVA 5CEYB 5DRXA 3DARA 4TYUA 3ZMRA 4J3WA 1FVEB 4JGJA 1HI6B 1NCCH 2JJUA 3GMOA 3K0WA 4P5TD 3UTZA 4X4YB 3NCFB 1S7VB 4JO4L 2ZG2A 3MV7B 4PGBA 2EZ0D 4MXWH 1R5VB 3RWIA 5TQ2H 5HHNB 3GJFH 5LBSL 3HC4L 5FYKU 3QDMA 4Y4HB 1FGVH 5TH2A 5K59E 1ZHLA 3OXSA 4PJHF 5IQ7H 4PJEF 4ZSOB 3ULVD 1ZTXL 4X5LA 3S4SB 4XAWH 2A6JB 3HS0A 4H25A 1F4YH 2D2OA 2FWOA 2EKJA 1LNUA 1A6TB 4MLSA 4XNXL 4Y1AE 2XZAH 2YZ8A 4TOYL 5HDBE 1I7TB 2XG5A 3N1GC 3K1KC 5I1KH 4OFYA 1E4KC 3ZE0E 4U1NA 3QPQC 2R1YA 3O2VL 2FGWL 3CPLB 4YAQA 1I7RB 1AHWB 3KPTA 4FQPA 4DAGL 2QADD 4DGYL 2C4XA 4HS6B 2Q3ZA 1MI5B 5FB8A 3NIGF 3WIIL 4AYFA 1HOCB 2VXTL 1MCRA 1QKZL 4PGCA 3QDAA 1DANU 1KB9J 4JZJA 3TIDB 5JW4N 1T0MB 4KROC 9CGTA 2SEBB 3TF7C 1JPFA 4PJ9C 5ADOL 1L4IA 3SDYH 3UJTL 1QSFB 2IFFH 2JB6A 3RP1A 3KG5A 2BMKB 5IB4B 3EJYC 3HCVB 1EEYA 2KQNA 3MRHB 1A3RL 4BSVB 4MJ4A 3MBEB 4UV7H 2AS5M 4RIRB 1CGSH 1FN4B 5EC2A 2EDFA 1VGKA 3QIWA 5DMIL 4ZFGH 5I2IB 5ERWB 1P6FA 3QP3A 2EE2A 3ARGC 3BIAX 5IB5A 1MUJB 4NWTL 4L8CA 1FIGL 1JHLL 2X1QA 5F7LB 4KKNA 4I77H 1ODAA 3F62A 5ALBL 4HS3B 1BBDH 1XIWB 4ZUTA 3VXUD 5E8EA 1AIFB 4HJGA 1ETZA 3P77B 1FFOB 4JY4B 4MX7B 3I75A 5L6YH 3SQOH 4JFFD 3QG6A 4WW2C 5C9KA 2V2XB 4PBWD 4KHTL 2DLFL 4I0KA 2AEQH 1UYWL 5F7MC 3GJEB 3IF1B 3V4UH 3GNML 3EFDH 4AY0A 4IOIB 5FF6A 1XGYL 4FTVB 3ZKQD 3V6FB 4M7KL 3BUTA 3S5LG 3TWCH 1A1MB 4DZBB 2X4UB 5FYLL 3H9HB 3HMXA 2Y36H 3MJ9A 4LPXA 3U4EA 3MJ7B 2WSKA 3NA9H 5DC0A 5L88H 4HUKB 2VLKA 3GSUB 2PUQT 3QFJE 5CZXD 3WHE1 1JK8A 3SPVB 5TDNB 1Z2KA 3VCLA 1WGOA 3KPSA 3O45B 2A9ML 4OLVH 1WBZB 3QZWB 2M1KA 2R0LL 2EH8H 2VN7A 5KSAD 4V1DD 1FL3A 1N6VA 3JSSA 4UB0L 2OZ4H 3UTOA 3WHE0 3DVNB 1ZLWH 1QNZL 5GS1B 4YZFE 4AIXA 4AIOA 4J4PD 1FJ1B 5C0IA 4XVUC 5GJTH 3LS4L 2WQRA 1ORSA 1A47A 1IILE 3MLXH 4KTEH 5FKAB 5D7IE 4PRPA 5I71C 4M6ML 4XP1H 1FYTD 3MCLL 2V5TA 1NC4B 5F7EH 5F9WB 1NC2A 3ESUF 2ZUQC 4MXVF 2QQKH 2PTTA 5F9JA 3T08A 1JI2A 5GRWA 3GMLA 1FORL 4TVPH 4YC2B 3U9PH 3UYRH 2MJWA 4Z7UF 3HG1D 1TJHL 2YN5A 3SGEH 3LHPH 1FCCA 1DLHB 2FEEL 1CQYA 4P2QA 4Q7DA 3E6FB 4WI8A 1WZ1H 3P4NA 2ERJB 4HBQA 4BH8A 4BM7A 3LB6C 4OD2A 2NY1B 4RRPA 3OTTA 4ODVL 2AJYL 1V3MA 4AZ8A 3QXUA 3BW9A 5DJAB 3T2PA 4GLRI 3SDDC 2O93L 1KTDB 1TVHA 1FZMA 1M7IB 2ITDB 4IRSD 3VRLE 4Y4HC 1IEAB 2VJXA 3TZVB 4LASH 4RA0C 3P3YA 3V6OC 4YHIA 3N0PB 4LL9A 1U36A 1FVDB 5ID0A 32C2A 1EEZA 4U1SB 4M61B 4Q9QH 3FQXA 4YDJA 4HIXL 4GOSA 3ZL4H 1XFPA 4GKZA 2DLGA 5B39A 1LO2L 1D5IH 3OR7B 2Y1VA 1NLBH 3BP5B 1MVUA 2VABA 2DQJH 5LQBL 1NAMH 1C7SA 5FGBA 1UJ3B 3O11B 3GHEH 4P59H 4XPFH 2Q8AH 1DSFH 3C2AL 2R2CA 5T3ZL 3IFOA 1AHWC 2R8SH 4KGJA 2G5BB 5I73B 5INCB 4LGRB 3WFBH 1KIRB 4PJAE 3O3AA 1A4JB 1HCVA 3AMLA 2FX8L 4J3TA 1B0RA 4YHOH 5CBEB 4IEFB 5CEXA 4XVJH 1HKLH 3TBSA 5E03A 4HXAL 3P4OA 5FYJU 5A2JH 5CJQH 5F8QC 3MBEC 5E1AA 4R7DB 5GZOC 3O8XA 3QFJB 4XP4L 1XF3B 4K3DL 3L5JA 3BFOA 5F1SA 3FO2A 1OTSC 4OCSL 2H3NA 4JFEE 4K7PH 2Z9TA 3LEXA 4PGZA 3K80A 2J4WL 4LRNL 3WS6C 4RX4D 2J8UA 1GZPA 1U92A 3Q6GL 3FQNA 3PWPE 1NLDL 2EKSA 1XIWC 4KI5D 3MLSH 1JVKA 4KH2A 2W38A 4PJCB 1AR1C 5E2UL 3HMXL 2FHCA 1QPPA 3BKYH 1RZGB 3MJ9L 4FQ1L 3DSFL 4U1KA 5AEAA 1BJMA 3MRQA 5EPMA 3OGOE 4ERSL 1HSAA 2HLAB 5D7IB 1JPSL 2VDQL 1LD9A 2AGJH 3Q0HA 5HI4C 1G9ML 3NFPA 5DJ0B 1GRWA 1XCQA 2I07A 2IBGA 5KW9H 3MMEA 3PNWB 1PZUB 2YBRB 1OAUL 2XKNA 4A6YB 4Y4FB 1MJJA 3OAUL 3JV4B 4ZFZB 4BYHA 3SJVA 5D7LE 3GJFK 1LO4H 1X5ZA 4IJ3B 4U31A 5C2BL 4NT6B 4GJTB 5CJXA 4X5WA 3HFML 3OF6A 1DDHB 5C92A 3BQUB 3G5VA 3ZSTA 2HLFD 4NQDD 4I13B 1UKTA 1P7KB 4F7PA 5HYSG 3VXRA 1A4KB 2CR3A 5KANI 4PJXE 3QRFM 3L5XL 4OSUH 5KVEL 2W59A 4HF5H 1KTLB 2AK1L 5DJZA 5D7JA 1PW3A 3K4AA 4OM0L 1DEEB 5GS1C 3RWGA 3LMJL 1D6VH 4M7ZB 3MGOB 3TN0D 2VXSH 4GBXA 1H3TA 3A6CH 5FGSA 3QCTH 5GGQL 3INUL 2H26A 3QIBB 4PY8J 3DGGB 5I30L 3PWJB 3TFKC 4KK9D 3QB7C 5DFTA 3DUSB 3KLHD 1BFTA 2W9DL 5F9WC 4I48A 1ZK9A 3B5TA 3EO0A 1OGTB 1YEFL 4Y5VC 5T1LB 4OFKA 1UWXH 4PRDB 1I7UB 3GSOA 1MCWW 4W4OC 4YC2C 5FM8A 5HGHA 3C9NA 5I66B 3KYOA 4Y19D 5F3HB 4Y2DD 2ERJC 3BPCB 2J1KA 3HE6D 2NY1C 2IANA 1VFAA 3QUYD 1H5BB 1CTNA 1VADA 5E9DA 5H8DA 3KPMA 1CU4L 2YK1L 4KC3B 3VFOA 5CJ8A 5AZEL 1Z9MA 4K7FA 1CE6A 2IJ0C 3O81A 2UZXB 3DTXA 1AC0A 3K4DA 4Y16B 3DX8B 4YJZL 4OZGA 3OKDB 1NDMA 2VLJD 4H1LB 3RJDA 1K5NB 1TETL 3I3EA 1NAKL 3MNWA 3TZVC 3V0WL 2RBLA 5GHWH 3MLUH 1RZJL 1UKSA 3D0VB 1S9VA 2COQA 4JFEB 1C08B 3H8NA 4P5KB 2F19L 1RJLA 3O41B 4BZ1H 4HKJB 1CR9H 1QYGH 12E8H 2ICES 4EDWH 4A2LA 1CF8H 5BVJB 5HGAA 4S1DC 5AAMA 3PWPB 4RZCA 1NGZA 2O5XL 3KPOA 5I0DA 1IC4L 3ARBC 3RVUD 5JHDA 3ULUL 1UJ3C 2BVQA 3CCHB 4IMLA 1FE8H 4IDLA 4RWYL 1NCDH 3CZFA 3VXNB 3QDGA 2FSEB 1KT2A 2A9NH 4HIIB 3UO1H 5I73C 4UTAH 4ONHA 1CI5A 1ES0B 3DV4B 5CWSA 1CG9B 4Q6IA 4BFBD 3FRPG 3LIZH 5DVOA 