5CK4A

Signal recognition particle receptor srb-gdp from chaetomium thermophilum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
300
structure length
214
Chain Sequence
b'TTLPSVLLIGPSGAGKTALLTLFERTSYKVDLDAAGATARKFLLIDTPGHPKLRGTTLQHLLNPSPSLTIIPYKSKLKAVIFLLDAAALADSDGDYLSQTASYLYDVLLSLQKRFHSRKNSRAPSSIPVLIAANKQDLFTAVPASLVKSRLEHELGRIRKTRQKGEGWLGAVGSKEFKFEEMMEFDMEVEVMGGNVIGDGPGAERWWRWIGERI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative signal recognition particle protein
publication title Structure and Switch Cycle of SR beta as Ancestral Eukaryotic GTPase Associated with Secretory Membranes.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Signaling protein
total genus 76
structure length 214
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09439 SRPRB Signal recognition particle receptor beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ck4A00
3GPLA 3LW8A 4KITB 1N5LA 1J70A 1FTSA 2AKAB 2G0NA 2QU8A 3CR8A 3FB4A 4UXJA 3ZIAA 4DLRA 2BC9A 5CM8B 4BQSA 3TAUA 4HDQB 1P3JA 3GJXC 3HU3A 1OFUX 2OCPA 5D3MA 1YR9A 3TUZC 2ZI5A 4U00A 3HDTA 3BXZA 2OFOA 3THYB 2XNSA 3T1OA 5AJZA 4Z8XA 5FPHA 2EFHB 5HCNA 5K8UA 3I92A 4KXFB 3AGPA 3GFPA 1KDPA 2GNOA 2NPFA 3BFVA 3B1WA 4DLVA 1WCV1 2QORA 4A0FA 4JL8A 2PLRA 1D6JA 1XD2A 3PEYA 1QG4A 1IY2A 4FCTA 5CB6A 1A2KC 3NBYC 4DLYA 5KOYA 3BB3A 2ZPTX 2DHRA 2LKDA 3EA0A 3H84A 3SDZA 3I3SR 3E1SA 5GJVC 4ZKEA 3VQTA 4AY2A 4B3CA 4DSUA 1G5TA 3QKSB 1FZQA 5BN3A 2QA5A 1XEWY 4TYWA 4P0TA 1U9IA 3MAAC 1NJFA 3PIRA 4RCZA 2IWHA 4LC0A 4AKEA 3SFVA 4JIMA 3I8XA 4PR0A 3MWYW 3QBVA 5JWOA 2W83A 1G8PA 3GJ8A 4X8MA 4OQNA 2FH5B 4BUJA 5J47A 3PXGA 2OAQ1 1KI2A 1E9CA 1R0WA 4M1KA 4TN1A 1G3RA 4IEEA 4LI0A 3QSYA 4B2PA 2GAOA 1CRQA 4PPQA 3JZMA 4FMDF 3UKDA 3UXMA 3BBPA 4RD0A 4MGIR 2XTZA 3HJNA 4P32A 2C96A 2O8BA 1US8B 3BH0A 1U9IC 2CVHA 4NBSA 3SR0A 1R8QA 4UJ5A 4FINA 4O2RA 4D2IA 4HATA 5KYKA 2FNAA 4I99A 1GKYA 4AKHA 1PUJA 1JB1A 3TH5A 4EPTA 5BN5A 2YOFA 1NSFA 3REGA 3LW7A 4Q19A 2HDNB 1XWIA 1P4SA 1SXJA 1XEFA 2QMOA 2WSSD 3GFTA 1F3OA 3PR1A 4B2LA 2XNDD 2WWGA 4EDHA 3K9NA 3VX3A 4HUQA 2RGEA 1R0ZA 4JYCA 1JEDA 2ZR9A 4NU0A 4C4PA 1PLKA 2F6RA 1IJEA 2A5YB 3AKCA 4IRUB 1J99A 1Q1EA 4YMTA 5L3SB 1SXJC 2P67A 1AS2A 1CJKC 3REFA 1RC8A 1EX7A 4M9XA 4TWZA 3I32A 2CHVA 3CRRA 4Q1AA 5AJYA 5JEEA 3WNCA 4NH0A 2IYZA 3E70C 3KUDA 3KKNA 1NNEA 5FOXA 4AG6A 3MWKA 3W8NA 4RZ2A 2WMNB 2W6ID 3A1TA 4NYMQ 2HCBA 2ZUCA 3L8ZA 3QPWA 4YDHB 5CK4A 3SYLA 4DIDA 4CDGA 2OM2A 1EESA 2A5DA 2Z4SA 1NL3A 2OCAA 4DZZA 1L4UA 2V1UA 4IFEA 4G0NA 3LV8A 4N1AA 1KGDA 2R6CA 3IUYA 1KI4A 5TXGA 1Q1QA 3ZQJA 5HE9A 4Q4JA 1GDDA 1J8MF 2WJJA 3NKVA 1IBRA 4I1UA 1G7RA 4LHWA 2PEZA 3IO5A 3ECCA 2WWXA 4F4JA 1P2UA 3D3QA 3GLGE 3CBQA 4RFSB 2DFLA 2GETA 3OIUA 1QHIA 1P6XA 1P5ZB 4GOJA 4QL3A 2J41A 1NG1A 3QPVA 1CIPA 1OV4A 5B58C 1RIFA 2H16A 4BZQA 4HZUB 2AWNA 1P75A 2CCKA 1GRRA 3MWLA 5JBQA 5H8WA 4Q5IA 4IEIA 2KWIA 2ZI3A 2QNRA 4RD4A 4TTQA 3IQWA 6Q21A 1H8HD 4Q4AA 5BYJA 4YQFA 1G9XA 4DWJA 4LJ5A 1CR1A 1KJWA 2R9VA 5E3HA 2OCYC 3U44A 4O3MA 4CVNA 1GNQA 2R6DA 3QXSA 3WMGA 4WXPA 5CIWA 5CLQA 1ZNXA 1FW6A 4GOKA 1FTNA 1X86B 5FPYA 2ASEA 4C7OB 1DAMA 4KBFA 1G5PA 2Z83A 1Z0FA 1RRPA 2JLWA 4XSHA 3OEHD 4U7DA 3CR7A 2C5LA 3HPQA 5IK2A 4JMPA 5LD2C 1YZQA 3C7KA 4L16A 2JA1A 4HAZA 1DARA 3AVUA 1DG1G 1K5DA 3VR3A 2R6FA 3IKJA 1KSFX 1Z06A 5JJKA 1JR3A 4FCWA 3SU8A 2QSYA 1E0SA 3RS3A 3EZ9A 1FPMA 4Q9JA 5K8IA 1QHYA 4DLWA 2VYFA 2UZ3A 1S2MA 2ZE7A 3CF6R 1V5WA 1W36B 2O8EB 2QBYA 1AS0A 4JLAA 5KPDA 1IOZA 2OSBA 1WP9A 5H70A 1S4QA 3G82C 5FOVA 4B34A 2IYSA 2ZANA 4QJ3A 4LY6A 4S35A 4GSYA 4KFRA 4M1TA 3IIKA 3PUWA 4UNQA 5JS8A 1FP7A 2VRWA 3VHLB 2YWHA 3K9GA 2HYDA 2XX3A 3KKMA 3LX5A 4LJ7A 2J7PA 1QG2A 1NVXQ 2Q9AA 2GJKA 3AP2A 2ZJ2A 4PSVA 3V4RA 5JEDA 1CS4C 1G21E 2YWGA 1LV7A 4H1UA 1D2MA 3CB4A 1GM5A 1ZVQA 2DFKB 4FMDB 3U3MA 3HR8A 2ZREA 4B76A 2O8DB 1Z0JA 1XFAA 1P2TA 1Z0IA 1VPLA 5HZKA 4F38A 2VHJA 2ZJ5A 3LBIA 3X1XA 1GG2A 1RPZA 2FSFA 4HDCA 3KQNA 4JT2A 3ETLA 3EZ2A 4BLTA 2ZROA 3DOFA 2AFHE 1IN7A 3U3RA 3CZPA 5JJLA 2C95A 2BOVA 4D81A 4E22A 2BJWA 1CEEA 2BMJA 4KSCA 1M7BA 2IYRA 1IJFA 4ZIRB 1NY6A 2ZRHA 4FCVA 1EFRD 1X8JA 4NONA 2CDNA 2XTNA 2QL6A 2VSXA 4V0NA 2JCSA 2YOGA 3EIQA 1CLUA 2VSOA 1Z5ZA 4R2IA 4A6XA 1OHHD 3QQ5A 4G5QA 1FX0B 1Z07A 4ZV4A 3SJAA 1W2HA 2JJ2D 3BJIC 3KDSE 3W6NA 2P3SA 2YZ2A 3CUEF 4EQ6A 5F9HA 3FGNA 4TL6A 1VYTA 1YZKA 4ESHA 4JLBA 3NH6A 1GNRA 4NCJA 2KBEA 2PT5A 1A7JA 3TSZA 3DPUA 3I72A 1E0KA 3SEAA 1KK1A 4M1MA 4CW7A 1E3MA 2FSHA 4QGGA 3K09A 3ZVNA 2V7QA 1KI8A 1NKTA 5FTLA 1FNMA 3GLIA 2XXAA 4LHVA 5KSOA 1E2LA 2UZIR 3KJHA 4LBVA 5D3MB 1G8HA 3KQHA 4QBFA 3TR0A 3B2EA 1TUIA 2HF8A 4NKRA 4A8JB 4B3FX 4DXAA 3CZQA 4PTLA 2RH5A 4TMXA 1ZM9A 4CT5A 2QPOA 4QJ4A 3AM1A 2CJWB 1EFCA 1E6CA 1N6HA 4TSFD 1NIJA 3SJZA 2E87A 1G6OA 2VIIA 4JLNA 5DNYB 5IT5A 3QXHA 1HT1E 4OK3A 2WPDA 5FOWA 1OLOA 4B33A 2PLFA 1OXXK 1XD2B 4LJ8A 4NCIA 1T8TA 4M22A 3KQLA 2X77A 1CJUC 4RD2A 1UFQA 3B60A 1VCOA 3W5IA 3TK1A 4MH0R 1WRBA 1N6KA 4IJMA 4UXHA 2VPPA 5G3YA 4GL2A 3U5ZB 1OSNA 2ODEA 1MKYA 2CMKA 2JDID 4MRVA 5FBWB 3PUVA 4TT3D 2ZYUX 3U3KA 3DKPA 1NVUQ 3TKLA 4TQUS 5HKKD 1WA5A 5CJPA 1YZLA 1W5TA 5CIQA 4B71A 1AKYA 1W0JA 5L8VA 3K0EA 3T06B 4B6FA 