5CJ8A

Human osteoclast associated receptor (oscar) extracellular domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
185
structure length
179
Chain Sequence
PKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of collagen recognition by human osteoclast-associated receptor and design of osteoclastogenesis inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Osteoclast-associated immunoglobulin-like receptor
total genus 35
structure length 179
sequence length 185
ec nomenclature
pdb deposition date 2015-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cj8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cj8A02
4HD9A 3VXQB 2EDQA 4WTZG 1GC1C 2D2OA 2YC1A 4WU5B 3S4SA 3BSZL 5CZXC 2NY5L 2H45A 4U1IA 1NCAL 1NBYB 2JIXA 4ZS7L 2CLRB 3TZVC 1AI1L 5D9SB 2CKNA 2V5MA 2FATH 1KT2A 4WI3A 4K94L 5I1HH 1EMTH 3RTQC 2EKSB 4GAJH 3MBEB 1X5KA 3LDBC 4WI2A 4OBRA 3ROOA 4ZS6C 3BT2L 1N4XL 1QFWM 4N0YL 5DJ2A 1UM5L 5C0IB 4PJEE 5FAAA 1P9MC 1TCRA 4M6ML 4J3XA 4YPGA 5KOMC 4M6NH 2AJUL 4G6AC 1MHHB 1V5JA 3LH2L 5JHDB 5I1IL 1U93A 3K8KA 4S10A 1NDMA 4Z7WA 4GRWE 4UT9H 1CVRA 4KKNA 1MFCL 4WO4A 4KJPC 2K9UA 2NPLX 3BIKA 4HUUA 1VGEH 1MJUH 2M26A 3IDNB 3DOSA 3SJVD 5CEZE 3FO2A 3MXVH 1ZVSB 1ZLWK 4M4RA 2ZZUT 4IOFD 4RBPK 5F9JB 5A2JH 3CC5B 4HIEB 3SEPA 4I2XB 3L9RB 5DGQA 3RZCA 2FJHB 5GGSY 5J1AA 2VZSA 1EJOL 1MCLA 1RY7B 2W0PA 4P2CG 4ZPTB 3DHJA 4ZUVB 4ODVL 3OKKB 5EC2A 1IC7H 2VR4A 4P9HC 3VXNB 4JJ5A 1IKFH 3AROA 1H8SA 4DZBB 5J8OA 2VABB 4QRPB 4Z7NE 2FSEA 3FMGL 4JO4L 3VG0L 4OQ1A 1G7JB 2NLJA 4LCYB 3QO0B 2JE8A 4PJBF 3H42H 2ZOKA 1IGYB 3LS4L 1SEQL 5DT1H 4EDXB 1E4KC 3QO1B 1UH3A 4C57C 3SPVB 5F97E 3KPNB 1NEUA 3W5MA 1YQ2A 4OCMC 2VLME 3KYKL 1NDGB 3S3SA 1ORSB 4FQXD 3AXLA 3RGVA 5H37G 4X4YA 1L4IA 1OTUC 3RNKA 1PX4A 3W39B 5BRZE 4D8PA 3FO9B 1G1CA 2DQJH 1FZMB 4CVWA 1M7XA 5KVFL 5CCKH 2ZG3A 5E8DL 1JUFA 1VGEL 2PO6A 1ACYH 3FAWA 3LKNB 5I1EH 4QO1A 1OF2A 1YMME 3K0WA 4FQQB 4JRXE 1B3JA 4XB8A 3D39E 2JLLA 4MXQD 3C5ZC 4AT6A 3GKZA 1U3JA 1OY3B 2F58L 2YD3A 1FO0A 4YE4H 3SO5A 4BFIB 4I9WD 1MHHA 1CXHA 4NCDA 1ZT7B 3HNVH 4OF3A 1F4XH 3FFCA 5F93C 1RJZA 3PABB 3QQ9D 3F7VA 4AMKL 2EDTA 4YHPB 5JNYA 3C5ZB 5T33L 1DEDA 4IRJB 5GIRA 2VWEC 1RZFL 3A67H 2AQ3A 1J9CT 1S8DB 4GKZA 2M2DA 1T22B 3BPCA 5DSCB 1OD9A 1XGQA 1SBBA 4PJEF 5EUOA 5DMKB 4NN7C 4BZYA 1T1WA 5D7KD 3HHRB 3KPPA 5JMRA 3RQ3A 1BBDL 5E9DA 5I1AB 5DA0B 4Z8FL 5SWSB 4MNQD 4ZTOH 4OM0H 4JFYA 4JM2C 3NGBB 4WDIA 2G60L 1U8HB 2ZOLB 3U0PB 1KXTB 1N2RA 3RU8L 3SDAA 2YMXL 2YRZA 5C07D 1DDHA 5LCVL 4BH8A 2G75B 4M7LT 1D9KA 3P4OB 1DBMH 2FEEL 3BEWB 4GQ9L 1WZLA 1NGYA 2XZCL 3B6SA 1RQ5A 3TBWB 1QQDB 3WIFA 2WNGA 4YHNB 2W9EL 2IBZY 3CH8A 5F88B 3ARTA 3BZFB 3EW3B 1U8QB 2C9AA 3CIQA 3G6AB 1KN2H 4LBEB 3QEQE 3MMEB 1FORL 1HHJA 1ZLSL 3MNVB 1I1YA 3BYTA 3SGEI 1RK1B 1XR8A 3CU1A 5L9DL 3H9SD 4POUB 4K9EC 4W6XB 4PRHE 1FPTL 1JNJA 4S1QL 3TA3D 5IVZA 3QDAA 4XB7A 4PJEB 1C16A 3O81A 4P49A 4LCUB 4PRNA 5DK0B 2E7CA 5J6HA 4Q2ZB 4FFYL 1T4KB 3L95B 3GM0A 4GRMA 3T2OA 2DQUL 4ZO6A 1U8MB 4HKZB 3E2HB 1Z9LA 3EJZC 2VZ3A 4J6RH 1U2CA 4Y1AD 3O6FC 2ERJB 1QFOA 2XY2A 3CFJB 5D5ME 2DAVA 4PJ7E 3N1QC 3O2WL 4FFVD 4MA8H 2CK0H 2GFBB 1PD6A 5FYKD 3F7RA 3KPNA 4OCWL 1XGTB 1VFOA 1T5WB 3TBYA 3ZMRA 1O5DT 1ORSA 4YHKH 4KK9D 4NZUH 5DRXB 3LKQB 1JV5A 5HVHC 4UB0L 5FGCE 2G5BB 4YDVB 3E2HC 3S37X 1LO5A 2DQDL 2XICA 1A5FH 3G08B 3ZYZA 3CSPA 4OSUH 3T8XA 3BN3B 1JPFA 5T1LB 4RFNC 4JPWL 5CEZL 1Y6KR 1KUMA 1TTUA 1YEEH 2SEBA 3SDYL 1A1OA 5HYFA 1LE9B 1INQA 4UNTA 2ZCHH 1FO0B 3LQAH 1CN4A 4X99B 3LHPH 4CADB 3JUZA 3V7MA 3FT3A 2EDBA 3H9HA 4P5TC 1UM4H 2QSTA 4DN3L 4XNYH 5CSGA 3WS6C 1MNUL 4HFWB 1SJVA 1TQBB 3T09A 2FD6L 4KWUA 5JW4R 3WXWH 4YGVA 2EDOA 3ARUA 4KDTA 4MWFA 5HXMA 4MJIA 3UTTD 4YHYB 4GW1B 4YNYB 3IJHA 1P1ZA 4N5ED 3M17B 3ROLB 1W0YT 2CK0L 5C86A 3JUYA 2VNCA 3O3AA 3EOTH 1HQRA 5GJTL 1WIPA 2A1WL 2HKFL 4WHTB 2FL5A 3BPOC 4Z7WB 4KPHH 1A4JA 4HDIA 3E8UH 1EAPB 4U3HA 4E9LA 3P0VH 1TNMA 4L3EE 1HQ4A 2X40A 5KVMC 1U8KB 2VL5B 1YNKL 4LPVA 1JVKA 4KZEH 4UT7H 3FQWA 5FUCC 2CIKA 1P7QA 2XKNB 2WP3O 4PJ8A 3GMRB 3F58L 2D0HA 4DJMA 3OXSB 2V5RA 2I5YH 1A1MA 2AJYH 2A83B 4RAHA 5ANMB 3BMVA 1PDKA 1SVCP 5F96L 5TF1H 1WF5A 5EU4B 1Z6JT 5CHNA 1J10A 2NW2A 1CR9H 2GCYA 5AZ2L 4X7TA 3RNQA 4G43B 3BRGC 1CFBA 4FTVB 4O9HH 4I8DA 5I8CA 1GYAA 4FZEL 2XRAH 2VC2L 3BH9A 3MV9E 5BOPA 2CQVA 4JZNA 3QRFM 1C5DB 5M95B 1YA5A 2EDEA 4EDWH 4TTGA 1MLCA 4Y4HC 3T0EE 4WFFD 5JPNA 1LHZA 4HIXL 1RZIB 3AGVA 2DQHH 3NTCH 1AGEA 3CC5A 3SDAC 4JO1H 4FNLH 3H3PH 2E3VA 3IFNL 2FJFB 2OSLA 1AGCB 4J3WA 4Y19A 2X41A 5JOPD 4JM2D 4K3DH 2Q76B 2YOCA 3MGOB 2NMSA 5TFSH 1KF9B 3VH8G 1ZVYA 1B0GA 1TNNA 4S1QH 4Z7WF 1TJHH 3OJDB 3D18A 1NDMB 3RKPA 4P99A 1MFAL 1N7MH 3CLFH 5I1JH 4KHTL 3TF7C 5JXEC 4R4BA 1GIGL 1WT5A 4JG0H 1HKLH 2YPLE 1JWSB 2R4SL 1EFXA 2H32A 4NHCH 2FECI 3OKDA 2WBWB 3TVMA 4NM8H 4F7MA 1F6AA 4NN6C 3L7FB 3AREA 4PJDE 3C2AL 4X6DA 2UVFA 2ZPKH 1UB5B 1UACL 4X83A 4ZG1A 3MRCB 3K80A 2BMKB 2JIXB 1SY6L 4QNPF 5HVWA 2OP4L 1QFUH 4OD1L 3BN9D 2XFXA 2QQNL 2PO6D 5A2IH 3QHZH 5IF0B 1I9EA 5E2UH 1B6DA 5IUSA 1IFHL 3HMWL 5HVGB 3U36A 5JW3H 3ARBB 2UUDK 3P11H 4LLVA 5CMAB 3VXPB 1CF8L 2IBBA 5IBUG 3V6OA 1N6QH 4L8SA 