1GIGH 3WLBB 4CKVX 4FQXB 3VFUA 3U0TA 3FQUA 4X9HA 4F8TA 1WF5A 3KWWB 5D7LB 1ZLWK 1YEEH 3BD5A 2BY1A 1T7ZA 4JM2D 4PYGA 6FABL 5J1AA 2VDRL 3VFSB 3I9GL 4HGWA 5EO1B 5FUOL 3CDGA 4U6VL 4GG8A 4FABL 4PJXB 3S97C 1FZOA 4FNLH 1Q8MA 4XXDA 1ZHBB 1BFVH 3O4OB 3R0MA 1IM9A 1EFXA 3PP4L 5GS0L 3VU2A 3MX0A 5DJ2A 3FKUS 2B2XL 3MYJA 1ZEAL 4NJ9H 5C0AE 3OKOB 4ZUUA 3TGXA 5JORA 1AD9B 4CUCA 5IVZB 4U6XB 4XTRC 1CLYH 3CFBB 5C0CD 1JCKA 3C8KA 4BQ6A 3WLWD 3T0EA 1CGWA 1YPZF 1J8HA 3FN0H 5J6GB 3RVWC 2WLYA 4DGIH 1FFQA 2NMSA 1G7JB 3LEVL 4OCYL 5J9PB 4JHAH 2V7NB 2LTQB 3FN3A 3CFJA 5HHVL 4HXBH 2HVJA 4LVHC 4L3AA 1FL6B 1R5WA 4Y4FC 1FNHA 1SBBA 1EERB 1D5ZB 4MLIA 3HUJA 5DFVD 4IJ3C 3BN3B 4W6XB 3GMQB 4K2UL 3HLAA 3JWOL 2Q3AA 4P23B 2FR4A 3BQUC 5GGUB 1MH5A 3AFLA 1FFNA 4XCEA 1E0OB 3HB3D 5EZOH 4YGAB 3BP6B 2VZUA 3VH8A 2KDGA 1XGTA 3PABA 5D1ZB 4PJIA 3D39D 4DQOL 4U6HB 5KVDH 5BXFA 4XC1H 1S7QB 4N5ED 1RURL 1EAJA 1IGJB 2QR0A 4NYLB 4M7ZC 4E41A 3QRGL 5EFIA 1SYVB 2HWZH 5E8PB 3JV0A 3EJZD 3QIBC 2APBA 2CKBH 3DVIA 1KCVL 3GEWB 4XPGH 3ARGA 5F7YC 1IEBB 1WFNA 2GTWB 3RVXD 1CICB 4LSQL 1EEUA 5C0BE 3UZQA 2VH5H 1B4JL 1MAJA 1WIPA 3LKPA 3X3GH 5GRUH 2VYRE 2QSTA 5SWSA 4RQQA 4HFWB 4LU5L 1IAKB 2WBJA 3LRHA 4FRWA 1I8IB 3LQAC 5E08L 4M6OL 4NOFA 5IGXH 5IMMB 4C55A 2W1NA 3KNBA 5EU3B 4R7NA 4JANA 3F7QA 4E9LA 5KVGL 4PP1D 2Y5TA 1IGTA 3CVIH 1JHKL 4WW2A 3OKYA 1OLLA 1RZFH 5KSBF 1H5BC 3D2UD 1FNEB 1CFQA 5DJYA 5F9OL 3MODH 1VCAA 2YD7A 1CZ8L 5D72H 4UOJA 2Q6WA 4Y16C 3FFCA 2R2HB 4YO0B 1EJOH 2DM7A 4RSVA 3BSZH 1OAKL 2Z4QA 3ZDXF 1QFHA 4ZUVA 4S1SH 4K8RC 4XBEL 4GRWH 5TDPB 5EUKA 3ARFB 1HH6B 3GSXA 4OFIA 4GQPH 4U1MA 2YD2A 3AGVA 1GOHA 4WEBH 1L6ZA 4ODBD 1BP3B 4Q74A 5C0AB 1NFDA 2EDWA 4EI5A 4TNWK 4PB9L 2DYPA 2HRPH 3B9AA 2F5BH 1VENA 4K94L 4EUPA 2HT3D 5IBUG 2BC4A 1QRNE 2CDEB 1N6UA 3MV9A 5JR1H 5GS2H 1D5MB 1KJ2B 3DRTB 4LCYA 2E7CA 2XWJB 4NC1E 3CSYB 3E2HC 4JG1L 3QI9D 1RK0B 4WGWB 2DQCH 3P73A 2VERN 4FQXC 1HHKB 5M95B 3QA3A 4OD1L 5KSUA 43C9B 5E56A 4WWKD 1RULH 2YXMA 4HQQL 4XVSL 5KN5B 3SGEI 3UTTE 5HPMB 1JWSB 4JHZA 1U93B 2E7HA 1IKFL 4WEMB 4WFGD 4NFCA 3M17B 1FVEA 5EG6C 1HI6A 5L2KD 1FAIH 4QYOA 3NAAH 4X4YA 1KTKE 3QDJE 4CDHA 5HHOD 5KJRL 4NSKB 3MV7A 2UZIH 2YUVA 1R5VA 4PJGA 4G5ZH 3THML 1BEYH 3QCVH 2MTPA 5HHNA 1QSEE 4GRWF 5F9DC 4PLOB 1UWXK 1D5XB 2GJ6E 3PGFL 4Y4HA 4YFDB 5DA0B 1YQVL 3P0YH 2B0SL 5DI8B 4LIQE 1R0AH 4U7KA 1AD0B 4ZSOA 4JB9H 4NQEE 3R8QA 3S4SA 4P46D 1DUYB 2FEEI 3VG0H 5C0BB 1F2XK 2JJSA 2DM3A 1A6TA 2HT2C 1EA9C 2LTQC 2OM5A 5ADPL 2DBLL 1OHQA 1HZHL 1I7TA 4HS8L 1KJMB 4LCCB 1BVZA 3WJJA 3UC0L 4APQB 3TJEH 5I1CH 1DQJA 3MRFB 3VDCA 4MS8D 4P23C 2FBJL 3CPLA 3O3DB 1AHWA 4AMKL 4HS6A 2GT9A 1MI5A 3JV6B 3MUHL 3RA7L 1XR9B 1HOCA 2NY0D 1AGCA 1TFHA 3GBLA 1F3JB 5D1ZC 1T0MA 5HI5D 3P4MB 1IZJA 2IH3B 5IQ9A 2SEBA 1A64A 4MAYB 3JTTB 5EULV 5E99L 3K8LA 4FZ8L 1QSFA 1ONQB 5IB4A 1A14L 2VXUL 5MP6L 3HCVA 3IU3B 4CN4A 2H2SD 3MRHA 4FFWC 4BSVA 3QQNA 1V7ML 4NZUL 1GHFH 3MBEA 5DXWA 3T0WA 2E9IA 3PL6D 2FO4B 1FN4A 5D8JH 4U0QB 3TV3H 2VO5A 5HJ3B 3EZJB 5FYJH 2AJVL 5GRYA 2EXWD 5I1LB 4LSRL 1MCSA 1T83A 4NN6B 1CICC 1MUJA 1AJ7H 4X6FA 3QR2A 3C6SB 2MQ0A 2CUIA 3T09A 1MQKH 4JRYD 4NFBA 1GGCH 5EUOE 2YXFA 2YR3A 4HS3A 1XIWA 1BD2E 4AQ1B 1AIFA 5F96H 3TEUA 4JO1H 1QRNB 4JY4A 4MX7A 1BIIB 3KPPB 3U36B 3LRGA 4XCFH 5J7CC 5CZVL 4YPGB 1M71B 1R3IH 4ALAH 1Y0LB 1E6OH 3GO1L 5FV1L 3GJEA 5B38G 2R1WA 2XI9A 1AO7A 3G5YB 4IOIA 4FTVA 3V6FA 5CLTA 1A1MA 4DZBA 4KQ3H 3H9HA 4OFDA 3STZB 3TA3B 1AP2B 1MHHB 2IBBA 4GAGH 3UTTB 1HCFX 5B4MD 4HD9A 3GSUA 4ZPTB 3QXDA 1II4E 4GW1B 3SPVA 1A7QH 1AQKH 4UINL 5TDNA 3D1MC 3LEYL 4LFHD 1K6QL 3ARFC 5T5NG 1J0HA 4HULB 4QXUL 1LHZA 5D1XB 4XP6H 4JHWL 4MDIA 1CD0A 3P0VL 3QDJB 3QZWA 1FG2A 5CCKH 3IFLH 1ITCA 3S34H 5LVEA 4BZ2L 3HZMB 4HHAA 3MPCA 3DVNA 1QSEB 4X9BA 2WUBH 4KI1A 5EIQA 2XN9D 1U8PB 2GJ6B 3K4ZA 4DKEL 1FJ1A 2DQEH 1RIHH 1WITA 2FD6L 1OGAD 2VDLL 4AENB 5BV7B 4O02H 5LWYH 3LDBB 2CR6A 1U8NA 1U8QB 4NQEB 5FKAA 4ELME 2ZP0T 1QLFB 2X1PA 5B21A 3B83A 5D5MF 1RZ8B 5FGRA 5IFJB 3MUZ1 3OKMA 2OMBA 1NC4A 3K1DA 1U8KA 5JPMB 2EIBA 1J0ZA 2C1PB 2H1PH 3C08H 4YHKL 5IMOA 2FDBP 5C09E 4P2RD 2DJUA 4ONOA 4KKBD 4ZTPH 3VI4F 1YNLL 4ESKA 1DLHA 1MFAL 1RJYB 3E6FA 5C7XH 1QZ1A 3NIFF 3QWRA 1BWWA 2VIRB 4X9FA 3OZ9L 4RFEA 1T20B 5IG7A 3EGSB 1LK3H 3HI6H 5JIHA 5FHBL 3G5XB 3MRIA 5DJAA 3GHBL 3H6JA 3LVEA 1CLCA 2NLJB 4I3RH 1KTDA 1M7IA 4ODTL 2ITDA 3QUMB 1NL0L 4ISVA 4WDIA 5HYJD 1IEAA 3TZVA 3VDBA 4P4RB 3SE9L 4NN7B 1H3VA 1J5OH 5E2VL 1A6VL 4KFZC 3G6AB 4NM4H 3RNQB 4M61A 3NA4A 3B9KA 4Y8AA 4YGVB 1NEZG 2GITB 1RUPH 1U6AL 5EUOB 4RAHA 3AC0A 1JWMB 4LCCC 5KZCD 4U1LA 1BD2B 3OR7A 4APQC 4Z7WF 1L0YA 2GCYB 4NOBA 4EBQL 1T1ZB 1NQBA 1EHLH 2X9XA 1UJ3A 3O11A 