5CK4A

Signal recognition particle receptor srb-gdp from chaetomium thermophilum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
300
structure length
214
Chain Sequence
TTLPSVLLIGPSGAGKTALLTLFERTSYKVDLDAAGATARKFLLIDTPGHPKLRGTTLQHLLNPSPSLTIIPYKSKLKAVIFLLDAAALADSDGDYLSQTASYLYDVLLSLQKRFHSRKNSRAPSSIPVLIAANKQDLFTAVPASLVKSRLEHELGRIRKTRQKGEGWLGAVGSKEFKFEEMMEFDMEVEVMGGNVIGDGPGAERWWRWIGERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative signal recognition particle protein
publication title Structure and Switch Cycle of SR beta as Ancestral Eukaryotic GTPase Associated with Secretory Membranes.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Signaling protein
total genus 76
structure length 214
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09439 SRPRB Signal recognition particle receptor beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ck4A00
3D8BA 1KOFA 3T1OA 5KPDA 3CLVA 3QEOA 2BMEA 1FX0A 2GCOA 2C8VA 2H57A 4LYFA 4NTZA 1NBME 4YLGA 3UK6A 1A1VA 2Q3FA 4X8OA 4ZDJA 3GQBA 1R0ZA 2J41A 4HDCA 2UZ3A 4LJ8A 2O8EA 4NU0A 4BGDA 4HSEA 4OI4A 3Q8XB 1Y3AA 3G0HA 3QENA 3ZQJA 2RB4A 3HP1A 2V7QA 3HU2A 3EW9A 1EFCA 3F0TA 3GLGE 4RKEA 2EFDB 4I1UA 5FL7A 1W36B 4JMPA 2ZETA 5DI9A 5EP4A 3A4NA 1S2MA 1A7JA 2VP2A 1G3MA 1JXMA 3W3AA 4LOAA 5D3MA 3B1WA 4IW3B 2EFEB 2P6UA 3HR8A 1X1SA 4BEJA 1D2EA 1ZAKA 1DAFA 1Q1ZA 3IPYA 5JWRA 4PSAA 3L0SA 4D2IA 2IYSA 3OZXA 2ZE6A 3ZZUA 3U7HB 3EC1A 4TT3A 2JLVA 4JJKA 3B60A 3PXGA 1ZW6A 3BOSA 3TR5A 2RKOA 3A6PC 2HF9A 3RDPA 1BKDR 3AB3A 2AK3A 4EUNA 1F48A 4TMKA 1Z0AA 4IDQA 2DFNA 1W36D 4JSTA 3DPUA 3Q85A 2O8DA 4C0AC 1Z0KA 3QKSA 3MJRA 1XCGB 3A8TA 4AKHA 1XEXA 4OJQA 1NLYA 1BMFD 1JI0A 2WJIA 3CM0A 3SJAA 1GZSA 2D4HA 2FF7A 5CYOA 5GJCA 4M1KA 1MH1A 4URUR 1SVLA 4ASUD 4FD2A 5E7IA 5E95A 3T1VA 1W5TA 2ZPTX 1KAGA 1HURA 2VP9A 4Q4JB 5FOVA 5GJVC 3I5XA 4MITA 2K5UA 5HR5A 1E2PA 1R4AA 1SVKA 2J46A 4F4IA 4D4JA 1UKVY 4FXPA 4JL5A 4O2LA 1H8HD 3QI2A 4BPBA 2NZ8A 3T15A 3TQFA 2WM9B 2CHGA 3FFBA 4DDUA 1HE8B 5J4YA 1P9RA 1XZQA 1E0SA 5FTNA 3SS8A 2XJ9A 1XFAA 4A0GA 3C5CA 1NG9A 2XNDD 1XZPA 3K1JA 3D6TB 3EZ7A 3WP0A 2GBLC 1ZM3A 2H16A 2B8TA 3CB4A 2IK8A 4DIDA 2F3RA 1TL7C 5DHFA 5EP1A 3SBDA 3KQLA 4DUGD 2GVZC 4TZ0A 2KBFA 3DVLA 1SQ5A 4URYR 5FOWA 1FTSA 4QGHA 3SQXA 4DT1B 1G3QA 2IYZA 2WPDD 2VSOA 3FOZA 3SZRA 5C1BA 4P31A 1ZNWA 3O8BA 1HT1E 1N2CE 1S0UA 3KB2A 1AKYA 1G3IA 5DYIA 4V0KA 2PZGA 1DEKA 1AZTA 3P4XA 5IF9A 2SHKA 5LBIA 4V03A 4NCHA 2GEVA 3LRPA 4RD2A 4PTLA 1BYIA 5JHGB 2R8RA 3K9LA 1Q3TA 4PX9A 3K0CC 1KY3A 1ZBDA 4YDSA 2ZAMA 3NDPA 4BWYA 2Z4SA 4Q1EA 1P5ZB 1LS6A 5L8VA 2ZI7A 4BZQA 4UXHA 5C46F 1GKIA 1UDWA 2J3EA 4GZMA 4IXMA 3WNBA 2PBRA 2CHQA 4PQRA 1Z6TA 4MYCA 2P65A 3EIHA 4ARZB 1MKYA 1WE2A 2IUTA 3FTQA 2TMKA 2GEDA 5L3QB 5EP3A 4OQFA 1J2JA 2CLSA 3SFZA 1W0KD 2GESA 2IA5A 2C77A 3MWYW 4JLDA 1P60A 5A4JA 1G8FA 2F1RA 2XOKD 2ZRCA 4EDHA 1OSNA 3QKRB 2GF0A 4WBSA 3OEED 2AXNA 1VG0B 1XXHA 4LJYA 2RAPA 1G16A 4EPTA 3KQHA 4JBYA 1M7GA 1X86B 2IUSA 2GAOA 1VCNA 4V0MA 2REOA 3W8NA 3BB3A 1EFUA 5JCZA 1KO5A 4K46A 2C99A 4JVNA 4I4LA 4Q9LA 3CBQA 5EZ6B 1EG7A 1JR3E 1VTKA 1FQKA 4A6XA 4DSUA 5AJZA 2H17A 1DARA 2ZE7A 4Q1CA 1SKQA 4NKRA 2O8BA 1Z0JA 4C0SA 1OH7A 1KDTA 1KJYA 2DFLA 3TK1A 4IVQA 3GLGB 4D0GA 5TXGA 4B2IA 1L8QA 4Q03A 3CPHA 4XVQA 3TUJC 2VP4A 5H8WA 1IHUA 1NSFA 3Q9LA 3GJ3A 1Z8FA 4TLDA 2JDIA 5JBQA 3HPQA 1AK2A 2OFXA 2I1QA 5FPTA 3WBJA 5KU1A 4QKQA 4OQNA 3RAPR 1JNYA 3FWYA 4DKXA 1II8B 3W6NA 1OB5A 2IHYA 4U00A 4HZIA 1WB9A 1CP2A 3MG9A 4B3CA 3AP1A 1OXSC 4GI7A 3CX7A 1DOAA 3KKPA 4JJZA 1NVXQ 1Z6AA 4C0BA 1M2OB 3I8XA 1N6IA 2C96A 1XJ0A 1JBKA 4FCWA 4IVPA 4JBXA 4NYIQ 1LS1A 3BD9A 4PHHA 1YZQA 1KSGA 2ODWA 3EZFA 3PEVA 1W0JD 5LDDC 2ZYWX 4LYAA 2QSZA 2ZR0A 3FMPB 1SXJA 2AX4A 2D2EA 1ZUIA 1IAQA 3OFND 2C2HA 4O2RA 1X1RA 1CJKC 1TU3A 3ZD7A 4YXWA 5EJEA 3GJ5A 3K0EA 4NP6A 3QIAA 5JZVA 4ZPXA 5JS8A 2GZAA 2OCYC 3R7WB 2NMVA 3NBYC 4QRHA 4DEXA 5JEDA 1NY6A 4DEYA 4GOJA 4BRWA 2ZR9A 1XBTA 1YZGA 2R9VA 3Q5EA 4IVRA 2HYDA 4MUAA 3SE0A 4B33A 3RC8A 3PUYA 1VG8A 3OAAA 1DADA 2FSIA 1MABA 3AKYA 2IS6A 4L16A 1F2UB 3ZGXA 5C18A 2XITA 1ZM2A 1E2HA 1E2DA 3VAAA 1Q21A 2QRZA 3OESA 3VX4A 3AVOA 4HLDA 2GVDC 2WIAA 4JLKA 4OHWA 5F3WB 2EWVA 2WWWA 5B64A 4PZYA 1GIAA 1PJRA 4KFSA 3ZIAD 3OIYA 2IUUA 2JLRA 2IL1A 3K0AB 5BN5A 1E1QA 1Z08A 3KXIA 5DO9A 5SZHB 1DTSA 2HJGA 3WYAA 1IY0A 3C14C 4XWKA 1NLZA 3R9XA 3DOFA 4HZUA 2R65A 3HDTA 4PPGA 5TV2A 1X6VA 2C04A 4IDNA 5B57C 2IS1A 1UF9A 5EE1A 2JLQA 1CULC 3LNCA 2G0NA 3VU9B 1UM8A 4MGKR 5BW8A 4BFSA 4DLVA 1OHHD 1T0JB 2ZYVX 3A1TA 3IBYA 3TSWA 1FOEB 5CJPA 2BMDA 4Q66C 2JJ1D 4R98A 1N5LA 4MKFA 2W6IA 1T6NA 1XMVA 1QZXA 2ZQ5A 4FCVA 4PAMA 2L0XA 2NTYC 3SBEA 3VR5A 2FSHA 4NYJQ 1ZMXA 5EP2A 4A0RA 4RZ3A 4QNRA 1G4UR 1D9ZA 2C9YA 2QAGC 4B76A 2WSSD 4CRWB 1JQJC 1AGPA 3AV0B 3ZDQA 1I4DD 5FPSA 1HYQA 2XSZA 2G83A 4PQYA 1T5IA 4F4CA 3GLIA 2HLDA 3DOEA 3FKSA 1NRJB 3K8YA 2HT6A 4MUBA 1ZNZA 2KBEA 2O8FB 1G17A 1UAAA 2J1LA 1SVSA 2V8OA 3E2IA 1NJGA 3LO5A 4DLXA 3TNFA 3UG7A 5JRJA 2Q3MA 3B1YA 3EZ6A 3AM1A 3T1QA 1YKSA 2WJYA 1NN0A 4A82A 4XWOA 1Q22A 2PX3A 3QKTA 2RGNA 1P73A 2YWHA 4NMMA 4CIDA 1GITA 2W2TA 8OHMA 1FNMA 221PA 2OILA 4BLRA 4N3NA 2C9CA 2GXUA 3B1XA 3IILA 