2R23A 4U0RC 4A6YA 3GSNB 5DS8B 2X4QA 3SGJC 1QHOA 4YDIH 5D5MA 5C2BL 2DLEA 3A6OA 1NJ9A 3QWQB 2PW1B 4CU6A 1VESA 3QDGA 4LRNH 4K3JL 3U0WL 1VPOH 4L4TB 2E27L 1GVIA 1JJUA 4L3EB 4UILH 5D1QC 1BGXL 3NCMA 2ATPA 1AD0B 3ZE1F 4PLJC 1QBML 4Y4KC 5C0NC 4XBGA 4I5BA 3CUPB 2OR9L 2YK1L 4UAOC 1MAMH 3IJYB 3IF1A 5L8LB 5LWYL 2DOCA 3ZE0E 1OTSC 2D7MA 2VQUA 3TJEL 2FHBA 2CLVB 2DQIH 2Z31A 2WW8A 3W11D 4WFEE 4KDVA 5JOFA 4YO0B 1R5IB 4QEGA 2GHWB 1QBLH 3PJSA 5TH2A 4M1GL 3U0TA 3O6ML 3HAEG 5JDSB 5LQBH 5T1KD 4LEOA 5J1SC 2H32H 3QEUB 5I76B 5JA8B 2EO1A 4PTTA 5EPMB 2BNRB 3I3BA 1VEMA 2VKWA 3EDFA 1YC8A 2ITDB 1PFCA 3EBAA 4MJ5B 5GGTL 2I25N 4WTZA 4X8JA 5EZIH 3V5KA 1DEEB 5I1DA 1JMZA 2FO4B 3KG5A 3L3OA 4RGNE 2JB5L 3G5ZA 1G7LB 5DQ9A 5JIHA 3U46B 2Q76A 1UCBH 1ZTXH 2P43B 5FK9B 1RK0B 4NJAL 4PUBH 4JM2F 1MAKA 1ZGLM 1UM5H 3W2DH 3WN5B 5F7MC 2WWMC 1CR9L 2Y1VA 5AZ2H 1BQLH 5E08H 1FRGL 4UT6L 2AI0H 5IROC 2QR0A 5E03A 4GUPB 2NY4C 4MAYD 1RURH 2YSSB 4FG6D 2NX5D 5EA0L 3MRMA 1UA6H 4JPVH 2HJKA 4Z5RB 3W0WD 3TC9A 1MLBA 1K4CA 4G6KH 2XFXB 5HHME 1KCRH 4G8EB 1UM6H 1JPTL 3NIFE 4WJ5A 2WBJA 1G6RL 1C08B 2WWKT 2Y23A 5SWZB 4LGSB 4LSVH 3FN0H 4DW2H 3UAJD 2V2XA 5GJTH 1T1ZB 2HFTA 2ZCLL 4WY7H 4HK0B 3OKEA 4G9DB 2RAMA 4G8GD 3DO7B 1C12A 3WNMA 1CGYA 3G6JA 3QIUD 3V4PL 3ZKMD 2PYEB 2YEZA 3VXPA 3GSXA 3ARGA 3NAAL 5C0BD 4XC1H 3NMEA 5DUPL 2GJ6D 1SHMA 3NCFB 3WIHL 2B5IC 1ZT4B 3D18B 2VXQH 2EIZA 4BSVA 2L7JA 2R15A 2B1HL 1J05A 2A0LD 2X5PA 3U30C 1U42A 5JW5B 3BX7C 4J1UA 5HHOB 3SDCD 1IM9D 5IW1A 4HLZH 5GS2D 3TT1H 4KRNA 5KAQG 5DF0A 4AG4L 1JYXA 3ALPA 4L4VB 3L7FA 4NQUA 1RUML 4K3GA 4ZD3L 2VZUA 2YN3A 3W0WA 4G6JH 4OQTA 1W0WA 1YJDC 2W91A 2JCCE 1KPVA 2D7TL 1C5CH 5KG9A 4HIIA 4NZUL 4NP4L 4X5XA 2Z8RA 4OIBA 1CL7I 3QI9C 4U49A 2GSIA 2XYCA 2MFNA 1JPGA 4GXUN 1G7IB 1MHEA 3MJ6A 3S96B 1OAZL 3ET9F 3RVVC 4HJGA 1BMGA 1IAIH 1G6VK 3Q3GB 4X6CF 1FGNL 2CRYA 3BN9C 2DQGH 4Y2DD 4WFHE 1Z3GH 3OJVC 3LZFL 2Y07L 3C5JB 3JV4A 1L6XA 1CTNA 1WFUA 4M6NL 3QH3B 5EOCH 1B0RB 2CKBH 3JWOL 1KJVA 3PGFH 5K9OA 4PGCB 2MSPA 2NYYD 5E8DH 3BQUD 3GKWL 4DZ8B 1GPOH 5F1IB 1CICB 2EYSA 3IJHB 3DMMD 1TCMA 4AY0A 1JPFB 3QPXL 4WEMB 4MSWB 5SWZA 1YEIH 3KPSD 5FB8A 4U1SA 3INUL 5EIQA 2XV6B 3DNKA 3JTTB 4ODXB 1CLOH 3GSVB 1R5VA 5JPMA 4TVPH 1CFQA 2WSKA 3FN3A 4QGYA 3VGFA 2WP3T 4L8DA 2X70B 3LKQA 1P7QB 2XKNA 1NKOA 3HNVL 3VFGL 1MJ8L 5J3HD 1QVOB 1IKFL 1PKQA 4ACPA 4GG6B 1BD2A 4JKLA 5CAYB 4U2ZA 3QDJA 3WKMH 1QBBA 1ZVHA 3H9YA 1G6RA 1EEQA 4KTYA 2Y07H 1AD9B 2X4RB 5F7EL 3HZMA 2FO4A 4HMEA 1JV5B 3EZJB 4WWKA 5TGBB 3MOQA 1BM3L 1KTKE 3L3GB 4RGOL 4XMLH 3TIDB 1R3KB 1PYWB 3FB5B 4C58B 3CFEB 5FUZL 3VD7A 1KXVC 5MEPB 2GFBA 5FM5O 5EO1B 4LU5H 3HUJF 1A3LL 2LTQB 4X6EA 4QWWC 1T1XB 5CWSA 1D5MB 3TV3H 3FO0H 3DX8B 4KRLB 4LHUG 5D93B 1E27B 1NUNB 1WBXB 2MTPA 5IQ9A 5KSVB 3H9SA 4JO2L 1NCWL 4U7MA 4DVBA 5GS0D 3D9AL 4MAUL 4MD4A 2VZVA 4Y89A 3D69A 3OGCB 1XT5A 3DUSA 1I1FB 1LNUB 2WIMA 4HK3N 1BD2D 2EZ0D 2NY1D 3HE7D 4XPHH 1EX0A 4NQSB 3BAEH 2W07A 5J9PB 5DFVD 5C0DA 1YMHB 4LCWB 5HGAA 1TPXB 4XMKH 1TVBA 4H0IA 4JQVA 4RX4D 4GOSA 3K8LA 5FYJU 2P8LB 1MQ8A 2Z93B 4AIXA 5DD5L 2MQCA 2VERN 4GRWB 4X7SH 4R4FH 2VUYA 4QOKB 3QUXD 1A6TB 4TNVF 1K5NA 1X7QA 2RCSL 1G7IA 1MHEB 4MA3B 2G75A 3P9LA 1RU9L 4XNQB 1T03H 2WZPD 1HNFA 4U1MB 1MJUL 5EU6B 1DVFA 3RWGB 3TO4A 1DQLL 2MOVA 1H3PH 4PJHA 1NLDL 2ORBL 5FEBA 4P2QE 3UZQA 3SBWA 2Y6SD 2Z9TA 4HW6A 3ZHLA 3ZTJG 4J6RL 4MD0B 2VDLH 1T1WB 5BZWB 4P5MB 2P24A 4NC1E 3R0NA 3B2UD 4M9PA 5DJCB 1BOYA 4Y2DA 5E4IA 4NZTH 1ZHLB 4JAMA 1OTTD 4IRJA 5L2KA 3BRDA 3VFVA 1YPZB 1MFBL 1N8ZA 3LB6C 4JR9L 3SKJH 3D25A 3QCUL 2X9YA 1I7UA 5IHUL 1B4RA 3CAFA 3N50A 3O3UN 1L7TH 1MCDA 4GLRI 1EFXB 2XN9E 4NKOB 1RUQH 4EZMA 1JGLH 5H2BB 2N4IA 3MFFB 5IHZB 5F88A 2QSCH 1JZ4A 3TT3H 5CJQL 3VD5A 4UBDD 1KENL 2GI7A 2CD0A 4GRWH 1HXMA 5T3XH 2IH1B 3BGFC 5D2NC 3ZSTA 1M7DA 5HDQH 2NXYC 4O4YH 2IANE 5AZEL 4BH8B 2W1NA 2VE6A 4PGEB 4GG8B 1R5WB 3RBSA 4JN2B 3RWEB 4ODBD 1EHLL 4EKXA 2A9ML 1H8OA 1HHGB 3S35L 4NQVA 3BD3A 2J4WL 3O3DA 4WGWB 1F58H 4H5SB 4I5BB 3EO1B 3MUGB 2DN7A 4D9RD 1PG7X 1DBAH 1J0JA 3KVQA 3U6RB 3SQOH 1PX3A 4MJ6A 4XH2B 4WUUE 5ENWB 4BJLA 2DJUA 2DYPD 1G7PB 3PGDA 3EKCA 4NWTH 4OLVL 1K4DA 2C3GA 5CP7A 1WBZB 5SWZE 3SOBL 3U2SB 4KRPD 4Y4FC 4DCQB 3MUY1 1ZEAH 1JE6A 4XRCA 5DTFA 3TYGH 1S7WB 2WUCH 2VH5H 3NACH 3VG9C 1KCSL 5EC2B 1NDGA 3DETD 2PYED 2C5DC 4JG1H 3F8UB 2V7HA 3MBEA 1DEEA 1EERB 2ADJA 5I1KL 1UCTA 4L5FH 2ZUTA 1RIHH 4IRSA 4RZCB 1NMCC 3J7HA 1QLFB 5J6GB 2MCPL 3WNOA 3U7YL 1MHPH 3JWDC 1KG0B 3GBLA 3QXTA 5IT2H 5JDSA 4ZTPH 2PN5A 3GMOA 4QRRD 4R8WL 4TRPH 3QIBB 3ES6B 1AQDA 1MWAL 4PB9H 4QY8B 2BY2A 5L6YH 5J12C 3IDGA 1DSFL 5KTEL 5GZOD 5C0CA 4HWZA 3BPNC 3BP7B 2LU3A 3BIKB 3LSOA 4HUUB 3ULVD 4X6BB 3IU4L 5EBGA 4D8PB 5BOZG 1MCPL 4QHMB 1GXEA 2OJEA 2Y5TA 3UC0L 5I1EL 4JRYA 3FRUB 1FVDB 5HHXL 4ISVB 4PRDA 3JWDH 1RIVH 1F4WH 2E5EA 4OCXL 1RSFA 1T2XA 4X7DC 4YBLB 5E4EB 1U8JB 4X98A 3GBML 3SE3C 3UTTB 3U4BL 4H88H 3I85A 1OPGL 2V2TB 3FQXA 2QEJA 3QIBC 4EDXA 1JGDA 2G2RA 2BNQE 5EO0B 4I18A 1XCQA 3KS0H 4RQQA 4F9PC 2F8XC 1FVCB 1YDPA 3VJ6A 4OZGB 5M94B 4WTWA 2FWOA 2YWZA 4HUKB 5ADPH 5DT1L 1QLEH 1NLDH 3PDDA 5JW4M 1MLBB 2IANB 1RMFH 2D7NA 4HULB 1NFDE 3R1GL 2CLZB 