3THYA 1XEXB 1XTJA 2BDTA 2QRZA 2R6GA 5EXPA 1I4LD 1XPUA 2AXNA 3UIEA 1QF9A 3CPJB 2NGRA 1J8YF 1MH1A 4OHWA 2JLVA 1OFHA 5JWHA 2ZAOA 3FE2A 2AX4A 1FQKA 1J90A 2O8BB 5FOUA 4URWR 5HTKA 4YXWD 3KKOA 1E2GA 3RRYA 1KMHA 4B3DA 1MO5A 2DCUA 4BECA 2GJSA 1ESNA 3W6OA 4BFZA 2KJQA 2G3YA 2MMCA 2KBFA 3LLUA 4TL9A 1E2EA 1E2NA 3QKSA 4HAYA 1XZPA 3W90A 2JJ1A 1U8YA 2NO1A 1E69A 4V0ME 5FUXA 1KI6A 4XWKA 5JCZA 2BKEA 3M6AA 2VP9A 4AKGA 1LF0A 1AKEA 2FV8A 3QI2A 4NYJR 1SVKA 1WMSA 3NEJA 1H8ED 3QF4A 3IIJA 4DEYA 4NPHA 3AGQA 3CO5A 4QG7A 1A5TA 3Q9LA 2XSZD 4NDZA 3OE7D 2FA9A 1ZM4A 1W0KA 2HLDD 1Z08A 2ZJZA 3FHOA 4I1SA 1E1QD 4Q9LA 1OYWA 3CX6A 3VR4A 3A58B 3GLFE 1US8A 1W4BA 1VDZA 3NHBA 1BKDR 3OFNA 4B35A 4A36A 1DE0A 2C9CA 2JGNA 4KCGA 2IXGA 2ZSAA 1KNQA 1II8B 1N3BA 2GCNA 2GHIA 3EARA 2OE2A 3RYTC 4KU4A 1TTTA 5FBQB 3B13B 1OH8A 2GF0A 2EW1A 2UKDA 2IWRA 3M1IA 2IYYA 4Q9KA 4EPYA 4MYUA 4TMKA 2B8WA 4ACAA 3C14C 1L8QA 3NH9A 2XJ4A 4A2PA 3T61A 4UXIA 4IVPA 2PZFA 3KUCA 3IEUA 3Q5DA 3LX8A 4FMBB 3VKGA 5L3SA 2AXPA 2WSMA 4A92A 1CR2A 3W3ZB 3F8TA 5AR1A 5FUYA 1GWNA 4EPXA 4AG5A 1NLZA 2X8AA 4CF7A 2C77A 2ZIAA 1KYIA 3LD9A 1ZP6A 2A5FA 4Q7LA 3RAPR 3RS2A 1IHUA 2IYVA 1QHHB 4DLUA 4A6PA 3SC3A 2CLSA 4W5WA 1C4OA 2VO1A 3DDCA 2ZRAA 3ZVRA 2JLRA 2PJRA 2FFHA 3Q8XB 4AIIA 1P60A 5FL7D 3ICEA 1QBKC 4ILEA 2JLYA 2QENA 3RHFA 1Z29A 1G20E 1VCNA 4BGDA 2EFCB 2FJUA 4O25A 1Z22A 1G18A 2WJYA 4PC1A 2OAP1 3LXRA 4JZKA 4M9ZA 1O87A 2VSFA 1W7AA 3F5FA 1KK0A 1R7RA 3KB2A 4TLAA 4WW0A 2ZVQX 1YZGA 5GVSA 3NTUA 2AFIE 3PITA 3O8DA 2NG1A 2IUTA 3GJ3A 3CKLA 5E7JA 5AJXA 1N5KA 3A1VA 3MG9A 2RAPA 2C9OA 3UATA 1D9XA 2YWEA 2QAJA 2CCGA 3AP3A 3I62A 2CBZA 1GNPA 4F92B 2JASA 1KSGA 3DM5A 1Q20A 3X1WA 4JVNA 3AV0B 2OLJA 4A0RA 1ZNYA 1E2MA 2W00A 3QVUA 1NRJB 1CXZA 3KFVA 3GMTA 3HYTA 4OJKA 4JLPA 2BMFA 1E2PA 2EYQA 5C4MA 4Q1CA 3HP1A 1YJ5A 1KY3A 1R8SA 3ADCA 4C0BA 1VYUA 5DN6D 3ZS9A 2OXCA 3C8UA 1ZUIA 4LDJA 4H9GA 4D4LA 2O5VA 4II7A 4XH9B 2EU8A 3D31A 3EC2A 4B6EA 4EKDA 4PO8A 2QMUA 1KK3A 3P32A 3MWJA 1NMXA 2KE5A 4Q9HA 3GLGA 3N70A 1ZD9A 1RW4A 3NVAA 3SJBA 3A1UA 1R4AA 3T15A 2RGDA 3A4MA 4TZ0A 2O8EA 3R8CA 4BFYA 1NY5A 2ZS8A 5BQ5A 2C78A 3GEEA 4OQLA 3VR1A 3AF0A 3FKQA 3QEJA 4LBYA 3Q5EA 1ZINA 3UK6A 1LY1A 2ERYA 5DE3A 1UKZA 2GBLA 4GPTA 2J87A 2IK8A 1GIAA 5E4FA 3RANA 2RGBA 2GVDC 3A6PC 4CGZA 2WZQA 3BH6A 1LS6A 4M2LA 2OG2A 3H4MA 3TQFA 1CF4A 1W36C 4ITRC 3AKDA 4XVRA 4Z54A 1OXUA 3KQUA 5FTJA 1CKEA 2O8DA 3KKQA 3GLHE 4GT1A 1COWA 821PA 1E79A 3BAFA 1XJ0A 2W6JD 4EIWA 3DEFA 2IS1A 2GBLC 3GEIA 2SHKA 4WZBE 1EXMA 5EP1A 4TQAA 4HB3A 1XTSA 1UBFA 2Z5FA 4ZKDA 3MCAA 1KI9A 2GESA 4ZCLA 1YVDA 2O0JA 4RD3A 4NYMR 5DGXA 2WAYA 1RE0A 1U8ZA 2KB0A 1P73A 2GCPA 4C0QC 3W6PA 5IDVA 1GFIA 1J2JA 4TL7A 1M7HA 1T5IA 1KKLA 2BEKA 1DAFA 3NG1A 4ZIRA 2QT0A 2C9YA 4IXNA 1GRQA 3ZGXA 3DO6A 4WBSA 3VHXA 2GA8A 3QEOA 2QT1A 1T8UA 4FI3C 3SYNA 2WWHA 4G5RA 2ZETA 4R98A 2EFDB 2UVQA 1MO6A 4MITA 2GJAA 4N0EA 1KY2A 1N6RA 4BFSA 2ZUDA 4N3NA 4YMSA 4KLZA 4ZCMA 4C0AC 1GL9B 2FF7A 3NBFA 1Q12A 4RVCA 2P0EA 5G41A 1WBDA 2D7CA 4LJ4A 1VG8A 4URZR 3VKHA 2W0SA 2AD5A 2WWIA 3QENA 4A1FA 2HT1A 4GZMA 2G0TA 4DCUA 3DKVA 3KXKA 1U81A 4RJLA 3PEWA 5KDLA 4LOAA 4JJKA 1XRJA 4URUR 1HQYE 3EC1A 4BLOA 1XDBA 1TEVA 3LVRE 5LDDC 1OXVA 2HT6A 4RZXA 2VEDA 3AEZA 1T4GA 2HXYA 4A8JA 4OQFA 1LF5A 4Q00A 5DH9A 1IXZA 1EWQA 3CF0A 1KZGB 4IKEA 1GZSA 2CJWA 4OL0A 3THWA 4Q66C 2BHRA 1IN6A 1G7SA 2X19A 5FTNA 1KDOA 5JCPA 3D8BA 2ORVA 4GFDA 1UKEA 5BW8A 4QOSA 3RVBA 3C4JA 3PEUA 5P21A 2QROA 2ODWA 4LRWA 1KMHB 1M74A 2BBWA 3VR6A 2E1RA 5KNDA 4A8JC 2FWRA 4TQ9A 1WBBA 3JVVA 3SZRA 4ZDIA 2QY9A 4IFBA 2QAGB 4DCSA 2EWVA 2FEMA 2QZ4A 5L3RA 4G1UC 2N46A 4Z1MD 2FMXA 4EUNA 1OFIA 2A5GA 4K81B 1KI6B 5FUVA 4HLQB 3BS4A 4XD7D 2NO6A 1T5LA 4JVLA 4URYR 2WSSA 5DHFA 3QF4B 1XEXA 2YINC 4IDHA 2XNDA 4IXMA 4KJZA 5SZIA 5J4VA 3CW2A 4RD1A 4L15A 4KYUA 2CCJA 4B44A 1KDRA 5K8LA 1OH6A 4BLRA 4JS0A 1NJGA 1L7VC 5FBLB 1EGAA 1DOAA 5CDFA 4I81A 1W4CA 5FPSA 4LV6A 3QBTA 3SOPA 1LB1B 2MSCB 3AF1A 4RKFA 4AYTA 2JEOA 3N2IA 1OB2A 1XBTA 5C18A 4MKIA 2IEZA 3TBKA 3AVPA 3WMEA 5CB8A 1I2MA 1KK2A 4LCBA 5GVRA 4QXAA 1R0XA 1R5NA 3BGWA 4ZDWA 4AWXA 4Q7JB 5DI3A 3SQXA 3WY9A 2H8KA 2J0QA 1G17A 1XCGB 4MKHA 1JI0A 2ZRDA 2BCJQ 1G4UR 2W6IA 4PHGA 4HZIA 4DEXA 4LPSA 4QNMA 4F4IA 4HSEA 2VBCA 5KDDA 2HCJB 2MMGA 4FWIB 4KV9A 2FDCA 1W46A 4AI6A 3GP8A 2VP2A 2O52A 1AZSC 1PJRA 4JT4A 3EA5A 4S2EA 3HPRA 2JLQA 2WKPA 1NSTA 1O3YA 3BRWD 621PA 2P6UA 4LSGA 4B3XA 2PMKA 2ZS9A 4UNRA 2LKCA 3I4LA 4JBXA 4PXAA 2IA5A 3ADBA 1QDEA 3FOZA 1S96A 1E99A 3EPHA 3VFDA 4W7SA 1AK2A 2VHQA 4G01B 4FD2A 4P4TA 1NI3A 5DISB 5B2ZA 3L0IB 3LRPA 1NN3A 4DSTA 4LGMA 1II8A 4A2WA 4DUGD 5FUWA 1ZM7A 2FN4A 1QHSA 2B7CA 1T91A 3FPAA 1GKIA 2EFGA 1E98A 5LBIA 3ZLJA 2ZRIA 3QXCA 1XMVA 4V0MA 3FHTA 1X6VA 2V4ZA 1TQ6A 1H8HA 2QPTA 2F55A 4F91B 3T34A 2XZLA 3EZ7A 3L43A 1XF9A 1P9RA 1CRPA 5KUTA 3K0CA 1VCMA 3H0KA 2C99A 1R5BA 4GNKA 2WTUA 3K0AB 5ELXA 4GDFA 1WE2A 1YR8A 1KAOA 3OEHA 1MT0A 4M9SA 3T5GA 4JJZA 2V8OA 3AVWA 3GLFA 4QKQA 2XTMA 4RD6A 3CH5A 1RJ9A 4BFVA 1IY0A 1EK0A 2LCFA 4NCNA 4LV5B 3LH5A 4A82A 1QHHA 5G3ZA 2OO7A 3SFZA 4D26A 4QHYA 3K0CC 1LS1A 3H86A 2IS4A 3ZH9B 4DSOA 4HAXA 1VHTA 3H2YA 3UMSA 5F9FA 3P1JA 3WYFA 4JLDA 5AK0A 2DB3A 3EXAA 