4LHWA 1MV5A 5HCNA 1EFRD 3QVVA 3CNOA 4WZBE 1L2TA 2FN4A 4EJSB 5AJVB 3I73A 1XNJA 3ECCA 1VCIA 1E2JA 3CF2A 5FUYA 4AG6A 4JVLA 2QT1A 2F3TA 1R0XA 3I1FA 1PZNA 3GP8A 4Q9HA 2ATXA 3U6BA 3N70A 1NVVR 1RC8A 4KSBA 4CF7A 5KDLA 4QM7A 1VIYA 2GNOA 2IS4A 5DYGA 5DNYB 4A36A 2QL6A 3KKQA 4C7OB 3BFVA 4JYBA 4Y0AA 4OHYA 2ZM5A 2ZRHA 5FL3A 4R7ZA 3REFA 5J5CA 3GPLA 1H65A 1T9HA 2G1KA 4OI0A 1WRBA 3BWDD 1JR3D 4B47A 2GJAA 2PJRA 2WBLC 5EZ5A 3LH5A 4ACAA 4N0DA 4I1OA 2OO7A 5JS7A 3DMNA 1OIWA 4ZO4A 2WAXA 1W47A 2R2AA 5A5GA 2QT0A 2YWGA 1VKJA 1VPLA 2ZRKA 2DFTA 2VHJA 4NCIA 2R6GA 2WWYA 2I1VB 2ODEA 2XTMA 5FPHA 3HU1A 4ZKEA 2WMOB 2JASA 1M74A 5F98A 2BBOA 3QUSA 2ZITA 2KE5A 4FMCB 4HUQB 3A1UA 4U5XA 1RYHA 4HI0E 5A0FA 1DO2A 3RYTC 2Q9BA 3I61A 3TW8B 4LCBA 4I81A 1YZKA 2CDNA 3PITA 1CTQA 3M4YA 2RGEA 1EK0A 5CYPA 1CKEA 4UJ5A 3NIBA 4A6PA 3UWKA 1AQYA 1U9IC 2JJ2D 2EFHB 3QY0A 1KK3A 1Z0IA 3PUWA 2YNMA 2QP3A 4ZCLA 2RGNC 1ZM9A 4RZXA 3T12A 1S8FA 2ZJ2A 3I3SR 3THYB 3U4QB 2OUKA 2UZIR 2VEDA 4C0JA 1GDDA 1U0LA 3KL4A 4Q9JA 3CH5A 4OK6A 1E9DA 4IOLA 4LJ5A 3PG5A 3E1SA 1NSTA 5TARA 4B34A 2JLZA 2O0KA 3AVQA 4CT4B 4TL7A 4M1TA 1OFTA 1GNQA 2J7PA 4LDJA 1W1WA 1SVMA 4JLOA 3C4JA 4Z1MD 4Q1FA 3PUVA 2JLWA 4RD6A 1NN3A 3QQ5A 3K09C 4TQUS 1E2NA 4Q7JB 3AF3A 1P7CA 4JLNA 3W5JA 5L3VA 3RC3A 4JZKA 3K70B 1GFIA 4DIEA 1OH8A 3U61B 5J4HA 2JGNA 2IYWA 1NIPA 4JLAA 5FTJA 1KSHA 2VQSA 1Z22A 3UWOA 4CEJA 4LBWA 4DLTA 3U3RA 1LFDB 2XEXA 2EYUA 2Z0MA 1Z63A 3QPUA 1W2GA 2WWGA 1KK0A 3RLFA 2REBA 5J4LA 3ZVNA 1JB1A 1E2EA 5EE3A 1XD9A 2ZVPX 3LX8A 3TIFA 1US8A 1QVRA 2XNSA 3JZMA 3NEYA 1NY5A 5J4KA 4KVAA 3FPAA 4M9XA 1TQ6A 3K70D 1I2MA 1NVUQ 3DEFA 2IXGA 4A1FA 4ZV4A 3QXXA 3R8FA 1XX6A 5LB4A 2CJWB 5FTLA 1UBFA 1OFIA 1M34E 5F9FA 1PLLA 4HATA 3IQXA 5BXQC 3FHOA 2W58A 4HLUA 4TWZA 5UKDA 3UG6A 4I1SA 3ZZ0A 1E6CA 3MCAA 1KTVA 3QXCA 4URZR 2IT1A 3BE4A 1A82A 3C7KA 5EXSA 1MO3A 1E9RA 3NH6A 4OQXA 2AFHE 5FI1B 2LKDA 2QE7D 3ND8A 2GJSA 1X8LA 3KJIA 3AKCA 4AC9A 2IBMA 2ZRLA 4M9SA 2FZ4A 1COWA 1PUJA 2VPPA 4KJZA 3U3MA 3D3QA 4GNKA 1LTQA 2ZSFA 2EYQA 3REGA 5KDDA 4Q4AB 1OKKA 4LJ6A 4II7A 1E9SA 1UADA 4GT1A 4PFSA 4FWIB 3B85A 4OQLA 2Z6VA 1GRNA 4YC7A 1SHKA 1MT0A 1W5SA 2G77B 2PMKA 2WICA 2QY9A 1FMJA 3BAFA 4V0LA 1G41A 1MO6A 4L9SA 4P4TA 1P62B 2JLSA 1TUEA 1WDTA 4RD3A 1XD2B 4TYWA 4V0NA 2OCPA 4DCTA 5IHPA 2F55A 1A5TA 4K81B 3EX7C 1OB2A 1KSFX 3L8ZA 4MKGA 4YMSA 4IFEA 1VIAA 4UNRA 3GLHE 2WV9A 2ZRAA 4DVGA 5JEEA 3A37A 1DBSA 1JECA 4RFSB 3V4RA 4E03A 4B43A 2W0SA 3PUXA 4DCNA 3LW8A 3BXZA 4Q21A 4OK5A 1QF9A 5FBRB 3QBVA 4KLNA 3CKLA 2ZRNA 2V54A 4WVFA 4RD1A 2MSDB 1T0HB 2GK6A 1Q3HA 2PLFA 3L0IB 3BERA 1YQTA 4QBFA 5DN6D 1QHGA 4AKGA 2C78A 4B3XA 1XMSA 1P72A 1QG4A 1WCV1 1XCPA 1LB1B 1SKYE 4Y0VA 2MSCB 1W4RA 3KTAA 2XXAB 3KX2A 3WNCA 2EFGA 2WZQA 2NPFA 1OF1A 2ZE5A 1XB2A 4DJTA 4G0NA 1UKZA 1EFHA 1Z83A 2VYFA 4B35A 4XTCS 1SGWA 2OM2A 1N5IA 2QSYA 3G82C 4C9BA 4NYMR 2RGDA 1RJ9A 4NZYA 4HLUC 4Q02A 1MR3F 2ZJ5A 4JL6A 3RSOA 1VDZA 5E3HA 4QGGA 5E7JA 1KHTA 1JJVA 2GBLA 3V00A 1W2HA 4LBZA 1BOFA 1TPZA 3LBNA 1E79D 1L4YA 4A0HA 1N0UA 2HCJB 4RKFA 4ESHA 3B78A 3KXLA 2FX3A 4P0TA 3EIEA 3NHAA 4LHYA 1JQLB 2EVWX 4JKIA 4Q5IA 4O0MA 2C03A 1KSJA 3V9PA 4TTQA 1OH6A 3AVTA 3CO5A 2BEJA 4KFUA 2XJ4A 3AF0A 1R5BA 2V1UA 1FX0B 2VL7A 5EE9A 2P6RA 121PA 2R6DA 3F3YA 2ORWA 4LHVA 2P67A 4A0FA 3TGPA 4PHGA 4A2WA 5L3SA 2HCBA 3O8CA 4LC1A 1ZYUA 2O8EB 3TSOA 1UFQA 2CVFA 1BMFA 2FE4A 3B9PA 4MKIA 1QHNA 3SJZA 4BE7B 4E22A 1MO5A 3A1SA 2WWIA 3K0CA 3KQNA 4D4KA 4GL2A 1KI1A 1KIMA 1R7RA 1OIVA 1KK2A 4X8MA 1OW3B 3ICEA 3DZ8A 5HKKD 2ZJ8A 1YVDA 1DAHA 2GCNA 4LV6A 1E94E 3MRSA 3EPJA 3AH8A 4PQFA 1DG1G 2C9OA 2IX3A 4PPNA 1UBGA 4WOPA 1PLJA 3QXSA 1JPNA 1X8KA 1TAGA 2B6HA 3LD9A 5D3MB 2Z5FA 2NOAA 1ZU4A 3OEHD 1H8HA 4WW0A 4MDFA 3QJYA 3RS2A 1SVIA 3AQ4A 3C5HA 2RH5A 1X3SA 1G6HA 2J5XA 2G6BA 2QZ4A 4KSCA 3U6KA 1WP9A 2XNDA 1DE0A 4ON9A 1RW4A 3B13B 4W5JA 4R9UC 4EFMA 2A5FA 2FU5C 3CR8A 3H2YA 4PC6A 1CR1A 4V02A 4B2PA 2J0QA 2IYVA 5IK2D 1UPTA 4KCGA 4KFRA 4EFLA 4TL9A 5FL7D 3QEJA 4DUGA 3KQKA 3LLUA 3QPVA 3QKSB 1QHYA 1E2IA 1TU4A 4TL8A 5B30A 1V5WA 2DWPA 2WPDA 3DHWC 1XEXB 4IEIA 2IWHA 2ZSDA 5JJIA 1GTVA 1WBBA 3GEIA 1RRPA 2OHFA 5JFGA 2D3WA 2ZYUX 3CZQA 2AKAB 4JLPA 5JCPA 2WAYA 2DFKB 1YJ5A 1OXXK 3IEUA 4IOJA 4D26A 1IBRA 2ZANA 2IC5A 3S1AA 2O5VA 2UKDA 5B2ZA 1FFHA 2VHQA 4WZAE 3IIMA 1NP6A 2ZI6A 1G5RA 4BECA 4DXAA 1IN5A 5CDFE 4HLCA 2ZRBA 4M1WA 2BM0A 2CLCX 2ODNA 1IJEA 1J90A 5FPYA 6Q21A 1XEWX 1W36C 1XTRA 4M4SA 4JS0A 2BCGY 4AY2A 2E9SA 5JWOA 4PSVA 3BH7A 4DCUA 3W3ZB 2F9LA 4P32A 2FFAA 1W0KA 5B58C 3GJ8A 1CU1A 1OFUX 3GLHB 5K8UA 1IXRC 4Q9IA 3FHCB 2XOKA 2RGXA 3OE7D 3CUEF 3OEEA 2RCNA 5IRCD 3NTUA 1E2FA 4RCYA 2WJGA 3RSLA 1N5JA 2JEOA 2WOOA 4LJ7A 4TLBA 3CRVA 1P61B 5CLLA 1OXTA 3GEEA 4TYPA 2CL6X 3EZ2A 3CF0A 2G1JA 2BWJA 1TMKA 5D3QA 2GJ9A 4DLUA 2HYIC 2OXRA 5FOUA 5AJXA 4B44A 2ZSEA 3AP3A 2X8AA 4ARZA 1ZCAA 4A4DA 4ERNA 5GJBA 1QHHB 2ZS8A 4NDZA 3ZVMA 1SKYB 4CEHA 4B75A 1GAJA 4RSGA 1CXZA 1P75A 2GA8A 1IXSB 1KI8A 1WQ1R 3DO6A 3VR2A 1WA5A 4FMBB 5KNBA 3VNUA 1JR6A 2QQEA 3E5HA 1Z06A 2WKPA 2N46A 4UNSA 4NPHA 3W34A 4G3XA 4QJ4A 2QTFA 5JHHB 3EXAA 2ZJBA 1JAHA 3N5CA 1Q0UA 4B71A 2GXAA 1Z0FA 4Z54A 2QG6A 2DY1A 3AF4A 1F6BA 2BDTA 2AHOA 2VA8A 4OHXA 