4F15B 4LPUA 4X6BA 3AY4C 1JL8A 3MRGB 4L4VA 4RWHA 2HTLC 4LFHD 2CDGB 4M1CC 4NQVB 3PWJB 1KCUH 1MEXH 2L4OA 4FMFA 1MJJB 1NGXB 1CICD 1HHIA 3LRSB 3O9WC 4CVZB 4Y1AB 4HUVB 4F2MB 3STLA 2CDFA 2AK4A 4TNVK 3PL6A 5FO7A 4UZGA 1IEBB 1T7WA 2XIDA 2YD7A 1OCWH 4PJHE 4HF5L 4OF0A 3GSOB 1F4XL 4MJ2A 4JQIL 4QXWA 3I75A 2HMID 4WHDA 3MLTA 5HJ3B 1EO7A 2LTQC 1JK8B 4GKSA 3G5XA 2P5EA 1BQLL 2IFFL 2FGWL 1KV3A 2HVJB 3UYRH 1A5FL 5JO5B 5C0FA 2DQCL 3NAAH 4GRLC 4N90D 3ZYIA 4QY8A 5C09D 3OAUL 5L2KE 5DMIH 3D3VB 1F3JB 5DRNA 1GOGA 2HYMA 2XA3A 2W9LA 2AJXH 3LB6D 5B21A 3NVQA 3L3KA 1VERA 1FNFA 1PLGL 2JELH 3MOBL 1ND0A 3MACH 2DM7A 4Z7UB 1FVDA 5C0CD 4NNPH 4UNVA 1MF2H 2OJEB 2Y5TB 2UV3A 1I3GL 3GHBH 4QRPE 1HYSC 1QSFD 2R8SH 3IDXH 1XF5B 5T1DH 3EDDA 2K3TA 4DN3H 3BO8B 4WHYG 2GUOB 4XP6L 3QPQC 1TMCB 2DDQH 3P9WB 1P7KA 5DTFB 5ITFA 4BH7B 1EJ6A 4GBXB 1UXSA 5J56B 4KRPB 5TE4L 2Z93A 2VYRE 3MLYH 1T0NB 2QKIB 4E41D 2VXTL 5LGJA 5D4QA 2ILLA 1R3IH 4NYLB 5IK3B 2QQLH 4P4KB 1KEMH 4IDJH 3TH2T 5A43C 4F7PB 3BIAX 4KJQC 3DBXB 4RDQG 4ISVA 4L1HA 1AO7A 3ULUD 4GBXC 3O4LE 5HHVL 4E42B 1WWBX 1KOAA 2QHLA 3QNXB 5ANME 3MTRA 1OAUL 4KRPC 1H5BB 4IEFB 1KJ3H 1NUFA 5TH2B 3GI8L 3LSOB 4HWZB 3MRNA 5EN2B 4DK3A 3GKWH 3IFOB 4P5MA 1YEGH 2AJVL 1CCZA 1RD6A 5FF6B 3VGGA 2J88H 3MV01 2CDEA 3S5LA 4XCEB 2NCMA 1MFCH 2AEIT 3VWJC 3FB7B 1CFTA 3B5HA 3DXAA 4KY1H 1IGML 5KS9B 5HGHB 4LSSL 1AR2A 4LAQH 5MERA 4B53A 2VITA 4O51B 1KLGB 6FABL 3LKNA 4MVBC 3MUHL 5DJZB 3UTQB 1ED3B 1S7RA 1NJ9B 2DIAA 4G3YH 4JFFD 5IBTH 9CGTA 3ULVE 2V2WB 1NBVL 3CFKA 3WFCH 2D9QB 4M48H 1FL3B 3FOLA 4FQXB 5DUPH 4OGXH 2IQAA 1U0QA 5C6PB 5DJYB 3VXUD 5EU5A 2XA8L 4ZQKA 1TIUA 1I4FA 3N85L 2QTEA 3MV9A 3UMTA 4XNXL 1BECA 2AEWA 1ZS8A 4WI6A 4KKAD 2QQKL 1L0YA 1ZEAL 1FFPB 1ITCA 3EO1A 3X3FL 1UXWA 2DQTH 4RA0C 1IGFL 3OZ9L 4PG2A 1HCFX 1T0PB 4EIZC 4M7LH 4PJCE 2JIXD 3VXNA 1FSKC 4UOW0 2D31B 1KJMB 3C6LD 3L5JA 3KYOA 1OARL 2XOTA 3N06B 2VSDA 2C7UA 2HTKD 4ZUTA 2Q3AA 4TVPE 4S0TD 2VIRB 3NCJL 3BHBA 4NKDB 1BIHA 4I2XA 3O45A 5DC4B 1YMHA 2EE6A 4J3SA 5IHUH 5LAXA 5AG9A 3NZ8B 1S7QB 5K59E 3GHEL 3AB0B 1QBAA 2GSGA 4K2UL 5F1OB 4LSVL 1KTDB 4POZD 2CSPA 3QXWA 3WD5L 3VFWA 2J12B 2CGRL 4PJDA 3REWA 5KVGH 1LNUA 3QRGH 4DTGL 5IKCB 4RWYL 5A1AA 3LY6A 1QLRB 3IS0X 2Q87A 1G9MH 3JV6A 2F19H 4FQCH 5T5NF 2IAND 4HIIB 4FQJL 5IMOB 2HFEB 4XPGL 2Q86B 4EOWH 4YZFF 1NBQA 4K3HA 4S1SL 4XTRC 4YBLC 3CGTA 4H88L 1VACA 3KJ6H 2YZ8A 5I71B 3LEVH 3PWPE 1BP3B 3BD4A 1VFUA 3RWDB 1S7SA 1JGVL 4KVCH 4G43A 1EA9C 2X89A 3LEXB 4U6HB 4HWEH 3BSZH 3U1SL 5ADPL 4TVPL 3GUTA 1KPUB 4AEFA 5GS1C 1IQDA 5TQ2L 1N5AA 3CH1B 4KQ3L 1F45A 4IOSD 5JLZB 3PDGA 1NH6A 5KN5B 2NZ9D 4WO4D 5DJAA 3R06B 5HHPB 4UMGA 5B22A 3ESVF 4RCAA 1JWUB 1J8HE 3WV0A 4ONFH 2P47B 1A6ZB 3BKYL 3LRHA 3MRIB 4ODTH 2HFFB 5JQ6L 5JA9A 2CIIB 1QACA 3O3BB 4EUPH 2V5YA 3O2DA 2AEPL 3QJFB 4PRIB 4YFEA 2VDML 1EXUA 2B20A 5AAWA 4R26H 5E2VH 5F3BB 1V05A 1CFQB 4WHTA 1NEZA 1N3NB 4NO0D 4XCNA 3TA3B 2F5BL 5IFHL 1A6AB 4RMTA 1UZ6E 3VXRD 2A73B 5FB8B 2CO6B 4RMRA 3BKJH 1BREA 2UWEE 3O4LD 5AYUL 4JFPB 3IGAB 3BT2H 4C56A 5EDXA 1F4YL 3HC0A 4GO6B 1E27A 5KSVA 1OGTA 5HDQL 3OKLA 3GIZL 3RL1A 2DQTL 3O4LB 3QULB 3QFJA 4I0PC 5FO9A 5ICZA 1I8KB 4D0BA 1IAKB 3FOMA 3KR3L 4RGMC 4OGYH 5IMOA 3RL2A 4LLMA 5D1QA 5EBWB 3FCTB 2FLBT 1QFUL 2J8UE 3TIDA 1MCBA 4PJGA 2DMBA 4JZJC 4JHWL 3DUHA 3G6JE 3CXHJ 3VGEA 4AMKH 3ES6A 2UY6A 2E8ZA 3EJJX 5IVNA 5D1XB 5INCB 3HC3L 3HE6D 4XCFL 3VFOA 2VAJA 3BVNB 1ZLVH 1FLRL 1R3JA 1S5IL 2AGJH 4I13B 4LMQI 4U0QB 4XNZB 1CE6A 2Y06L 5LAXB 1KJVB 5GRJL 5K9OB 4QCIB 4PJXE 3Q6FA 4UOW1 5CJOL 5HYEA 4JG0L 3I6GA 5C08A 3T2NH 4TUOB 3KNBA 3OB0K 2RQ8A 1XF2A 1DJSA 3ZT5A 4U1GB 5DVKA 3R8BB 4RIRB 5FCUH 1S7QA 1CU4L 2A9MH 4HKXA 1U8LB 1QFWL 5T3XE 2E7LA 4NO3A 1R5IA 2VKXA 3SDXF 5IVXE 2JCCA 3D3VE 3QEHA 3I6LE 3BP6A 3M8OL 5HPMB 4D94A 2BVOB 3MC0A 3UYPA 4HG4J 3WO3B 4EUPA 4Q9RH 3WUWA 4KQ4H 4U1GC 3K81A 1KN4H 5HYJE 4Z7VE 3UJTL 2FIRT 3HNSH 4KI5E 2Q6WB 1DVFD 2PW2A 3LPFA 4X8XA 2HN7B 4DUVA 3HC4L 4OLZL 3FO2B 4ZAKB 3X11B 1MH5A 5GGRB 4U3CA 4F33A 3BZDA 4FA8A 3C8DA 4JZJA 4PRAA 3H8NA 1GGIH 5FYJD 5CILH 2NXZC 1I7ZB 3GJFK 4XP4H 1K3ZA 5JHDA 4DQOL 2CK2A 3JBG7 3F62A 4I2XE 3OKMB 3BGMA 4KH2A 4EI5D 2VLLB 2DYPA 3QCTL 4EQ3A 2OX5A 3VWKA 3N1MC 1MFEL 5IB3B 4OLXL 1KPRA 4JFOA 5DJ2B 1JF1B 2CDEB 3OKEB 4MS8D 1MF2L 1N8ZB 4OF8A 2X4UB 2R2EB 5D7IA 3U7WL 5F9OL 4HS3B 4HFUH 4JPIB 2VLKA 1I9JH 1BX2B 5JORA 2E7LC 1CTOA 1F00I 4UT9L 3WN5A 1KIRA 1QRNE 3IJYA 5L0QC 2XT1B 4XNYL 4KDWA 3WJJC 5E99L 3ZKSD 4DAGL 2AJSL 2JCCB 5BW7A 4PJFF 4UB0H 5DUBB 4APQA 3MRNB 4J12A 2FYYB 5AD0A 3S7GA 1ZSDA 2B0SH 3IAGC 1V3LA 2IPUK 4JHBA 5DI8B 4KHXH 1XGYL 1CFNB 4GAJL 5D6DC 1QG3A 3HNTH 3V6BR 4PRID 1HZHL 4OI9A 3FN0L 3B8SA 3VXUA 3I6GB 2R56L 3KXFE 4KKCD 3UPCA 4FQIH 4JKPL 2HLAA 2BSSB 2GAZB 3WIIL 4IMLB 3S97C 4AL8L 2MMXA 1FC2D 4JFFA 1I1AD 4GW5A 4NQEE 4RMQA 4NPYB 1F11B 1RFDL 1U6AL 2PYEE 2X1WL 8FABB 1G1YA 3MR9B 1FGVL 2XXCB 1CFVL 4M5ZH 4KMTL 1FJ1A 4UUJB 3SKOB 5E6ZA 2BOBB 1CLYL 1NGWA 2X4NA 3H0TA 4L29B 3RUGF 3UJJH 2PTTB 5HGBA 2X09A 2F19L 3TN0D 4PV8B 1FZMA 4DFHA 4Z7QE 2AERT 2HFGH 4PJFB 3C6LB 3QPXH 5C3TA 4I77L 1H3TA 5JXED 2FGWH 3QFJE 4LCCA 5CJXC 3DBXA 5E6IB 5F72S 2BCKA 1WAAE 