1ONBA 2BBTA 2IHYA 2Y8EA 1T6NA 3EWAA 2P2LA 3QE0A 3K8YA 2PX0A 2J59A 1UDWA 1VKJA 5GJBA 4YMWA 1FMJA 2VLIA 4DDVA 2WJIA 2RMKA 1ZJ6A 1VG9B 4JYBA 3HU2A 1E2DA 5KNBA 2QI9C 4AYXA 5CYOA 4OKSA 2QN6A 4KLNA 2IUUA 3LY5A 4POAA 3GLGB 2PBRA 3BB4A 3KKPA 1GRNA 4LWZA 2JLXA 4QNRA 3EG5A 3A1SA 1VIAA 3TNFA 1KOFA 3AVYA 3ND9A 4D82A 2DFTA 5L3QA 2IL1A 3EW9A 2AK3A 721PA 1JBKA 2GVZC 4MYHA 121PA 5JI3E 3RRNA 2QEQA 1I4DD 2ZJOA 2G1JA 1E9SA 4R71A 4B48A 2H17A 4L9SA 4OBEA 3AVTA 1KJYA 4BFUA 1Q0UA 1JQLB 1ZUNB 3IPXA 3UMFA 1TF2A 3RWMB 4GBMA 3E5HA 2VP5A 1Q1BA 2ZSFA 3DMDA 2FPLA 4HAVA 1N6PA 1F60A 1P2VA 1EFRA 2AN9A 2W58A 2WICA 1OH5A 5EE9A 1EFTA 1S9DA 1NG9A 2A9KA 4QBGB 4PZZA 4PPGA 3I5YA 1ELOA 1VMAA 3MMPA 5CK5A 4KI0A 1KDTA 4OK6A 1OHHA 3V00A 2NQ2C 2ZUBA 5H1YA 5C46F 1TQ2A 4OI4A 2JJ2A 4XTCS 3SE0A 1JJ7A 4BLQA 3K9LA 1D2NA 1HY3A 2YV5A 4BZPA 4D0LB 2VP6A 4NYIR 1WF3A 5J4LA 1S3GA 2WV9A 2ZRMA 1VG1A 2BVNA 3VKWA 5KSYA 3T5DA 1X8LA 1DO0A 4Z51A 2PJZA 3CLVA 5DI9A 1DEKA 3O47A 3C5CA 1Q57A 2PH1A 2XOKD 2VL7A 1I4TD 1E9EA 2GZAA 2KSQA 1IXRC 1BO6A 4WXRA 2J0UB 4Q1EA 2JJ8A 2OHFA 4V0LA 4Q1DA 1YRBA 1RYHA 1SULA 2ZE8A 3P26A 4KYIB 4TLBA 2MSEB 1M8PA 1IN4A 4GRAA 4PPNA 4DSNA 4MGYR 3WXMA 2J9RA 2DPXA 3U61B 1TU4A 4TSFA 2P6RA 2IX3A 3WBKA 3U7HB 3AP1A 3NXSA 4FWTA 4PPFA 1CJVC 2B8TA 4MYTA 1G5RA 4NL4H 2PX3A 5JRZA 2VHUA 3BORA 2W2XA 3ZJYA 2J7KA 1OXTA 2R6AA 4LYAA 4Y0AA 2HYIC 2VQSA 4PQFA 3B8HA 2QQ0A 3TW4A 1ZD1A 1NKSA 3TR5A 2L0XA 2X2FA 2YOHA 3DZDA 1YU9A 1KI1A 3JVUA 3TE6A 2ZYWX 3ZZUA 4IOKA 1K8RA 1E1RD 2DR3A 2GRJA 2V6JA 4TT3A 3GCGA 2P5TB 1J7KA 3O8CA 2A5JA 5HKKA 1X1RA 5M04A 1NBMD 3THWB 2DWOA 1ZD8A 2WWWA 3E2IA 5K8TA 4MRRA 4TMZA 1E2FA 3GQBA 3K09C 2CEAA 4JVSB 5EXXA 2QTHA 1HH4A 4OHXA 1FL9A 1BH2A 1VCIA 4J0QA 5J40A 2GCOB 5CM9C 3Q85A 4JLVA 3QY0A 3GJ5A 2IT1A 2J1LA 1IN5A 3GJ0A 3MFYA 4JSTA 3X1DA 1MABA 4XSGA 4YXWA 1IN8A 2RGNA 5HE8A 1U0JA 4FXPA 1Z2CA 3VR2A 4W5JA 2D3WA 5JZVA 4H1VA 1E2KA 1XD9A 4US1R 3TSOA 4M0LA 4Q7MB 5KSPA 5JHHB 2GZDA 4AKIA 2W0MA 5DIFA 2ZR7A 4YMVA 1ZRHA 4XJXA 1SVOA 2MSDB 1XX6A 3UWOA 2RKOA 3OESA 2IXFA 2N1BA 1U90A 2ZU0C 1GKUB 1XTIA 4QBHA 5E7IA 3WMFA 1SXJE 5EXTA 1ZC3A 1T3HA 3GEHA 2GXSA 3LO5A 4FW9A 1ODFA 4WZ6A 1H8EA 2ZRKA 4DHEA 5A5GA 4EAQA 1MO4A 3P4YA 1EFUA 3IO3A 4PAQA 2XSZA 4PAOA 3SHWA 3KJIA 1UADA 3W34A 4DDUA 1G3UA 3OE7A 4US0R 4TYQA 2DWPA 2HLDA 5BWMA 2QP9X 1S8FA 1E1QA 2BEJA 1HYQA 3AVVA 3EZFA 2J5XA 1KIMA 2RGCA 1E32A 3VX4A 1F6BA 4I4LA 5DI3B 2QAGA 4JLJA 4XIGS 3VAAA 4ZDJA 3O8RA 2ZQ5A 4Q48A 4MA4A 5DYIA 1NLYA 2ZRNA 1XTQA 3KB1A 3TSWA 1SQ5A 2VHTA 3U7GA 1GL7A 1G3IA 2ORWA 4ZCIA 1G4AE 1ETUA 2GJ9A 2ZRCA 1G19A 4EPWA 1BMFD 1S0UA 3IILA 5KNCA 4IOMA 5KHOC 1XP8A 4IDPA 1H65A 2QAGC 4OHVA 3QKUA 4DLTA 4Q9IA 3C15C 1NVVR 2ZXUA 4MUAA 3RSLA 1Z8FA 4EPRA 2PL3A 2CVFA 5KPJA 3R9WA 1ZIPA 3B85A 2JLSA 2ANBA 3CM0A 2HXSA 1AZTA 1AQYA 2G9NA 4DRZA 3PJRA 3WBJA 1ZBDA 4QM7A 3AUXA 4DC9A 2CL7X 3Q7QA 4Q1FA 2FEOA 5AUQA 1DAGA 2KI5A 5FFMA 2OESA 1AGRA 3LLMA 2AHOA 1G7TA 1DPFA 1F2UB 1KHTA 2D2FA 2ZSBA 4JLOA 5E7MA 4UKDA 1W49A 4M8NE 2RGXA 3OEED 3GD7A 3WHKA 1TAGA 2CK3D 3CF2A 4A9AA 2OUKA 5FL7A 2NO9A 1WQ1R 4MKGA 2FPKA 1ZC4A 1MV5A 2R62A 1G8FA 3I73A 4M21A 1VHLA 1XTRA 1OKKD 5C1BA 3FKSD 3C16C 3HU1A 3T35A 2VF8A 1F48A 4P4SB 2NPIA 2J0SA 1E2IA 4XWOA 3GLFB 4CEHB 1HT2E 3SJCA 2Q3HA 1JECA 1RJ9B 2BV3A 3AB3A 3AUYA 3K0FB 4JKIA 5LB2A 4BZXA 2HJVA 4QHSA 4V02A 5EE1A 1E9AA 1CULC 2EVWX 1AQUA 4IDNA 2EFEB 4KFUA 4LBWA 3OAAD 4GZLA 1M7GA 4A0GA 1E2QA 1F2TA 1IAQA 1WDTA 1XXHE 3V4FA 5SZHB 1W48A 5B30A 4FN5A 3AF4A 1RRGA 3WYAA 2FGKA 4MYCA 4BRWA 4D25A 5FH9A 2XAUA 3IDQA 1JR3E 2GEVA 4D4JA 3VU9A 2ONJA 3U60B 4WVFA 1TUEA 4NZYA 5TV2A 3ND8A 2VA8A 1Z63A 4LC1A 2PZGA 3TMKA 3K0AA 3UANA 3FTQA 4ARZB 2RGAA 1D9ZA 1S1MA 1W2GA 4NP6A 5EJEA 5DN6A 3U3OA 4WA7A 5AJVB 5DLQC 2GTPA 1GAJA 1OJLA 1QHGA 4A15A 1G16A 1G3MA 1NN1A 1Y63A 2ZAMA 3FWYA 3GFOA 5TB5A 1NN0A 1Q1ZA 1XNJA 4QGHA 5L3QB 1U94A 2ODBA 4C9BA 1E4VA 4RFVA 3PVSA 3WHLA 4JL6A 1D8TA 2ZI6A 2CE7A 4LJ9A 3W8RA 3U7FB 3LAWA 2IYWA 3LBNA 4ASUD 1JR6A 1GSIA 3L2OB 1KAGA 3DMNA 3RS4A 1RKBA 1AA9A 1SZPA 2IXEA 2P5SA 2D2EA 2GEDA 3R8FA 5FOSA 1QZXA 2O8FB 2BWJA 3EAQA 3LDAA 4HYYA 4C0SA 2ZU6A 2ZRLA 2ANCA 5FPKA 3FHCB 3LXXA 4XVQA 1V43A 2A30A 2RCNA 5JWRA 4AYWA 4W5HA 2O0KA 1UM8A 4TTPA 1SVMA 4Z8YA 1DADA 1NBME 1U0LA 3SI7A 3B1YA 1ZCAA 2WIBA 1ZU5A 2H5EA 2IF2A 2G83A 2AWOA 1GILA 2J3EA 5DO9A 4C0JA 2VTKA 3MGCA 3QKTA 5F2EA 3UWKA 3ZVLA 2RHMA 4NCHA 2HUPA 3RC8A 4PFSA 2QE7D 3WNBA 4B75A 3I5XA 1FFHA 1UBEA 4DLZA 1Q21A 1ZCBA 5CJ2A 2Z43A 4M1YA 1AJEA 2ZEJA 4KODA 2BMEA 1R0YA 4QGAA 4QBIA 1W4RA 2JAQA 5IF9A 2W6JA 3UPUA 2IYTA 3CIOA 1YZNA 4FMCF 2ZYTX 4CEJA 1UBGA 1Z28A 1EG7A 4BLSA 1E9BA 2HEIA 3SN6A 2NMVA 1IXSB 4GMXA 4JVMA 2OZEA 2Z0MA 1W44A 2I3BA 1QHNA 1A1VA 4M1SA 4PAMA 3GLIE 2JIZD 1KO1A 2QGNA 2ZRGA 4R7ZA 4RSGA 4B3BA 3NBXX 1JEEA 4ERNA 2D06A 3IIMA 2O8CB 1I2DA 4NYJQ 5EE5B 3B5JA 2ZRBA 2IS2A 1UEIA 8OHMA 2QTVB 5J4YA 4OHYA 2OT3B 3Q7PA 2FX3A 2PCLA 5FBRB 2AK2A 3MSXA 1R10A 5FTKA 3EPLA 2Z6VA 1Z6YA 2YNMA 2I1VB 5D3QA 1U0HC 4ZI3A 1S9HA 5IHPA 3CNNA 4A0HA 3UG7A 4L8GA 5JFGA 2I1QA 3WRYC 2XITA 1GUAA 4B73A 4X8HA 2J0UA 4BFTA 3B78A 2WHXA 1VIYA 2J0VA 2BBSA 3A1WA 4PO1A 4MGZR 1DO2A 1G8YA 3K70D 2H18A 2WWFA 