3GGWA 1L9MA 4PS4H 4XX1E 5AYQA 2CMRH 5I18L 1XGUA 4PB0H 4Q0XL 3DLQR 5E8OB 2XZQL 2CIKA 2G5BA 1F11B 5DJ6A 5INCA 1IVLA 1KIRA 6CGTA 3L7FB 1A4JA 4AQOA 3OWEA 1UWGL 4MAYC 3JWDC 2OTWA 4LCWD 4G6KL 4PLJD 1F00I 3ARWA 1GGIL 1CDUA 1GPOL 2E9JA 4BK5A 1NEUA 3UPRA 4HDIA 5BOPA 4R7DA 2DLEA 1MFDH 2DLTA 1XF3A 5FYLD 1U8MB 4LKCB 4ZD3H 1S7XA 4ZPVB 2A73B 4XB7A 4QXGH 4V1DE 5IWLC 2NW2A 4NN6C 3BAEL 2E8YA 5IESL 3FO1A 2EC9T 2BHUA 4WU5A 1PG7L 3JXAA 4OKVB 3AU1B 4PJCA 5DD0H 3T1WA 3D9AL 3MYZA 2RJMA 4NP4L 1KXTB 1NMAL 4HWNA 4NC1C 2HLAA 4OLWL 2B1AL 4WI9A 5MENE 5EWIL 2LVEA 4KPHL 1YEGH 5CJOH 3BXNB 1RHHA 2XQBH 4F33B 5ACMA 5ESQB 3T0AA 3PNWA 4QWWD 5DUMH 2VDKH 5C09B 4A6YA 4Y4FA 1TZIB 5IBTL 3TA3C 4M3JA 4KV5E 4NZTH 3UBXG 4JO3H 1P7KA 4UNTA 1D3CA 1A4KA 5D1XC 1SMAA 2R69L 2V5MA 3WHXB 4ZUWA 4FQIL 3P30H 3L3JB 1A5FL 1KTLA 1MCNA 1XH3B 4JFZL 1MHEA 1KJ3H 1JPGB 1LGVA 1DEEA 3MOAL 1HWGB 1C5BH 3MRKB 3MGOA 4GXUM 4N9GB 4GKNB 5BV7C 5CP7B 4M8QA 5E4EB 1BIHA 3LDBC 4D0DA 3WFEH 1G9NC 3IXTB 4LOUD 3JUYA 3QIBA 3PWJA 3RWGB 3DUSA 1IGYA 1YEJH 4YWGH 5D6CA 3RUGE 4DN3H 3WFDH 1E4XL 4G6JL 1OGTA 4GG6F 5T1LA 1I7UA 2B5IB 2DQTH 4EQ2A 3NCEB 3IU4H 1B6DA 3L6FB 2AI0H 2VLLA 4Z7NF 3OGCB 1F2QA 2W9EL 4N0UE 1KFAL 5I66A 4XCYB 2H45A 4LK4A 5F3HA 1B2WH 35C8L 1RK1B 1ZT1A 3BPCA 5T3ZD 1A7RH 4K7PY 3T77B 5ITBL 5DD1L 3SQBA 4GXVH 3CAFA 4BQ9A 3O3EB 5MERB 1UQSA 4WFEE 4XAKE 4JO2H 1LO5B 4Y16A 4UMGA 3S3PA 2PW2B 3OKDA 4H1LA 1MCWM 1S9YA 1L7IL 4ZOCA 3D0VA 1FDLL 4NN7C 1DQDH 4JFEA 4V1DB 4D8PB 5F1IA 1C08A 4P5KA 3O41A 4ORZC 4HKJA 1VGEL 4KI5E 1UFUA 5BVJA 3Q6FB 1IC1A 3BDBA 4ONFL 3G6JF 4YDVB 3S5LB 4YHZH 3S3JA 5IKCB 4XCNA 3I3BA 3RWFB 5CP3A 2HVKB 5HGDA 3CCHA 5I16A 1FZJA 4NKOB 2F5AH 5CSBA 3VXNA 2FSEA 2QKIB 1T2QH 5M94B 4HIIA 2VLKD 1QRKA 3ES6B 1ZLSH 5MENB 3VGAB 1YDPB 4MD5B 5I15H 1YJDC 1ES0A 4ODWB 3DV4A 5JO5A 3CX5J 1TZHB 4J6RH 3JUZA 3IJSB 5FA3A 5DD3L 3WLBA 3MJ6A 4FQXA 1A7OH 4OFVA 5ILTL 4XXCA 1QD0A 3SGKC 2QLVB 1CBVH 4W6YB 5DDHB 3KWWA 1C5CL 3IFPA 3OJVC 1JRHH 2OL3H 2L4OA 3VFSA 1GCFA 5EO1A 4CBPA 4FFVD 4R4BB 3WUWG 2A77H 2NW3B 2NYYD 2IPKB 3PWVB 4ELKB 4RRPG 4PJXA 5JZ7D 1B0GB 3ARZA 1ZHBA 3PXJA 2ZUTA 2IC2A 4PRPD 1C8PA 1CDIA 1NMBL 2H8PA 5JA8B 1FRGH 4ONGH 3ULSB 2VXQL 3OKOA 3V5HA 1NC2D 3H3PH 4JPKH 4A6YL 3KR3L 5IVZA 4MVBC 2VDML 5IUSA 4U6XA 2QQKL 4OZIA 4P9HH 5L7XH 2FECL 3CFBA 1J9CT 3RZCA 3JBG7 1BOYA 1MCCA 3U9PL 4OZFH 5J6GA 3NFNB 3MRMB 1S9XA 1FBIL 1G7JA 2QHRH 3EDEA 3RUGB 5J9PA 1EHAA 3IDMB 2HH0H 2V7NA 1UC6A 4QOKE 3L7EB 3QNYB 4JEGB 1MJ8L 2ESVB 1KJVB 4N0UB 4XGZB 1ADQA 4P2CG 3DBXB 3V5DB 3GMQA 4P23A 3JVGA 3FCTB 2XXMB 4ACPA 1T6WA 2CQVA 3SE3A 1AQDB 1DFBH 1RZ7H 2CGRH 3W81A 1A6ZB 3BZDA 1UZ6E 2ICWB 4TUKL 1M4KA 5D1ZA 4OCXH 4BK4A 1NCBH 3KS0H 4JLRB 2G2RB 3X14B 2GSIA 2H2PD 1IQWH 3U7WL 5TE6H 3EYSH 3P11H 2BVTA 4RGND 3HI5L 4Y7MA 4NYLA 15C8L 1AXTL 3BYTA 5CGYC 4YX2H 1EBAA 1G0DA 4L8BB 4HJ0D 3SKOB 5E4EC 4W6WB 5E8PA 3GI9H 1U8HB 1INEH 1W2KT 5E94B 4XPFL 4RAVB 1M05B 5HTSA 1K2DA 1CICA 2Z8SA 3F7YB 3DUHA 5BO1L 4D9QD 3VFGL 3PHOB 4NFDA 4I1NB 4PJBE 4YZFF 5I8OL 1OWRM 4HFWA 1IAKA 4KRNA 3FO0H 2NY5L 5IFHL 2B5IC 1I8IA 4YHOL 1T0NB 2Z8RA 1YN6A 4Z7OE 4OF0A 5IMMA 1OLZA 1MCKA 4OCRH 2EXYD 2UUDH 3V52L 3LQAH 1PG7X 5D7IF 3O8XD 5DHVH 4AEIH 2Z91B 3Q1SL 4K8RL 4UI2A 2DI8A 4YHML 3MA9H 1FO0H 1CD1B 3D18B 3FB5B 1FNEA 5F7NC 3SY0A 1KC5H 1PDKA 3CH1B 1OCWH 4J3XA 1UEYA 2O5YL 4C83B 2FHFA 1OSZB 3L9RA 5BS0E 2R2HA 1VB9A 4RMVA 1A7PL 1OP9A 1A9EB 5GS3A 2ZPKL 1DBAL 2WWMD 3AS3A 5TDPA 5FYKD 3ARFA 1HH6A 2EDXA 4DN4H 4E0RA 2FB4H 5DURD 2FJHA 2X2YA 3CZJA 1A6WH 3A6BH 1SMOA 2EC9U 1N8ZB 1CE1H 2GHWB 5BMFL 2VDPH 5C0AA 5CMAB 5C0CE 3VRLF 4M1CD 2HKFH 2FATH 1HHHA 1ERNA 1JHTB 3T0DA 2ZOKB 3OPZL 2YPLA 4Q9BA 3K3QA 4DVBB 3S9DB 1KLGB 2CDEA 1DBJH 4KK5D 4OGYL 3RVVD 3SJVD 1EFQA 5HYSB 1D5MA 1GGTA 1NGQL 3BOVA 1I9RH 4HFUH 3CSYA 3VE0B 5DUPH 4AIZB 3B5HA 4QOKB 4HUVB 1RK0A 2BRRL 3FJTA 4NKIL 4EIGB 1J1XL 1HHKA 4OIIH 1AE6L 4Y2DB 1HHIB 2UY7A 2CJUL 5D7JD 3HE6B 4XNMB 1Q0XH 2PTVA 4Y4KB 4HWBH 1T66C 5KN5A 5HPMA 3M1BB 4YUEH 1JWSA 1G6RH 1U93A 3VXTA 1OPGH 1FPTL 2R2EB 3IYLW 4PTTB 5JXEA 4GBXD 1FNLA 2BVPB 4PJAF 3M17A 1ZT7B 3T8XA 5EBMB 3RIFF 5BQ7A 4IRSC 1OOAA 3B5GA 3HR6A 5GJSL 4J3VA 2BSTA 4NSKA 2PYEE 2XV6B 3MNVB 4NQTA 5F8RC 5CJ5A 2Z31B 1DQLH 4HV8B 4G8EB 1OAXL 1D5XA 1ADQL 1RUQL 3ZE1E 5I19L 1U8IB 4KQ4L 1U2HA 5DI8A 1DBML 1AD0A 4AK1A 1DUYA 1JNLH 3N9GL 3H3BC 3QISA 3TIEB 3ELAT 4WTZA 1H3XA 4PJBB 2IAND 5EN2B 3G6DL 2XXCB 3GSVB 1KJMA 4LCCA 5E9DD 4APQA 5ENWA 3U2SB 5GSVB 1F42A 3MRFA 4RMWA 2Q87A 2DICA 1JNNL 2KZ1B 3OG6B 5DZLA 4BZYA 3RIAK 2D7MA 3HR5B 5IF0B 3HZKB 1QG3A 4D2NA 2GJZA 4QHLA 3VD3A 1JMXA 1XR9A 4BFGA 2ZJSH 1OAYH 1F3JA 2DDQH 2F74B 3PF2A 1PG7W 