4NWTL 4WI8A 1WLHA 4PJCF 3QYCA 1W0VB 4XAWH 5GS1B 1N59A 3QO0A 1F02I 4LP4A 4KROD 3CLEH 1KNOB 4Y19B 2H8PB 2VO5A 3FONA 4JHAH 3HAEA 4GJTB 2NY0B 2PR4L 3MRCA 4KROB 4KI1A 3VE0A 1RZJL 4OQTH 4QHLB 3ILQD 4ZFOB 2YD8A 2NX5A 4XT1C 2IFGA 1KBGH 1NFDF 5DZNA 3SGJA 1NL0H 4CVZA 5SV3A 2O93L 3NTCL 3OGOE 2D7OA 2P8MB 1F4AA 4HS8H 4OLZH 5IG7B 1AY1H 4OD3H 4LGPB 1CK0H 1WVZA 1P5UA 1Z5LA 1Y0LB 4JHZA 5C09A 3TM6A 2XWBB 3GMPA 1M4KA 3RX8A 5T1KB 3S34H 2W9DL 5IIEA 1A9EB 4IM8A 4NT6A 2W65A 4K8RC 4H26B 4JREB 3T2PA 1NPUA 1X4YA 2HFEA 4LF3A 3RI5K 2ICCA 1HXYB 4N0YH 3RKDD 5J06A 4JKWA 1IGTB 4IBLT 2DI8A 3RGVD 3HLAA 3EO0B 1RJLB 1LEKA 4NUGH 4YC2C 3FRUA 3UPAA 1HINH 3X3GL 3RY4A 3FT2A 4NNYB 3ZDYE 4JJHA 4ODHL 1PQZA 4AENB 1V7ML 3H7BB 4KK5C 3AY4A 2YPVL 3W11C 4JREC 4N0CD 5EWIH 3WKML 3UAJC 3O6FB 1PJ9A 4HGWA 1GCFA 1MELA 2ARWA 3QEQA 2VIRA 4XNZC 3S4SB 4K3EL 3ZDZE 3Q0HA 3I50L 3RTQB 4EXPX 1BLNB 2D03H 4KJYA 4R4NC 1D5BA 1Y6NR 4PJ8C 3KLAB 5IB2B 3D5OF 1A47A 5F7HA 2SEBB 3C8KA 3EYSL 4LPCA 5FKAB 2WINA 1GL4B 2YXFA 3LEXA 4U6HA 1JFQL 3D48R 4OLYL 1IC5L 3IU3A 3VXRA 5D1XD 3B8YA 1U95B 4Y16B 4P3DA 3SN6N 2ATKA 4I1NB 2ZKHH 1T21A 4HUWB 2KQMA 2Q86A 4PGZA 1RZGB 2XWTA 3MLZH 4W4NA 5I0ZA 4JHAL 1DLFH 3CSGA 3A0OA 4HIHB 2VISA 5CIPA 2P5WA 3X12B 4OLWH 3AS2A 4OV6F 4YHKL 3V4PH 1P84J 3RWEA 1NKRA 1E4XH 4K7FB 1G7QA 4WI5A 3QXVA 1HOCA 1MCQA 3T3ME 1UT9A 3ARRA 3AMLA 4HXBL 5HGHA 4PJGF 1U8MA 4MWFB 3V5DA 1S9VB 5E8NB 3DIFB 1KIQB 2IPTH 4IRSD 5DJ8A 2ZUVA 2J3SA 5I8OL 5D2LB 5D70L 1AKJB 3VGAB 2FIKA 3QUMA 1P4LB 2FEDD 5TQ2H 1NAMH 4G9FD 2NW3B 4NRXA 2AABL 1CE1H 2NR6D 3DPBA 2G9HB 2B7DT 1EMTL 2B8OT 3LIZL 3MBED 1JHKL 1MOEA 4UTBH 3R4DA 4S1SH 5EUKA 3LVEA 5SX4I 2QQNH 4P46C 1EEYB 2A6DB 5DQDH 2JK5A 5GRZA 4M02A 1HWHB 3CPLA 1D6VL 5ALCH 4X6CA 1N5YH 3OKOA 2MQ0A 2IALB 5F71A 1F3DJ 1QPXA 1HILA 3RZCC 4Q9CA 4KPHL 3HFMH 4HFWA 1HDMA 5CGYD 3BD5A 5CSZB 2ED8A 4CADA 4HJ0C 3G5VA 2AW2A 4GSDL 4P2OB 4LGRB 5KAQF 4K7PH 3S35X 1LE9A 1DBML 2VE6B 5FYKL 4PYGA 3SE3A 5EN2A 2YPLA 3VXTB 2GQHA 4KV5E 4TULL 3OSKA 4BSWA 2OS7A 1FHGA 1JCKA 1UWGL 1KFAL 1W72B 1YQVL 3MROA 3ARED 1WEJH 2GK2A 2P46B 1WCBB 4PTUA 4NQDB 5J1TC 2NY3C 4I3GA 1K5NB 1FFNB 2JTDA 5DFWH 1XGPB 3ZE2F 4LHUA 3MRRA 3VXRB 4EUPG 2GKIA 3DMMC 4FFWD 2X9XA 3V0WL 3E6FA 1T80A 3EO0A 5FGBC 3PWPD 1BQHG 3NACL 4A6YB 3K2MC 2NY3B 4O2FA 4NNXB 5DJCA 5FYLE 5GGTH 3CD4A 4F7CB 1KN2L 2BHUA 5LXGL 1I7RA 5D6CB 2EDYA 5FUZH 2O5ZL 3BKCL 4G8GE 5I9QB 5CBEA 3B9EA 1LVEA 3BW9B 4HKXB 4R0LA 2PO6B 4Y88A 4ZUSB 2XG5A 2R8SL 1HKFA 2ED7A 3QFJD 1R24B 4J4PC 3RU8H 1Z3GL 5D7IE 2MCG1 1BD2B 5I1AA 5E9DB 3QA3A 3GNML 4WY7L 1NL0L 5JQ6H 1ZKAA 1A7RH 1CDYA 5LKNA 1TVHA 3LKOB 4NWUH 1KC5L 4K9EL 4DKEH 3LRGA 4LCWD 1F4WL 1ZXQA 3IETB 5E6ID 1VPOL 4YFDB 3NABH 4L8CB 5KW9L 3EOYG 5IEKB 1BZQK 2FGZA 4OLUH 2ATKB 1QQDA 3GI9H 4GG6A 3B6SB 1QVOA 5DMJB 4EQ2A 3DVIA 4PG9B 32C2A 2DIJA 3HRPA 2WIIA 3PP4L 3MYJA 4HUVA 1T0MA 4PRHD 2LU7A 4F80A 3U0PA 5DUML 1IGIL 3UROR 2HG5A 1RZJH 3MA9L 4RISL 2OM5A 5GXBB 5L7XL 5EZOH 3JV0A 3EYOB 5D72L 1ZE3C 1YJDH 5E8OA 1QSEE 1LQSR 3Q6GL 1MI5A 2HFGL 4KVNL 2CDFB 3UO1L 2HT2D 2FB4L 3P0YL 3O2VL 3GIVB 3I6KB 4NZRL 4O9HL 1ZWIB 3H9ZA 5GSRB 2C1OB 4KGLA 2NY2B 1IAIL 5E2TL 4GW5B 4OT1H 4MHHG 4FG6C 4PJIA 3SHSA 4DW2L 2I60L 3RWFA 5C0BA 4YHOL 4IMLA 3L5WA 4HQQL 1N0LA 4NJ9L 3SKUD 2V2TA 2FD6H 5I1IH 4AEHL 5T3ZH 1CYGA 1BPVA 1T89A 3WIIH 3KHOA 3OHXB 2ERJC 4V2CB 4NO0B 4M1DL 1HXYA 3ARVA 4LLAA 2BY3A 4QHNA 1MFAH 4D0DB 4LLUB 1N59B 5EA0H 4CRPA 3B9VA 4L29A 1G7JA 1OB1A 3MBEC 2DIBA 4HBCL 5HI5C 4GXUM 1ZHKA 3PP3K 3TN0A 2A77L 5FDWA 4YHYC 3WO4B 3UTZA 1Y0LA 4K8RH 3IRZA 2COQA 1WWWX 4JGJA 3KPTA 1OGAE 5FYJE 5JMOC 1QO3B 1U8IA 4R7DB 2EYRB 5T3ZD 3ALWA 3QCVL 4HWNA 2BY0A 3ZL4H 3V6OC 5CJBA 3EAKA 1CBVH 5MI0B 3BE1H 4X4YB 4ZAKD 5DYOB 3VFTA 4KI5D 4Z78A 2EKJA 1I1AA 3NBNA 3IT8D 4RFNB 1UH2A 4MZ3A 3SDCC 1OP3H 1OOAA 3T1FB 4LIQL 3CXHK 2YBRA 2CMRL 3U30B 2OL3L 4QRSB 5DEZA 4YK4C 3PUCA 3D39D 3ARFB 3P3YA 2WUBH 1TZIA 3VGAC 1JPGB 3V0VB 3GGWB 4OLUL 4CNIB 4F33B 4NZDA 2HP4A 2R0ZH 4BUHA 5IIEB 1C08A 2AJVH 2JB6B 2CUMA 1N6UA 2VLMD 3RVUC 5E1AA 4GAYA 4N90E 3ZKNC 2BVYA 1CL7L 2YA2A 4XVJH 4HZAA 5ISZE 2EECA 1G7PA 3H7LA 3S6CA 1JFQH 4KTEL 4XCCH 4HGMA 3I2CL 1INDL 3O2VH 4PJ5A 1ES0A 3ZL4L 4X6DF 3VFUB 1HHGA 4AK1A 4YXKL 1M6OA 2E7HA 2EYTA 3DX6B 5ADOH 3MFFA 5IHZA 5MP6H 4FNLL 4X5WA 1F2XK 4WV1A 3X13B 1FH5H 4MB3A 1NMBH 4PJIF 3GMMB 4J3OC 5DK2B 2XZQH 5ID1B 3MYZA 1ZLSH 4GXVH 4PRBA 3BZFA 3S3JA 5HD8C 5IMMA 1U91B 3M8OH 5LWYH 4A6YL 1LP9E 1YN6B 3WBDA 1T2QL 3C60A 2NTFA 2ID5A 1J8HA 4FXKB 1EGJL 4YHML 1VENA 1IGJA 4U0RB 2BNQD 3CSYB 4PGDB 1FBIH 3L1OL 5CJ8A 5D7IF 1ETZA 1HDMB 2OL3B 5E24E 1IE5A 5DD1H 2UYLB 1AY1L 5DS8A 3GSNA 1WFTA 1CLZH 1A7QH 3DVFA 4UTBL 2VXSH 4OV5A 3WS3A 5EBLA 2LFGA 3MLVH 3BGMB 1FLRH 4H0GA 4H20H 4CNIA 1G6RB 3DV4B 3D0LA 4Y4KB 3HMWH 3VDCA 4XCNB 3MCLL 3TA3A 1HYSD 3B9KD 1CDUA 1VGKA 1R3LB 1WV7T 1K2DA 4PJAA 1A6TA 5K9QG 2J6EH 3VDBA 1S9YA 5IJVB 1NANI 4ZFZB 4H25A 1QFHA 4I0PA 1QA9B 5L2JA 3O9WD 4NQEB 5HHOE 1XF4B 2Z0BA 2C1PB 2NY1C 1MVFA 3THMH 1CS6A 4XPTH 4X9FA 5KZCD 1AP2B 4ENEC 4NQSA 4DKEL 4R9HA 4PYHA 4BFGA 3OR7B 2V7NA 2HRPL 4LKXA 2B1HH 2H3NB 3LKRA 2BNRE 3GUTB 3CFBB 2IEPA 5J3HC 