1PZNA 4LHYA 1N5JA 3LQRA 1P7CA 2XZOA 4PO9A 4YDSA 4B2IA 3PV0A 3ZYCA 5L3VA 3GLHB 1OW3B 3ONWA 5SZKB 2WBLC 4TYYA 1IONA 1UKYA 4HLDA 5BXQC 3BE4A 1MABB 3DZ8A 3K9HA 4HUTA 1YZTA 3PCRB 2P6NA 4BE7B 4M1WA 4DB4A 1BYUA 4TTRA 1KSJA 2XJ9A 1Z83A 3A36A 4M4SA 2IC5A 5EP4A 1W5SA 1ZM3A 3S1AB 1YE8A 4HAWA 1IY1A 2HF9A 4C30A 1YQTA 1Z0AA 4ZO4A 4YONB 1GL6A 4Z1MA 3B1XA 1ZM2A 1Z6GA 3OHMA 2ZRPA 1U2RA 2RHDA 4C3ZA 4OQMA 1LNZA 1EFHA 4V03A 2GDJA 3A37A 4XD7A 2BCGY 1HURA 2EYUA 4LV8B 4OYHA 4XWAA 1DVRA 4IVQA 4PX9A 4BASA 2HV8A 4NHOA 1JXMA 2IYLD 3OZXA 1KO5A 2GCOA 2GKSA 5CYPA 2G88A 4B43A 2EQBA 2WVJA 3KQKA 4OI0A 1VECA 3IPYA 4TLDA 1NP6A 2ZJBA 1P9NA 4GP7A 2VHCA 2ZTSA 1B0UA 1SVWA 2A7QA 2ZRJA 2OBMA 1T0HB 5H68A 1ZNWA 2CNWD 4IOJA 2ZE5A 3IHLA 3CPHA 5FPTA 2REOA 3ZS8A 4HLCA 1CP2A 1NIPA 4KBGA 1PLJA 1G1MA 4LUCA 4IHQA 1P62B 3W3AA 4G5OA 1N25A 4UJ3A 1G64A 4EJSB 221PA 4KHZA 5JLJA 4DVGA 4L4UA 4GOXA 3IGFA 2CE2X 3F3YA 1BYIA 1U98A 1HE1C 2YWFA 3SS8A 3ZIAD 4F7WA 3THOA 2IW3A 5AUNB 2C8VA 3OIVA 3T1TA 1TX4B 4LYFA 3TJZA 3VMFA 2F9LA 3ZDQA 3M4YA 2V3CC 2QSZA 2NO0A 3K53A 2R44A 3AKEA 3AVXA 1Z6TA 2ZITA 1Q44A 3EWSA 1P2SA 3UMRA 3TGPA 2VP0A 4BPBA 4A4DA 4B3GA 1TNDA 2NO7A 2Q6TA 5J4HA 4N0DA 3MJHA 4XOIA 4O0MA 5JI2E 3AF3A 1TF5A 3AQ4A 2YHSA 1VYVA 4Q7KA 4WAUA 1LW7A 4Q21A 4DUGA 4P31A 4FMCB 3EZ6A 2I4IA 3DOEA 4ZPXA 3VNUA 3OF5A 1E0JA 4G5SA 1E2JA 4UQOA 2DBYA 1LTQA 3CH4B 1XJQA 3FFBA 4B32A 4OJQA 5A0FA 3U6BA 2XGJA 2R2AA 2CL0X 4RZUA 4NTZA 1DAIA 2OLKA 3DM9B 4LJYA 5EQTA 4YLGA 2IEYA 1Q3HA 3KX2A 2ZI7A 4IW3B 1K6MA 1CR0A 2JLZA 4LYHA 4DDTA 3CRW1 4PZYA 3TVTA 4DJTA 2ATXA 3QKRA 5FOTA 2PZEA 1GTVA 4P33A 3P27A 3QJYA 3T1VA 4LK2A 1KTVA 5JMTA 4CEIA 4URVR 4D80A 1N5IA 1F2TB 3CNLA 1OIXA 2GK7A 2YYZA 3FMIA 2C03A 3D7MA 4PQYA 5J5CA 3VNVA 4TLCA 5JSZA 1F2UA 4U02A 3VU9B 2YC4C 5GJCA 1SHZA 1JPJA 3A4NA 4OI2A 4UNSA 2LWIA 1SXJD 3MD0A 4CRWB 4MQBA 2WAXA 2OBNA 5C4GB 3M0EA 5EP3A 4P4UA 2C04A 2XB2A 3P20A 1DBSA 1XPRA 4DCTA 3A4LA 1XCMA 3O8BA 4DKXA 4F4CA 3JZAA 3TUIC 4P4SA 3BFKA 4G3XA 2QM7A 1N0VC 3LVQE 4CEHA 5EZ6B 3ASZA 5TY0A 2ZJYA 3K0FA 3EIEA 3N5CA 1KZ7B 2YKGA 5JS7A 1DAEA 2ODNA 1FMLA 5AWFC 2F3TA 2CHQA 2QP4A 3W9YA 1OB5A 3RRMA 4I1VA 2K5UA 1L4YA 2B92A 3TW8B 4HB4A 5FTMA 1Z2AA 3ZD7A 1XJCA 3BFXA 3KFXA 1QHXA 5HCIA 2QRNA 3L0SA 2ORIA 1DTSA 2DFNA 5GADl 3IBYA 4YC7A 2GZHA 4DLXA 5AUPB 3CRQA 3HWSA 3CONA 2QP3A 1AN0A 3L8YA 3B6EA 2D4HA 4Q03A 4ARZA 2H1LA 1YHNA 3BD9A 2BKUA 3RNLA 2ZR0A 3N2EA 2WJVA 2C98A 2FOLA 4PC6A 3RDPA 1JJVA 4DCNA 1BS1A 1ZAKA 2YC2C 4JKYA 4RKEA 1W1WA 2GF9A 1R6BX 1YR7A 2B6HA 2OCBA 2OFWA 3BH7A 4LHZA 1RRCA 1AS3A 1YKSA 2WM9B 1OXSC 3KJEA 2F1JA 3KZ1E 4Q4HA 4IVRA 2PMDA 1Z0DA 1M2OB 2REBA 3R9XA 1DELA 4F93B 2QPAA 4MRNA 1CU1A 2FZ4A 2Q3FA 4HAUA 1T3LA 2H57A 3A8TA 1XXHA 1RVDA 3QNUA 5FR2A 3L82B 1E94E 4CEJB 1CBUA 4HB2A 4LPKA 3R7WB 2YJTD 3C5HA 3B9PA 1TADA 5F98A 2O8FA 2BM1A 3AF2A 2R65A 3BK7A 4PC7A 4PSAA 3U6KA 3RS7A 2IBMA 1K5GA 2XOKA 1Y3AA 2DY1A 3QUSA 3TQCA 4Y0VA 1XMJA 1KJZA 3F0TA 2PCJA 5EE0A 3KTAA 2D7DA 2J46A 4PZLA 1N6LA 3AVOA 1XMSA 5IK2D 3K70B 1XTKA 3G0HA 3NDPA 3PUYA 1TL7C 1ZU4A 2AKYA 4M9QA 4ZDKA 1G8GA 2V55B 2ZJ8A 1N6IA 3PENA 3U4QB 3TLXA 2CLDX 2Q0HA 1WB9A 2XEXA 1Q22A 4XTRA 4B74A 1DG3A 4NCKA 2VH5R 4BFXA 4EPVA 1JR3D 3SBEA 4P3YA 4PC2A 1T3SA 3ZQ6A 4QJ5A 3T1QA 4E5UA 1HA3A 2AD1A 1NN5A 2AL7A 1TU3A 3Q3JB 2OBLA 2QM8A 4ACBA 1A82A 3QPUA 3SQWA 3ICQB 3BIFA 1E9RA 2ZRFA 4E07A 3ZD6A 3SYKA 5AUOB 1TPZA 1E1RA 1E9FA 1P9WA 4JBWA 4QHTA 2AR7A 2IHBA 2Z4RA 3SNHA 1VG0B 2J7PD 3IEVA 2B7BA 2O8CA 4TLEA 1F5NA 3X2SA 1NBMA 4NMMA 3C41J 4O2LA 4PHTA 3THXA 4DT1B 4RZ3A 1MO3A 2TMKA 3GJ7A 3L0OA 4IDOA 2OXRA 3W5JA 1UDXA 1E96A 4PSKA 4R9UC 4WZAE 1MR3F 4M53A 4PANA 3U2QA 3K0SA 3RRZA 1G41A 2NIPA 1RRFA 4U5XA 3UG6A 1GITA 3AH8A 3V9PA 3DVLA 4D0NA 2CHGA 1OH7A 1GVNB 3RWOA 5GJWC 1CJTC 5KSZA 2IUSA 1JAHA 1JAIA 2JDIA 2W2TA 2NOAA 2QMEA 4JLMA 4AC9A 1Z6XA 4G5GA 3I8SA 1XPOA 2FFBA 1LFDB 1SVLA 3I1FA 3EPJA 1P72A 1W47A 1XU4A 2GXAA 3RLFA 1KO8A 1OFTA 4LBZA 3TAHA 3WNDA 3QXXA 4TMTA 3G5UA 4MDEA 3GLHA 1OT3A 4QM6A 5DYGA 2F43A 4W9MC 1ZW6A 1ZUHA 1FP6A 1N0WA 2FFAA 5J4KA 3BWDD 2G77B 1DAKA 4KSBA 3EPKA 1SKQA 3P4XA 5CDFE 2D62A 3S1AA 4ABYA 3PFIA 3HR7A 1KSHA 1XD8A 1OE0A 2HJGA 3QOFA 1FQJA 1S3SA 5HPYB 4HB0A 3PUXA 1FUUA 2RGGA 2ZSDA 3I61A 2WJHA 5FR1A 1SKYE 4DLSA 2V7QD 4HEJA 2FSIA 2A78A 5JJIA 1UAAA 3NBZC 3QVVA 4BEJA 2ZVPX 5TVKA 1C1YA 1FOEB 2FFQA 3ZVMA 3R20A 3LNCA 2RGNC 1X3SA 4EFNA 1E2HA 3HYRA 4AURA 1ESMA 2FSGA 4XVUA 1BMFA 5BYKA 4LYJA 3CX8A 1TF7A 4D4MA 2F3RA 1QVAA 4URXR 4TYPA 1BOFA 1YRAA 2XZPA 1Q3TA 2WPDD 4TYNA 3Q72A 1Z0KA 2H7VA 4Q02A 4Q47A 3CPEA 1AGPA 2J45A 1PLLA 3IQXA 3QG5A 4ZI2A 2X2EA 3TRFA 4CT4B 1OIVA 3CRMA 4EJSA 3R9IA 4I1OA 3VR5A 1OYYA 3CNOA 5CITA 2G1KA 2WKRA 4Q18A 2X1VA 3AVQA 3QXJA 2QQEA 4JSYA 4K46A 4LZZA 1SKYB 1DS6A 3OIYA 1CTQA 1HQCA 5EUMA 1HEIA 1TQDA 2FGJA 3ADDA 1W0JD 3LBHA 3OEEA 5DHAA 4DB2A 1HUQA 2CK3A 1E9DA 3LA6A 4LX0A 3CRVA 4R2HA 5FI0B 5UKDA 1SXJB 4MKFA 4GMDA 2ZYVX 2WKQA 3LFUA 4AK9A 4MRSA 1M6NA 3WRXC 4EJSC 4BLPA 3QKRB 3NWJA 1XB2A 4HUQB 1OKKA 3SHFA 2CL6X 3U7EB 3FKSA 3QIAA 3QF7A 4ESVA 3BC1A 2BBOA 2JLUA 1CR4A 1NVWQ 4MGKR 4CEIB 5SZJA 3MLEA 2IF0A 3CWZA 4WIAA 5LPNA 4WOPA 5EUQB 4FIDA 2GAAA 4OI1A 4MDFA 