3MV01 3JTTA 1QFWM 5HI3C 2JIXA 4R2GD 2LAAA 12E8L 1ONQA 3QG7L 2EECA 3C2SA 3IU3A 4CU7A 5TQ0H 5BS0B 2FZ3B 3W11D 2VZOA 4G7VL 3G08B 1EZVX 2FO4A 3MREA 3V4VH 3CX2A 5JHDD 4UT7L 1LP9E 2VOTA 3EO9H 5HJ3A 3BRGC 4NUGL 4QEGA 5IMKB 1N4XL 3ME0A 5I1LA 1F4HA 5IWLA 1NCDL 5JDSB 3HE7A 3VGFA 3KPQB 3C6SA 3WFCL 1S78D 4IDJH 4UILL 2GIYA 2R4RL 1RJZB 2YWYA 3BT2H 5CINL 1JZ3A 1QR1B 4KRMB 4LBEB 4JFHE 3SBWC 5E6IB 4Z7VF 2IWGA 2YMXL 2FIRT 1QRNA 5CS7A 1BIIA 1YYML 1MRDH 3KPPA 1I8KA 1J0YA 1IC7H 1W0YT 2Y6SC 5EZLA 1Q94A 4YPGA 4WO4B 1M71A 1JL8A 1IGFH 2OLDA 1JF5A 2VKXA 1XGRB 1Y0LA 4XP5L 3B9DA 3VJ6B 1JPTH 3U4BL 3Q5TA 2AKRB 4FA8A 3TNNA 3OMZA 3PJSA 1X4XA 4JKWA 4HCRH 2D9CA 2HLFC 2X4TA 1R3JB 1G7PB 2AJUH 1Z5LB 3VFVB 3CLFH 3BVNB 1IM9D 2VWEE 1QBLL 2AW2A 3STZA 1GGBH 1AP2A 1MHHA 3UTTA 5L2KE 4ZPTA 4GW1A 4G6AC 2I9TA 3BPOC 2Y23A 4LAQH 1SM3H 5D1XA 3T0ED 1EUTA 1NH6A 4WI5A 4HGKC 1J8HD 5H2BB 3T65B 2AXHA 4GSDH 1JYVA 3ZDYE 2IBZY 2FIKB 4HLJA 2N7BA 2PYEB 4XPBH 3HZMA 2EDHA 5LAXB 1ZA6B 1QSEA 1U8PA 2GJ6A 2JJWA 1QPXA 4OCLC 4X7DC 3KLHC 5ISZE 2IQ9L 2PO6A 2EDDA 2C3GA 4RFOH 1U8QA 4NQEA 1XF5B 3T1FB 4GMSH 1X5HA 2X09A 3PGCB 3QPQD 4K9EC 4I9WE 5AD0B 5EA0H 3GK8H 3MRGB 3FAWA 1P1ZB 2V5YA 4LQ1A 4X98B 1QLFA 4K23H 4HH9A 3FQTB 1KJ2H 5IFJA 2VR4A 3IDNA 3TPKA 5EZOL 3NTCH 1NSNH 4N1HB 2GUOB 4Y2DC 5D71L 4KROD 3I3DA 2VLRE 4PJ9D 1MREL 1S7WA 3HE6C 3L3OB 1L7TL 4NC2B 4Y4KC 4XHJC 3EJYD 3R4DA 2P49B 5FYJD 2BP3A 4KXZH 1I85C 4OQTH 4TSAL 5FECB 4DCQB 1EJ6A 1F90H 1T20A 4LARH 4M4PA 2XIDA 4MMXC 3ARGD 3EGSA 5CHNB 3L3KB 5LCVL 3ZHDA 1LWRA 1M7XA 1E4XI 1W0WB 3QUMA 4L3EE 4K7PX 4CW1A 4PFEA 5C0NC 3MACH 1LP9B 4LCUB 3WFHB 3MGTA 2UUDK 4FQCH 1DN0B 3SKUD 4X0KB 4CAGA 4GH7B 1JNHB 4DK3A 4LCIH 3RNQA 2WWKO 4MSWB 5GSRB 4GRLB 2ADGB 4IOSD 4OAWB 1SEBB 4YGVA 4CJ0A 1G7HA 5IHLB 5GGTH 1X9QA 1JWMA 3W2DH 5ICYA 2GCYA 3ALPA 1J7VR 2NX5E 1T1ZA 3MODL 2ICEB 3L3DA 1HQ4A 1NPUA 1SYSA 3EZ8A 3H9SB 3T0BA 4S1QL 4QY8B 3MNZB 1HXMB 5KS9E 3FFCD 4BQCA 5EIIA 1KEGH 1SJVA 4POUB 1F13A 1EJOL 1F11A 3U30B 4HX1A 1KLFA 5C08E 4Q6YA 3HAEG 1IBGL 1QFPA 3VA6A 4F37F 4S1SL 3QHFH 1QUNA 3L7FA 3OHXB 5LXGL 1MNUH 4OT1L 5E2WL 4JM2C 5EU6B 3P40A 1ROWA 3U48A 4N8CH 2IG2H 2RQ8A 3SGKA 3JWDH 5IBUB 3O0RH 1MEXL 5I1HH 4NRZB 1JRHI 1K85A 5AWNL 1I3GH 3MJ8B 2D7OA 4LKCA 3S3SA 4Z95H 4ZPVA 4XVUD 3OKNB 2A73A 3LKRB 4Y0GA 3OKEB 3MV9D 1XMWA 4P3CL 3BISA 3SE8L 1TJIH 2XN9E 5A2IH 1V7NH 2VISB 3F58H 3TESA 4PJFA 1JP5A 3MLWL 4YHPB 1YC8A 5I1EL 5IHZA 4NCC1 5T1DH 1PKQE 5E6IC 4MZ2A 5ISZB 2ZSWB 4NRYB 3TT3H 4R4NC 4MA3B 1F6FB 4LLDA 4S10A 4OKDA 2P8MB 4WO4C 4GXUN 4J8RB 4N0RA 4J2XA 3AMKA 3LN5B 4D3CL 4H8WC 1X4ZA 2UWEE 3W82A 3FB8B 5D7SH 3VFWB 2YPKB 4LPVA 4MNGE 2B20A 1KOAA 3SO5A 2VLRB 1DBBH 3VXQB 5C09A 4PY7B 3MV7D 4YBQC 1U2CA 3LOWA 3WKML 2ZCHL 3BDYL 4G5ZL 4MQ7B 1BEYL 3VA2C 5GGSY 4Y4HD 1KCSH 4D0CB 1MFCH 4KTDL 4PD4J 4UQ3B 5D96C 4N5EC 5DEZA 3AREA 4TPRL 1CWVA 4HUWA 2DRUA 4OQ1A 5HYJE 4XZUA 2ID5A 1HN1A 1XH3A 2VL4A 2P42B 1G1YA 3OX8B 3L95B 3EJZC 1JPGA 4M48L 1V3LA 4L3EB 4EVNA 1E28B 1C12B 1JF6A 1MCEA 3GBNH 3TBWB 4GKNA 2GK0B 2AJ3B 3BMVA 1CIUA 4JFDA 1WISA 3IXTA 4QHMA 4UU9B 3U83A 4PJ5B 1RIUH 2OJZH 4CADA 1NBZB 1WWAX 4LIQH 3P9MB 3K2UL 5FO7B 1MI5D 1G9NH 1RVFL 1FNGA 5GRJH 4ZXBA 3FOMA 1J1PH 3GSNB 5TPWH 2NXZB 3NCJL 4DEPB 2NX5B 4FQLH 2R0WL 3QUML 3TT1H 1LO3L 1QSFD 3NZHL 3L6FA 3OGCA 1LDSA 2OYPA 3D0LB 4QRQB 3QEHA 4XCYA 5C07B 5KS9B 1I9IL 3MBED 1TZGH 5GZOD 4XPHL 1RK1A 2X5PA 5C08B 3CSPA 4TTDD 3T77A 4Z8FH 1H3PL 1OTSD 2N56A 5TF1L 3WXVL 4PJ8B 1UACL 1H15B 4XNYH 3O3EA 2EDJA 2DQFA 5MERA 2K3TA 5FYLE 2NNAB 2CLRB 1LO5A 3BMWA 2PW2A 1EGJA 1CQKA 3NFSH 3CDYA 4KAQH 5K9JH 1ACZA 3TYFB 1XIWD 1AR1D 4FFYL 2F58H 4D8PA 4RISH 4WHYH 4I2XE 4LLQB 4LSTL 2X89A 2EDLA 4NCC2 4E42B 3HNSH 4XCFL 5DRZB 1UM5L 5B38B 4GRLC 2V5RA 1KB5A 1R3IL 4Y8DC 4M00A 1T1YB 1K8DB 5CLWA 4YDVA 4OZHE 3S5LA 1E6OL 5HI4D 5IKCA 3KAAA 1YY9C 1PKQB 4PJDB 3CFDA 1GZQA 3RWFA 3IJHB 4KJPD 2HVKA 4FTVD 3MQIA 4WRLA 4NGHL 3VXPB 4WUKH 2UY6A 3BZ4A 4L4TA 3ZYOA 3NABL 3U30C 3ES6A 5JTWA 5MENA 1RV6X 1YDPA 2FX7L 4MD5A 1WEJL 4LFHG 2DM2A 4ODWA 1MPAH 3TNMB 3X11B 2FJFB 4MNGB 3IJSA 1F6AB 1FZKB 1CDBA 1IL1B 4LHUA 1YJDH 3QUKA 1T2JA 1I8MB 2VWEC 3KLDA 3CU1A 1PSKH 3QDME 1SJHA 5DDHA 2IFGA 3ARRA 2EEDA 5K33A 3IDUA 2NY3B 1A6UH 2DD8H 3HMWH 2PR4L 3WJLC 1QBMH 5DK2A 5FEBA 4K3EH 3OBAA 2NW3A 2IPKA 3PWVA 4JY5L 2WQ8A 1ZGLB 1MELA 3WEXB 3EYOB 3F12B 3QEUB 3WKNA 3OR6B 3TFKD 4NKQB 4YDIL 1KIQA 4LSUL 1UWEH 1NC4D 5EOQL 4B41A 1IC5H 4LLWB 4F37K 4WTWA 1YNTB 4J1UB 4NHCL 3ULVH 1Q9LB 2HFEB 1Q1JH 3JTSB 3RY5A 4XPTH 4YHYB 2L7JA 4KUZH 4N0YH 3MRCA 3NFNA 4QHUB 4ZS7H 3RNKB 3GSWB 3C5SB 4HGMA 3RUGA 1DUZB 5DD5L 3V4PH 5EUOF 3QWRD 4MS8C 1RZKL 2FLBT 