4OK3A 1XXHB 4QJ5A 4R71A 2FJUA 2FGJA 2ZRDA 4A92A 4XH9B 3GLGA 4YMVA 1DAKA 4Q18A 3ZS9A 3A58B 2OZEA 4TQ9A 4OKSA 4Q4LA 1W0JA 2GJKA 2W2XA 4RZUA 1EWRA 4MKHA 2BM1A 3THXB 1UBEA 4PAOA 2AD1A 2GTPA 3H1TA 2WSMA 3OFNA 1XWIA 1NBMD 3AVVA 4B6FA 2CXXA 2X2EA 2B7CA 1R6BX 1AM4D 3N2EA 2FPLA 4TYQA 4QBHA 2O8BB 4ZDWA 3FMIA 3TMKA 1DAEA 1NLFA 4LUCA 3VHLB 4IDOA 4M8NE 5EXPA 3SFVA 4ACBA 2B7BA 4CEIB 3ZS8A 4DLZA 4KHZA 2FWRA 1G3RA 2QAGA 2EW1A 2P0EA 2CNWD 4ILEA 5SZIA 2ATVA 4WZ6A 4XVRA 5EXTA 2Q9AA 3NG1A 4MDEA 1G6OA 4HYYA 3HJNA 2GXQA 2QTVB 4DLWA 1N6HA 3VMFA 2YV5A 5J47A 3LV8A 4Z8YA 1G8PA 2AKYA 4K8OA 5HPYB 3EG5A 3ZZTA 3TR0A 1P2TA 1FTNA 3H86A 2J87A 1GL7A 5FR2A 1J99A 5HCIA 2VTKA 3ZIAA 1KJWA 4PPQA 5FBQB 4TMVA 2VP5A 4JLJA 1YRAA 1XF9A 2H18A 2PH1A 3IO3A 4LWZA 4F4JA 1N6KA 3EA5A 2QU8A 1Z47A 3KDSE 1CR4A 4JT4A 5FBWB 1DAIA 2JDID 1SXJB 3ZVRA 5JRZA 4BFYA 3VKGA 1YHNA 4ZI3A 2YC2C 5CB6A 3T1TA 2Z83A 4OHZA 2A5JA 1GG2A 3RABA 1Z3IX 2JIZD 2OFOA 2E1RA 3MUFA 4TQAA 4M1MA 1MO4A 3B5JA 4BQSA 3KKNA 1OHHA 2RGAA 2ONKA 1ZRHA 2FMXA 2NO1A 4QBGB 4TL6A 4WAUA 1T5LA 4BFTA 1E9EA 2VHUA 3FFAA 3SYNA 1IN4A 1FP7A 3CWZA 3A4MA 5CB8A 2J7KA 3CX6A 1VYTA 1MABB 3BH0A 5CJ2A 3A36A 4BFWA 2QENA 3K0AA 1IN6A 5G3ZA 3LXXA 2V6JA 3WNDA 2HEIA 2D06A 1E1RD 4UKDA 1YE8A 2WSSA 3OIVA 3TRFA 3PR1A 1KKLA 1Q57A 2PZFA 2JLYA 3DDCA 1ZP6A 4JKYA 4PO8A 4JIMA 1IQPA 1I4LD 2QEQA 1Z0DA 3BK7A 4GP7A 3VX3A 1GNPA 4DLRA 1LVGA 5EUMA 4KAXA 3K0FB 1NKSA 2QTHA 5EE5B 4OBEA 4ZCMA 1AJEA 3L8YA 2CMKA 2ZRPA 4EPRA 4C0HA 4HLQB 1GL6A 1CJUC 3BFXA 4A8JB 1RYFA 4MGIR 1XCMA 1HY3A 4FMDB 5E7MA 2JLXA 1HQCA 4B32A 4RD4A 3N2IA 5AUNB 2CK3D 3K9HA 4AG5A 2R6AA 3EAQA 4W5HA 3CW2A 4H1VA 4BFZA 4BLQA 1EFRA 4EPVA 1D5CA 4DDTA 3P4YA 1LY1A 4FN5A 1KDOA 2IXEA 1B0UA 3NBZC 2BC9A 1OXVA 1HT2E 3L2OB 2Q3HA 3GJ0A 3EA0A 4D4LA 5FBVB 1YZUA 5KSPA 2QROA 2OE2A 2QQ0A 2BV3A 5G41A 1U9IA 2A5DA 4IHQA 3W6PA 1N25A 1G5TA 3NEJA 1P2SA 2Q9CA 4U02A 4Q4HA 3DKVA 4UNNA 4F7WA 2Z43A 4AYTA 4JVMA 5P21A 2LWIA 2VLIA 4XWAA 3GLIB 1OYYA 2PEZA 2IYQA 3PFIA 1G4AE 1Z2CA 1H8ED 2XAUA 2IF0A 1E9BA 4B6EA 3AF1A 1RFLA 4QOSA 2WTUA 5L3RA 2PT7A 3HU3A 4NYIR 2IYUA 1GVNB 4MYHA 4EFNA 1D6JA 3VR3A 2GF9A 2ZRGA 3P1JA 1P9WA 4L9WA 5HE8A 4FI3C 1ANKA 1JR3A 4CZ2A 4B74A 4EPYA 1I4TD 1NIJA 1NJFA 4PHFA 3W5IA 1FW6A 1P4SA 2RGCA 3ZQ6A 3C16C 4HB3A 2BMFA 1UKYA 2PMDA 1CRQA 4XIGS 1GNRA 3K09A 3WYGA 4ZCIA 1XTQA 2HXSA 4PSKA 4RZ2A 4JLVA 1YZTA 4DCVA 1ZNXA 2QP4A 4JLBA 1TEXA 4Z51A 4JSYA 4ZIRB 3TAUA 1K5DA 1G291 2G3YA 5C4MA 4NCJA 4RVCA 4Q1DA 3SOPA 1KI2A 1A4RA 1U2RA 1YR7A 2QMHA 2W6JD 3RVBA 2GAAA 3MJHA 3X1DA 2OLKA 3SEAA 3B2EA 4KV9A 1TADA 1AIPA 2D2FA 3H84A 2E87A 5HZHA 3EWAA 1KMHA 1RKBA 1ELOA 1EXMA 2A3RA 2MMGA 2XZPA 3NWJA 3PCRB 1KY2A 5JWHA 3VHXA 4A9AA 5JI2E 3BH6A 2YOHA 4EQ6A 5FUVA 2QPAA 2JJ2A 3EPHA 1R0WA 1E9FA 4TSFD 1Q1QA 4IJMA 2C98A 3TW4A 2ZROA 3C41J 1S3GA 3U44A 4IOKA 4YQFA 5ANRB 1AKEA 2IYYA 4IDPA 3P26A 5DI3A 1X8JA 3MWJA 4GMXA 2FSGA 4URVR 1S9DA 2Q21A 2J9RA 3AVXA 3ADDA 1YR6A 1EFTA 4GZLA 4Q01A 5AUOB 3BJIC 1KMQA 1U8AA 3QXHA 4ITRC 4LK2A 1R5OA 5HZKA 3FHTA 1F60A 4HUQA 4WA7A 2XB4A 5BN4A 1E32A 3LQRA 2JCSA 2GETA 3WHLA 1HUQA 4RCZA 5FI0B 3K0SA 4L8GA 5FOTA 4DHEA 4UNQA 3THOA 2EU8A 1O3YA 2BBSA 2J0UA 4Z1MA 1JALA 2ZEJA 4GOXA 1AA9A 1E0JA 3I92A 2FDCA 2W00A 1KI6A 3HYTA 1P3JA 4WXPA 5JSZB 1HE1C 4LJ9A 1SULA 1KNQA 5KO2A 2ZS7A 2H1LA 3UATA 1TX4B 1CR2A 4PC2A 1XEWY 4LBYA 4KYUA 1FNNA 1R2QA 1KZ7B 4PO1A 4TMTA 3P20A 2R6FA 1ZM7A 4DBLC 2WJVA 4QG7A 3W6OA 3AKEA 2F43B 4QHTA 4ZDKA 1L7VC 1XMJA 5AK0A 1CS4C 4EJSC 4Q9KA 4BLPA 2ZVQX 3DKPA 4M1OA 2OG2A 2ODBA 4XD7D 1GWNA 3T61A 3W8RA 4B2LA 4D4MA 3B6EA 1T3HA 1T91A 5KUTA 1G7TA 1OFHA 5FOSA 1GSIA 3QE0A 4P4SA 1RRCA 3TE6A 1LF0A 3M1IA 3A1WA 4QM6A 1YR9A 1XTIA 3TQCA 1ZUNB 2P5SA 3UMRA 3ADCA 1S3SA 1KK1A 2FH5B 3DM9B 2AN9A 5EE0A 1Q12A 3AGPA 2DWQA 2B8WA 3BC1A 4AIIA 1WMSA 3TKLA 2QNRA 4C2TA 1U99A 2J45A 5F2EA 3E70C 4RFVA 1F5NA 2VO1A 2W0MA 1HA3A 4YMWA 4D0LB 4PC3A 3UMSA 2JAQA 3SDZA 1TTTA 3VR1A 1S1CA 5CK4A 1E99A 1GOTA 2YOFA 3IUYA 1CBUA 2C95A 4U7DA 1Z07A 2WHXA 3ETLA 2VRWA 3L0PA 4MRPA 3LAWA 4OI1A 1E98A 1JEEA 2QE7A 1UKEA 1ZC4A 3JVVA 4MQBA 2CBZA 1PV4A 3THWB 3IDQA 1ZJ6A 3KJEA 3PIRA 4CEJB 2IXFA 1VHLA 1MRNA 1W49A 2AWOA 3WRXC 4QGFA 4UNPA 2CJWA 2VHCA 3IIJA 1V43A 3MMPA 2QA5A 2QAJA 2F1IA 3O47A 2D74A 3W9YA 3WYFA 2QGNA 2OT3B 3ASZA 1XMIA 2PX0A 1QRAA 2FG5A 2YC4C 4GPTA 4BLTA 1KO8A 1IN7A 3GJ6A 2NO9A 1N6RA 2BVNA 3HPRA 1R10A 4TMXA 4A15A 2WJHA 1N5KA 2B92A 1KYIA 3QXJA 3LVRE 5HTKA 1RZ3A 2BKUA 2GCPA 4RJLA 4KFTA 4KI0A 5H1YA 5JLJA 4BZXA 3QVUA 1C9KA 1LV7A 3FVQA 1UJ2A 5KSOA 4LYHA 3LY5A 3ICQB 3EC2A 4KODA 4NCNA 4AKEA 3SNHA 4Q4AA 3RWOA 1J8MF 1P2UA 1ZU5A 3CRRA 2FV8A 3CF6R 4DLYA 4US0R 5AUPB 3V4FA 1N3BA 2FOLA 5KHOC 1GRQA 1OYWA 5AJYA 5IT5A 2YZ2A 3TVTA 1OXUA 3SR0A 4CW7A 1AS2A 3LLMA 5DN6A 5TY0A 1NG1A 2FA9A 5JECA 1F2TB 2DB3A 3WMFA 1R5NA 3IHLA 1WF3A 1W44A 4GFDA 2ZRIA 4FIDA 2OSBA 2ZI9A 4FMCF 4JL8A 5DE3A 2QM8A 5BYJA 5KSZA 3K70C 2A2ZA 1N6PA 3LX5A 2O0HA 1NNEA 4AD8A 2FSFA 2MMCA 3CZPA 1HQYE 1II9A 3AUYA 5CM9C 3WP1B 4MRRA 5JMTA 2ZJOA 4G5GA 2O8CB 2QUZA 2YINC 2ZI5A 2V3CC 5KYKA 3AVYA 3GLFA 3RRMA 1QVAA 3NBFA 4J0QA 3EASA 2ZUBA 1ZIOA 1E79A 2NO7A 3CR7A 3LVQE 5GADl 2PLRA 1ZIPA 