1R2QA 2R8RA 2Q3MA 3ZZTA 5JSZB 2QTFA 4TL8A 4TMVA 3RSOA 1OPXA 1JPNA 2VF7A 1CJMA 3FFAA 3OAAA 1N6NA 5KDOA 3GJ6A 1D5CA 3B7GA 3BOSA 2JJ1D 1PVOA 1KO7A 1A2BA 2GILA 4NYIQ 5KU1A 1OIWA 3TUJC 3ZZ0A 2ZI4A 1SGWA 4MUBA 4V0OA 5FBVB 1KMQA 4C2TA 1GOTA 1MOZA 1UKVY 2FG5A 4BFWA 5G53C 5F3WB 3U3JA 1U99A 1AM4D 4C0KA 2A3RA 1RYFA 1X1SA 3X1YA 4B47A 421PA 2H92A 2FZLA 1QRAA 1SHKA 4UNPA 5EZ5A 2ZI9A 2FE4A 2E9SA 4L9WA 1W0KD 1II9A 2QUZA 4D4KA 2DYKA 521PA 2OILA 4Q4JB 4KVGA 2ONKA 2A2ZA 2P65A 3TVDA 3ASYA 3PG5A 3OFND 2WOJA 1R5OA 2ZJAA 2GJ8A 2NTYC 5TDHA 2V54A 3T12A 2B21A 1NLFA 4BEBA 5EE3A 1ZMXA 4DBLC 2BJVA 3MRSA 1NF3A 2WMOB 1Z3IX 1KKMA 1SVIA 4LJAA 2F1HA 4ASUA 2Q21A 4JBYA 4EFMA 1KI3A 2O0HA 2BM0A 4CYMA 1QVRA 1HV8A 1MRNA 5LD2B 4GP6A 5C2JB 1NMYA 3GJ4A 3KXLA 1G3QA 3NDBB 3NC1C 1WXQA 5TARA 1D2EA 2ERXA 4C0LA 5HZHA 4Q4AB 4QC2A 5LB4A 1W4AA 4UNNA 3U44B 3FMOB 3FMFA 1TMKA 2QGZA 4OHZA 5E95A 1RFLA 1RZ3A 2F7SA 2NZ8A 5EP2A 1EX6A 3ADKA 1G7CA 1B23P 4X8LA 5CLLA 2ECKA 4Q4HB 2PT7A 4DDWA 4KFSA 3X1ZA 3PQCA 1E0AA 1L2TA 2QE7A 2EWWA 4D6PA 1XXHB 4TMWA 4RFSA 1IQPA 2GXQA 1G6HA 2V6IA 5BN4A 5JHGB 4HI0E 3DL0A 3H1TA 4PHHA 5DSZA 1ZIOA 1PUIA 4RY2A 4IOLA 1YR6A 1IM2A 1MRSA 2BIFA 5B57C 4HLUA 4C2UA 3B1ZA 3D6TB 1N6OA 1HE8B 2FU5C 5HR5A 1FNNA 4HZUA 3NHAA 1JNYA 2GWHA 2ZE6A 3FDIA 3LQQA 3RC3A 4PHFA 3FVQA 2N42A 3B9QA 1JALA 4QGFA 2QBYB 1T0JB 1SVSA 1T9HA 3CWQA 3NC0C 4MRPA 1G291 3DHWC 3WP0A 3KTAB 3WYGA 2ATVA 4QRHA 5KTYA 2WIAA 4DCVA 4TZ6A 4C0HA 2OFXA 4JL5A 1VTKA 2JIZA 4C7OA 2OEPA 4HLUC 1II0A 1AIPA 3RABA 4V0KA 1YZUA 1M34E 1KO4A 3LWNA 3PEVA 4PC3A 3RS0A 2Q9BA 1XZQA 2Q9CA 1LVGA 2QG6A 3FYHA 3R7WA 4RCYA 1GP2A 4EFLA 4DIEA 4US2R 4QFMA 3NIBA 4A2QA 1FUKA 3MUFA 2CXXA 4M1OA 2IYUA 1UPTA 1ANKA 3KJGA 1HTWA 1ZYUA 2RB4A 4JLKA 1XMIA 1JXOA 4CIDA 3BB1A 4NE2A 2ZSEA 1N2CE 1DAHA 4KFTA 2REXB 1KNXA 1TEXA 3THXB 2F1IA 5ANRB 3CX7A 4K8OA 5FL3A 2GEUA 3SBDA 3TIFA 4BRUA 3U4QA 4E09A 3FMPB 3K1JA 4Q1BA 1Z6AA 4KVAA 1E4YA 2W2VA 3EIHA 1X8KA 1XCPA 1NVVQ 4YMUA 1M1YE 4X8OA 2D74A 5TMPA 4KO8A 1XEWX 1Z47A 2C2HA 3B1VA 4AD8A 1W36D 4EQ6B 5FI1B 2F1RA 2IYXA 2GXUA 3K70C 1EWRA 4KAXA 2ZM5A 3KXIA 2IYQA 3MJRA 4LJ6A 5B64A 1PV4A 4HDOB 4LHXA 2BMDA 2NZJA 3AKYA 5G40A 2V1XA 2YVUA 3KL4A 2IS6A 2PEYA 3EX7C 4CZ2A 3RS5A 3GLIB 1KI7A 4IDQA 2DWQA 4BWYA 4DT1A 2XXAB 2G6BA 2F43B 1TQ4A 1ZNZA 3L0PA 4L5BA 4ON9A 5IRCD 3IHWA 2WWYA 2VP4A 2JATA 2F9MA 2V9PA 5A4JA 1C9KA 2ZS7A 3BERA 2WJGA 4E03A 3WP1B 1OF1A 2CLCX 1BIFA 4Q01A 5EXSA 1COWD 4Q4LA 1JQJC 1E79D 1U8AA 2FPMA 4OQXA 3QG1A 1FX0A 2OV2A 5KO2A 1N0UA 2WOOA 3IBGA 1A4RA 5AJWA 2CNWA 4OK5A 3B82A 5JECA 5JRJA 1UBCA 3NEYA 2XB4A 2QMHA 3OIWA 1UF9A 1UEJA 4GI7A 3VTKA 1NMZA 3J81k 1P61B 3EASA 3PUZA 1UJ2A 1S1CA 2GK6A 4D0GA 4PQRA
chains in the Genus database with same CATH superfamily
2LR0A 1KYWA 4GOLD 2AKAB 1FTSA 3CR8A 3BMNA 3ZIAA 3Q8WA 4BJ5A 5J2UB 1JFFA 3BXXA 3RIXA 1TT5B 1XUOA 3D7NA 4XARA 1M2JA 2VNSA 3NAQA 4LK3A 2OCPA 4EHFA 1EXWA 4E3WA 1Z73A 3AINA 3KHSA 1LSOA 2ZI5A 4U00A 4LYGA 3BXZA 1BS2A 2OFOA 3I4FA 3JATA 4NFSA 1QIIA 2IHZA 2XNSA 5LZ7A 3SSOA 3T1OA 4DXDA 4ZCTA 1ULZA 4ND5A 5LQUA 5FPHA 5K8UA 2HTFA 2VYVA 3I92A 4N5DA 3AGPA 3E3MA 4GVXA 2B4RO 4YP9A 1HG1A 1OX5A 1KDPA 1SEPA 4W6QA 1NHGA 2NPFA 3FDFA 3B1WA 2VDOB 4QOFA 4ER5A 1XYVA 4JL8A 3UFXA 5I7UA 3GD5A 4Z9YA 3IPLA 4GGOA 2W93A 2RHLA 1P4JA 2A0WA 1A2KC 1MC4A 3NBYC 3Q10A 2OXFA 4D43A 4ZOCA 2QV7A 4DLYA 2QNIA 1BX0A 1UWVA 2DHRA 3OE5A 2VDWA 4J0JA 3EA0A 1WSWA 4OU4A 3SDSA 3SDZA 4PS0A 3SX2A 9MHTA 5GJVC 3C3MA 3TL3A 4W8GA 3IEIA 4UFNA 4YLEA 1YE5A 4B3CA 1G5TA 2DG2A 1P0FA 3CLUD 3I2JA 5BN3A 3JQ8B 3WQQA 2J9YB 4TYWA 2GPTA 4PIVA 3R3HA 1AHHA 1Y3DE 2O0MA 1YFJA 4FGKA 4AT1A 3PIRA 1AB6A 4HEA1 1N5MA 1C9MA 2VBIA 2WYIA 1X14A 3MWYW 4MJ7A 2ZB4A 4HGPA 1U5CA 1L7NA 3BSFA 2OQVA 2W83A 3GJ8A 2FH5B 3AI2A 2A9OA 2B1IA 4UUPA 4TN1A 1NYTA 3FTDA 3UJAA 1V39A 3O0DA 3VR6D 2EBFX 4KR0A 1FFSA 2VXYA 1YASA 4HLNA 5DBGA 3BBPA 4RD0A 4MGIR 4TYMA 3HJNA 3TZLA 2B2NA 1C3EA 2VHZA 5B36A 1US8B 5FWAA 1JG1A 1U9IC 4RELA 1AQNA 3CVJA 3AJ9A 5TE9A 1XVAA 4AF6A 2ZWIA 1HMPA 2X1MA 1SKUA 1XQXA 4MV0A 3JARA 4UU7A 1MC5A 3AFGA 4U7GA 4IILA 3G1TA 5E1BA 4DA9A 4F2PA 1E6MA 2IEBA 3G0BA 3GHHA 1GRVA 1JB1A 2NTJA 2IU0A 1MGOA 3OQ6A 1NSFA 2PSDA 3BZUA 3ZV6A 3E3OA 1YZHA 3DO8A 3LGXA 3BKXA 2W11A 1SXJA 1XEFA 5LN1A 1F3OA 1V8FA 3PR1A 2XNDD 2I4OA 2WWGA 4F72A 2H1OA 3ZWPA 1SBYA 4EDHA 1NZJA 4HWPA 5EXDA 4F3KA 5MGNA 3LBFA 3F49S 3IUQA 4ALNA 3BMQB 4PQEA 4PYRA 4YIKA 2A5YB 3AKCA 1PQ4A 4K86A 3SZOA 1RC0A 1YF3A 1J99A 1Q1EA 4DILA 4YMTA 4UE2A 2CUKA 1H4SA 1HNZB 1M73E 4W5QA 4B4OA 1AS2A 3HFJA 3SCZA 1RM0A 1QGDA 3L1VA 4TWZA 4K6OA 1T8WA 4WUTA 1C9EA 1K9VF 1W19A 1JKJB 4Q1AA 5AJYA 4BO6A 3WNCA 4CLHA 4WCFC 4QLBA 4MVYA 1F4PA 2I2DA 1NNEA 1ZICA 4JXKA 1NV9A 2EWMA 4B3TB 3G2PA 4K88A 2YFKA 2WMNB 2MSLA 3A1TA 3ID6C 4WXHA 4ZVTA 1ZJJA 2ZUCA 2AYZA 4JEHA 4DIDA 1VMIA 2WJWA 1DRKA 4PVCA 4FNAA 1EESA 5B1SA 3W77A 3ZVKA 3MOIA 2OCAA 3JQ9C 1A7UA 2PGAA 5IJ0A 4UPEA 5C51B 2B4AA 1PZFA 1UC5B 2V1UA 5K3OA 4G0NA 1DHRA 4UEJA 4YJHB 2AVDA 3PX3A 1NC1A 1KGDA 1Q7BA 2WF8A 3A1NA 5FPPA 1CS0A 2XNKA 4JSRA 3SZUA 2P90A 1U5BA 5HE9A 1Q92A 1GDDA 3V2HA 3DHVA 3LKZA 4JJFA 2QZ9A 3GCZA 1IBRA 4I1UA 4UBMA 4ZV7A 5B5SA 4LHWA 4U6SA 