4DKAA 2NY1D 3L7EA 4RMTA 3QNYA 2VNCA 1PY4A 4JGMA 1CLOH 1IAIM 3CDFA 1LK3L 2ESVA 3HI6L 1KJVA 3BP4B 4N0UA 5T3ZE 4XGZA 1IM3A 3NPSB 3V5DA 1JJUA 4F2MB 4B7LA 1UCTA 3FCTA 1PY9A 2YZ1A 1D6EA 1T5XB 5CEZL 3TZVD 4LSDA 1A6ZA 3AS1A 2ICWA 1XZ0A 1TQBB 4ZQKB 5IIEB 5HHQB 2EYSB 3LS5L 4JLRA 2G2RA 3DVGA 3E0GA 3X14A 4WY7L 3TH2T 4U3XA 5GPRA 4S1DD 4TRPH 4F15C 4JFYA 1M6OB 1PKOA 4L8BA 3SKOA 2HKHL 3IRZA 1MFEH 1YUHA 4O9HL 1EHLL 1S8DB 2HTLC 4I2XB 1YECL 3R1GL 5DVMA 1S7SB 1A0QL 4XCCH 5E94A 4MXQC 1M05A 5CBAA 3LKQB 3UP1A 3F7YA 5C2UB 4ZTOH 2DM4A 2XA8L 3HZYB 3PHOA 3GBML 4OZHB 5C86A 2W65B 2NXZC 4DEPC 1FNAA 3ULVF 1ZV5A 1NUNB 3CK0H 1ACYH 3MO1B 1T0NA 5HY9B 1A02N 3SBWA 3SDXE 1EGJL 4ELMF 3FOLB 4JAMB 3KPSE 3GMOB 3QFJD 2Z91A 3UTZB 5JHLH 2R39A 1U3YA 1ZVSA 3BYYA 4FXGB 2D7TL 1CD1A 1HINL 4OCWH 3D18A 3FFDA 3FB5A 4NO0B 1BAFH 1RMFH 4PJ8C 3ZSSA 5JUEL 1YY8B 5B4MC 1KB5L 1GYAA 4QRPB 2HFFB 5BVPL 4C83A 1JBJA 4KJWC 1OP3K 3C60A 3QDMB 5JQ6H 5L0QB 1T04B 4HEME 5GIRB 1ZHLB 1OSZA 3WIHA 3MRRB 5L8LB 3B2UD 1A9EA 3HS0B 5DD0L 1PD6A 4QTIL 1MLBB 2B1HH 2OP4L 4PRPE 2AEIT 1VKXB 3E3QE 2IPUK 1B9ZA 4DUVA 3MLYH 5KVFH 2V2TA 1KN4H 3IRPX 3QUZB 3QXTA 1T89A 1FQ9C 3RVWD 3PP3H 1W0VB 2GAZA 1UM4L 5CMAA 3AM8A 1YEGL 4LEXL 3F65A 1FH5L 5BW7A 1P4LB 5HYQB 3VFNB 1JHTA 1SVCP 2ZOKA 3UBXB 1YEIL 5FB8B 4P2QE 2EIZB 4Y4FD 1KLGA 3UZVB 4XP9H 1FLRL 2IBZX 1T3FB 3FQWA 5HYSA 3BQUD 3DETC 4OD3H 2VZSA 1INQB 3VE0A 4O4YH 1CDCA 4AIZA 1EH9A 2XWBA 1RU9H 2BY3A 1BJ8A 1F4XH 4KKBC 3AB0B 2JB5H 4NQCE 4PGEA 3SE4A 2OR9H 1SBSH 3QIWB 3D87B 1V3JA 2GW5A 4HUUB 2NY3C 5ICXA 4NIKB 2R2EA 4KY1L 4PTTA 5HDQH 2BVPA 5DWUL 2C3WA 2BVUA 1I85A 2P48B 4OF6A 5HHXL 4NWUH 4HW6A 3QIBD 2ED7A 4HT1H 1V5JA 1KG0B 3B3IB 4ZUTB 3MNVA 4HJGB 5J1TC 2Z31A 2AJXH 4HV8A 4G8EA 3G04B 4LSPL 5T1LD 5JW4M 2VDOL 1INDL 1JGVL 1Q9KB 1U8IA 2XZZA 5I1JH 4TSBH 4YHYC 3SKJH 5D70L 2BJML 1OAZL 3MXVL 4G9FB 1PLGH 5FO9A 2Y07L 3GM8A 3TIEA 2LABA 4PJBA 4Z76B 1RIVL 3GSVA 3ULUE 4LPUA 3R06B 4ODSH 1RPQA 3U2SA 5GSVA 4WCYH 3SDXB 3KS0J 4PJ7E 5FHAH 1X5JA 3NPSC 2XTLA 4JO2L 4KVNL 2LVCA 2JELH 5DC4B 3EYUL 4Y16D 4M6NH 3VCLB 1X44A 4F57H 1MWAH 3HR5A 3KPSB 1C1EL 4JFPB 2MPAH 1OSPH 2I5YL 3HHRB 3GB7B 1MIML 4XVTH 1DLFH 4JFED 1FL3B 4K8RD 2JKXA 2F74A 1TQBC 4GAYB 1G0YR 5HYEA 3CMOH 4EN3A 4PRIE 4JDTL 2XOTA 5I74B 5IB2B 1YEKH 4M62H 4KV5F 2R4SH 5BS0A 2FZ3A 3PWPD 4L1DA 1BGXL 5TFSL 2LV4A 1UH4A 3M07A 4EIZC 1PEWA 3WO4B 4YDKL 5IMKA 1K3ZA 1TITA 3SGDI 4LHQB 4M7LL 5EO0B 4KK8C 4UUJA 1PEZA 2DMCA 5JDSA 3T4YB 3FRPA 4HG4K 4FZEH 1T2QL 2PTTB 4R97B 3QFDB 3HPLB 1IGMH 3DYMA 4JQXC 2ED9A 2P8PB 4R8WH 1RJZA 4L8DB 3X3FL 5ID1B 1QR1A 2X4NB 4D9RE 4JPWH 4I3GA 4FQXD 5E6IA 1JPST 4P2QB 2NZIA 5GGRB 5LGHH 4DW2H 1AI1H 5JPNA 1JV5B 3P4NB 5D7LD 3F6LA 4BH8B 1CBVL 3WUWB 5A2FA 3VXRE 3IFNH 2PCPB 3T2NH 4WO4A 3EYFB 3WDHA 3FMGL 3GMNB 1AFVH 3OKLA 4QWWC 1XGRA 2OL3L 1UXWB 1CK0L 5CIPH 3VJ6A 2AKRA 1IGCH 1FZMB 3CLEH 3BZEB 4NQCB 1YEHH 5D2LE 1MJ7L 1R3JA 1PAMA 1G7PA 2PXYB 5EZJB 1Z5LA 3VD4A 2OMNA 5L0QC 3BVNA 1F8TH 1Z3GL 2HA1A 2GTZA 4YHIB 2VQTA 2J88H 4XH2B 5ID0B 1EEZB 3RAJH 2AQ2A 3I84A 3H3PL 3TCLA 3WYRA 3FQXB 4UOW1 3CJJA 3S88H 1N59A 4NM8L 4O5LH 4KHXL 1PZ5A 3QUZC 5B39B 5H2BA 4NRXB 3T65A 4UV4H 5L9DH 2PYEA 4JPVH 2NXYD 2W92A 2VABB 3CVHB 1EHNA 1JGUH 5LAXA 1DL7L 1VACA 1ZA6A 1EMTH 4UOW0 1WFOA 3H9ZA 2VE6A 3B2VL 5HBBA 1A1OB 2YD6A 4O2CB 1XF5A 3NACL 5AD0A 3PGCA 4KI5F 4P23D 5J12B 5F6IB 1P1ZA 4TVSa 1B0RB 3KYMB 3BE1H 4PREB 3UPAA 3FQTA 3QIUB 1R3KA 4MA7H 3AB0C 4HPYH 2GUOA 5D1ZD 4OZGE 2O5ZL 5F21B 1K4CB 1LE5B 1KPVB 4PJ7B 3QIWC 1CYGA 3BZFB 4JVPA 3FO2B 3L3OA 4UIKH 1IT9L 2O26U 1N3NB 2H3NB 4GO6B 4R4FH 4FFWD 5HD8C 3OAYH 3LEXB 1H0DA 3DGCR 1KELH 2CH8A 1TJGL 1GZPB 2CDFB 1RUAH 3FQNB 4PRIB 5CHNA 4HH8A 2IGFH 3IKCB 5EOCL 1HHJB 1CICD 3V5KB 5JHDE 3FT3A 4FN0A 1MIEL 1W0WA 1MFNA 4OLYL 3QUXB 5EBLB 1CL7L 2CO7B 3MRQB 1KCRL 2APFA 4FMFA 3QDGE 2DQGL 1HSAB 3FO0L 1LP9A 3WFHA 4N5UA 4WHTB 5CUSL 1DN0A 2EE9A 4X0KA 1MRFL 3WNMA 3KGRA 5ICZB 3MMEB 1NFIA 2YD1A 2ADGA 4GRLA 4OAWA 1SEBA 2XKNB 2X05A 1W8NA 1DBKH 4D0BB 1KC5L 1CGXA 5KBNC 1OCWL 2ICEA 3G5VB 4YR6B 4F3FB 4Z7QE 2DL2A 5DMGC 3H9SA 4F7PB 2YN3A 4QY8A 4IRZH 3MNZA 1RFDL 3Q5OA 4JCLA 3VXRB 1HXMA 5C6TH 3QWOB 2VRAA 5HXMA 1OD9A 5D9SB 1QFOA 4OB5L 5DJZB 1I1FB 5D7JB 2BDNL 3ARFD 5D2LB 4MQXC 3GRWA 5EU6A 1UH3A 5I74C 4RFNB 2IAMB 4OM1H 2XZCL 4FFVC 3N50A 3PP3K 4C59B 1E4WH 5JZ7C 2NYYC 3OJMB 2BNQE 4L1HA 5C0AD 2ADFL 1WTGT 4NRZA 3T0EE 3WO4C 3MJ8A 3ROLB 4QXTB 3WS3A 5M7QA 3E3QC 2EDTA 4YFEA 3OKNA 2YPLD 5AZ2H 1UZ6F 3OKEA 3D6GA 3QEGH 2GY5A 3NH7L 4X8JB 4I48B 3DXAE 3EO0B 4R97C 1U3JA 5C3TA 2VISA 4L8SB 1G9EA 1CDHA 4X80H 4FFZL 4XMLH 4HC1A 3HRZB 5DUPL 4H0HB 4MJIB 1VFOA 2YD5A 1XGPB 