4LX0A 1ETUA 3KFVA 3F8TA 2QBYA 4TLCA 4GOKA 3U3JA 4CDGA 2FFHA 3RRZA 2ASEA 2AWNA 4A2QA 5DISB 2HXYA 4HDOB 1Z28A 2QM7A 4Q00A 5KPJA 1OJLA 4LY6A 2BIFA 1E2QA 2YWEA 3WXMA 2VF7A 2A5GA 4XJXA 3AF2A 3RWMB 1EESA 4L5BA 2A7QA 2OCAA 3QF4B 1NVWQ 3K53A 1KI7A 4ABYA 2AR7A 1U8ZA 1W4CA 3SYKA 1T3SA 3HYRA 2NQ2C 3EIQA 5K8TA 5C4GB 1UDXA 3LFUA 3ADBA 4UQOA 2ZJYA 5M04A 3DL0A 3DMDA 2VP0A 4P33A 2HDNB 1N6NA 1Z2AA 2JJ8A 1KNXA 4OI2A 5HKKA 1XTKA 1Q20A 1ONBA 2PCLA 4KVGA 4LPKA 3T34A 1CRPA 3R9WA 1XP8A 3BRWD 3IHWA 1XXHE 4KLZA 4EPXA 4X8LA 3IPXA 2BHRA 2BEKA 4G1UC 4HEJA 4LC0A 4LYJA 2FNAA 4URWR 2GCOB 3AEZA 3KKMA 2JATA 2YOGA 5K8LA 4V0ME 3CPEA 2KI5A 4QNMA 1JXOA 4UXIA 3OEHA 3AGQA 2H7VA 2ZRFA 4C0LA 3W90A 3RS3A 1NL3A 4F91B 2QPTA 3ZVLA 4MYUA 4GMDA 3H4MA 3QPWA 3VR6A 3PV0A 4TYYA 2OESA 1U8YA 3UIEA 2QPOA 4IDHA 1XPOA 2AK2A 3LXRA 1VG1A 1VG9B 4DLSA 1K5GA 5G40A 1GRRA 4JT2A 1Z29A 1II0A 3IKJA 3MGCA 4L15A 4ASUA 1C4OA 2ZAOA 2CCGA 2J0SA 1G8YA 4W7SA 5IK2A 4TMWA 4C0KA 1U0HC 4YMUA 2REXB 3G5UA 5L3SB 4B48A 1W46A 2GXSA 1G5PA 3VR4A 4TZ6A 1LF5A 3SJCA 3BBPA 1RRGA 2WWXA 3IIKA 2KJQA 4PR0A 1YZNA 1E9AA 1QHSA 1BIFA 1ZC3A 2BCJQ 3WMEA 3CNNA 3TBKA 1E9CA 4LJAA 3KUDA 4P4UA 4G5OA 1DVRA 4UXJA 2V7QD 4Q1BA 4E5UA 2WIBA 5FR1A 4QBIA 3I8SA 3TVDA 1E0KA 3BORA 2O8DB 3QG1A 3CWQA 2CHVA 4Q4JA 1SXJE 3UXMA 4C2UA 3BGWA 2F7SA 3SU8A 1YRBA 3FB4A 4F38A 2QN6A 1IM2A 3IO5A 4BLOA 3ASYA 1FUKA 2VBCA 1OPXA 2YVUA 3PEWA 1S96A 2F6RA 2BJWA 3QF7A 3B82A 4B3FX 2QGZA 4X8HA 2VSXA 3OIUA 3P32A 2Z4RA 3OHMA 4TT3D 2WJJA 3X1YA 2KSQA 4W9MC 3PENA 2Y8EA 3M6AA 1TF2A 3Q72A 3I4LA 1DAMA 3OE7A 3PEUA 4V0OA 4ZI2A 1S1MA 4DB2A 1GL9B 2CEAA 3BB1A 2IEYA 5IDVA 3FMOB 3C15C 4QJ3A 2A30A 4AI6A 4IKEA 5FUWA 4DT1A 1CF4A 1G19A 2KB0A 4TN1A 3DZDA 2ZSAA 3NDBB 3D31A 3AVUA 4Z8XA 1QG2A 1ZM4A 3LQQA 2GK7A 3S1AB 1BH2A 1ZVQA 5KNCA 5SZKB 4LJ4A 4IFBA 4TLAA 3MSXA 421PA 2V9PA 4KO8A 2AL7A 1M7BA 1O87A 4BFUA 2H5EA 4RD0A 3GLHA 3RANA 3ZJYA 2IW3A 3NXSA 3VTKA 4TMZA 4Q7KA 2I3BA 5DIFA 5ELXA 1NMXA 2CCJA 4YDHB 1SHZA 4KBGA 4N0EA 1N6LA 1M8PA 3CNLA 1OV4A 5DH9A 1CR0A 1U0JA 2FFBA 1N0VC 2OBMA 3LDAA 5JJKA 2BJVA 1EX6A 1GILA 1VMAA 2OEPA 3FGNA 3X1WA 1FZQA 1U94A 3FE2A 5L3QA 3P27A 2GEUA 1G8GA 1QHHA 2J59A 2N1BA 1ESMA 4NONA 4PHTA 4IOMA 4QHSA 3FYHA 1WBDA 4Q19A 1HH4A 3QKRA 2A78A 1TQ2A 3U3OA 3GLIE 1PLKA 2B21A 2OBLA 4GBMA 5H70A 4D80A 3PEYA 2CL7X 2P5TB 1NBMA 2DR3A 5FUXA 2ERYA 1FUUA 3CH4B 3RS0A 2BMJA 4CEHB 4G5SA 1TF7A 2QORA 4DDVA 1BYUA 1G8HA 1K6MA 1W48A 5DHAA 2ZU6A 2GHIA 2BBTA 3ADKA 4C4PA 3UKDA 4MH0R 1OLOA 5FH9A 3AP2A 1ESNA 4B73A 4BFXA 4ESVA 1EWQA 2CNWA 3JVUA 2IWRA 1DELA 2PZEA 3U60B 1FPMA 3KFXA 5BN3A 3TJZA 5CM8B 4FWTA 4BASA 1E69A 1G1MA 1LW7A 2UVQA 1D2MA 3EZ9A 4HUTA 3THXA 2PL3A 3SYLA 4AKIA 2LCFA 3VKHA 4NHOA 4H9GA 2O0JA 4M22A 4KITB 4G5QA 2NPIA 1C1YA 1G9XA 1II8A 2EWWA 4E09A 1Q1BA 3ZLJA 2GKSA 1DO0A 5CIQA 2G9NA 4XOIA 1TQ4A 1S9HA 2J0VA 4LSGA 4PXAA 2CE7A 5BWMA 4PZZA 1MOZA 4CEIA 4P3YA 3KKOA 4B3GA 3B8HA 1XDBA 2ANCA 2GILA 1ODFA 4G01B 2IS2A 4CYMA 2QP9X 4IXNA 4GP6A 3O8DA 4MRVA 2YWFA 4CVNA 2ZREA 3NC0C 3ZH9B 2GZDA 3K9GA 1DPFA 2JIZA 3I72A 2OAP1 5G3YA 4AK9A 3U7EB 2RMKA 4PC1A 3RS7A 1AS0A 2WKRA 3SQWA 3VQTA 3PJRA 4D6PA 5LPNA 1U98A 4TYNA 4O3MA 1KGDA 3Q3JB 1Q1EA 2QAGB 1LNZA 2CVHA 5BQ5A 4HAUA 4JBWA 4LRWA 4H1UA 3R7WA 1PVOA 2CLDX 3FDIA 3TUIC 2DBYA 2YJTD 1P9NA 1E96A 4O25A 1G3UA 1JAIA 4UJ3A 1QDEA 3LBHA 3SI7A 1CJVC 1R8SA 2IF2A 4R2IA 3TH5A 1E1RA 3AUXA 1M6NA 1RE0A 2ZUDA 1NVVQ 4S35A 4Q7LA 4WXRA 4HAVA 3WY9A 1E2KA 1Q44A 1NKTA 3HWSA 3RRNA 3CX8A 5BYKA 1RPZA 1F2UA 1HV8A 1OT3A 1I2DA 2FGKA 2PT5A 4GDFA 4CT5A 1NN1A 4R2HA 3RNLA 4AWXA 4D81A 4DC9A 1ZD1A 4IRUB 1JPJA 2RHMA 1KI3A 2JJ1A 3C8UA 5LB2A 1R8QA 3SN6A 2NIPA 1IY2A 1KDPA 2ANBA 2QRNA 2R62A 3AKDA 5J4VA 2OBNA 4C0QC 1XTSA 1YU9A 2ZJAA 4M2LA 1XPUA 5FOXA 1T4GA 3QOFA 1IONA 1VYUA 1SXJD 2CK3A 5CDFA 4W5WA 2FEMA 1E0AA 1E2GA 2OFWA 4DSOA 3GD7A 821PA 1DAGA 5FBLB 2LKCA 3IGFA 4YXWD 1UBCA 5HE9A 3I62A 2ZSBA 3R20A 3VU9A 5JJLA 5CITA 4BRUA 1FL9A 4ZDIA 2V1XA 2FZLA 3K0FA 1EX7A 2D7CA 2OXCA 3B9QA 5TDHA 3X2SA 2IYXA 4Q48A 2IYRA 2ZI3A 4KYIB 4FCTA 4DCSA 5GVSA 4TTRA 5E4FA 3VNVA 1XU4A 2FFQA 4DZZA 3KXKA 3UPUA 1J7KA 4A8JA 1KKMA 2DYKA 3B1VA 3OAAD 4HZUB 2PEYA 5CLQA 3CIOA 3MLEA 4I99A 3AVPA 1J8YF 4POAA 1H8EA 2WWHA 1KO1A 3Q7QA 1JEDA 1IY1A 1TEVA 4XTRA 3RS5A 1OE0A 2X1VA 5EUQB 2VF8A 3MD0A 2O8FA 3QSYA 2PCJA 4LHXA 1SVWA 1Z6GA 3O8RA 4C3ZA 4D25A 2NO0A 1E1QD 3TLXA 3QKUA 5TB5A 3LW7A 2WMNB 3NKVA 1KZGB 4GRAA 1AS3A 3WMGA 1CJTC 4NBSA 3GJ4A 2WOJA 2QI9C 4FINA 1QHXA 3GMTA 5DLQC 3SC3A 4M21A 2XB2A 1IJFA 3U7GA 1N0WA 1SXJC 4F92B 3CRQA 4BLSA 1S4QA 4XSHA 1KAOA 4LHZA 2W6JA 2XGJA 1XEFA 4EJSA 2ZRJA 1D8TA 2R6CA 3IBGA 2GJ8A 3ONWA 4HB4A 4US2R 3I5YA 2W6ID 1GP2A 4Q4HB 4QHYA 3M0EA 2CCKA 3HR7A 4G5RA 4CGZA 5TMPA 2ZIAA 1BO6A 2ZR7A 4BUJA 2RHDA 4PO9A 1VECA 1E2MA 4TSFA 4HAYA 3OF5A 2XSZD 3WRYC 1W7AA 2ECKA 2HLDD 3FKSD 1IOZA 1QBKC 4ZIRA 3QBTA 1IN8A 3KZ1E 1KI9A 2IYTA 5DSZA 3PUZA 4C7OA 4GSYA 2HUPA 5LD2B 4E07A 4A2PA 1N6OA 5JI3E 1DS6A 4L4UA 2F9MA 4FW9A 2ZS9A 4DSTA 1D9XA 5J40A 4MGYR 4MRSA 4JVSB 1B23P 3QNUA 1NMZA 2F1JA 2X2FA 3SHWA 5KNDA 3D7MA 3KJGA 2ONJA 2XTZA 2R44A 4TLEA 2JLUA 2A9KA 5C2JB 1E2LA 2CE2X 4NL4H 1MRSA 3T5GA 4A8JC 2AFIE 