1N9ZA 4UBJA 2LP4Y 4L1KA 2I55A 2AOTB 3RAJA 2WWXA 4EMUA 1AXEA 1XWFA 2H7XA 4NAVA 1PJTA 2LGJA 5FAXA 5BSKA 3ZEAA 3P2EA 2VJPA 4TM7A 5EIBD 4IVNA 3D3QA 4ZO9A 2GCIA 1MAUA 2DFLA 5TQ0B 4ZMBA 3K8QA 3D8UA 4FHGA 4QL3A 4EBFA 2GI4A 3HXMA 1NG1A 3U7JA 4D02A 4L85A 4BUZA 1CIPA 4KLCA 3ED1A 4P5DA 1RIFA 1WMBA 2H16A 5JBQA 2AWNA 1BWQA 1J9EA 4DFDA 1C7EA 1XZFA 4WESB 2BI4A 2QNRA 1BFDA 6Q21A 5LOVF 3W9SA 4LF5B 5BYJA 1L7QA 2Y93A 4U8HA 5DU2A 3SLGA 4LJ5A 3UAZA 3ZEIA 1O54A 2OCYC 4FHCA 2PQ6A 2QTTA 3G13A 4K40A 4PLGA 4UBIA 2FLVA 3PXEA 2XCRB 5CIWA 5CLQA 1ZNXA 1FW6A 1FTNA 1Y6ZA 3A6DA 4KBFA 2Z83A 4J7XA 2NVUA 5JH7A 4XSHA 4U7DA 3P9YA 4LVOA 4YCLA 2GMWA 4JMPA 4OY3A 4DWVA 3AY6A 1FSPA 2Q4EA 3Q7EA 2JD2A 1JS1X 3I1IA 3LM8A 1DARA 4HAZA 5EC8A 1DG1G 8ADHA 3ONNA 2ZYGA 4ZRDA 3KZNA 5JARA 1CZLA 2P79A 4ODIA 1JR3A 1ECFA 2A86A 3GEDA 2EJTA 1E0SA 4IDGA 5AHKA 1FPMA 3RS3A 4Q9JA 1Z38A 3U4DA 4D3DA 1U2SA 1P3DA 1DTWB 3ZHOA 4R7GA 2QD3A 2ZE7A 1W36B 1VE3A 1KORA 1GGVA 1H05A 1AS0A 2OSBA 1NX6A 2P1ZA 2YS7A 5H70A 2ZUUA 3SYMA 2Q0QA 4WKNA 1VKHA 2ZANA 2Q0XA 2FUKA 4LGVA 2CJXA 2DR2A 4UNQA 5JS8A 2YZKA 1I7SB 4X44A 4ZCPA 5D87A 1IY9A 1PN3A 3KVVA 3L4BC 4YQYA 4E5NA 2HYDA 3KKMA 4POOA 2FRVA 5A7FA 5A06A 5ILQA 1NVXQ 2Q9AA 2Z98A 4CFSA 4PSVA 1WOYA 2V5AA 1G21E 4N0QA 4W8OA 1NXWA 1I80A 1DBPA 1LV7A 1QCCA 2JIMA 3C24A 4B82A 3GARA 2ZREA 1HC7A 2YYSA 3O7WA 4B76A 4BNTA 2O8DB 4KN9S 3ULKA 2OB1A 2VHJA 4G4IA 3ROTA 3VJKA 2QLJA 3MWDB 3HA5A 4O5AA 4JT2A 4QAQA 3WJAA 3H1PA 3EZ2A 4BLTA 2ZROA 2AFHE 1WNFA 1MG5A 3KOYA 1F38A 3U3RA 1CJCA 4LJRA 2C95A 3QPBA 5EG5A 2Y0EA 5JJLA 2SICE 5A5VA 1YJBA 3A6FA 4LQCA 4D81A 1PKEA 1N9KA 4R84A 1J0CA 1BS9A 4XYBA 2JI8A 5ICFA 4P36A 4GI5A 3QHQA 3KQTA 2UYHA 4JDUA 4ZI5A 3R7BA 2OP1A 2YWJA 2GLUA 1UK9A 2R8OA 1L5NA 2YOGA 3E15A 3HV0A 3WB2A 1HXHA 2C7VA 3LCRA 4OX9B 3EXFB 2VSOA 4RA9B 1Z5ZA 4RM2A 4UTOA 1OHHD 3PQ2A 1USUA 4IUCS 2IZ7A 4MS1B 3IP8A 4N7MA 3UBTA 2AQKA 4OATA 2VXCA 2YWXA 3PT9A 4BMDA 1DC4A 1T4CB 3WJ7A 2FF5A 2ISSD 3J81A 1SBIA 4DSZA 3FGNA 1M2EA 1YZKA 2X40A 4YCAA 4ESHA 1A7AA 1QFYA 2IHJA 1JA9A 3NH6A 1GNRA 5JPDA 1LJ8A 2KBEA 1A7JA 1LLUA 2PT5A 4L3WA 1AO3A 4I9HA 1JEJA 3CUUA 4LJSA 9LDBA 4M1MA 2XKKA 1QGUB 5HZMA 1XT6A 3KYDB 4TRMA 4KDRA 1E3MA 2HF2A 3R5KA 2Q99A 3EGDA 3ZVNA 2ZJ3A 3K09A 4JA0A 5IARA 4LWPA 1KI8A 4NNPA 4FEEA 3COVA 3VPGA 5I3CA 5I7EA 4NBNA 2Q50A 1E2LA 1I13A 1X7GA 1G8HA 4K1XA 4D3FA 5BPHA 3KQHA 3UGKA 4RGBA 5IDWA 4F3RA 1ESDA 3VYRB 2O7QA 4DXAA 4IIGA 2CEKA 5JH7F 2OZKA 1CB7A 2CJWB 1N6HA 3GBVA 1M0SA 1TC2A 1WXFA 2FOXA 2NX2A 3AL3A 2W22A 1VJ5A 3BN3A 3MW8A 1ZNQO 5K3DA 4G56A 4JLNA 1H3FA 5ALTA 1XVLA 2X2PA 3B5EA 3B89A 3FPCA 1K5PA 1RI1A 3VTFA 4B33A 1Q1NA 3GRCA 4QDJA 4JP8A 1XD2B 3KQLA 1M1YA 5JTUA 1MA0A 1W2WB 3H16A 3DAGA 1NDHA 3L02A 4F4FA 5C80A 1CJUC 2XA2A 1VKNA 3TEFA 4P54A 1E8DA 4ZYWA 4RD2A 3M6VA 4ZQGA 1VCOA 3W5IA 4CF6A 3LKBA 5A4KA 1CFJA 1N6KA 4PZDA 1UJBA 5CX1A 1IBKB 1Z12A 2Y1GA 1TQHA 4N7RA 1MKYA 3M5DA 2QTGA 4Y6QA 3MS7A 1Y9JA 3PUVA 4KQEA 2PAAA 3U3KA 1X2EA 3DKPA 1NVUQ 4UNIA 5HKKD 1G2QA 4DM3A 5CIQA 5H81A 2VDMB 2BF4A 4B71A 3FYCA 4CLRA 2PRJA 2VCHA 1TK9A 1W0JA 4IV5A 1L1FA 5JMPA 3K0EA 3T06B 3TVYA 2DH5A 1E1YA 4FPXA 2B5VA 1TLTA 2A0KA 5D2CA 1XEXB 1JDSA 4RQBA 3ZK8A 3UIEA 5FDFA 4P58A 1YR2A 3HLKA 4CUKA 3SDBA 4H1WA 3T1HB 1AV7A 5AVRA 3SS7X 4XPZA 1FQKA 3T52A 2QDXA 1L4LA 3VNAA 5DT2A 4LWOA 1BE8A 5EZYF 4YX9A 4NENB 1E2GA 2EJUA 1CQXA 3HVHA 4HNSA 5LWQA 1UC9A 4EHNA 2HQ1A 3PD1A 1O95A 2KJQA 5JJCA 2HA2A 3W9UA 5HIMA 3V97A 3I2IA 4Z4HA 4RSHA 5IMSA 5GONA 4ARAA 2KBFA 1N34B 3TD9A 4CG3A 3A4YA 1E2NA 2B94A 4HAYA 3L6OO 4F60A 3T0GA 3FTFA 5CBPB 1NVEA 1NPYA 2JJ1A 4PY2A 2NO1A 2OQ2A 4V0ME 1TECE 1X7ZA 4XWKA 2CLHB 4NMLA 3RYHB 4BNDA 4EYGA 3M6AA 3JQDA 5LQNA 2FV8A 3TNJA 2Y0BA 4B3HA 2FP4A 1JG6A 3E3NA 1H8ED 3Q0EA 4JENA 4MUFA 2B1JA 4RDIA 4YP5A 4CMBA 2F2TA 2QVZX 3C8HA 3JSXA 4MW0A 5FP0A 1QGZA 3VVLA 3Q9LA 4BNUA 3NYQA 1NJ8A 2G72A 2ZBVA 3OG9A 1KAHA 5IVDA 1J39A 2DLDA 2FUG1 2QTCA 3VZQA 5LMCA 1L4NA 2HLDD 2Z9DA 4I1SA 1E1QD 1OYWA 2J3MA 3A58B 4AFNA 1U3DA 2PKRA 1LRLA 1W4BA 4H6XA 1IBMB 1ZWKA 1VDZA 2B6NA 3TZKA 2PJUA 1DE0A 3ONVA 5K0CA 3OLWA 4RMIA 2IXGA 3IAS1 3KPYA 1R66A 1TZMA 5CDTA 2IXBA 1YHYA 3QFRA 4FBLA 1KNQA 4UMFA 1XNRB 2I4TA 3EHEA 2GHIA 3RIEA 1K6JA 1GQQA 1TTTA 1J6UA 5GY7A 4RK0A 3B13B 3CE6A 8LDHA 5CR9A 5CFNA 3HXPA 1HNWB 4FZRA 4MI3A 4QEDA 1Z75A 4BNNA 1EJBA 4C0XA 1TPYA 1WQ4A 2IWRA 3WWCA 2GYUA 3TF5A 1HYGA 4LDRA 2IYYA 4Q9KA 3DQQA 3T7KA 4XQ9A 4TMKA 1L5YA 1TM7E 3C14C 2J09A 3KE8A 1F1BA 1HE5A 2L2QA 2WDZA 2YDXA 2XJ4A 3NH9A 1PQYA 4YRJA 2EW8A 2PZFA 3KUCA 4HDSB 4RKRA 3DW3X 4WN9B 4XUDA 1J8DA 2Q5QA 4N7BA 4GF5A 3ZWNA 1UH5A 4PLWA 3LX8A 2IDJA 3MPUA 5L3SA 3L06A 1LWNA 1MAWA 5I6DA 1CR2A 1X8XA 3W3ZB 3DBHB 5AR1A 1LJLA 4EPXA 4EUKA 3FVRA 1U63A 2RC6A 4OAPA 4AG5A 4JB8A 4NBLA 3DL7A 2BFCB 1ZUWA 3AY7A 3BE8A 3VISA 2MINB 2XUGA 3S99A 2C77A 2RJOA 2RAFA 1A5ZA 2ZIAA 4Q7LA 4RMJA 3R7NA 3RAPR 4RTQA 2CMGA 2QUBA 4ZMSA 4A6PA 4RTJA 4XX1A 3SC3A 3LC1O 2OPHA 2B8JA 4R2LA 3T7RA 2FPPB 2JLRA 2FFHA 2QN3A 2G04A 3PPXA 1KS9A 3Q8XB 4BP3A 2PUTA 5FL7D 2AG8A 1QRUA 2JLYA 2NUBA 4C0WA 2JLAA 3SXJA 1Z29A 4KOEC 2EFCB 4GP9A 5KX5A 2FJUA 5AK6A 3RYIB 3ZDXB 1XMPA 1NTRA 3GAFA 5K0BA 4YV1A 3EPKA 5CH5A 1S7GA 