3TPUA 4M62L 4JDVA 4N0UB 1D9KD 1DBKL 2KBGA 1T7ZA 4HCRL 5EZJB 1JPST 2ENYA 1R0AH 1S7SB 2KH2B 5FUOL 2DKUA 4PIRF 1G7QB 5TDNB 4XBPA 5C08E 5HHNB 1UENA 3D1MC 4X0KA 5F3BA 1A22B 1I3GH 3GHBL 1XAUA 3CX2A 3CVHL 1I8KA 4D0BB 2I60H 4KK6D 1L9NA 2IG2H 5D5MB 1EGJA 3VWJD 4G8GB 4TUOA 3SGEH 5E00A 1JWUA 1AXTL 1I3RA 4ELKA 3DYOA 4NOFA 3V8CA 3LH2H 1AD9A 2X4RA 4P9HL 2EEDA 4PY8J 1AQKL 1HNGA 4JQXA 5FOBB 3ZE0F 2DWDB 1TDQA 2PYFA 2VQTA 5EU6D 1RZ7L 1JZ7A 1ADQA 1R3IL 1QSFA 5IM7A 4XMKL 4HC1L 3QFDA 2IH3B 3F7YB 3MRBB 3O6KL 1NCBL 1BVLA 4IMKC 3DX7B 3GSNH 5ESVB 2BDNH 3MACL 3C8KB 4GT7A 4UT6H 2LABA 4JM4H 1CGSL 4XHQA 3IFLH 2AABH 4PLNC 1T83A 4G9FB 5AG8A 5F89B 4W81A 1JHTA 3O2DH 3AVEA 4MAUH 4J1UB 4XNUH 5CEYB 3VRLF 4BZ2L 1I9RL 3EFDH 4HGWB 4JFHE 3MA7A 4Y4FA 2GJ6A 5IHLB 4Z7VB 1OW0C 4R97B 1OPGH 4GBXD 4YXHL 4XP1H 3QUXC 5C07E 2A1WH 3TCLB 2NY4B 5F3HB 3RI5F 4Q7DA 1QTYT 1FE8L 3OF6A 2R4RL 1DP0A 4MNQE 2IG2L 3OJDA 2XQYK 3BZ4B 1KIPB 4BKLB 3FOLB 4FQXA 1FN4A 1J1OL 2P5WB 3X12A 4JFXA 3D85A 3B3IB 4MQTB 2FL5B 4DKAA 5FECB 2A74B 3PGCB 1T66C 4UQ2A 2B39A 1SJHB 4OFDA 1FZOB 1A64A 1CXKA 3QXAA 1P1ZB 7FABH 2YPLB 4YFLI 3VXTA 3TNMA 4IS6A 4XP4L 1ZMYA 2ZCHL 4HKBB 5HSFA 4XPAH 3SJVB 1E4XI 4B41A 1MHCB 2X7LA 3KYMA 3X3FH 4FQHA 1NCBH 4JEGB 3FB8A 4XNXH 4E41E 5KG9B 3O45B 4HT1L 4QHNB 4AEEA 4D0CB 5F9DC 1I4FB 3UXFA 1KEGL 3MRPB 1KYOJ 2ADJB 4IIQA 5EU3B 3UJTH 4KUZL 4N8VB 1IBGL 1FYTB 4AG4H 3OXSA 3G6DH 4GS7C 4OUUB 3NIDE 2Z4QB 5GGSA 3T0DA 1BLNA 3L3JA 5BZDB 2EEAA 5D2LE 1CL7H 5IMKA 1PVHA 4KKBC 3LQZB 4X4XB 3OKNA 3P4MB 2LAAA 3WL9B 4GW4A 3V4VL 3W5NA 2VAAB 1YMMD 2AXFA 4O2CA 4NO2A 3QDMA 1HI6A 5C0CE 3GJFH 3PXJA 3WIHH 1XFPA 2EIZB 4NFCA 3PGDB 2NZIA 4PS4H 3D2UA 1HHKB 1KB9J 4ZNEE 4PREA 5ESAB 5IROA 4YDLB 4AYFA 1I9IL 3RAJL 5SWQB 4JFZL 2UWEB 4OCSH 1V3JA 1T5XA 5DJXA 5C09E 5L2KD 3CFBA 2HTKC 5I19L 3QIWB 4XCEA 5F7DA 1INEH 4CDGC 4G8EA 3V5DB 1AHWB 4XBPB 2R0LH 1DQJB 4MQXD 2IBGA 4BSWB 3T1WA 3MUJA 3T3PF 1PAMA 2WM0A 4Q9QH 3QNZB 4Z77A 3OTTA 4ALAL 4O51A 1FZKA 3IDJA 3GMNB 4YDLC 5E9DD 5IV2B 3U9UA 1PY4A 3TNNB 5DWUH 2XWJA 3LCYA 1EUTA 1FDLL 1UFUA 1VACB 1NFDA 1KEGH 1CLYH 3RY5A 5FOJA 1KJ2B 2FNBA 4LBEA 5CJ5A 1AHWC 3CMOL 1PKOA 3DVGB 3MREA 4QTIL 3MLYL 4Y4HA 1RZ8A 3MX0A 3VFPA 2BVEA 3DV6B 2IQAB 3HRZB 3GSRB 5BVJA 5L8JB 5I1DB 4B5EA 1OW0A 2AP2A 1Q94B 3RHWF 1KLUA 3JWOH 5EPMA 5D7JD 4ORGA 1KXQE 3VI3E 1A6UL 4JG1L 4TPRL 1JGEA 1YNTB 1FZJA 3PE9A 4JO3H 2R1XB 5IFHH 1JHLL 5H94A 5MEQA 5ALBH 5CZVL 3NFPB 1JGLL 1R3HB 1NGPH 1P4IH 1X5YA 5HGDA 4XAWL 2GT9B 4R26L 4PBVC 4G7YL 3FRPG 1FG9C 3UBXA 3DRQA 3KDMA 4U2YA 3KPRB 2FJGA 1P4LA 1HHHB 3HR5A 3B83A 4RGOH 4Y1AA 1EH9A 4NO5A 1LO0H 2JF1A 1OSPL 1UADC 3HG1E 3CFDA 1P7KB 1NGZA 4JPIA 1WWCA 3QI9A 1HSAB 3LPGA 3KPSB 1FNAA 1UM4L 4XVUD 4G80A 1C16B 1X5ZA 4LDLB 3WIHA 1IBGH 2ATPB 2FX7H 1SYSA 1YN6A 3E6FB 3BKML 3PHSA 3VFRA 4GRLB 3V5HA 2CLVA 2WQ8A 4HX1B 4OD3L 1LO4L 2IFFH 1J8HB 5IB3A 1RK1A 1XR8B 3BPLC 1B4JH 2YS4A 4Z7UA 4N0UE 4ERSH 3SE9L 5ACZA 4HEPG 3V0VA 3VG0H 1U9KA 1NFKA 4LIQH 1CG9A 2EIBA 1I8MA 1F5WA 5ITBL 5GRVL 1AI1H 2UZYB 3MV8B 1IM3A 1CT8A 4JRWA 3WUWG 1F3JA 3QUMH 5DRNB 3MV7B 4QF1A 4KMLB 4DOHE 5I6XB 4BZ1L 3T1FA 3X11A 2O5XH 4AIZA 2BVPA 1LP9F 3L7EB 4Z76A 1NGXA 3QXUA 4XI5D 3REVB 4CL7A 5IJKC 1T1XA 4Y19E 4MNQA 2EXYC 1WWAX 3WUWB 5CCKL 1A6WL 2DBJA 4HXBH 1GC1L 2VSCA 3HE6C 1FCGA 3P4NA 1R3KA 3FB5A 3L6FA 3KWWB 3WUZA 3MRQA 2VN4A 1T66D 3FQNA 5FO7B 3V8OA 1SYVA 3NCJH 1Z0MA 2Q8AL 1IEAB 2VWEE 2DQEL 2C3XA 1H0DA 5BO1L 3D2UD 1U8PA 4PBXA 3HAEH 3QDJB 1TENA 2DLGA 4NCC1 2NLJB 4LCYA 3LKSB 1Q9WB 4D9RE 1S5IH 5KBNC 4K71B 3RPIB 2AV1A 3BGFB 2PXYC 3MXWL 3ZTNH 1HQ4B 2QV2A 4O58H 5FYLL 1KYOK 4OF5A 1JP5A 1C5CL 3QXDA 4OCXH 2R2BA 1EBAA 1FVEA 5CSBA 5DRWA 5L9DH 3VXMD 1JK8A 4GKSB 5E6YA 1AGCA 2AAVA 1MRDL 1TQCB 4NUJB 5T33H 3PV6B 4TPRH 3P9MB 3PXHA 3M17A 3ROLA 4TOYH 4JRXA 3VMPA 1QNZH 2VABA 3QHFH 4PPTA 2CH8A 4QRPA 5KW9H 5E94B 1U8NA 4Y5YC 4G8FA 4I18B 4DGYH 5IT2L 1Q0YH 2ESVA 4K71C 5EG6C 3I50H 5DJ0B 4K8RL 3JSSA 4XH2A 5I8CB 2HKHH 1KB9K 4NKMA 35C8L 5K9JL 4HPOH 3IDIA 4OFYD 2RBLA 3LMJH 1MY7A 4LKCB 3FFDB 4LLUA 2EEBA 1FPTH 1QKZL 4WWKD 3C60D 3RDTC 4X4MA 1A1MB 4TULH 5ANMA 3I9GH 4OD1H 1U36A 2B5IB 3W39A 5F6HI 2JJWA 4TN9A 4WHYH 1TXKA 2V17H 5EC1B 1C7SA 1CDHA 5ESQB 4WCYH 3ULUC 1T21B 2VDOH 2MKWA 4IJ3C 2YUXA 1NGQH 4P2QD 4XP1L 2ICWA 5DJ6A 4I3SH 4DGVL 3IU3B 2YHGA 1D5XA 2YXMA 1QFWH 4G7YH 1O7SA 2DD8L 4W4OA 4NO0A 3G6DL 1XF3B 1HKLL 3E1F1 3QCTH 5J12B 2DM4A 4L4TE 5SWSE 5FO8A 8CGTA 3LZFH 3RPIA 5B8CB 3GSQB 3FQNB 1IRAY 1MI5B 1FP5A 2HAZA 1BVKB 5F9WC 3FAXA 3L3HA 2Y36L 2X2YA 1YNLL 4M7KH 3GIVA 3HI1B 4WFGE 1KPUA 2I27N 4M7JH 4ONGH 3ULUF 4ZXBC 3WYRA 4YHLH 4YR6A 1ZLWH 2I9TA 3EGSB 4C83A 4D9QE 4G8FB 4RFOL 4OZ4A 2HVKA 2JKXA 4OCSL 1FDLH 2B4CH 3RIFK 3QWRD 5K59F 2VLJD 5DJ0A 2GYSA 2BERA 1OP5K 1NMCB 4H5SA 1CZ8L 2XRAL 4K55A 3B2VL 2CGRH 1IKNA 1EZVY 3GK8L 5B39G 1IJ9A 1FVEB 5B38B 4TSBH 3QUYA 3P9MA 3B9DA 3P0GB 4F15C 1J5OL 2PCPA 2G5BA 2VZOA 1M05A 2X1QA 3O11B 1DQTA 2HH0L 3LKSA 3ARDD 1L9MA 5GRYA 5HYSG 1KLFA 1NCCH 4K23H 4DCQA 4QTHA 3JXAA 3X14A 5ALCL 4JRXB 3FKUS 1E6JH 1ZLVK 5HDBF 1T20B 2P48B 1FFNA 2F5BH 2KPNA 4P2RA 1N7ML 3CLFL 3V6FA 3RKDC 4B0MM 1VFBB 