1YZZA 3CU7A 2ZSWA 4NRYA 4UNVA 1NUDA 4MA3A 4YXLH 2IPTH 5E6ZA 2P8MA 4GKOA 3O6MH 1VADB 4J8RA 4GMTL 3LN5A 4PJIE 3DTXB 3FB8A 4GLRH 1Z6JT 3VFWA 3WXWL 2J6EA 3OJDA 3MBXL 5DR5H 5AG9A 2PXYC 4OZGB 5E7FA 1EIBA 4KJQC 3PWUA 4Z7OF 2VLRA 4E41E 3RWEB 5CD5C 4PY7A 3QNXB 3WBDA 2OK0L 2QTEA 4X5XB 1QP1A 5JIIA 1IAMA 4D0CA 5J11B 4PV9A 4MJ2A 5CSZB 4JCMA 2CO6B 1TNNA 5E5MB 4WFHE 3GI8H 3O3UN 4JM2F 5SWSE 3D85A 2ZOLB 5C0BD 4OCMC 5JHDB 3OX8A 3L95A 3SEPA 5A16B 5CAYB 3NZ8B 3O6FA 1A3LH 3ARQA 4IMLB 4LKXB 1RZJC 3TO4B 5DA4A 1R3HB 3CZFB 3T0XA 3QDGB 1E28A 1C12A 5DRWB 4APQD 2Z0BA 1W72B 4M03A 2GK0A 4GQ9L 2AJ3A 4P3DB 4JG0H 5CWSB 3QHZH 4Q6IB 4UU9A 5J12C 4PJ5A 5F6IC 1HXYA 5E2TH 4G6ML 3N1MC 1OAQL 2NR6C 3P9MA 4HJJH 1CTOA 1QQDB 4LQFL 3QIUC 5FO7A 3NMEA 4MA8H 3IDXL 1F97A 2RB8A 2EXYC 3EDFA 3D69B 3GSNA 3ULUC 4X6DA 2ZCLH 2NX5A 3GKWH 3VRIA 4A2MA 4MAYD 2WANA 3IJYB 2LQRA 3U7YL 1TLKA 3RTQB 4F7CB 1P4IH 5C07A 4GG8B 3HC3H 3AS0A 1P53A 3CFCL 1UA6H 4OF5A 5C08A 4WI2A 1EFXB 1CD8A 2ZCKH 3MYJB 1D9KA 1NFDE 1YC7A 4OGAC 2DTML 5A3IC 1G6VK 2WWMC 2BNQB 3B9EA 4OLXL 1QFUH 2NNAA 2CLRA 5JXAH 1FLTX 1MVFA 3RGVB 5I8EB 2H32B 4TQEH 2X4QB 3PWLB 2IEPA 4YQXL 2BVEA 3KJ6L 2Y5EA 2W0KA 4M5YL 1QRND 3O9WB 4LLQA 4KGLA 5GS0C 4OLUH 3DXAB 3V7MA 4E42A 4M1CC 3V0VB 3CFJB 3CXDL 5B38A 1IARB 1Z9OA 2NPLX 3U9UB 5KG9B 3HNTH 3RVVC 1T1YA 3GRWL 4JQIH 1K8DA 1QA9B 1BZQK 1TVBB 2VXVH 1JPTL 1PKQA 4PP2B 4PJDA 3QCUH 3IJHA 5MEQA 4IS6B 2YHGA 4M1DH 3ZE1F 1UCBL 3LKNA 3VXPA 3CLFL 5LJYH 3ZT6A 3N1FC 3UTTD 2AAVA 1XGTB 4DOHB 4PJIB 1N6QH 5D7JC 3NCCB 5AYUL 4ODUB 3TNMA 3X11A 2C3VB 2FJFA 4TSCL 4MNGA 4PJGE 5D1XD 1F6AA 3VFPA 4CU6A 2QR0B 4U3CA 4HC1L 3O2WL 3QDJD 1F4WH 4JDVA 4E41B 1I8MA 3JWOC 3DHJA 3ZLQC 2I25N 1NGYB 5FUZL 2YD8A 5FCUL 1QSED 2HRLA 3O2DA 5DT1H 4P4KB 2GJ6D 4CMMB 4UZGA 1N7MH 4Z0BL 1CDJA 3FAXA 2R2BB 4NQED 4ZG1A 5SWSB 3WEXA 4GMSL 2WBJB 1HIMH 2ZKHL 3EYOA 3F12A 3QEUA 3UMTA 5IVNA 2J6EL 3CUPA 2QQQA 2X4RA 2WIIA 4DTGH 4XPAL 3KNBB 1WQVT 3ZTJH 1LO0L 1CFVL 2Y06H 4LLWA 3I50H 4PUBL 1NSNL 5E8DH 1YNTA 1IGTB 2MCPH 2F8XC 1BVKB 1Q9LA 1KPRB 2HFEA 1HQRB 1MI5E 4YXKH 3VXSB 1UVQA 3OAYK 4TULH 1RQ5A 3B8YA 3UJIH 2DKUA 3RNKA 5ESVB 3C5SA 1DUZA 3EDDA 4JKLA 4H20L 4OLEA 5CD3A 1WCBA 4M7JL 4OQTL 1JWUA 4KVCH 5LGKA 5GGVH 4XBPB 2Y7QA 2EDKA 2Z4QB 4EOWL 1JI1A 2EH7H 3GSXB 4XC3H 5CJBA 4U1MB 1JMZA 5J11C 4Q9RH 4HPOL 4NZDA 3S37L 1NEZA 4EI5B 1SY6H 2NTSP 3B43A 5IIEA 2DYPB 2EYSA 2VR5A 3GSNL 2ICWI 2JCCF 2PF6A 3TBYB 3TO4C 5FDYA 2BC4B 1URLA 1BD2D 1MCPH 4LCYB 1A1NB 1WBYB 4NUJB 3AUVA 1JZ2A 2AABH 4Q6IC 1S7SA 3HAEB 3ZDYF 3KPLB 5IMLB 3LKQA 3BN9C 1AO7E 3WD5H 2QSCL 3HZYA 3QA3B 4FTVE 3VI3F 4K94C 4OZHA 5IT2H 5EIVA 5FM4A 5IK3B 2W65A 3DO7B 4JQXA 2EIDA 3HNVL 5SV3A 4LLMB 3MO1A 2HTKD 5SX4I 3MOBH 5HY9A 2P5WB 2H9GB 3JWNC 3RTQC 4CRPA 2AEPL 2IG2L 2XY1A 3FOLA 1MHPH 4P49A 4JAMA 2QQLL 3F7RA 4RGMC 4QYOB 1CFBA 4FXGA 4UTBL 3VD9A 2AJSH 5TDOB 4NO0A 4PJGB 4PRBB 3ARXA 4XWGH 1YY8A 3S36L 4QRPA 1P7HL 3ZHLA 2HFFA 4RAUB 4AEHL 1T04A 3RGVC 1V7NL 5F1NB 3QPXL 5GIRA 3V95A 3T0EC 1P4BL 3VGGA 3MRRA 3MUJA 4M5ZL 2E6QA 4L5FL 4NQVA 1GC1H 4MVBD 4XMPH 4I8DA 1MLBA 3C8DA 4X6CF 2J3SA 1VKXA 5EZIL 2HJFB 3MLTA 1L0XA 2EYRB 3QUZA 3W39A 3DI2B 4HG4J 4JO4H 1W0VA 1DQJB 3KPRB 5IP4A 3T2QA 2HFGL 5GRVL 1QBBA 5LBSH 3HC4H 5IR1A 1ZMYA 1P4LA 5HYQA 3VFNA 3UBXA 5I1GL 3O2DL 2GT9B 5C09D 2EIZA 5I75B 4X8XA 1AGCB 1T3FA 3SDCB 5J6HB 1ZTXH 3VG9B 1KTRL 5IQ9B 3MFGB 1INQA 4HKZB 1WWCA 2AQ3A 1AKJB 4XNXH 3DYOA 5HVGB 5IOPB 1RSFA 4TOYH 3CNKA 5DF0A 2C5DC 4G8GE 4NKDB 1BQSA 4JFOB 4HUMB 1HYRC 4HUUA 3T4AB 1JN6B 5KS9F 4OFPA 4P4KC 5I1IL 1JZ4A 3O2VH 2FGWH 2EEBA 5CGYD 3WE6A 4DAGH 3P4LA 4X6FB 1ZLVH 4DGYH 3MROA 1T1XB 3ARVA 3WIIH 2VXTH 1QKZH 5CEZD 1H3UA 4CN1A 2WBJC 4PJHB 4R26L 1KG0A 3B3IA 3FONA 4IM8A 4ZXBD 3UJTH 2FEDD 1QVOA 1A3RH 3G04A 4CVUA 5H94A 2G60H 2KPNA 2QQNL 4MJ5B 1Q9KA 3G9VA 7FABL 1BFOB 4MAUL 3C87A 4G9FA 2R1WB 5IVXA 5F71A 1NCAH 1AO7B 2MCG1 4JE4B 4NWTH 4KZEL 4L9DA 4UAOB 2WBWB 1FIGH 4Z76A 1JHLH 3DOSA 1IZKA 3ZKMC 4QXWA 2WUCL 5ALBH 3R06A 1XGQA 1PX4A 3SDXA 4XNYL 2XNAB 3QXDB 2OTUA 4FQHB 3ZTNL 3RX8A 1XCTB 1KCKA 3D3VE 2LU3A 1J88A 4JFPA 4O2FB 4UDTA 5T5NF 4CGTA 5KTEL 1CD9B 4KAQL 4MDIB 1BX2B 2A0LD 2XQYK 3GB7A 1FG2B 3KPNA 2UWEF 4JFFA 4H88H 4KHTH 4HHAB 1NCWL 2DLFH 4EI5C 1UYWH 4RISL 4GAYA 4U1JB 4LHUG 3GNMH 1RUKL 2K9UA 5IB2A 4PJCE 1XGYH 1G7QB 1HSBA 2JTDA 2B4CL 4M7KH 2I60L 3WMSA 1NANI 3X17A 2BFVL 4WI4A 3GJFB 4ETQB 5FYLH 1U8NB 4HWZA 4WU7B 1CXEA 5IV2A 2E27L 2ZUYA 1I1AB 4O58L 5EO0A 3OKMB 2AXGB 1PFCA 1U8KB 2FRGP 3T4YA 3NIDF 1HK6A 3ALXA 2A9MH 3RWJB 5IW3A 3QFDA 3TC9A 5MEND 2R0LH 3HPLA 3LPWA 4YHLL 3QHTC 5IMOB 5JW4R 2P8PA 4UB0H 4L8DA 4H5SB 3M45A 1QNZH 1WAAF 5ID1A 