1W73A 2PG3A 2XRYA 4DMLA 4M9ZA 2C2GA 1W7AA 3F5FA 1MFPA 2AYYA 4IIEA 4UTXA 5SV2A 3ZN2A 4BJ1A 3OFKA 3ZIUA 2FLKA 3KJFA 5KYXB 3GUYA 3X43A 5M5BA 4WY5A 5T67A 4AVYA 3GXBA 1EUDB 1K3UB 5GVSA 1FS5A 2DGDA 2EGHA 3MWEA 5K51A 4C07A 3PITA 1YR1A 3P4UA 3DVAB 4L8FA 4CR7A 3U37A 3BD7A 4F86A 3CKLA 4DRYA 4FNGA 1W30A 3CJRA 1VJDA 2Q6KA 5JSFA 5IVHA 1D0SA 3L4KA 4ZPJA 3MG9A 3PFWO 1GCIA 1Z33A 4KXYA 4R16A 5ALLA 5K6TA 3JQAD 1P1BA 4MJ3A 4Z99A 2MR5A 1AKTA 1I5EA 1JU3A 3AP3A 3LUAA 1MENA 2QE6A 1B73A 4F92B 1RYBA 3U13A 3D9QX 4JUFA 3AV0B 2OLJA 4A0RA 5CFRA 3IMFA 5I9BA 8GPBA 2W00A 5K0SA 1NRJB 4MROA 2UVPB 2MDTA 3GMTA 4OM7A 4AZWA 4RO0A 4QVGA 2FSPA 2HIMA 2QF7A 2EYQA 4QJBA 3PUJA 5HDBB 5C4MA 4XM0A 3ZCQA 4C0BA 1YJQA 2NO4A 5BW5A 1XLTA 5DN6D 2XT6A 3N05A 4UATA 3AEKB 2OXCA 5EGNA 3ZS9A 4BRSA 4E5PA 2ZSIA 1BQ3A 2O5VA 4EM6A 1E3SA 1NC3A 3THSA 4XH9B 1CY2A 1R0KA 3KT8A 4KR9A 4B6EA 3KFLA 3SVLA 3I04A 4TKLA 4DM7A 4CM8B 5IKMA 2JH3A 4X95A 3WAJA 4B48A 1IG3A 3N70A 4YAEA 2V3WA 3O9MA 4CM9A 2WI8A 3C3CA 4ARUA 3PUHA 1EINA 4UDNA 2V65A 5CAEB 3WGHA 3R44A 4BFYA 3WDKA 3MLAA 1F8FA 4PAGA 1G0OA 2Q3JA 2AMYA 4DVJA 1JHXA 3NHRA 2TRSB 2WHEA 2XIQA 1Z15A 2CXUA 3FKQA 2YWDA 3H1AA 3OETA 5I51A 4CM5A 3VZCA 4U4AA 3GUZA 5DE3A 2AN4A 1UDAA 2HIAA 1VKZA 4KQ2A 1WPGA 5DHPA 3ZHRA 2DTXA 1JTFA 2RGBA 3DEKA 1R0BA 3FXAA 5C0OE 4ZYVA 2WZQA 1J0DA 3AM3A 3H4MA 2Y27A 2QTMA 5L51A 2BKAA 2VNHA 4J2HA 5DLPA 3ROXA 3TQFA 1W36C 1CF4A 1VPDA 3OO1A 3SSNA 3AKDA 4Y2GA 2WTEA 3RFVA 1OXUA 3E23A 4INOA 5IUJC 1CKEA 3L6EA 3EH2A 3DXZA 1NR7A 5IZ4A 4Z86A 3CVYA 2BRUC 3A1DA 4N3BA 1DXOA 2ADOA 2IUFA 1OJ7A 3LUDA 4GT1A 1DKMA 4WLOA 1XJ0A 2IUEA 4IZ6A 5CVCA 3WIBA 4EIWA 2IS1A 4JYAB 2EHDA 3MHTA 4FGSA 2A1TS 1AK9A 2IZ1A 3BX1A 3IQGX 1I7LA 4HB3A 2YQZA 4KGVA 4OLHA 4KC0A 4TQAA 3R8XA 3HO8A 4BMCA 2RHOA 3OBIA 3M5CA 4ZCLA 1YVDA 1L5ZA 4BNLA 4IH4A 1N2JA 5K45A 4HP8A 1O1YA 4NI5A 1S89A 3O73A 3SE7A 2P35A 5KWVA 4W5RA 1GLVA 1B15A 3AY3A 3RAGA 2GCPA 3SD7A 4C0QC 3UJ6A 2XLCA 3UOWA 2GBPA 1WTCA 2IXDA 1M7HA 1N2CB 1KKLA 2Q7OE 3VHXA 1RYEA 2GA8A 3PJEA 1LC0A 4TLMB 1T8UA 4FI3C 3ZGLA 2WWHA 2CF5A 4I5IA 2H3HA 1XL1A 3NHFA 1KHHA 3U7QA 3WRVA 3U1BA 1MO6A 5K3AA 4BVAA 2O8NA 3CJQA 1G21A 1N6RA 3GQBB 3MT0A 3HB7A 5SYMA 3UV7A 2TMDA 3CLRC 5FNVF 2FF7A 2II6A 3NBFA 3NCHA 2CWDA 1M8FA 1PR0A 2QLNA 4A6EA 1CDZA 1BU8A 1VG8A 2YNMD 4GH5A 2A3NA 3W2FA 2Z57A 2W0SA 1QQAA 2HU7A 2CNKA 3K31A 1AZLA 2WWIA 5EVCA 3SY8A 4A1FA 2HT1A 2G0TA 3H7AA 1QP4A 3I2GA 2VJYA 3QY9A 3U48A 4OSEA 4KXWA 2E85A 2W70A 4BKOA 3C70A 4JJKA 2AFHA 3EC1A 4PM4A 4QDXA 1RXIA 4QBKA 4BLOA 3ZOKA 2F3PA 2YZNA 2N75A 3PQDA 5LDDC 1N1DA 4XJSA 4G23A 3TRDA 4EI9A 2PUFA 3IAHA 2ABWA 1QUEA 2DULA 3ZBQA 4LXHA 1T4GA 2A1UA 3OIDA 2BE7A 4FX5A 4A8JA 1D09A 4HRYA 5HS6A 4OP1A 1RD4A 3CF0A 1N7HA 3GGDA 1GLGA 4TV8F 2WIFA 5FO0A 5JSYA 3W5UA 4WADA 4CR8A 1KJIA 1DXYA 1VHDA 5JD6A 1JN0A 2ZVJA 4JBIA 3QVSA 4JHLA 1IN6A 3DD1A 4MSUA 3O8QB 1CUCA 4ID9A 1KDOA 4LRTB 4Y9UA 3WLQA 3D8BA 1P17A 1NXPA 2ORVA 4L6CA 2C4VA 1JIXA 3EZGA 3M5WA 4NPAA 1WXHA 1RYDA 4HPXB 3RVBA 3ORSA 3V46A 5P21A 1DKOA 4HH1A 2I9KA 3DVSX 4K6MA 2QROA 3FNIA 3ISJA 1C7IA 3DA8A 3OWOA 4XD2A 5U1PA 3LPLA 3ZZNA 1M74A 2PVPA 4HQNA 3JAWA 3CLUC 3PFNA 4D0RA 4ND2A 3OFVA 5L9AA 1QOQB 3PXAA 2R1TA 3VXKA 1ZO8A 1YB5A 3NHUA 4DY4A 2FEMA 4Z1MD 3CF4G 5KB3A 4EQZA 3LIPA 2XUIA 4MRAA 1OFIA 1CYDA 1P4GA 3BCHA 3EODA 1PL8A 2P2GA 4MVJE 1EGVB 4DAEA 1KI6B 4PYJA 5BQ3A 3JRWA 3AB8A 4YROA 3BS4A 1J8FA 1K7YA 3K0KA 3LPDA 2NO6A 3FPSA 1IHXA 1C1XB 2XMBA 2G1UA 4CKBB 1IZZA 3P9PA 1BZYA 3M70A 4URYR 1BHO1 3Q8KA 1VSVA 3IVRA 5DHFA 1L7AA 4IDHA 4IXMA 3ZD6A 4MVXA 3TXXA 3SJ7A 1UJ6A 3DNMA 1TO2E 3JQFC 4JS0A 4X6LA 1FDSA 5KEIA 2G36A 2Y0DA 2R79A 2QPLA 3KP1A 4DBLE 4I8IA 1W4CA 3T9EA 2GBGA 3SOPA 1LB1B 2A35A 4NG4A 2QRVA 3PL5A 2Z8YM 5AI4A 1QF6A 5AIBA 3RGGA 2GN6A 3U7IA 1OB2A 4MCJA 2JGAA 4QYMA 3MZ0A 1E7WA 3ON5A 4KSYA 4Y98A 1P4HA 4PYOA 4PV7A 4JA2A 1I2MA 3TQIA 3ND7A 3NGLA 4HN4B 5GVRA 3TSZA 1D6NA 3QW2A 3AK4A 4P7GA 5BWOA 3ZQUA 3K6RA 4ZDWA 2Q8PA 2V6MA 1DOZA 2E4WA 3EVNA 5NULA 3BMOB 3PTZA 2HOQA 3WWDA 4INJA 1JI0A 1N3LA 5EWJB 3H11A 4ZYXA 2NNLD 2BCJQ 5IKOA 2W6IA 5BV0A 1NGSA 4QDKA 4ZVKA 1QR2A 2D6FA 4LPSA 2VUSA 4QNMA 3RIMA 2VBCA 4KV9A 1I6MA 3SEQA 2FDCA 4DXHA 2VP2A 3TSCA 1ULTA 3L84A 4JLUA 1PJRA 5AKJA 3EFOB 5FQNA 2M6SA 3RVQA 3HVRA 2EDAA 3HPRA 3SLRA 4DUZB 3C48A 4MZDA 2P6UA 5I5GA 2MWMA 2ZS9A 1L3IA 2LKCA 3EWIA 2DLNA 3EFBA 2O1XA 3I4LA 2IELA 2VPQA 3D0RA 1EDOA 4JBXA 4XZ3A 5I9MA 3FOZA 1FDTA 3DTYA 3RYFA 1A9OA 1E99A 1WOMA 4YAKA 4W7SA 4TWAA 4AJ2A 2VHQA 4G01B 4P4TA 3NOXA 5B2ZA 3L0IB 1YS6A 3LRPA 4X97A 3VVCA 4TKUA 4LGMA 1II8A 2BGTA 3BJRA 5EFOA 3PQ5A 5G0UA 4AF7A 5JYBA 4ZTZB 4I5GA 3PPIA 2B7CA 1T91A 3FPAA 4PYNA 4DSAA 5AVSA 1C3XA 5F5XA 1Y7LA 4ZEWA 5IJXA 5LBIA 1NVGA 2FQXA 2R1UA 1UANA 2NQ8A 1NX9A 1XMVA 2NUAA 4FNMA 4V0MA 3FHTA 2FN3A 2V4ZA 1YH3A 4CQMA 1AA6A 3TLYA 1H8HA 2QPTA 2JLCA 1ACLA 4CTKA 2XZLA 4YJFB 2R7LA 4D6YA 5EIBC 1P9RA 1VC2A 2DWUA 3D7LA 4UE6A 5C8YB 1A50B 1N0IA 4H16A 4GNKA 1SVUA 4OA5A 4U5QA 4C78A 1WE2A 1ZW1A 2PUWA 1KAOA 1VSUA 2EAUA 4MA5A 1GCOA 1MT0A 2UZ0A 3T5GA 5IJWA 3OVMA 1GA6A 1X0VA 2Q4RA 3PHLA 3K6JA 2EARA 5DX0A 3CH5A 1PGJA 3DR3A 5EI5A 2E21A 4BFVA 2GEKA 2LCFA 2EC5A 2XQIA 3LH5A 4LV5B 