4HUXB 2W60A 4NFDA 3KPRD 2OR9H 3WJLA 1FGVH 1S3KL 3VXQA 4Y5VA 3KYOB 2BNQB 3KPLA 3THML 5DK0A 5F7LB 1G7HB 4NDMA 4POZC 3TESA 1J12A 1JI2A 2I9LB 1FL5A 4XI5C 3OX8A 5MEPA 5JOPE 1VFAB 2V5SA 3MRKA 3PQYD 1AXTH 1W0VA 2A6KB 1AE6H 2VR9A 3FB6B 1TVBB 1SJEB 4X9GA 4G8IA 1FIGL 1AIFA 2IAMA 5KJRL 5IEKA 1KACB 4XTRD 1B6UA 4HF5H 5DHVB 5E8PA 4LCCB 2Y72A 3TO2B 4NBZB 1I1CA 1RMFL 1T6WA 5I18L 4RGMB 3DUSB 5B4MD 4QHUA 4F7TA 2AJUH 4JY4A 1UJ3A 5IV2A 2P8LA 1RZ8B 1HHJB 3LN5B 1Y18B 1XR9B 1UYWH 4Q9QL 4HLJA 2BOBA 3GMQA 4QRQB 1A3LH 4MGXA 2QADB 4NZJA 2R0WH 3DTXA 1S7XA 4WW2F 2R39A 2XZCH 1B9ZA 3DXAB 1UEYA 4L3ED 2FECL 4F8QA 4HC1H 1MFEH 3OJMB 1MCSA 1LDPL 1S78D 4P4KC 3EYSH 4LEXH 4JFDD 3BDYL 1ZAGA 3UBXB 5DHYA 1S7UA 1N3NA 2KL6A 3UTTE 3S36L 3A6BL 1AJ7L 1XZ0B 1P69B 4MLIA 2UWEA 3BGAA 5D1ZA 4ZOAA 1ADQL 3JV5A 3RHWK 3BH8B 4IRSC 4YZFE 5GRUL 5C6WH 3DVGA 2NY2D 5BZDA 5HGDB 3U0WH 3DV6A 3GMLB 2XPGA 3KPMB 1DVFC 3ZSSA 4NQXB 1N64L 3NABL 2WUCL 4UIMB 2ADFH 2VUOA 2C26A 1IAMA 4Z77B 4U6XB 4MA1C 2Z31D 5DC9B 3VFNB 3C5SB 5SX4H 3U9UB 2NXZD 3G5YB 1AKJA 2H1PL 5CFHA 3PGFL 1GGYA 2MQ3A 3RTQD 2C3VB 3IKKA 3OPZH 4OZFB 5DVMA 4P23D 1JNNH 3K8MA 3F65A 4LSQL 1OAKL 2NXZB 4M1GH 4HIHA 3QUMB 4R7NA 2NY6C 3ZDYF 1KCVL 5K9KB 1DVFB 3IDXL 4YQXL 3PWLB 1P5VA 2EC8A 1BEYH 1C1EL 4FQXC 5JR1H 1YEDB 5D7LB 5GSVA 4Y5YB 4ODSL 3NA9L 1IGMH 4OZHB 1QP1A 2XZZA 3O6LL 1J86A 5KSBA 4DVRH 5I17A 3BDBA 5IOPA 5HHMD 4ZDHB 1FNLA 5FKPB 2ZKHL 5ADOL 2E9JA 1OP9A 3NH7H 2VLJE 3EHBC 2DKSA 2N7BA 4E42A 2PW2B 3RDTB 4Z7VA 2ADGA 1YY9D 2HJFB 3MGTA 1KENH 4MX7B 1FSKB 3DO7A 5I1KH 2PKDA 3GSUB 3RY6C 4W70A 1MRDH 4OBSA 1KT2B 1AFVH 4L9DA 4FFZL 2AKRB 3RVTC 2RB8A 2X05A 1EHLH 5HYIA 4HCRA 5F96H 5EIVA 4Z0BL 1FL5B 2AK1H 1KGCD 4RGND 4WJ5B 2YC1B 4UDUA 5FKAA 4APQD 4WUKH 4MD5A 5F89A 2F58H 2HJLB 5ERWB 5H35B 2XQBH 4XGZA 3V7AG 3WNPA 3AC0A 4Q58C 1X6NA 2Z92A 1UGNA 4Y5VB 1FZOA 1NCWH 3QXAB 5B8CC 3Q5YA 5F1IA 1NAMB 2PETA 4LEXL 4LVNC 5C9JA 3O8XA 4RFEA 3TIEA 1Y6MR 4OCRL 4U31A 1UG9A 4MX7A 3H3BC 1EVTC 2W0FB 1OAYH 1V8HA 2XXMB 4KV5F 1J5OH 3BZ4A 1MRFL 4FQHB 3L7EA 4HUNB 4KUCD 1WIOA 4ZXBB 4Z76B 3FTGA 3H2WA 3S8WA 2I5YL 4HKBA 5C0AB 4EBQH 3M1BA 4HWUA 1A1NB 1U8OA 3GO1H 4YEFA 5KSBB 1KGCE 4GRWF 4MA7H 4XVTL 2VLKE 4ZO9A 3UX9B 1F6LL 4UU9A 3RX7A 1J1XL 2MJWA 3P0VL 4IRZL 4JN1H 3T3MF 5H37H 3PDOB 5C0IA 3SGKC 3VCLA 1QHPA 2DM3A 3EYVA 1ZANH 3AS3A 4LPYA 5CEYA 1JGUL 1OM3L 3IXTB 2I07B 5E6IC 4O5LH 2R1WB 2Y36H 2RFXB 3O41A 4JO1L 2RCSH 3IGAA 1MCPH 4J8RB 5D2NE 2AQ1A 1NBYA 3VXME 3LEYH 4KUCF 3GJFB 1JWMA 5JDJA 2F15A 4KKCC 3TA3C 5HYQA 2IMNA 5HI3C 1XCTB 4KTEH 3TJEH 2R29L 3EYUL 2HJKB 3KWWA 1Z9SA 3MV8D 1YPZF 2DB8A 2L7UA 4JANA 4WW1A 3MV7D 4BSJA 4F3FA 1A7RL 3VRIA 1J1PL 1YEKH 3MNWA 1CLZL 3PV7A 3R06A 4H8WH 3LN9A 3QG6B 3L3DA 4OD2A 4PRPB 2VRAA 4K8RD 1KIUA 1GHFL 1RJYB 3I3EA 2OMBA 4LP5A 2AS5M 4U1JB 3TWCH 3V5KB 1T2QH 2V9QA 3F7QA 1CFVH 1YEDA 3O3EB 1LD9B 4NIKB 1KTLA 1X5GA 5C07A 1AD0A 2XQYG 5BVPH 1URLA 3VFRB 4X7FC 4YC2B 3BUYB 5C7XL 5FF6A 4FXKA 1RUMH 4PD4K 5ETUA 4ZD3H 2ARJQ 1P2CA 4WV1C 3C9NA 2ICES 4BUGA 1OSZB 1Q9KA 4D2NA 5B3NA 3T0ED 1UZ8B 4OUOA 2W59A 2VDRH 4CBPA 4JFDE 1GGCH 1UZ6F 4LHUD 4R4ND 1DBJH 5FHAH 3T0EB 3IDUA 4HLZG 2VXSL 4NRYB 2EYTB 6FABH 4KHXL 3ILQC 2APWA 1MIEL 4NN5C 2OTPA 4JZOB 1T0NA 4WV1B 3X13A 2JJUA 1QA9A 4E41B 4U1NB 4NSKB 2HLFD 4PJBA 1MCNA 4XAKD 3SJVE 4NQTA 5I1CL 5D1XC 4XCYA 3EIFA 3BESR 4ZS6D 1Q9OB 1T2JA 3C9NB 5F7NC 2H1PH 1P9MA 4ETQB 3C09C 1CD8A 4JZNB 1LGVA 4BQCA 3P30H 3RPKA 5MENB 3S98A 4KDTC 2H32B 1T22A 5SX5H 1ND0B 4Z7WE 5IVOA 2DLTA 8FABA 3IU4H 3S34L 1IQWH 1BAFH 1XIWC 3VWKD 4QTHB 3X14B 2BHZA 3ZKXC 5L6YL 4RGNC 3PQYE 1U8OB 3PP3H 5CJOH 3CVIH 1RJZB 4PLKD 5ACMA 3NH7L 3IFNH 1GGTA 1DFBL 2AGJL 3KNBB 3QDGE 5FCSH 1HXMB 3S36H 1FRGH 1DZBA 1PEWA 1JF1A 3PP4H 3QG6A 1KLGA 2H41A 3WDIA 5IEHA 1PZUB 1CE6B 3UDWA 2FCBA 4LK4A 1QNZL 3QHFL 3QQNA 5ACZB 2NY5C 3SKMA 3O3AB 1ZLUK 3DO3A 1JZ6A 2JB5H 4MCZA 3LS5H 2NR6C 1BQSA 4DTGH 4UV4H 2EYRA 5HI4C 1U8IB 3OBAA 4G6FD 2DQGL 2NW2B 3HUJA 3MGOA 4YWGH 4KKLC 1S3KH 3IS1X 3UDWC 3QNYB 5IW6B 3QUZC 5L8KB 4MAYB 4LFHG 2F53A 2P7TA 4YE4L 5J6GA 1A7NL 2Z4QA 2ZSWB 4FOMA 4QXUL 2Z8WC 4XNUL 2R1WA 4P46B 3CFEA 1CDJA 4FQLL 3VGHA 1OTUD 2H9GA 1X5IA 5CGYC 2GCYB 4H8WL 1TJHL 1FG2B 4YAQA 3RDTA 5ITBH 2X4SB 4U6VL 4R2GB 3ZO0A 2CMRH 5CLTA 1WFNA 3FFCD 4OZGA 1YDPB 5JIIA 2E6QA 1WBZA 5JTWA 3CXDL 4JY5H 3N0PB 5DR5H 4Q6IC 1RUKL 3HR6A 3ZDZF 1F90L 1OWWA 4LLYA 4YDIL 5GJSH 5DD5H 3AREC 1U8JA 3UTTA 1SEBB 3ECBA 4PP2B 2DLIA 4LCWA 3H9SE 1UVQA 3GJEA 1FNEB 3MA9H 5IQ7L 4Y4HD 1A3QA 4M7JL 4ONGL 4V1DE 3IDIB 3FL7A 5CGTA 4K7PX 5I8KH 1IQDB 2R69H 3MOBH 2XZAH 3MLUH 2BC4B 1BBJB 1YY8A 2RGSA 3FCTA 5IBLD 1LDSA 3DLQR 1NLBL 4WO4B 1CQYA 5BV7L 3T8XB 3CDGB 4RAUB 4BQ9A 1EK3A 3RL2B 3BEVA 2D7QA 3L3HB 2ADIB 2NY0C 2APBA 3L5IA 1N4XH 2EDDA 5EZOL 4YHOH 5DRXA 3RWJB 5B8CA 3VFMB 4H0HB 2G5RA 2UVEA 3S5LG 1U8KA 2VL5A 5FM4A 4GLRH 2XNAA 1QLRA 4LSDA 4NN7B 4OLYH 5JW4Q 1G9NC 3KYNA 1S9YB 2IMMA 3HPJB 1PSKL 1EO8L 5JXAL 1ZHLA 4DEPB 5IVXB 2X4TB 1I9IH 2OR8A 2GSGB 3HG1A 2Z91B 2ZCKL 5BQ7A 1N5YL 2P49B 1UWXK 5A2FA 2VLRD 4YNYA 4R96A 4R0LB 1ITBB 1S9WB 1KB5L 4YDVA 2IPTL 5DEGA 2DQIL 4ZTPL 4HPOL 5C2UB 3E3QC 3T0BA 3VRJA 