1GM5A 4KU4A 2GRJA 5KDOA 3X1ZA 1AN0A 5AR1A 5KSYA 2XZLA 1Z6XA 2OV2A 1OIXA 3ZYCA 1NN5A 4QXAA 1KMHB 4DWJA 1KO7A 4F93B 4KBFA 3GJXC 4EAQA 1IXZA 5G53C 2OAQ1 2X19A 2QMOA 4KXFB 1FMLA 4EQ6B 3OIWA 1HTWA 1GKYA 1G7CA 1WXQA 4QC2A 4NE2A 4XD7A 3RHFA 3GEHA 3U44B 1KO4A 3WHKA 3GFPA 5GVRA 1J70A 2FPKA 3GLFE 5DI3B 3ZD6A 4M9QA 1TQDA 1TF5A 5JSZA 3MWLA 3R9IA 3JZAA 4NCKA 4Q1AA 1AGRA 1PUIA 2DHRA 1A2KC 4BZPA 1CIPA 3THYA 3U4QA 3TUZC 4NYJR 4MYTA 2DWOA 4OJKA 2H8KA 4DB4A 2A5YB 2F43A 1L4UA 1XJCA 2J0UB 1ZUHA 2NZJA 1TUIA 4OL0A 1G64A 2VH5R 2IHBA 5GJWC 3TAHA 2FPMA 1KI6B 3U5ZB 4QFMA 4PPFA 4M1YA 4LV5B 2W2VA 2XX3A 2HJVA 2AXPA 4FMDF 2NO6A 4AURA 1SZPA 2ZYTX 4HB0A 4TTPA 3BS4A 3MFYA 2GZHA 3NH9A 3UMFA 3IEVA 3L0OA 2BBWA 4PZLA 4NH0A 4M0LA 2PJZA 3T5DA 2I4IA 3B1ZA 1XTJA 4EIWA 1RRFA 4MGZR 3SJBA 3U3KA 5H68A 1F3OA 4BFVA 3IQWA 3I32A 2EFCB 4I1VA 3RRYA 3H0KA 5AJWA 5AUQA 5LD2C 3FKQA 3EPKA 1A2BA 2ORIA 2WVJA 4P4SB 5FTMA 3B7GA 5K8IA 2VP6A 2IEZA 3K9NA 3BIFA 2ZTSA 1JJ7A 1M1YE 3RS4A 2XTNA 1P6XA 3NBXX 1BS1A 1G20E 3R8CA 4EPWA 2VHTA 4LGMA 1P2VA 1E3MA 4NYMQ 3CRW1 3KJHA 5KTYA 3GFOA 1OH5A 3LBIA 2ZU0C 1G18A 3PVSA 5FFMA 3SHFA 2DCUA 2ERXA 1T3LA 2OCBA 3A1VA 3UANA 621PA 3THWA 1ZD9A 4US1R 1AQUA 1K8RA 3T35A 4QL3A 4D0NA 1Y63A 3NC1C 4YMTA 4M9ZA 2IYLD 2J7PD 4C30A 1G7RA 2DPXA 2NGRA 2YHSA 1US8B 1Z6YA 5AWFC 4DDWA 2V4ZA 3TSZA 4PC7A 3F5FA 3Q5DA 4N1AA 4B3DA 2V55B 2ZRMA 3PQCA 3J81k 3QG5A 2MSEB 5KOYA 3U7FB 2EQBA 2NG1A 4BEBA 2C5LA 2HV8A 1RVDA 5DGXA 4PANA 2W83A 1CEEA 1GKUB 2P6NA 2GDJA 2VSFA 3FMFA 3LWNA 3NHBA 4HDQB 3KQUA 2ZUCA 3ND9A 4JYCA 2YKGA 1DG3A 3EPLA 1D2NA 4LZZA 1VCMA 1ZCBA 2P3SA 1FP6A 2WWFA 1E4VA 1YR8A 3LA6A 4RY2A 4HAXA 2D7DA 3KB1A 1NF3A 1TNDA 4PAQA 4LI0A 5TVKA 1CJMA 4HAZA 2ZI4A 1XD2A 3BFKA 4DRZA 5EQTA 1ZINA 2RGGA 4IEEA 4Q47A 1F2TA 2G88A 2JA1A 1XRJA 4QGAA 3GCGA 2WKQA 2H92A 3CONA 5CIWA 721PA 1NMYA 3KUCA 4ZKDA 2N42A 1SVOA 4MRNA 2V6IA 2RGBA 3VFDA 1W4BA 4AYXA 4LV8B 2VIIA 1R0YA 3L43A 4RFSA 1Z5ZA 4DSNA 2HT1A 1HEIA 4URXR 2QMEA 2O8CA 1M7HA 1FQJA 4Q7MB 3WBKA 2OLJA 1E4YA 2X77A 4HB2A 1CLUA 1U90A 1VCOA 4XVUA 1T8TA 2ZJZA 3DM5A 3L82B 1G21E 1KDRA 1VYVA 2CL0X 3CPJB 2AD5A 4OYHA 4HAWA 1COWD 3GJ7A 3MAAC 1UEIA 1UEJA 3EARA 1VHTA 3T06B 2BKEA 1OKKD 2ORVA 4WIAA 5F9HA 1NI3A 2Q0HA 2XZOA 2ZE8A 2XXAA 4OQMA 1YZLA 1RIFA 2GWHA 2QMUA 2Q6TA 3CRMA 2P2LA 4B3BA 2ZXUA 3GLFB 3X1XA 3Q7PA 5FTKA 2FEOA 3BB4A 4M1SA 2G0TA 3NVAA 3QF4A 1KI4A 3GFTA 1U81A 3EWSA 2O52A 2YYZA 3A4LA 5FPKA 5EXXA 1KJZA 2QBYB 1W4AA 4D82A 1QHIA 4LBVA 1ZNYA 1G7SA 3KTAB 3AVWA 2HF8A 4MA4A 4LPSA 4AYWA 1XPRA 1AZSC 2D62A 3MWKA 521PA 1T8UA 1GUAA 4M53A 5CK5A 1XD8A 2BOVA 4JLMA 1ZD8A 1EGAA 2KWIA 4OHVA 5SZJA 3U2QA 3VKWA 2F1HA 1RJ9B 4S2EA 4EKDA 4YONB 1XJQA 4XSGA
chains in the Genus database with same CATH superfamily
4EO9A 5KPDA 4L8FA 1Q19A 2BMEA 2GCOA 3IUBA 4ZI7A 3WOHA 2ZQYA 1NBME 1BXZA 2Q3FA 4OIFA 3TDMA 2EOAA 2DF8A 3LUBA 4HDCA 3WICA 2UZ3A 4CL3A 2EGHA 3V4SA 2O8EA 1LC3A 4IH4A 3H4TA 3GZNA 2UUBB 3R7BA 4NU0A 3ZW7A 1CUSA 3DBHB 4HSEA 3Q8XB 3B6KA 1S02A 3UUGA 4ALNA 3G0HA 2RB4A 1DKLA 1CUIA 1SD2A 3HP1A 1Q83A 1XDUA 2D0DA 4EO7A 1EFCA 3F0TA 3B6JA 5DGHA 1LI5A 4AU1A 1GZ3A 3U56A 2EFDB 1XZMA 5DWDA 2YQ4A 1BGVA 5CB4B 3X1KA 3S2EA 3A4NA 3VPSA 2VP2A 3HXKA 4IGEA 1VMIA 4LQ4A 5KTOA 3AY6A 3H16A 1U7HA 4U7PB 3EXIA 4DIMA 4EKNB 4XZ3A 3LG2A 1YBAA 2COUA 4LOAA 2JBAB 4YAFA 3B1WA 2CYBA 3I45A 4UTVA 1S3IA 5EMHA 2D1SA 4K28A 3HR8A 4CF3A 5K0TA 2PA0A 2RARA 3VC7A 5LJLA 4IMIB 3C6MA 1RLOA 1O97D 1LLCA 2GHRA 1SD1A 1J2TA 2FR8C 4PSAA 2ZQZA 4D2IA 4BQOA 5H81A 4XQ0A 3W5SA 4C7XA 1C81A 5ESXA 3C3XA 4AY3A 4TT3A 2QT9A 3II6X 4H1TA 2JLVA 4JJKA 3B60A 2FRDC 5CXUA 3CEPB 1EAYA 4QGBA 2PUCA 3A6PC 2ZBGA 4TPKA 1W5AA 3U9SA 3QVWA 1HYEA 1F48A 1F8XA 4TMKA 3VV2A 4IDQA 1BDMA 2DFNA 1M2JA 4ZALA 4RDHA 1X38A 4E15A 1YDHA 2PPLA 4I1IA 3GLUA 5L4SA 4OGWA 3D1JA 3QKSA 3MJRA 4QUKA 4NOMA 3EVGA 1HM5A 4E5YA 4MTLA 1XEXA 3PGKA 1BMFD 3E27A 1TQHA 4RE5A 5ALSA 2WJIA 3OKFA 2BW0A 1GZSA 1FYDA 1JRLA 5ALEA 4OH7A 3DPIA 5CYOA 3VC3A 1MOSA 4OAOA 1E1DA 1G66A 1MH1A 3S5JA 4URUR 2WUDA 5K5EA 3IJEB 4FD2A 1GUFA 5E7IA 4LIPD 3WSVA 4WA8A 1KAHA 1W5TA 4YUWA 4ZAFA 1FU8A 4RQAA 2FSPA 1CQJB 2VP9A 3FNIA 2OAGA 3OT1B 2V0NA 5FOVA 3VH2A 5JR3A 1GGHA 3L49A 3I5XA 1NBAA 4I4TB 3E9DA 4ONEA 4RV9A 4HFMA 1SIOA 2Q2WA 3LKDA 4YRIA 1R0SA 3CGWA 1L5HB 1K68A 5EQJB 3WGTA 2C5HA 2YASA 5K0BA 3NDRA 3TQFA 1QPGA 3T15A 4R1OA 2Z9DA 3VSCA 1GQQA 2Q29A 2WM9B 2D1QA 1M1ZA 3KR9A 1M9NA 1P9RA 2H1WA 1E0SA 1U2TA 4K9QA 3SS8A 4Q7QA 4A0GA 1S8AA 3C5CA 4PVDA 5CVCA 4DG9A 1ZM3A 2H16A 2B8TA 3O91A 4RPCA 4RS3A 3EXHC 3SJ7A 1GT91 3QGMA 1C9YA 1E3LA 2V4MA 5H9WA 3IKTA 3TLYA 3G2JA 4JMLA 3SBDA 3KQLA 1VLZA 1VIMA 2GVZC 4DUGD 4TZ0A 3DVLA 4URYR 1PWHA 3GJZA 1XV5A 3SQXA 2GD6A 3PQ8A 3QMMA 3FOZA 1F9AA 2PWAA 5C1BA 3ZE2B 1JP7A 2DLCX 4P31A 4PR3A 4EKGA 5A71A 4COOA 1UC8A 4YCJA 1G3IA 2PS0A 4FHDA 1EFVB 1OR8A 4J91A 4U7WA 2R84A 1Z0ZA 1BRTA 4F97A 5HVNA 2PZGA 8ADHA 1AZTA 1TJNA 2WE8A 2QR2A 4PGMA 2X13A 1J1ZA 1GT6A 1U0FA 1FW8A 2NNLD 4JWTA 1WDWB 1Y98A 1E5DA 4MW2A 4HEA6 4U6QA 2A9VA 2DULA 4EHAA 2C07A 1NSYA 2WDZA 1KU6A 1UMCB 5JDIA 1S89A 2WM2A 1LS6A 4ZPJA 2H11A 2ZI7A 3LGXA 4GMKA 3UHAA 4ETWA 2DCMA 3Q3GE 2PO5A 5C46F 3FBGA 1GKIA 3TTUA 