5DWDA 3SKXA 3UC9A 4A82A 2XCQA 5G3ZA 3EDQA 5B3JA 3H1EA 4AUEA 4N48A 2AJ8A 2WF6A 3EOBI 2V59A 1OU4A 1LS1A 3K0CC 4OXXA 3GJQA 5IXSA 4OGFA 3RHTA 5FADA 2ZXEA 4KLRA 2BFPA 4CUZA 2IS4A 4CMHA 3DNFA 4HAXA 3WL3A 2J5BA 1P8JA 3H2YA 1MB0A 2ZBEA 4Z4IA 2JCGA 3IVGA 2DB3A 2O2DA 1WQ3A 3EXAA 3UMVA 1T6NA 3EWAA 2Q45A 3EBLA 2PX0A 4OV6B 3MCZA 3UHJA 4J03A 1IU9A 4GM0A 5GJBA 2OB2A 2FMKA 2GB4A 4QG3A 4FHDA 1XK7A 4DDVA 3L0YA 1PV1A 1YJAA 4IIXA 2RMKA 5CDYA 4BBAA 2PLNA 4HNUA 4GKKB 5B12A 1U3FA 2FI1A 1E2DA 1EZ1A 3F9CA 4YRCA 1JLLA 2QI9C 4TVKA 3T0FA 4AYXA 5BV8A 4Y9DA 3KQSA 2Q8QA 2QN6A 1DRVA 2JJYA 3L7DA 4MUKA 3GLGB 3A7EA 2PBRA 3KKPA 2CDRA 3O3CA 4N8SA 2PRKA 3R77A 2JLXA 3P8ZA 1JW9B 5IBCA 4C7MA 4JB3A 4GM1A 4MPDA 5AJHA 5L3QA 5BWBA 2FMHA 721PA 1JBKA 1XU9A 2E6KA 2NV2B 121PA 5JI3E 2WIGA 1L4MA 4M9UA 3W06A 3T5AA 1I4DD 4DV4B 3CYFA 2AXEA 4E4TA 4TVSA 5BWNA 4GLOA 5REQA 1PEDA 1EEHA 2WA2A 5CB4F 1SIBE 2W5UA 3KT3A 1WIWA 5TQJA 1T2AA 1LW6E 1EJ0A 1I2ZA 1JQLB 2P30A 3IPXA 3UMFA 4YR9A 1TF2A 3P96A 1NTOA 2W4MA 3EXHA 3HJFA 3EIUA 3OH8A 4XX0A 5HQTA 4URFA 2WJ3A 4QT0A 3AERA 4EZEA 3DMDA 5EA2A 2AE2A 2FPLA 2E5FA 5CXSA 2COKA 3LQ2A 1IEXA 2AN3A 2W58A 2D8MA 2ENUA 2A58A 1BXGA 2FJPA 4RPGA 3F5QA 3K5WA 1E6EA 5AKZA 4PPGA 1V6SA 5CK5A 1N0HA 1RACA 5EEHA 1H2YA 1Z39A 3V00A 2YIMA 3STXA 2V74B 3LSTA 2HQSA 2ZUBA 1YTLA 1CF9A 1TQ2A 1VL2A 4XGQA 2A14A 4XTCS 1T4MA 4HJXA 2XIJA 3SE0A 1D2NA 1HY3A 3ECSA 3Q9SA 4L7VA 3LUPA 4Q9AA 1LI4A 3GRKA 4COOA 2HH9A 3GG2A 1VG1A 2BVNA 5KSYA 3VNRA 4AY4A 3T5DA 3MXOA 4LSZA 1VL5A 2V7VA 2JAHA 4MAMA 4C7BA 1DEKA 3LG2A 2PUAA 2BDEA 2PH1A 2WPNA 1RRVA 3C5CA 4OSOA 4A0SA 2VL7A 3HEBA 1E9EA 2GZAA 2KSQA 3M49A 4R31A 3U9TA 1BO6A 5JROA 3A32A 2JJ8A 1ZA1A 3EYWA 4V0LA 3RE1A 3LOPA 1ZIXA 3AFHA 4P1ZA 1RYHA 3FF1A 3NTOA 3NIGB 5D6NA 2H4JA 5EWLA 3N2YA 3V48A 1Y98A 1QX4A 2FEKA 4Q05A 4CDNA 1C9DB 2JIPA 4GRAA 4DSNA 3C7AA 1JX6A 2ZB3A 3FLAA 4MGYR 1X9HA 1Y3CE 2J9RA 4NPCA 1PS8A 5ERGB 5JPIA 4IDFA 1ODCA 4M55A 4EHBA 1J9GA 1TU4A 4E6PA 3MJEA 4TLLB 4D9GA 1G98A 1XDSA 1A9XA 2P6RA 3CC8A 3QV1A 4PX5A 3WBKA 1WXGA 3AP1A 4FWTA 5AVTA 2B8TA 1ST3A 4OXRA 3GNLA 5HUQA 1PZXA 1S3FA 1O5OA 2W2XA 3E82A 1OBOA 4LOHA 3WHIA 4E5YA 1TCVA 1YJXA 3HLTA 3MBOA 4Y0AA 2DUJA 1UQTA 2ZIFA 3OOYA 5DTEA 1P5FA 5CTAA 3W3AH 2QQ0A 1KJ9A 4BTEA 1ZD1A 1NKSA 2R87A 3TR5A 2ZUFA 5IAGA 2QZJA 3UUGA 2ZYWX 1W93A 3NOVA 5ECYA 3FVWA 5HF8A 3GGSA 2WLSA 2A1IA 2DR3A 4IO1A 4EY5A 5ALVA 2GRJA 1ZIYA 2DPYA 3A6KA 1XZHA 1L8AA 2P3LA 3FSGD 1L5GB 1Y4AE 1JQ3A 1N4DA 3WIVA 4ZI7B 5BW6B 2WWWA 1RYMA 1BDHA 4G0OA 5K8TA 4RSMA 1NOKA 1ZHFA 3A9WA 1E2FA 2PRYA 3B1KA 2QZPA 3IVCA 1YWGO 4L2IA 2CEAA 4ND3A 4OJTA 4Y2XA 5BWCA 2CFSA 1D1SA 3BRCA 4P5EA 5DRTA 1TVKA 4J0QA 4UTVA 3WIDA 3PDCA 5KTMA 3GPCA 1J23A 1U3UA 1YQXA 2KLHA 3QY0A 5BQFA 3MFYA 4JSTA 2NVBA 1LPBB 3GJ0A 3L6UA 1X13A 4KQJA 2KX7A 5I47A 3U3ZA 2ATIA 4E70A 3KV1A 3T9AA 2EL9A 3E05A 2C2YA 3WDLA 1L7XA 3BBLA 4KQKA 1Y8QA 4KE7A 4N5MA 1RM5A 2ZQYA 4QARA 2BELA 5G0SA 1Z2CA 3ZNNA 4IJWA 5JZVA 5B37A 5L3ZA 3HKDB 1VIVA 2UYGA 3TSOA 5KSPA 1ABBA 3BZBA 2OO5C 4OREX 3N8NA 2E5WA 3O1LA 1ZRHA 2IODA 2J6IA 3HDGA 3B7WA 2O5EA 3N8HA 1P1JA 4X63A 1PTKA 2IXFA 2OV6A 3OESA 3F8WA 4CFYA 1U90A 4XEHA 3PDUA 4X85A 1XTIA 4MS3A 4QBHA 2W8ZA 2QTBA 1ZC3A 3KWFA 4FW9A 3LVBA 2P3QA 3I39X 1AF4A 4KKVA 4QOGA 3KOOA 4YACA 3REQB 3EQ6A 2Q6IA 3S55A 4BAUA 5JMWA 3WFIA 3K5PA 4BP8A 2BMAA 3HKBB 1YJCA 1EFUA 2QZSA 4PAOA 4DW8A 3WJ1A 1Y8ZA 3KJIA 2J07A 2H4FA 3OE7A 1Y3BE 1JQKA 4GPIB 4F9GA 2DWPA 3UN1A 4R69A 2XWJI 1HYQA 1Y6QA 4G0MA 3TB6A 3EZFA 5JAPA 2C82A 1E1CB 1F6BA 5GIOE 4FFNA 1A1SA 5DI3B 1E6LA 1ULSA 3O8RA 2ZQ5A 3B3AA 1E9VA 3CA8A 3L07A 5TGDA 3ZW7A 3GWZA 2J0EA 1ISGA 4BDTA 1PZMA 4RF2A 1QTRA 4UEQA 5AMXA 3NTQA 4TXJA 4ZZ2A 4AJKA 1DEHA 2ZRNA 3I05A 3DKIA 3KB1A 3B38A 3TSWA 5BSRA 3G8AA 3PS9A 3L8GA 4EFKA 3BIWA 3T99A 5EJFA 3TQTA 4DV1B 1KFCB 1LJUA 1G4AE 3ESCA 4EPWA 2ZBGA 3IILA 4IOMA 2VZEA 3IT3A 3FFWA 4NICA 5DZSA 5INTA 1KJQA 3DFKA 1RKQA 3QKUA 4AZ0A 1Z2EA 3W04A 1RNLA 2Q2NA 2ZDGA 2K2QB 3AHFA 4GMHA 4JHXA 4MUAA 1K66A 3RSLA 5I9NA 5HNKA 4LDPA 4P98A 5FBZA 4K9DA 2ANBA 4L3OA 4A16A 5BVHA 4BB9A 1P31A 1L8XA 4DA6A 1RXVA 1Y9EA 4AJHA 3DFZA 1ZWLA 3GFRA 4KTVE 4HNTA 3HM2A 4EVRA 2I2AA 3PJRA 4YRFA 3WBJA 3MFQA 4OLBA 1MEJA 4XFJA 1A9RA 5D7NA 1T2FA 4Q1FA 3A6GA 4YAUA 1FRQA 2C5EA 2GN9A 4FZJA 4CKWB 1AGRA 1G7TA 1JYEA 3HCAA 4CIVA 4CL8A 2DERA 1TCUA 2J4CA 3GD7A 3WHKA 3INRA 2PYIA 4KACA 1TAGA 4H17A 3RRJA 1SO8A 5M29A 1U0OC 4Q9NA 1NVTA 2D5CA 3OD5A 2RHTA 3L4EA 3R41A 4OUDB 3GRRA 2R62A 3I73A 1UPFA 5F78A 3FMVA 2AEFA 1XZKA 2CC2A 2H3EA 2ZLBA 3BQ9A 4H3SA 3EZXA 5DGCA 3GVCA 5T41A 1HNXB 5LP6A 1R8XA 3IODA 3PWTA 4N03A 2VF8A 4B83A 1L1RA 4P4SB 2J0SA 3P9XA 1ZAYA 3I52A 1SMKA 3GLFB 5EJ5A 4CEHB 1G5FA 2F17A 3SJCA 2Q3HA 1YB2A 2I3DA 4MR9B 4MV4A 3K0FB 5LB2A 4CT0A 2PV7A 5EE1A 3VPBA 1J25A 3D64A 1AT1A 1RQ7A 2EVWX 3RTEA 3KIPA 1T9DA 2EFEB 4KFUA 4UAJA 1P44A 3PSHA 4KOAA 1E2QA 5AXCA 3RCBA 4A0GA 4G9BA 1KEWA 3K1AB 5SZHB 5B30A 2NU8B 1WS6A 3NHLA 4C4OA 5FWXA 2VT3A 5BRNA 5FH9A 4D4JA 1P2DA 4WVFA 1KYYA 4XYMA 4KAAA 1E8NA 3RV3A 5KKCA 1TJYA 2NO5A 2XUKA 1W88B 5IDYA 1EWTA 1NT2A 5A4FS 4JBGA 4LC1A 2E6UX 3LX4A 5J59A 2PZGA 5EHGA 3TMKA 4EG0A 3BYZA 2BGRA 2CJPA 2ZIXB 2RGAA 4ZD6A