2YD4A 1ZGLP 2YK1H 5EU3A 3WMSA 1JTTA 2NY3D 1CXLA 3H9HB 4ZFFA 3WE6A 2ADIA 2YWYA 2YA1A 4O2FB 2OK0L 1MQKH 2Z35B 1QOKA 4YFLF 2Q7NA 4P3WA 1ZWIA 4JFEE 1X7QB 4LSTH 4LSSH 3RWDA 1QBLL 1ZA6A 1I7RB 3VW3H 4UINH 5ICYA 3TVMD 4JB9H 1YN7A 3RVXD 3T65A 3AU1A 2A73A 4M62H 2RFXA 1F42A 4EBQL 4LHUB 1IVLA 3C2SA 1IM3B 4CJ1A 4B50A 3ARGB 5FYKU 3WS6A 4QRTA 1BHGA 4WW2B 4GG6F 4XMLL 3MFGB 3MYJB 4Y4KD 1AXIB 4Y5XB 3U4AA 3QA3B 4LLQA 3FB6A 1CWVA 1I7UB 2BNRD 3PL6D 1JHLH 2IADA 2EDWA 3NCYS 5HYSB 3K2UL 1OGAB 1QR1B 4PLKC 1A1NA 4MJIB 2IAMD 5AEAA 1K2DB 4X4ME 5A2LH 2AV7B 4HJGB 3IETA 4NC1C 4WU7A 2WBJB 3NCEB 4XPBL 4F58H 3SY0A 4WUUA 1T89C 4ZOCA 5LXGH 4ELMA 4WW2C 3D0VA 6CGTA 3HFML 4L3CB 4K3EH 4L9LC 4G9FA 3SE4A 4PR5B 3CU7A 3KDMB 1RZ7H 1VB9A 2AKRA 3TIEB 1HILB 3U9PH 2GT9A 1L7IL 3BDYH 3TBTB 1ERNA 4X80H 4I48A 4HXAL 2H6PA 2XKSA 3QFDB 4U6YA 3VXOB 1NFIA 3HCVB 4Q9RL 2F53B 2BVUA 5TPWH 3DVNA 4KKLD 3V0WH 5CBAA 5SWSA 4XVJL 1BOGB 3PWPA 1DN2A 3DMMA 2LU4A 1AO7B 3QJHB 5F8QC 2EDXA 3X3GH 1EIBA 1HEZA 1S5HB 5F1NA 1QFPA 1OGAA 4YX2H 2OXGA 3MGAA 4EI5B 2W60B 4NRXB 3MV9B 1F13A 2NNAB 1DL7H 2X70A 4L8DB 1S8DA 5A3IC 2L0DA 1A6VL 1D5IL 4OGAD 5CUSH 5HDLA 2BRQA 1MI5E 4LNRA 2FSEB 5JNYB 3OMZA 1C12B 2VDLL 1K8DB 5E8NA 2H2SD 4HQQH 4N5EC 3TYFA 4MSWA 5JOEA 3VFTB 3DROB 4XAKE 4HV8A 1RU9H 5FIEA 4Z7OF 2DQJL 1U8HA 1RFDH 2ICWJ 4OCRH 1H3UA 4BA8A 2DQHL 4PJXF 5DQJB 5DFTA 3BPOB 3QIWA 2BNUB 2V9TA 3IAPA 3ARFC 1LD9A 2QHRL 3P0YH 1FFPA 2BZDA 2B4CL 1GZPA 1BIIA 4HAFA 3I2CH 5GGTA 3S5LB 3U1SH 2A6DA 3UTOA 2C3VA 5CILL 1ZHBA 3H42L 5DVLA 4D0DA 3CPLB 5JIPA 5GIRB 1GAFH 2AXFB 4O2CB 3FJTA 4LQFL 5E9DE 1U93B 4FMKA 1FNGA 5FA4B 1X4ZA 3VXSA 4KRMB 5I8EA 4OI7A 1IC4L 2NW3A 4MHHI 1CDIA 5CMAA 4FQCL 4RRPA 5GGSB 3WNNA 4ONHB 2VDKL 3LOWA 3VFPB 1PEZA 2EKSA 1E0OB 1Q38A 5E2VL 1TJIH 3NZHH 2BVTA 2OR7A 2P5EE 3KLHC 4LAJH 4XPFL 1R5VB 5JPMB 2JELL 1MJJA 4OZ4B 4KKBD 3QI9D 2HWZH 4YXHH 1YYMH 4LDEB 4Q6IB 2E9BA 3RWIB 2B0SL 4DUXA 2GUOA 3MO1B 4UDTA 2Q1EA 4P9MH 1F58L 4LSQH 1DN0B 3QNXA 4MCYB 3PWVA 4MXVE 5DJ8B 5INDA 1P4BH 3F6IA 4JVPA 1RHHB 4MXWL 4XP9H 2J8UF 2J88L 3BP5B 4QT5B 5KS9E 4R3SB 3G6JF 4X6DE 4XBGB 5DK2A 5GS3A 1MJ8H 4XWOC 4LVOC 5SWQA 1W72H 1JNHA 3ZYJA 3RRQA 2NNAA 4IIQC 1T04A 4I4WB 4HPYL 2E27H 4UILL 3J8F7 3PWUB 3PL6B 4ETYA 3SCMC 4CW1A 5D8JH 1J8KA 1TZHB 2P5EB 1MWAA 1A9EA 1OGAD 4U1IB 2YD1A 2PO6C 1HIMH 3HMXH 4ZXBA 3LKOA 4DZBA 1AC0A 1WBXA 2W0FA 1DSFH 2EZ0C 2EE3A 5IW3A 3U9PL 3BXNA 1R6VA 2YRLA 4M48L 1BWMA 1KC5H 4PJ5E 1ES0B 2H9GB 1BFOB 2J5LB 1XF5A 1R24A 5T1KA 4OQTL 4HFUL 15C8H 4IIQB 3QG7H 3IRPX 1J18A 3KLAA 1IARB 3LV3A 5HHQB 2J2ZA 2Y25A 3PL6C 4LLDA 3VE0B 3TZVA 1XCTA 1YQVH 3ARXA 1SBSH 5D1ZC 3V6FB 3AMKA 5IR1B 3WHE0 5TDPB 3QDHA 2P8MA 2IAMC 5HHOA 3S88L 3IVKA 2YPKB 3FO9A 4DFIA 4LARL 4ELME 3ISWA 3V6ZB 1NC4D 1DL7L 3C6SA 4OM0L 4YBQC 4L9LA 3FQWB 1I3RB 5C0FB 3VMNA 2PCPB 5D72H 1H9VA 4XC3L 4AENA 4P5KA 5TE6L 3SPVA 1OTSD 2BHYA 4OFPA 1DFBH 3EYVB 2H8PA 3GFUA 5B38A 3BXNB 3SE8L 3NGBC 4AM0A 5IMLB 4FFZH 1T20A 2DQCH 4IHOA 1OT2A 4UIKL 4V1DD 4WEBL 2VDKH 3BOVA 5DGRA 5M7QA 3HS0B 2DTMH 1PQZB 4JCMA 3JTSB 4MJIE 5EU6E 1IZKA 1EHAA 4OLEA 3FT2B 1OAQL 5GS0C 3CFDB 3MCG1 4Q6IA 2I9TB 3DARA 1YY8B 1JMXA 3TJHC 3IVKB 4MCYA 2CJUL 3O6KH 2OMNA 2CKBB 1AGEB 1ZANL 4P23B 3HC3H 4JQXC 2B4CC 4PGCA 1RHHA 3FFCE 5DFVC 4JN2A 4M61B 4XP6H 4LCWE 2YR3A 2DTSA 1T3FB 1XMWA 2F53D 4OKVB 4KJWC 3RWIA 5E7FA 1OQXA 4ZFZA 4XRCB 4XZUB 4R96B 1REIA 4LLDB 3Q3GA 2R23B 1D5ZA 1M71A 4FABL 4HUMB 4JR9H 4JFEB 1BFSA 4NUJA 3SOBH 3LQMA 1K4DB 5CP7B 1QD0A 1EEZA 3PWUA 4ENED 4PJ8B 3B5GA 3WJJA 2ED9A 3ABZA 4EEEA 5EC1A 4GAGH 1A7OL 1FNHA 4R90L 1XZ0A 1A9BA 4QT5A 3T2NL 1TZHA 2BXZA 2OLDA 4PJ9A 3SDDA 1D5XB 5FYLD 1GOFA 1UQSB 4OCYH 4YX2L 1ACYL 4F57H 1MIMH 2PTVA 3TZVD 5DMGC 1IEAA 1IGIH 1U92B 1B0WA 3CDGA 4RAUA 4M5ZL 2PF6A 3MLWL 3QUXB 3T2QA 5I16B 1X5HA 1S7TB 4G42B 4F7MB 3IXAB 5E7BA 4LPTA 1I8LA 4MLSA 3OKDB 4OZHA 5IP4A 4PRBB 4YK4B 2X42A 1Z0NA 2H3NA 4CN4A 2AJSH 3PIQA 1NC2D 3MR9A 3T3PE 1YEFL 4GG8A 4PJEA 2XKUA 5DA4A 1CIDA 1L7IH 2VC2H 4HHAA 3WFZA 1MCJA 3P9LB 1DLHB 2GTZB 4UQ3A 5AUMA 5FYKH 2PTTA 3LHPL 3S36X 3CXDH 3KR3H 3ECBB 3QDMB 2DWEA 1JHKH 2ZP0T 4OCWH 1T7YA 3MXWH 2GAZA 2ZCLH 2HLAB 3ULVH 4EJ1C 3RIAK 4DVRL 2EDJA 2CKBL 3V0AC 1A2YB 4NKIH 1MREH 5F7WC 1NFIB 5DJXB 4IRJD 5E2JA 1WAAF 5TQ0H 4DUWA 1CFNA 5MI0C 4O02H 4KXZH 3C60C 3RDTD 1FORH 3KLDA 1A6VH 1D5IH 2EDRA 4TYUA 3D39A 3D87B 5EUKB 3VU2A 3E8UL 3TBYB 1FC1A 4PR5A 2F54A 5CINH 3DVNB 3NCBB 3RJQB 1NC2A 4FS0A 5GGUB 3SDAB 4OM1L 3DGGA 4N8VG 2X4OB 1KJ3L 4N8CL 1IAIM 1CGWA 5I1LA 5FCUL 5HHXH 3HCVA 2VLKB 2XZQL 1NGPL 5E95B 1BZ9A 3I9GL 2DMCA 4HS3A 4L3CA 4Q9BA 1UJTA 1BZ7B 4WRLA 5C0RH 3G5ZB 5DQ9B 2DQUH 3DIFA 4NO3B 3UPRB 4JKKA 5C0DB 4G6MH 1NUDA 3CZJA 4YXLL 1KIPA 4BKLA 3G04B 4G9FE 1JBJA 3OAZK 1IFHH 1NAKL 3ESUF 5ESAA 5H8DA 3W9DA 3CVIL 4U05A 1CICC 4LSUL 1YN7B 5ISZD 2GITB 3HE7A 5F44A 2DDQL 4ZXBD 3ULSA 5KS9F 1K8DA 3R8QA 4TSAL 1AGDA 1YPZA 3GSRA 5BVJB 1G9ML 1XGPA 4ZNCD 3DGCR 3HLAB 4YBQD 1RUQL 3DX8A 1F3DH 1YZZA 3FT3B 3GO1L 4XXCC 3TV3L 3ALXA 4PJGE 1YYLL 5ICZB 4Y2OA 4L8SC 4PJXA 4OF6A 1K8IB 5EO9A 3MLXH 4M8QB 1INQB 3JVGA 1C5DA 1DUYA 3T0XA 4MD0A 4D9LH 2XWBA 4FQPA 3ARBC 5IB4B 