2X4NA 4TVPE 2F53E 3QQ9D 5GGRA 2Z93A 4J4PA 3LS4H 1JV5A 2A83B 4XNUH 3QEQE 3WUWA 4RFEB 2PCPA 1T66D 2ZUUA 3EYFA 3GMNA 5IG7B 4MCZB 3IS1X 1UXWA 3MRIB 4M6MH 4K3EL 3RL2B 4CVXB 1DQMH 3MCLH 3TBVB 2R9HC 3BZEA 2FO1A 4J12A 3DMMB 4NQCA 4ISVB 4WDIB 4G8GB 2PXYA 4LPTA 5EZJA 5SV4A 2YRZA 4X7EC 5I9QB 3G9AB 2VTFA 3FZUC 1FORH 1FHGA 5A43C 1M1SA 4XH2A 5FXCH 3FB7B 1TJHH 3HG1A 3B9KB 1YYLL 2JJSC 1JGLL 3RX7A 4ZO9A 4PLKC 3ORJA 3RGHA 1SJEB 5E5UB 2VKWA 4NRXA 1BM3L 1MSPA 5DK3A 5IROA 3WJJC 4U1LB 4ODVH 3RHWF 2AJYH 3CC5B 3CVHA 5ESAB 1QLEL 2F54E 1WTLA 3GGWB 2IH1B 2ATKB 4RCAA 3S37X 2WW8A 1MCIA 2A6IB 1LK2A 1N64L 1XGUB 3GSQB 2CIKB 4QRRA 5B3JF 5I75C 2ESVD 1A1OA 5DJ6B 1K3IA 5J4MA 3SDCC 4O2CA 1OF2B 3ISWA 2RHEA 1DN2A 1N0XL 1OARL 3VG9C 2OR7A 3T04D 1QEWA 3KYMA 2UYLB 3EW3B 2OTWB 3ILQC 4HIEB 2VZTA 4PREA 4Z7UB 1QFWL 3QIUA 4UT9L 3TLRA 2OXGA 4PBXA 3UPRB 4HDIB 4XMKL 1LO2H 1FNSH 4JJ5A 4WFFE 1K4CA 2D9QB 5SWZB 4M1GL 1LE5A 4WFED 1KPVA 3QJFB 3NOIA 4PJ7A 4XAKD 5ACLA 4TTDC 5HI3D 5C0FB 3BZFA 1MCBA 5LQBH 1S7XB 3BPLB 4DFIA 3L3GA 1MCOL 4XI5D 1N3NA 3D3VB 4GKSA 5IJKC 1I7ZB 3C2AH 1T83C 5T3ZH 2E7BA 2NW2B 2DJ4A 3U1SL 5HDLA 1U58A 3FO1B 2CDFA 4EI6B 3DRQB 4WU5B 4GRMA 4W70A 1LEKB 4PRIA 2FX8H 3IKCA 2DLHA 1HHJA 4LVOB 3V5KA 4M6AA 4HXAH 3VXOB 4UDUA 3UCRA 3BEWB 3QUXA 5EBLA 2P24A 3S36X 4XP4H 3GMPB 4K3DH 1A21A 4WHTA 4OLZL 1NUGA 4AL8L 5T3XL 5GQBA 5T5FL 1RHHB 2Y6SD 4U7SA 1Q0YH 3GUTB 4G80B 4KJPC 4LAJH 5ICZA 2J4WH 5JHLL 2ZSVB 4UAOC 3OSKA 3MV11 4NC0B 1EVUA 4D0BA 3Q6GH 1BAFL 1NLDH 2NCMA 2BRQA 2F53B 5E2UH 1MRCL 3BIKB 4YR6A 4F3FA 3C60D 3HMXH 1KIPB 1NKOA 2ICWJ 3DWTA 3MJ9H 4I18B 4KKCC 3QEQB 4FQ1H 2P8LB 3DSFH 1CXLA 3QWOA 1HILA 4ZUWB 3IVKA 3BGFB 1DCLA 5D9SA 2Q8BL 2XT1B 1JPSH 3L1OL 4EDXB 4ZFFA 4G6AD 3BKJL 4OZFG 4P9ML 2VDQH 1I1FA 5DQJB 1MHEB 5J3HD 2D03L 3UYPA 5F1KC 1G9MH 5D2LA 3PWNB 3SOBL 1KN4L 2IAMA 2EIEA 5JMOC 1S3KL 3W0WE 1CFTA 4M8QB 4OZIE 4D0DB 4JY6B 4H26B 5FOBB 5C2BH 3H0TB 4PTUB 3HFMH 3ROLA 4QXTA 3MRLB 1IGYB 2CSPA 3O4LE 3R0NA 2QL1A 2OI9B 5D6CB 4YK4B 3VMNA 2CUHA 4X8JA 4XP9L 1OB1B 3L5XH 5KVEH 4L8SA 3HRZA 2F54B 3OB8A 3TVMB 3SN6N 4U2YA 2VLLB 1UADC 4QOKD 4MJIA 4OM0H 3C6LB 3FT4A 2C9AA 2P46B 1MY7A 1XGPA 2PKDA 2WBKA 2XTJE 3LMJH 1NAMB 1TDQA 1ZT1B 5ANMA 1HKFA 1JF1B 4YE4L 2A1WH 2VLMD 4Y4KD 1U8LA 5GGQH 4XHJD 3EYQC 3INUH 5C6PB 5I30H 4KMQA 2IADB 3PHSA 1ZLVK 2W07A 5BZDB 1UQSB 5JOPD 1TXKA 3DMMC 4MMZC 2W9DH 3CVHL 4BFEA 2MKLC 5I9QC 3A67L 1YEFH 4L9LB 1S9YB 2V9TA 3RWEA 4QNPE 4ENEC 3QNXA 2XA3A 2Z31D 4HBCL 4LGPB 4N1EA 1MAML 5F1IB 3BDXA 2HJKB 4X5XA 3B9KC 1A7NH 1ZANL 3RI5F 5C0ND 5CSZA 2OSLA 4FMKA 5E5MA 1FGNL 1AY1L 4XCNB 2ZOLA 1P5UA 1CU4H 2YK1H 5AZEH 1YPZE 5A16A 3REWB 5HGDB 3NZ8A 3TYGL 5I16B 1LE9B 1FZJB 4LKXA 1KNOA 4YNYB 3TO4A 4Y5YB 4RDQF 1R3HA 2WIMA 5DRWA 4PIRF 1NBVH 1EO8L 1W72A 1TETH 4G3YL 3V0WH 1NAKH 4ODSL 4P3DA 4K3JL 4WCYL 3U0WL 3MRBB 1RZJH 3BP7B 1T5WB 1TQCB 1WIOA 4IOFD 5FHAL 3P2TA 5B8CB 5JO5B 4HLZH 2F19H 4O51B 4M6NL 2X7LB 1QTYT 5FA3B 4GW5A 1QQDA 4EEEA 1ZVHA 3BH8A 3D69A 3LN9A 5GZNC 1JYNA 4OV6F 5FKPB 4Z5RB 3IFPB 4EN3D 1NCTA 3IJYA 3LKOB 3BPLC 1EV2E 4HKBB 1YEKL 3RTQA 2V6HA 4F7CA 3RHWK 5BS0D 4RWYH 3MXWL 3MLZH 4NZRL 2A38A 1U95A 1T0PB 1E6JL 2P43B 2VN4A 2IMNA 4K3HA 2H8PB 2VC2L 3ZDZF 4F7EA 4OBSA 2M8XA 1VFBB 4LVOC 3V5HB 2DQHL 3B2UC 5IW6B 4AG4L 1CGVA 5IJVB 3OXRA 2BNQA 3W0WB 4OZIB 1X6NA 3RGVA 2YPLE 4OTXL 5I8EA 2I9LB 2XRAL 3RZCB 1MF2L 2H32A 2X4QA 3BD3A 3PWLA 3O4LB 3HA0A 2X1WL 5E6ID 5FYKH 6FABH 2R0ZL 2VDRH 2NXYB 4QHKI 1S9XB 3O9WA 4R4ND 5F89B 5E6YA 5HVFB 4U6VH 2R0KL 4FABH 3DXAA 3V0VA 3RPIB 3WNNA 3Q3GB 5IM7B 5L2JA 4WO4D 3T2NL 3U9UA 5EO9B 5KG9A 5EORL 1TENA 4ZOBA 3DX6B 1QA9A 3PP4H 1TVBA 4LGSB 2ZNWA 3EKCA 3IT8D 1ZEAH 4PP2A 2XTJB 1MFBL 3RY6C 1KEML 4IS6A 4LEOB 4LLUB 1TIUA 4I18C 5E7BA 4NQXA 1FSKB 3O6LL 4QHNB 3PHQB 4YBQD 1F8TL 3DVFA 4NO5B 2P7TB 3BGFC 1FCGA 3DO3A 4ZO8A 1SJXA 3V2AR 4LSSL 1CLZL 4ODUA 2GSIB 2YKLL 3LEVH 2C3VA 4OCYH 4PBVC 5I8KL 2YUXA 4O5LL 3ZDXE 5HHVH 3NPZB 2W0FA 5DJCA 2PYED 2WAHA 4UV4L 4JPVL 1NGYA 2HG5B 4Q9CA 5KVMC 2KZWA 5C1MB 5JA9A 4K2UH 3JWOH 4P4KA 3BGMB 1DE4B 2ARJB 1K2DB 1S9WA 2NY2B 2OI9C 4CMMA 3SHSA 4YK4C 2J8UF 4JRXE 2R2BA 1I1YB 5TE4L 2DQIL 5C6WH 4PV8B 2RR3A 1X4YA 3LH2L 3F7VB 3RWHB 4DQOH 1YPZB 1YN6B 1F45A 3TVMC 1WK0A 3H7BB 4MHHG 5D4QA 5HVHB 1RURH 3QNZA 3LV3B 2QV2A 4X99A 4RGOL 1TVDA 4JDZB 3QRGH 1BVKA 1VERA 1KPRA 1HQRA 3CX5K 4MB5A 3VXSA 5KSVA 3SY0B 1KCVH 5FK9B 1OT2A 2DQUL 4ZS6C 3N1PC 5ESVA 1HEZA 5CILL 2NY5C 3J7HA 1KELL 4LSQH 4X7SL 1B4JH 1H3GA 1J05B 3L9RB 1OW0C 4L9LC 4XBPA 4LU5H 3CSGA 5E08H 2AQ1A 4M6OH 1D7FA 1W72L 3K8MA 4X9GA 4E0RB 1Y6NR 4BSWB 4HIJA 5KVGH 2FJHB 2YPVL 4DUWA 4FQJL 2C1OA 1KN2H 4GRWE 1JHKH 4NJAL 