3GR6A 3IUMA 3NGXA 4KO4S 3U16A 4H7EA 4PQRA 4EMUA 4RY9A 2P65A 1QP7A 3EIHA 5EVCA 3G2OA 3RG2A 3T9DA 1SIUA 2IUTA 3NTVA 2GEDA 2X5OA 1R4NB 3GOHA 3MVEA 1I94B 3X43A 1W0KD 2GESA 4CT0A 2K2QB 1M33A 2IA5A 3HLKA 3VGPA 1SCAA 3BUSA 3GLVA 5CT6A 5A4JA 3O0TA 4MGEA 2ZRCA 4B4OA 2B1IA 1RJFA 4EG0A 3X2EA 4BU1A 3OT5A 5BSUA 3DF9A 1A77A 3HLYA 4XRGA 2JHFA 2BGJA 4YCAA 1VG0B 1XXHA 4LJYA 5IVPA 3MQFA 2H2HA 4MMYB 4UTPA 1G16A 3P0EA 3NJ4A 4WPGA 1VJ1A 2PRYA 3BG5A 1X7GA 1DC7A 4CCYB 2GN8A 3HJUA 1EFUA 1V1JA 2C99A 5TQ0A 2IZ6A 4PO3X 4BIIA 1KEPA 1JE0A 4YJDA 2IQIA 4QTXA 3CBQA 4GXRA 2I54A 3AL2A 4HN4B 4Q9LA 3RV4A 1FQKA 4A6XA 4DWOA 2H17A 3BZWA 1KEUA 4CF4A 4JROA 1TI7A 1ZOIA 4C0SA 1C14A 2O8BA 2G28A 3AEXA 4S1PA 4IVQA 1V1RA 2PIAA 3VH3A 3EXFB 5IN5A 3FDFA 3KEGA 3OZIA 1B15A 3TUJC 1P91A 2VP4A 1PNTA 1MQAA 4I1YA 4TLDA 4Z2YA 4KR2A 5CMLA 3D2AA 1AK2A 2XYPA 3HPQA 1Z7GA 4XQ9A 2ZCVA 1OI4A 2VNIA 5LA6B 5KU1A 4CV3A 3NWBA 4MQMA 2C2KA 1RC0A 1NNUA 2QIPA 3AY3A 4DMMA 3IEMA 1WV1A 2NUPA 1JIXA 4M0PA 4KXMA 4Q39A 4B5LA 3KBBA 1H3NA 1FY2A 4D3XA 1GZ6A 2IHYA 4EW2A 1Z5GA 2MSWA 1FMCA 3H17A 2IZ5A 3S2SA 5I3CA 4EVIA 2I6UA 2G82A 3CX7A 1DOAA 3EGDB 5HQ3A 1EZ1A 3KVYA 4C0BA 2AC4A 2BDEA 1NYQA 1XJ0A 2C96A 1YD7A 3BD9A 1JI3A 2QRVA 1TM7E 3WIOA 2AMYA 1SG9A 3AZQA 3O3MB 5HHTA 3KRTA 1LPOA 1ODLA 3RS9A 1TMOA 2GNAA 1X7YA 1YS9A 1W0JD 3DCIA 2VUUA 5LXTA 2V59A 3ELDA 3O0DA 1SXJA 2YCBA 3O9ZA 4C76A 2D2EA 4XSVA 1ZUIA 4BWFB 4RA9A 4O2RA 1H0SA 4AJ2A 2MT9A 1TU3A 2P4HX 3G0BA 1GNLA 4KK3A 3VVMA 3GJ5A 5EJEA 1FIUA 2JH3A 4MPDA 1G38A 4MS3A 4IP0A 1NF8A 4Y7DA 4EM6A 4HDRB 1L5KA 3OPQA 5JS8A 1DPGA 5DB4A 1SCKA 3D5QA 5B3LA 4YP0A 4G8DA 2NMVA 5JQWA 3ZY6A 2VAVA 5JEDA 3R3YA 4ZT2A 1BVYF 1QH1A 4BRWA 2ZR9A 1ZISA 3U4IA 1UOEA 4IO1A 4IJ6A 4BO3A 4HNRA 3DLCA 3PUYA 4WZAA 4E0BA 3AUTA 4E2WA 2ZYSA 3X44A 3N3BC 3HZRA 3ZDRA 1P29A 1F20A 2HRCA 2WRZA 4IAOA 4L16A 2XITA 3M4NA 4HS9A 3IC5A 4X00A 2H31A 4D9JA 4RA6B 3VAAA 4F8YA 1EVQA 1X7WA 4C4ZA 3EE6A 1UBKS 1QWSA 4FDMA 2V3VA 2WIAA 1B0AA 4OHWA 3RUEA 2WWWA 3AJ9A 3S7TA 3WISA 4B0OA 5CT9A 3G9XA 5B64A 1GIAA 1B6TA 1PJRA 3LVFO 4KFSA 2FK7A 4OXQA 4H6VA 4FFMA 1W85B 2IUUA 1NHGA 1C30A 2DUMA 1A98A 1SBIA 3K0AB 1Z08A 5BN5A 4FC6A 4X1OA 3NV7A 4KACA 1O77A 1JJFA 4IHAA 2YIDA 3HEAA 5BSRA 3H87A 3RG8A 4BV8A 3P9CA 3WWPA 3DOFA 3EQ8A 5C7IO 3R9XA 2L2QA 4PPGA 3IB6A 1KY4A 1X6VA 3GYGA 2IS1A 3K6KA 1GSOA 4C6TA 1QORA 5EE1A 1CULC 1L3CA 2GCIA 2JEYA 1V11B 3LNCA 16PKA 3QJGA 4MGKR 3ZI7A 4A8HA 3CUUA 5HJEA 2ZJ0A 1MENA 3AR9A 4GM4A 1OHHD 4FZRA 3MPOA 2CDBA 3JZDA 1FOEB 5JT1A 4R98A 3C8DA 3TD6A 1BXKA 4AMYA 1XMVA 5THKA 4ENWA 3N6RA 4FCVA 1SELA 3C74A 2P0YA 5EP2A 2RBGA 2H5JA 4FFBB 4N40A 4ZVSA 3VC1A 2QAGC 4B76A 3LA8A 1Q5PA 1RRKA 3C7DB 2C20A 1AGPA 3AV0B 4RLSA 4WTOA 1HYQA 5EHNA 5FPSA 3ZDQA 3ZV4A 5CFLA 2GAIA 3WLJA 3DOEA 3FKSA 1O89A 3ORHA 5LQUA 3GLIA 2Y77A 2ZK7A 4MUBA 1PHRA 1QK3A 4QUJA 2YHIA 3F49S 4RVOA 2KBEA 2O8FB 2J1LA 4IIJF 4BNMA 4IYJA 5K3AA 3KK0A 4MIKA 3TNFA 3V9AA 3UXYA 1WW2A 1B76A 3FOFC 2Q3MA 1NBHA 3PQFA 2FWMX 3HCDA 3ABZA 3H0EA 2WJYA 2R8YA 4JU8A 4A82A 4XWOA 2I66A 1VHDA 2PX3A 3O1LA 3ZZ1A 4NBVA 1PL6A 4OM7A 3TMYA 2JGJA 1CQXA 221PA 4KIGA 3A1EA 2PXXA 4LFAB 5IBQA 3ITEA 3RS8A 2UUOA 2GBPA 2OO5A 2SCUB 1FJ2A 1EFRD 1QYIA 3QVVA 2BFCA 1QGAA 2FN4A 4UUAA 1XK7A 4EJSB 1AY0A 2SKEA 3C0KA 3I73A 4JC0A 4EEXA 4R9NA 3ZE6A 4EHBA 3CF2A 4MW5A 8GPBA 5FUYA 4XYMA 1D7AA 4CIVA 5D2CA 2O8NA 3RHTA 4Z0TA 1U8EA 3NIWA 3GFVA 1R0XA 5U9CA 1BD4A 2ATXA 4GLJA 2P75A 3U7JA 1CPYA 2BHNA 1RC8A 5BOVA 5D00A 4CF7A 2Q4EA 1XRLA 1BE8A 2YFYA 4LF6B 3ESCA 4J76A 5LXTF 5CCEA 2FWNA 2R1TA 2KM1A 2QVXX 5CFPA 1ZKDA 1SU7A 1F1BA 3PEEA 1SCUB 1NPTO 3WL7A 3BFVA 3F6RA 4JGIA 1R6TA 2XRMA 3OFKA 1MFZA 3GGJA 2O59A 3K1YA 3FUTA 4R7ZA 4CF5A 3N2KB 1WLYA 3REFA 3N0VA 4A0SA 1H65A 4W1PA 5HZGA 3WKAA 1RMYA 3KYIB 2CXOA 4IMJB 1FE8A 4BNUA 2A67A 1Q0QA 1D3AA 1T24A 3VPHA 1T6BY 4M9RA 5B7GA 3F6SA 3LT0A 2XQJA 4LSMA 1QONA 2VJMB 3LH5A 5IG2A 1LDGA 3NO4A 1R18A 2EZ9A 5DW3A 5JS7A 4UQLA 4ZK6A 4PLYA 1OIWA 4ZO4A 3CFYA 3MXTA 1EH5A 3KOWA 5J2TF 1K4MA 2R2AA 5JW6A 4O6VA 3SXUB 2Y27A 3DSRA 2Y0DA 2GASA 3EMVA 4ZYVA 4NCIA 4WL0A 5HQTA 4AQDA 1QTNA 1BC5A 1M75A 4XUGB 4AQ7A 1NE7A 5IASA 1DWQA 5PNTA 5BNFA 1UJCA 2J3IA 1NYLA 3U80A 4N6NA 4JP5A 1Z2OX 1JPUA 3R23A 2ZITA 1GPYA 4HCJA 5IBCA 4HUQB 4KRXA 2ZTMA 1WKCA 3X0DA 1EDDA 4HN9A 1RYHA 5A0FA 3CNQS 4TVOA 4FJ2A 3TW8B 3E61A 1DDIA 3WLOA 1PKEA 2R1VB 3KEMA 3WWOA 5C5IA 4BX8A 1A9QA 4EX7A 3FDZA 3M4YA 4KIFA 3WFZA 1EK0A 3UBTA 1V35A 3PF8A 4EPYA 2JJ2D 3C1AA 2PO7A 1KK3A 3IR6A 4J7UA 3DEHA 1TVCA 1D1SA 2ZTUA 2RGNC 1ZM9A 4Q3NA 5EINA 4OQQA 1V8PA 3VBCA 1UIRA 1NMSA 3NBQA 2I2BA 2JK0A 3JZIA 2OUKA 3R24A 1FK8A 4ARUA 2UZIR 1L3IA 2IPLA 3U4GA 4IDFA 4G89A 4Q9JA 5IDXA 3PWTA 1ZUNA 3CH5A 1A5SB 1M10A 1N2GA 2C0QA 1QOQB 1A2OA 2AG0A 2V96A 3E1SA 3KSZO 4I6GA 4OXKA 4ZVLA 5I9SA 3TI7A 3Q8LA 3AW9A 3H75A 3LYHA 5EHXA 4TL7A 4M1TA 5EFZA 2SBTA 1OFTA 1XZIA 4UCWA 4AY4A 4DLBA 2JB9A 4LDJA 13PKA 1HLFA 4B5KA 1SVMA 1N5DA 1ST3A 2CFTA 3JD3A 3QQ5A 4TQUS 5K1ZA 1E2NA 4MQ5A 4XFKA 4JLNA 3L41A 2LR0A 3RC3A 3DT9A 5JY1A 4Z2AA 2QYHA 3K70B 7ABPA 3VNBA 4RGYA 3TQOA 3VSBA 3C8MA 1KFJB 2FQQA 4DIEA 1BW9B 3U61B 3HZHA 3CLSC 3DVRX 1NIPA 1FDUA 2YYAA 4JLAA 4QBKA 1I1QB 1KSHA 