3GMNA 4OJFH 3DMMB 4WCYL 4M3KB 3QQ4B 4NHCL 3QDGB 1QSFB 5D71L 2DQEH 3FB8B 3IDYB 3O6LH 1IAKA 3FOMB 2R1XA 3OXRB 5EU6A 1NCAH 3MV7E 3RWHB 3HI1A 4KUZH 3ETBF 3FQTA 3IJSB 4QYOB 1JN6B 4PJ7B 1JRHI 3MV8E 2YMXH 4X80L 2YKLL 3TJHD 1PY9A 4N9GA 2OK0H 2H26A 2RHEA 4OB5L 2BVOA 3KYNB 1C7TA 2I26N 3FMGH 1DBJL 4YXLH 1OWRM 5BQ7B 1MCEA 3VFOB 4WUUB 4RAVB 4N5UA 3EYUH 1AE6L 4GKZB 1U8LA 1R3HA 4P4KD 4D9QD 3RJDA 2MHAB 5I66B 4NO2B 4M1CD 5I73B 1HQRB 5ILTH 2GSIB 4O2EA 2KKQA 4WFGD 1WC7B 4HWEL 3RWJA 2BMKA 1Q94A 2E6JA 4LLMB 4N0UA 4XX1E 5FYLH 7CGTA 2AJ3A 3HE7C 43CAA 1W0WB 2XNAB 2X1OA 2ZPKL 2FJHA 5J1AB 1YEGL 2BRRL 3JTTA 4ODXA 3WFDH 4NBYB 3CCHB 4LF3B 3MLXL 4RNRA 4PB0H 1B0RA 1A14H 3PDOA 5I73C 4RRPG 1JWSA 3MJ7B 4XP9L 4I77H 3ARSA 1TPXC 4RMWA 2XN9B 2HT4D 3VRJB 2QHRH 3IDNA 2XTLA 2N56A 1DBAL 1Z5LB 2XTJC 1DUYB 3LEYL 1OF2B 1VFMA 1SJXA 4NKIL 5D1QB 5EBWA 1NQBA 1B0GB 2ITCB 4JCLA 3LMJL 3QH3A 1MFNA 4ZFFB 1SEBA 1HE7A 4HMCA 1GAFL 1NAKH 3RGVB 5GZNC 1QSED 1CE1L 3GJEB 2FBJL 4EN3D 2W0KA 1XF4A 2H26B 2PR4H 3CX5J 5CZXD 3KYKH 1G0YR 1A6UH 3OJ2C 2XTJB 4P3DB 2F5AL 1QYGH 4MVBD 1N2RB 2J8OA 2EXWC 3G04A 5TF0A 4XVUC 1UA6L 4JPVL 3MOAL 1VADB 3DI3B 3W0WB 3RWHA 4JPWH 5CEZH 2BJMH 4YH6A 2C7UB 2KDGA 4Y8DC 2A77H 3X17A 2GW5A 3VD9A 5EUOB 3NA4A 2FO1A 4OUUA 3V6OE 4LKXB 4HS6A 1S7XB 4K7PY 5K33A 3WSQH 3DX7A 5ESVA 3T4YB 1BVLB 5JW5A 3FO1B 5T5NG 3IDMB 5TE7H 3OXRA 4YHPA 4P0DA 2PNDA 4I3RL 3U48A 2YUVA 3PABA 5DO2C 2QLVB 3VGDA 4MXVF 4J4PA 5D2NB 4GQPH 5HYJB 5ISZB 1E4XL 1CFSA 4ZMAT 4M03A 3DX9A 1WBYA 2GJ6B 1KTDA 2BSED 3K4ZA 4NKDA 1WICA 5C0GA 3L3IB 4X5XB 2ZUSA 4YHIB 1VA9A 4HJJH 3EDJA 4LEOB 2BSSA 2NY6D 3DSNA 5TDOB 5BV7B 4R8WH 1IC4H 3VXUB 3SDXE 4X5WB 1UB6B 5T1LD 1ZA3A 2ZSWA 2AK1L 2IH3A 4XCYB 3RIFF 4J2XA 1UKSA 2ESVD 5EUOF 2FRGP 3KXFD 4WU5A 3QBTB 1IQWL 3QZWG 1IM9B 3KJ4C 5D6CA 3VG9B 1HH9A 3BZEB 2FJGB 2E6PA 3MNZB 4PRIE 4XCCL 4LPWA 5TJWK 4YHMH 3L3OB 2WBKA 2VDQH 2VDNL 4G6AD 4MAYA 1LK3L 2X9WA 4N8CH 4PJ9B 3HZYA 3O4OB 4ESKA 1RV6X 2JB6A 2DBLH 1C5BH 1NMAH 1FL6A 1YEJL 12E8H 4LCIH 4DKFL 4JJ5B 3HG1D 2GTZA 2IQ9L 4UQ3B 4FQ1L 1EEZB 4DWHA 5I1JL 1DQQB 5JW4N 4GMSL 4AEIL 1ULVA 3DX6A 1NEZG 4LRIA 3P77B 3HE6A 3QUYB 4HIJB 5EH1A 1KIQA 1DLHA 3DX9B 1U3HB 2V2WA 3SO3B 3OWEA 3HI6L 1EV2E 3PIQB 1WJ3A 3SDAD 2CJUH 1OAUH 5CP3H 5T3XL 4L4TA 3TGXA 4XPTL 3M07A 5D96B 1KCLA 4OIIL 3UYOD 3E3QE 5BCAA 5AUMB 1FIEA 5B38G 1FJ1B 4UUJA 1X5XA 3QUXA 4KQ3H 3FO1A 3IFOA 4CMMA 4P2OD 1AHWA 3C08H 4JHWH 4JDVB 4FQIL 4JKPH 1KB5A 2JCCF 3RNKB 3FB7A 3CFIC 4YPGB 1YEIL 1RJCA 2EE2A 4LVHC 5D7LE 4I0PD 5DHVA 4YLQT 4NN6B 1X5AA 1IAOA 4AH2A 1AXSB 1ZHNA 4PREB 2CO7B 1NGQL 4P4KA 3WNLA 5JW3L 1RPQA 4LVEA 4CKVX 5AYUH 3IDYC 1NAML 3NIGF 4NHUB 4N0RA 3R0MA 4PUBL 3ME0A 1MCHA 3N1PC 2GJJA 4KAQL 5D93C 3LD8B 4BYHA 3EFFA 3L5XL 4JY5L 3D3VD 1R3LA 3UTPE 5T3XD 4GSDH 5B39B 1T3FA 1KTRL 3BO8A 4K7PL 2BNQA 4ZO8A 3U4EA 5TF1L 5HYQB 1LO2L 3N1FC 3CX5K 4QXGL 3WS3B 4WI9A 5KANI 1I1RA 2FX9H 4MMZC 2EH7L 3BPCB 5DSCA 32C2B 3ZT7A 5CD3B 5E1HB 5BO1H 3DTXB 2R1YB 1G7MB 3UTZB 1YEFH 3EJYC 1U92A 1FZKB 3IDJB 3VMOA 4J8RA 5ID0A 2AXGA 2GJZA 2ZUXA 4JVWA 1JGDB 2G2RB 2JJVA 5EO0A 4LSUH 4AM0B 2BRRH 2FBOJ 1GJIA 4OF7A 5EIIA 3L3IA 4F7TB 1CGTA 1B4JL 2QADC 2BFVH 3QWOA 4FP8H 4UU9B 4JKMA 1RZGA 2DMKA 3HE6B 3QEGH 1EDQA 1DQQA 1XF1A 4AQOA 2YBRB 1E6JL 5JHDD 4G8IB 4PJIB 1FO0L 4OTXH 2EC9U 1U95A 3IDGB 3S37H 3RNQB 5TDPA 1TZGL 2IWGA 2GTWB 1OSPH 5CD3A 4P3CL 3MRKB 5L88H 3ZE2E 4L4TD 1YYML 3O3BA 1IZJA 3HI6H 1DN0A 3BH9B 3KJ6L 2PXYB 1RULH 5D7SH 3QAZC 4L4VD 1FYTA 1F6AB 5JQHC 1A4KA 2IPKB 3PHOA 3QEHB 3QR2A 1FBIL 1QRKA 1UM6L 3F7YA 3B9AA 3O2DL 4FRWA 4GKNB 5T3ZL 5B4MC 4N9OB 5C0JA 1E4WL 4NM4L 3UTSD 1NCCL 4FFYH 1BFVH 3BP4B 4I3SL 3RA7H 4LASH 1HH6A 2P5WD 2CIKB 3QUZD 3EUUA 4HH9B 4JFHD 2IGFH 3GHEH 4TUJB 3DXAE 2CLZA 5I17B 1WTLA 1IAOB 4AH2B 3P73A 3QP3A 4ZO7A 4PRDB 4P5TD 5ECJE 4U7KA 2OJZL 4Y5YA 4IMKA 4X98B 2XY1A 2DS4A 2NY6B 2C4XA 2P44B 1WIUA 4WIQA 1ZV5A 1FN4B 5EB9A 4OIIH 4QRSA 3K4AA 4J7RA 4FXGA 2E8YA 4FZ8H 4HKJA 5GHWL 3PWNA 4V2BA 3WHE1 5F6IB 3ARWA 1LO2H 4QXGH 4Z0BH 4RMVA 4C83B 4ZSOA 4Z18A 1BM3H 2FDBP 4NQDA 3MLSL 1U8NB 1WT5C 1WGOA 4PRPE 5E94A 2GK0B 3VXSE 4S1DD 3LQAC 3L1OH 4LCUA 3QIUC 3G9AB 5KSAC 5BV7C 2NX5B 4HV8B 1DQDL 4XGZB 3EYQC 4KKAC 4OZFA 2D31A 3WLWC 4MNHB 2R2BB 3D85D 4JLRA 4ODUA 1QEWB 4PFEA 1YEKL 4UTAH 5FO8B 5IBLC 4F8TA 4G3YL 4QRUA 4MS8C 4TVPD 3FONB 1CLCA 4F7PA 2HJFA 5IWLC 2XPGB 3JWOC 4ORGB 2G9HA 4MNGB 5DI8A 1YYLH 2B1AL 4Y2DB 5IJKA 1HN1A 2FZ3B 1GHFH 1D6EB 3QIUB 2HFFA 4JFZH 1L0QA 3VXMB 2YUZA 1EBPA 2W92A 4Y5VC 5DJDA 3TO4C 3VFVB 1FAIL 2JK5B 4I0KA 4GRMB 1F3RB 5GRWA 4ZOBA 3VDAA 3C6LA 5C0BB 1BIIB 4C4KT 2VMFA 1BBDH 3GSNL 2XWJB 5A16B 3CSYA 1MPAH 4U1KA 5FGBA 2H6PB 2P24B 4MYWB 4Z95H 2ITCA 5IOPB 4MA3A 2DWEB 2GY5A 2BSTB 5LBSL 4HG4K 2A9NL 3K1DA 2IC2A 1F6FB 5DD1L 3EHBD 1GGBL 5C0AE 5C1MB 5K9KA 5C0GB 2HA1A 1LDPH 3NN8A 1IAII 1P7QD 2R0KH 5ID1A 2VXTH 1WBYB 3AFLA 3G08A 1B2WL 4CAGA 3PV6A 3D25B 3QDMD 1QRND 1U58B 3UJIH 2AJ3B 3CZFA 3BQUC 43CAB 4RSVA 1JZ3A 4TUKL 1LO4H 3VGBA 1HEZB 1S5HA 3U83A 5LGHL 3AM8C 1SYSB 2VAAA 2F8OA 4X7EC 4X4ZA 4Y8AA 1W2KT 4JGUA 4KHTH 4FQ1H 1A21A 3AS0A 3QUML 2FR4B 3FT4A 5KVDL 2EDLA 3Q5OA 5EOTA