1KYOK 2BVYA 2D4FA 3PE9A 2AK4E 3H42L 5F9OH 1HHHB 1CZ8H 4GRLD 2YPLB 3TBYA 4Y5YC 1TTUA 1S5IL 3KJ4B 2MQCA 1EX0A 1YY9D 4JFHD 1OTUC 1A1NA 1WBYA 4NUJA 2UV3A 1OAKH 1TQCC 3PV7A 3H9SD 2A2QT 1BVLB 3HAEA 5A40E 3KPLA 4Z77B 5IMLA 1OM3L 4XXCC 4ODHL 1WV7T 1OQXA 4BA8A 5IK3A 3DO7A 3RI5K 3W5NA 3MRJA 3DUUA 3E8UL 4LLMA 5EU6D 4K94H 4KJYB 2P5WA 3VXTB 2H9GA 2XACC 4C56E 2VDNL 4CVZA 3T8XB 5BQ7B 1R24B 1ZHKB 3O4OC 2BSTB 1F58L 5TDOA 5IHUL 1YEDB 2RFXB 3VW3L 1P69B 4PRBA 3NGBB 4OZGF 3QI9A 4RAUA 4P3WA 2IMMA 4OD1H 5F1NA 4BUGA 3RZCC 4HQQH 4JR9L 1SEQL 4WWKA 4WV1A 4JQVC 1QLRB 1CGTA 2NXYC 5ISZD 4JRXB 2CKBB 1IKFH 2HJFA 4I9WD 3S7GA 2EYRA 1BQLL 1JNJA 4HK0B 3IXAB 1HHGA 5ENWB 1S7RB 4LF3B 5KJRH 1J11A 3EOTL 3KPRA 1IAIL 3THMH 3I02A 5GGVY 2XTJC 1RUMH 3JVGC 4R96B 4K71B 2VLRD 1FSKC 2GJZB 3VGHA 4QHLB 1YQVH 3B6SB 3SE3C 3OQ3B 2YA0A 5C3LD 2B0SH 1X5GA 2GEEA 3UBXI 3SDCA 5J6HA 2FX9L 3I85A 3VMPA 3MV8B 2CIIB 2V9QA 4HKZA 5E24E 3WNLA 5IB1B 2JIXB 3ALWA 4OI7A 1AKJA 2ED8A 2GK2A 3W5MA 1WIUA 1NDGA 5ADPH 2DBLH 4NQUA 5IOPA 1HZHH 1XF1A 4HS8H 2X44D 2PN5A 2CPCA 3GI8L 3UC0H 3MREB 4NKDA 4Z7QF 3EDKA 4XHQA 4JFOA 1GOFA 3TO2A 3T4AA 5EOTB 3RBGA 1JN6A 3N85L 1A3LL 4P5MB 4JM4L 4L3ED 5IJKA 2FBJH 4OZ4A 2NY2C 4JFXA 3LZFL 3HE7B 4AMKH 4GRWB 4NO3A 3RA7H 1T1XA 5MEOA 2HTLD 2DTSA 2AK4B 2E9WA 4PJ5D 3M8OL 1ZWIA 4MXQD 4PJHA 4PJEA 4XNZB 4DGVL 5E99H 4FZ8H 3CFEA 1QACA 4BFIB 5HVHC 1A14H 2VXUH 5MP6H 1I8KB 2NXZD 2NX5D 5DFWH 1V7MH 4NZUH 5EZLB 1Q94B 4MJ5A 1AXSB 4DKDC 5IFAH 2DL9A 2YRPA 4AEEA 1BFOA 2AJVH 5FDWB 3K8KA 4KKLD 3BO8B 5C07D 3TNNB 4Y5XA 4LSRH 4LSVL 2UVEA 3PJSB 2X4TB 5TE7L 5C08D 1OVZA 5T33L 4QLRA 3VI4E 3HUJF 4FXKA 4PJ8D 5E2JA 1U8OB 2XNAA 2D0HA 3UZEA 4FQHA 4FP8L 4KJWD 4R9HA 4C56B 4Q2ZB 2I9TB 1XCTA 4HWEL 1VDGA 4I3SH 4KMTL 4O2FA 2GI7A 3NCYP 5CZVH 5D1QB 1BX2A 2VAAA 3BKCL 4PJIF 2IPUG 2X70A 4HAFA 2BZDA 3GIVB 1JZ7A 4N0FB 2ZNXA 1G1CA 3GO1H 4U1JA 4PJFE 4OLUL 4KDWA 1G7QA 1E4JA 1MJUH 5FFLA 2PO6B 3GJFA 3HNTL 4I0CC 4ETQA 2WLZA 2EO9A 5JW3L 1J8KA 2R1XB 4M43L 3EOAA 4EUPH 4WU7A 1WUNT 3ESVF 1T7WA 4M1DL 4X6BA 1L0QA 3LEYH 1K6QH 4HH9B 4OGZA 3KLAB 3KXFE 2K7PA 1I1AA 3SCMB 4QXUH 2AXGA 3IDNB 2C3HA 1JFQL 3LCYA 4JHWH 3RWJA 4CMHB 3MLRL 3LQZB 4D94A 3DETD 4L29B 1EO5A 4BZ2H 4MNQE 1FL5A 4P2OB 3LKSB 1S7WB 2A6KA 2O61B 1I9JL 4H5SA 5FCSH 2NY4B 2F8OA 4ZMAT 1REIA 4DKEH 5JXEC 4WW2F 2FD6H 2VDLH 2A83A 4FQ2L 2X1XR 5AAWA 1Z9SA 1F5WA 4NNPL 3W9DB 2NY3D 2R29L 1T7XA 4M02A 1WLHA 3HC0A 2OBGA 4MCZA 1F6LL 4X9IA 3RL2A 4UT6H 4QHKJ 4CVXA 4YPJA 5DMKA 3TBVA 1EO7A 3NGBC 3DMMA 4OF8A 5DLMH 4G8GA 4CW1B 4HZAA 4YHKH 3MGTB 4JFDE 4P2RA 4L3CB 3FB7A 5CEZE 3ARTA 2Y06L 1YNLH 4HK3J 3I50L 1MFAH 1C7TA 1LEGA 3I6KB 1G7HB 2MCPL 1SJEA 1NFDF 3OZ9H 3GMMA 1MCHA 1KBGL 3O6KL 1E27B 5ICYB 2AXFB 4IMKC 3CC5A 2YS4A 4HZLB 4DKFL 4Q97A 1JGDA 5ESAA 1Y6MR 5FHBH 3GHBH 4LRIA 3L3DB 1HQ4B 1SYSB 2IH1A 4ODTH 2ATKA 4LDLB 4G42B 1NL0H 4JKPL 5C0DB 4K71C 2A6IA 3GSQA 5DQDL 1YMMB 5EIIB 1ZAGA 2Z8VC 4HSQA 4HX1B 4NQSB 4F58H 5C0RL 1I8LA 3SE9H 1OF2A 4B50A 3F7PC 3BRFA 3NN8B 2Y25A 5E2VH 1A6VH 4WHYG 2G9HB 2UYLA 1U3HB 1LDPL 4HIEA 4Z7UA 2GQHA 4KZDL 1U6AH 5F93C 4KK6C 1FFPB 2OCFD 5SWZA 3C09B 3QJFA 4R90L 4EBQH 5C0FA 3VMOA 5SWQB 2R56H 3D3VA 1I7ZA 3HE7C 2HN7B 5I18H 4Q0XH 2XZQH 4BKLB 4PJGF 4EI6A 3DRQA 4GUPB 4PJFB 2AABL 1LEKA 25C8L 3ROOB 4KK8D 1UWGH 2ADJB 2YEZB 4ZAKA 5IHZB 3GIZL 2GYSA 2P5EB 2AERT 4G6KH 4LCWA 2OZ4A 3VXOA 1J12A 1GGIH 3V6BR 3I6LE 4LLDB 1J0KA 3BEWA 1JUFB 4YFLI 3RU8L 1GSMA 3RDTA 3GMPA 2BK8A 4L4TE 4MD4A 5FGCE 5F97E 2JE8A 3VRJB 3KXFB 4GG6E 1F02I 1Z0NA 3GUTA 4ZNCD 2FCBA 4G80A 3BAEH 1NCCL 5IESH 4MNQB 2ZSVA 4NO0D 3LRSA 3OKKB 4QO1A 5E1HB 1BFSA 4MXWL 1PG7H 5BRZE 4QRPD 1I3RB 2F53A 5TQ2L 3RY6A 3H2WA 1T4KB 3BIKA 4Z78B 3QDMD 1KIPA 3HI1A 4PPTA 3D9AH 4I18A 2ZUQB 1FGVL 3QEQA 3VXME 2KKQA 2EDOA 2P8LA 4NP4H 4U1IB 3AREB 1NMAH 3FQRA 3OG4B 5D1QC 4HUWB 5IQ7L 3WUZA 5C0GB 3U6RA 2B1AH 4XZUB 4EDXA 5F7DB 4XAWL 5DQJA 4XMPL 1F4YL 2YSSA 5EWIH 2R23B 4KPHH 3PWNA 2XZAL 4EVNB 1V8HA 3QUZD 4CL7A 3H7LA 2PO6C 4OFYD 4X4XA 3PGDA 4JY6A 5I1KL 3FB6B 4JFDB 4H26A 4PR5B 5IBTH 4QHMB 5FOBA 5GGSB 3H0TA 4C57C 3G6JE 3SDDB 4CADB 4PTUA 3MRLA 1EXUA 3FTGB 3AAZB 5H37G 3SCMC 1FNGB 4ZXBB 3FOMB 4U6YB 4JN2A 1ZHNB 2DIAA 5HHPB 4LDOB 1OB1A 2R69H 4CMHC 3RPKA 2R15A 1B0WA 4FQIH 4P2OC 1A5FH 1GAFH 1SHMA 2F54A 4JFZH 3TVMA 3SDYL 2ESVE 3RRQA 2IFFL 3C6LA 1WBXA 2NY4C 3QEHB 3B4NA 5IBLD 3MOAH 2X4SB 4HUNB 1NAMA 4UV7L 1CGSL 1GGYA 3QIWD 1JF1A 3RKPA 5MHSE 4ZFGL 5F1OB 3GMRB 4JZOA 5HD8D 2IADA 3WIFA 5BZDA 2DQFB 3MTRA 2MWCA 2FH8A 3IDGB 1E4XH 5DO2C 3UDWA 4G6JH 4IHOA 3IGAB 1ZVYA 4I77L 3F5WB 1OW0A 4L9LA 5J13B 3X13A 5DS8B 1BBDL 2V7HB 2W9EH 1KFAH 2Q86B 2HJKA 3ARYA 5HHME