1A9YA 1GRVA 2HSZA 3UMCA 2OTCA 1K8QA 5IH3A 4LXIA 4J3JA 4P5EA 1LZLA 2HGZA 4DMFA 5LU9A 1B74A 2P9JA 4IEFB 1UPBA 4ZO9A 3SS9X 1LFDB 2WILA 3QPUA 3G2KA 1T2VA 4QD3A 3F73A 2REBA 2HREA 3AU8A 3SCZA 1M72A 4QUIA 2MINB 5DULA 4ZJPA 3K2QA 1XDGA 1ZK1A 1CRZA 2B0JA 3EGIA 1XD9A 3MIIA 3AB8A 4MUKA 2AUMA 2PSDA 3N87A 1JFRA 4G1EB 4BYMA 4LQLA 3LX8A 2D0OB 5B58T 2X3YA 3TIFA 3UMBA 1EK6A 3VVLA 4I36A 3HK2A 5IJWA 4KVAA 2CUNA 3A9RA 3IMGA 5LVAA 1DTWB 1OX4A 4LXTA 1NVUQ 1SKBA 4EF6A 4K88A 4RJJA 3FTFA 1BA2A 2IXGA 4ZV4A 3LGSA 1QV9A 2AGVA 5TJHA 5LB4A 2B9EA 2CJWB 1R1DA 4KGVA 5FTLA 1UBFA 3IKLA 3OLVA 1EVKA 1AE1A 1ZMBA 3UMVA 3BCSA 1R0KA 2AE2A 5JDCC 5BXQC 3NXKA 3OQHA 4GI2A 3K1ZA 3UG6A 1JTFA 3N58A 1KEKA 3NRBA 2HFKA 3QXCA 4DFDA 1KR5A 3C1TA 2JIDA 3JQ7B 3NCTA 3CUWA 3FTDA 5EKSA 1D5WA 1PYOA 2AFHE 5FI1B 2JLAA 3DV0A 8AT1A 1NF9A 3P9ZA 2AOUA 1F3LA 2QE7D 3R3HA 1NJ2A 3R7LA 4AC9A 3G1WA 1YS6A 1HDEA 2RH9B 4BXOB 1OZHA 4MKZA 1NRXA 2CMFA 4B3SB 3BWCA 2GLTA 2O3SA 4PYRA 2W93A 2VPPA 1PUJA 5IN4A 3N9IA 3TQSA 1JDVA 2Y0PA 2XCRB 5LMZA 2ZB4A 1KQNA 3C43A 5KDDA 1YVPA 1RXCA 4G0OA 1I7LA 1HSZA 3QVMA 1UADA 3UOGA 3KD2A 1PEDA 4BTLA 3B85A 4D82A 2WAOA 1Z7EA 1USUA 1LV8A 2DQSA 4MWZA 3IDFA 4YC7A 3KR1A 2ZIXB 1G41A 1MO6A 1PDOA 1LWOA 2WYIA 4KPFC 3D3WA 1Z8DA 3UAZA 5A02A 1P62B 3RUPA 4EUEA 1GFWA 1D09A 2VJNA 6REQB 2FR8A 2OCPA 3IUPA 3D0KA 1GPLA 2OHHA 2PUWA 3WLSA 1A97A 2AMVA 4WY5A 2OBXA 3NR2A 2XECA 5BR1A 1OB2A 2NP7A 3MTGA 4NIMA 4YMSA 3FCSB 1VIAA 5I9BA 1T9GS 3DPSA 1M8GA 2WV9A 5C81A 1OLUA 1OXMA 3VYTB 1U7OA 3A37A 3V4VB 1SB8A 1CLEA 1EUDA 3H3JA 4B43A 4JXXA 4GOOD 3BXZA 1AKQA 1BAPA 4OK5A 4Q21A 4RLHA 3I30X 2Y3IA 2PX8A 1AHHA 1WZNA 1DIGA 3WO1A 1QWOA 3CKLA 5B1SA 3BHMA 1B0PA 2AC7A 2MSDB 1YAJA 4UDYX 3T7JA 3TGLA 3VPXA 1PEYA 1U0EA 3D4LA 5B36A 4FFDA 4UCQA 4ZWNA 2VQEB 4AKGA 2Q1SA 3BERA 1R6UA 3DTNA 1QHGA 1KY5A 5DCWA 4B3XA 4C78A 5KOJB 2XWBF 1DXYA 3JYQA 4GWGA 4R2JA 4FKBA 3ZY4A 1XCPA 3MNFA 3LRTA 2BH9A 3QVTA 1XZJA 1JJIA 4CMIB 3WDKA 2GBFA 3HYSA 5DK4A 2XXAB 2XIJA 1GCOA 2KHZA 3WNCA 2OD2A 2EFGA 1OF1A 2ZE5A 4RM3A 4DJTA 1P0IA 4CIBA 2VYFA 2I7TA 4XTCS 2NT4A 3NFRA 2OM2A 1N5IA 2QSYA 3LF1A 2JFUA 3KOMA 1LJLA 1RJ9A 4NZYA 3PUIA 5EJGA 4CIWA 3W8EA 3LCVB 3OOSA 5SICE 4AJHA 1RD4A 3L9WA 3DMFA 4QA9A 3SPXA 1QVWA 2HNKA 2BP7B 4X7PA 3JV7A 5E7JA 1KHTA 3V2HA 4D9NA 1QTIA 3EOZA 1B14A 2R4UA 4MQUA 1YL5A 1JFFB 1BOFA 3EXHA 2XQGA 3RBZA 1E79D 2QYSA 3ZVKA 3WK4A 3A9CA 2JFQA 1PT6A 2I3DA 3O75A 2FX3A 1USIA 3PXUA 3WLKX 2EQAA 2GEFA 3LL7A 3ETJA 4ZCQA 2EVWX 4JKIA 1J5PA 4ESOA 4O0MA 1KSJA 2JCYA 3V9PA 4IRMA 1X9IA 2J67A 5EWLB 1C8KA 3GDFA 1R5BA 1AKWA 4L0CA 1DFIA 1FX0B 1UQUA 2C2MA 5LCXA 4EG6A 1UT5A 1L1FA 2ORWA 2Q2NA 3D3KA 3O8CA 1CF2O 4A2WA 4DMRA 3KPVA 2JC3A 4AF7A 2MSNA 3RC7A 1UFQA 1RWVA 3TB6A 4E22A 4G65A 4BE7B 1QHNA 2JBAA 5TMBA 5IKMA 1UJNA 1QYWA 3A1SA 3H8SA 5FFNA 2P2CA 1YS7A 4GL2A 2VRBA 1XRSB 2CSUA 4CN8A 3I2JA 1OW3B 5DLDA 3DZ8A 5AVUA 4MUJA 3DMGA 4IUBS 4LV6A 1K0FA 3WB2A 3WADA 2RIPA 2IRWA 1H1LA 1E94E 4TV8B 1YVRA 3ETGA 2V97A 3FSEA 3LLVA 1NUUA 4K5QA 5E1DA 4WFJA 5KQGA 3RK1A 4PPNA 4J03A 3HUUA 1JJBA 4ZT6A 1JPNA 2IQ5A 2B6HA 3WL6A 3T0IA 3VNSA 3QLUC 3A27A 2C4HA 2NOAA 1ZU4A 2XCQA 3OEHD 4ND6A 4YRFA 2QTCA 3E1KA 5CDHA 3AQ4A 4ZVUA 3P9KA 5DNDA 2RH5A 4X1IB 1ZJ4A 2J5XA 2QZ4A 2FMFA 3CLTC 1BQ3A 2XKBA 1U3VA 1WP9A 2XNDA 4EJMA 4ON9A 1CY4A 2VJDA 4BN4A 4ZJYA 5IKXA 1NW6A 5EWMA 1GHTA 2JVJA 3JAWB 3CR8A 3TTYA 3ZHQA 4B31A 2GI4A 2GDZA 5IK2D 3KEQA 2NV2B 1KDYA 2A33A 5IJ0B 2Y1LA 5FL7D 3QEBZ 1MAWA 3KQKA 4H35A 4K9KA 2W6NA 4WINA 2PGIA 1K27A 1G5FA 1SNYA 3OT1A 1QHYA 4TL8A 3BRCA 4CTNA 4IEIA 3FZYA 4FT4A 2FG7C 2ZSDA 1IZYA 5JJIA 1JKJB 4G37A 3O84A 2DY0A 1PDVA 3ROFA 4LNAA 1QJCA 1J7JA 3HACA 3T3IA 4EMSA 1IATA 4RK0A 4CMGA 3L1KA 2D3WA 4X65B 3FR7A 3VTFA 3OZRA 4JLPA 4MA5A 4DV1B 4MNTA 2JHPA 2W4MA 3STWA 4MVJG 1OXXK 3EBPA 1H2AS 2R7NA 1SHLA 1VSBA 1N2SA 4M89A 4PYLA 3KJXA 1C3OB 4QULA 4GI3A 4AKTA 1VRWA 2XE6A 1LBIA 1QIGA 4F5ZA 1GG5A 2H2IA 3IURA 4G24A 3UGKA 4OX9B 3E9YA 2O3JA 1NP6A 2PH5A 2WP8J 3NDIA 3PPIA 1N9GA 5CTJA 1AKMA 3FMVA 3WGKA 4DXAA 4ZHQF 1H9BA 3HI6A 4HLCA 4H3VA 4M1WA 4V1CA 3E6AA 2VS1A 2XDQA 5F78A 3RUDA 2WD9A 4MTCA 2ODNA 5AKJA 1J90A 1PTJC 5FPYA 3S5UA 1U1EA 1W36C 1X92A 1XTRA 3DQZA 3SSMA 4BNKA 4JS0A 3SOZA 4PSUA 5JWOA 1TM1E 1YONA 4CLHA 4DCUA 5LQRA 4UHEA 2FFAA 2RC5A 4HYEA 4GICA 4HQ6A 1CU1A 1LXCA 1WY7A 2OHXA 2WUEA 2EBUA 3DMRA 3IP6A 4IBOA 4Q9IA 2XOKA 2UZ4A 3CA8A 1PZFA 4TXMA 2IHKA 1DKOA 5C34B 5KQPA 1E9VA 2RGXA 3EW7A 3N2NA 5LMNB 4JT8A 3ELBA 2WJGA 3E2PA 3RSLA 5EGSA 1N5JA 2WOOA 2I4LA 5I7RA 1P45A 1P61B 1P44A 5CLLA 1ADBA 1NXVA 3BGDA 1P31A 3GEEA 4M0CA 3EZ2A 3G9TA 1F5SA 2Q1TA 2GSDA 2PIDA 1QCZA 5D3QA 3KYDA 4RABA 2OXRA 5FOUA 4NS1A 4Q9DA 3ANXA 4B45A 4LRSB 2X8AA 4ERNA 5KNCD 4A4DA 1YK0A 2JBWA 2PKYX 3KO8A 4MDHA 5EEGA 2ZS8A 3KLNA 5AVJA 1DT3A 3BMNA 2WW8A 4AMGA 5K0GA 3ZVMA 1SKYB 1UP4A 2B2CA 1X1DA 2C4WA 2WVAA 4I55A 2PX2A 3EHDA 4D6YA 4EW1A 3CKKA 1XMQB 2L69A 4XCQA 3UPTA 3VDXA 3MT9A 1EUZA 2X2PA 3FRIA 1J0BA 5B12A 5K0CA 2Q8PA 2ALJA 3COYA 3VR2A 4A91A 3I2HA 3ZU6A 1X1AA 2HRBA 2NTVA 5H83A 3WZLA 4YMIA 2XUIA 4HBGA 2AFVA 5CFZA 5KNBA 1FSGA 2XB6A 3ERCA 3VNUA 4K3UA 3PC3A 1P39A 3E9RA 4MW4A 4YXFA 2PL5A 4U9HS 2QQEA 3E5HA 3T38A 2N46A 1U04A 4UNSA 3N86A 5ICFA 2HIGA 4NPHA 4CCYA 1ESEA 1C1HA 1AKNA 3B8EA 1HXHA 1QNFA 3OPMA 4G3XA 4QJ4A 2LXNA 3DE0X 1X70A 1WHTA 1ETHA 2DX7A 3WL5A 3WOVA 1Z0FA 5EUBA 3K32A 1MW9X 1QS0B 1E5TA 1B6GA 2H4JA 3AF4A 3PFNA 3EWNA 2B7LA 4OK3A 2EP5A 1UBOS 1XVTA 2VA8A 3FROA 3K94A 4YBRA 2E5LB 3KSDO 5MDHA 2ZRDA 1BU8A 3K4PA 1KWKA 3IMCA 4DRXB 4Z4QA 3NWOA 3DLTA 1LPMA 1Y7PA 4INOA 2VDVE 1REQA 5IZ4A 2AQIA 2O54A 4TWJA 1KKUA 4JXKA 2GJKA 3DR5A 1M66A 4MKHA 1PGPA 1Z8HA 3VPBA 3H1TA 3OFNA 2G63A 3VR6H 1TD9A 1DEXA 4LN1A 1P74A 4G63A 5BQXA 2B7CA 1R6BX 2HI0A 2M9MA 3DHVA 4R8MA 2I2DA 4TYQA 4WBNB 1A9RA 4D97A 1HBJA 4JP1A 5FX2A 3TMKA 2UVDA 3ACBA 3PNPA 3WGVA 4BC1A 2C00A 1RKUA 1OZGA 4K9SA 2AYXA 1NLFA 4U7FA 1H2EA 4NMHA 4LXGA 4IDOA 4M8NE 3SFVA 5HJ2A 1PX0A 1NR7A 1ZWKA 4FHZA 4ZO6A 2H1HA 4KMMA 4AS3A 1NTRA 2FWRA 1G3RA 2QAGA 2EW1A 3TZKA 1YCHA 2P0EA 3SYLA 2IHUA 3QPAA 5EXTA 4ZQFA 3VR4H 2Q9AA 3NG1A 4I4TF 4CNQA 5CEJA 3HRKA 4MDEA 1LRJA 1THTA 2NWQA 3M6UA 3OKAA 3MZ0A 4XB6B 3MT8A 3IQIX 3HJNA 2GXQA 4ZVMA 4CKEA 1MHTA 4Y2UA 3DLHA 3G1TA 1GCIA 1XNQB 4K6HA 4CM8B 1JG6A 1LK5A 2QW8A 3GBPA 10MHA 4K8OA 4AWBA 1Z88A 3ET5A 1Y7TA 3F6EX 1P2TA 4RK5A 1FTNA 3GNLA 1IBCA 2J87A 5FR2A 4EGCB 1KTIA 4A16A 3I5AA 2UDPA 3IOMA 3ZIAA 2Q4BA 3CG0A 4YRJA 4A10A 3T9FA 3KHUA 5H0IA 4JLJA 1YRAA 2H48A 3HKBB 2JZOA 3IO3A 1YL6A 2VTDA 1J23A 1TM2A 3CR3C 4YPFA 4F4JA 5FBWB 3FCEA 5FRDA 3KE9A 1THGA 2CT8A 5JRZA 1RXIA 3RIMA 4YRRA 2VJOA 2BD0A 4BQEA 2CHEA 2DWUA 2O07A 4GHWA 4S2UA 2A5JA 2X23A 1GG2A 3LRXA 3RROA 3JQ6A 2A9QA 4WNYA 1Q14A 4WLFA 5G0TA 3ST7A 4TQAA 4EHKA 2OYSA 3S2YA 1U7XA 3H1PA 2HY7A 4J75A 1PZEA 3KKNA 5E8JA 3W9SA 4FYKA 5JAMA 1XZLA 3OJXA 4WX2B 2FMXA 2NO1A 2YMPA 4TL6A 4BFTA 3FZGA 4P35A 1DXOA 1M5TA 4PM4A 5C51B 2WUFA 3PPVA 4HVTA 3LX6A 1FX1A 3A4MA 4TTSA 4U39A 3DAGA 3HDGA 3FJYA 4F7DA 4ZAVA 2C3YA 3K0AA 4I46A 1LDMA 3GJRA 2PNFA 3LXXA 3WNDA 2HEIA 2D06A 4UKDA 2BMWA 3PQEA 4GZ6A 2V7UA 3NC4A 5JFTA 1KKLA 3HC7A 3HVHA 4FEEA 1WVMA 3KLMX 4UUOA 4JKYA 1H22A 1QF7A 1NW8A 1YQ9A 3E5RA 4JYMA 3S70A 3QOYA 3WWYA 3X1JA 4AN4A 3BK7A 2P4EA 4GP7A 4LZLA 4XR4A 3ZQKA 1LVGA 3FBTA 3CZMA 4TKMA 1YSCA 2ZTVA 3FPJA 1JG4A 4OBEA 2D59A 2GYUA 4JK3A 4X54A 1C7JA 4TM7A 3RFTA 4F6CA 4ZCMA 4XIFA 3DZFA 1YE5A 2B98A 3KT0A 2GEKA 3K7EA 1XFDA 3A10A 1RYFA 4N3GA 4Z0NA 1XJQA 4KXNA 2QTWB 4H7DA 4BX0A 2O6HA 1NA5A 5E7MA 5EMNA 5TQJA 1KZ4A 3TXYA 4DLLA 2CK3D 1T2NA 3H18A 4KQCA 4FFBA 4YP1A 2HHJA 1RWMA 1X77A 1Z9BA 3UMJA 1EFKA 1CE8B 4DPLA 2I1WA 4PYJA 4EPVA 3TINA 1D5CA 3CMCO 1GG8A 1XKQA 4MVJF 1KYTA 3NHWA 1Q0HA 2I9PA 3G2LA 3TRIA 2IXEA 3TRKA 5HUQA 2XGGA 1T26A 1P2BA 3A11A 1B0UA 1DSSG 1SUSA 3OU7A 5LBUA 3RIXA 5KYTA 1G0NA 2BC9A 3FD8A 4DDMA 4KREA 1U3TA 2Q3HA 5FBVB 1GVHA 4CDNA 2LPMA 2QROA 2QQ0A 3CMMA 5HZMA 4KXXA 2P9FA 3W6PA 1G5TA 1JIQA 3LLCA 3NEJA 4Q4HA 2JVKA 1QSGA 2E4XA 4F7WA 1QTQA 5IAJA 4H27A 5DTRA 2WYUA 1DRWA 4IIDA 3EVBA 4NG5A 4XWTA 3PFIA 5ALFA 1H8ED 2HNAA 3Q15C 2IF0A 5LA6F 1T6XA 4B6EA 5LNK6 3D2LA 1QLHA 4YJFB 3GFBA 3WL3A 3WWDA 2WTUA 1V3UA 2PT7A 1N57A 4KZPA 1I1HA 3JALB 1N5MA 3GVIA 4PS0A 3PRHA 2GF9A 2ZRGA 1P9WA 3NT2A 5CDUA 1GYQA 1NQVA 4FI3C 1CR6A 1JR3A 3QA3E 4ZN6A 3MBOA 2AZXA 3EEQA 1FW6A 1P4SA 3JYNA 5DMXA 4D3YA 1KJJA 3C16C 1UKYA 3ESRA 1X9HA 4HWRA 4XDZA 4MV8A 3FOBA 1QR6A 1ZGHA 5CFOA 2QP4A 4JLBA 1RNLA 1TEXA 2AJBA 3MTIA 1DEAA 1SK8A 3ZJVA 3WKDA 4D4LA 4DCOA 1OX6A 2HLHA 1UPXA 2WVGA 2B82A 2JHCA 5C4MA 4G07A 3WXBA 1A4RA 1T2UA 1SCUA 1YR7A 3BEDA 2QMHA 3H5AA 3MJHA 3M2PA 2IEBA 4DADA 3N2KA 4KV9A 4J1TC 4PQEA 4KXWA 1TADA 1AIPA 2D2FA 3H84A 5FPPA 4QGSA 1FQWA 5DYWA 1BE6A 3JR3A 5F7XA 1KMHA 2X9VA 3KLOA 4UHDA 5EFOA 1UP6A 1ZI9A 2CLFB 3K9CA 3DFZA 2VJMA 3TQQA 2I2AA 3BH6A 4XEHA 1V8FA 4NXMB 3ELYA 3B6IA 3OD5A 1R0WA 3LE8A 1E9FA 4FYVA 4RPIA 4W9RA 3K9QO 2TYSB 2C98A 4RF4A 1XZAA 1TA0A 2Z3VA 5JMOA 1G63A 3GRYA 1BXGA 1AKEA 1MIHA 1ECPA 4JBIA 3MWJA 1XKXA 1F4VA 3NZEA 4GMXA 4RY8A 2IUYA 3KALA 5CM2Z 1S9DA 1PR3A 2PYIA 2TMGA 3MJDA 4WT7A 4B7ZA 5C1PA 3ZWAA 3KUXA 2D8AA 3ZY5A 1JDJA 1Z45A 3MMZA 3ZZMA 4OB8A 5IXJA 4KEAA 2ID8A 4ITRC 1Z2EA 5HZKA 4HUQA 1DV2A 2XB4A 5ARCA 3LJKA 4DNFA 5DRYA 1FP1D 5I9LA 1YVUA 5JAIA 1TB4A 2UXCB 4UUPA 4P0QB 1NJ1A 4ENVA 5CX4A 1HUQA 4YQYA 5CNJA 4DV2B 3TW8A 2YZGA 2K6GA 2P9ZA 1OI3A 3E9EA 4L8GA 4UNQA 3FHLA 3THOA 5BV7A 2AF4C 2FZ5A 3IP7A 1R6VA 1YVEI 1MQ9A 2J0UA 2Q2VA 2WTMA 2ZEJA 5FUMA 2C2YA 3HY6A 5B7NA 1KI6A 3IVGA 3U7QB 1CEYA 4HL6A 5AHKA 1I2CA 1N34B 5JXWA 3UATA 2H1LA 2W9XA 1CR2A 1XEWY 4WVLA 4YRPA 4MB0A 4CMBA 1R2QA 3I2IA 1AK9A 3GOQA 2V7BA 4TMTA 4D9CA 1R16A 1EK5A 2YICA 2WJVA 3F7MA 1XC7A 4LY3A 4NICA 3FXAA 4QHTA 4QG7A 3W6OA 3EDYA 4ZDKA 1OY1A 3D6MA 3MMNA 2XWSA 1N78A 1C8VB 1E6EA 3WIVA 5KVCA 2PZKA 2ZVQX 3N0WA 3O4IA 3ZWNA 4AJLA 5EHIA 1X9GA 4CG3A 2Q5OA 3S27A 5CBPB 1IULA 1GWNA 3OZBA 3B6EA 3DBOB 1T3HA 3ZCRA 3GV0A 3KFLA 5C0OE 4IFTA 4RF2A 4CU5A 2YV3A 2PQ2A 3H11B 3HVUA 4G0YA 3TLAA 1LPBB 5IBRA 1XTIA 3H0CA 1P0CA 5A6SB 5IKEA 2QUKA 1L4NA 3T7SA 3ADCA 1S3SA 1KK1A 2VDPB 3KOOA 1NWHA 1UPAA 2B69A 1Q12A 1L7NA 2DSNA 2DWQA 3AGPA 3BMXA 3QLVC 4UEOA 3Q3VA 4XPIB 1BW9A 4XIYA 3D6HA 2AH5A 3WKBA 1LX6A 4AIIA 4DCSA 4HNSA 5I4IA 1QOPB 1RHUA 1NWCA 4QZVA 3H9JA 1Z4MA 2FQYA 4JLUA 1N1EA 1RI1A 2J45A 2YZ7A 1DEOA 2C2BA 3P2IA 2Z