5CK4A

Signal recognition particle receptor srb-gdp from chaetomium thermophilum
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
300
structure length
214
Chain Sequence
TTLPSVLLIGPSGAGKTALLTLFERTSYKVDLDAAGATARKFLLIDTPGHPKLRGTTLQHLLNPSPSLTIIPYKSKLKAVIFLLDAAALADSDGDYLSQTASYLYDVLLSLQKRFHSRKNSRAPSSIPVLIAANKQDLFTAVPASLVKSRLEHELGRIRKTRQKGEGWLGAVGSKEFKFEEMMEFDMEVEVMGGNVIGDGPGAERWWRWIGERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative signal recognition particle protein
publication title Structure and Switch Cycle of SR beta as Ancestral Eukaryotic GTPase Associated with Secretory Membranes.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Signaling protein
total genus 76
structure length 214
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09439 SRPRB Signal recognition particle receptor beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ck4A00
3TSWA 1XEXA 2PMDA 5FOWA 2Z0MA 1E2KA 3NKVA 3H84A 4KV9A 5G3ZA 1JQLB 2KBEA 1OFIA 4I1VA 2GESA 3W5JA 1PLJA 5B2ZA 4OHXA 4HUQA 1B23P 1TEXA 5CIWA 3TW8B 5J47A 5JWOA 421PA 4ASUA 1T4GA 1T91A 4WZBE 2QG6A 2IWRA 4OI1A 2ZROA 1II0A 2V9PA 4DSOA 3SBDA 2ZYVX 1EFTA 1YZLA 4QBGB 3BJIC 4Q4JA 5JI2E 5B30A 1UEJA 3EIEA 2ZJBA 1CLUA 3P26A 3KUCA 2OLJA 4GT1A 1YE8A 2NO0A 4LJ5A 1BMFD 1VCNA 2CHVA 5JS8A 2QAJA 5J4LA 1HY3A 1NVVR 3FMFA 4UJ3A 5LBIA 4V0LA 2VHTA 1XPOA 3KQHA 2GJ8A 4RVCA 4LHVA 2IYLD 4DDUA 4IXNA 4ZDJA 4EDHA 4F93B 3IQWA 1GITA 1X8JA 3VX4A 1JR6A 4GL2A 2X2FA 2GEDA 2QZ4A 4EPYA 3EPHA 1JI0A 2D62A 5FI1B 2ODBA 1CBUA 1JPNA 3U6BA 4B6EA 3I4LA 1NMYA 2VSXA 1RC8A 5FOTA 1AS0A 4B3BA 4O3MA 2ERYA 4MRPA 4RY2A 4JBXA 2OG2A 2ZS8A 4JJKA 4QRHA 1KI6B 2VRWA 3CR8A 1LFDB 3V4FA 4EJSA 1RW4A 1VCMA 5SZIA 2B92A 1E2HA 1CJKC 4BFUA 1Z0FA 3CPEA 4KLNA 2LKCA 3QJYA 1KZGB 1S4QA 1Z0JA 3GJ4A 2JIZA 1KK1A 1NLYA 1QHIA 1FP7A 5EXSA 5JS7A 2O8CA 2ZUBA 4P4TA 2BHRA 3LNCA 3MJHA 1R7RA 1W2GA 4MRNA 1ZU5A 2FSGA 2YNMA 4UXJA 3DM5A 3NBFA 4QM7A 2OFOA 3R7WA 2P3SA 2DBYA 2FFHA 2A3RA 2J0VA 1LV7A 2DY1A 3L43A 4ZDIA 4P4SA 4D80A 5AUNB 2H8KA 1Q1ZA 2FPKA 4MH0R 2UZIR 2ZS9A 3IHWA 4E5UA 1CTQA 3TNFA 3BAFA 1KI4A 1E2QA 2YV5A 2QM7A 2BIFA 2A5FA 1XZQA 2EFHB 4AYXA 1GRRA 4EPTA 1TPZA 3TH5A 1R0XA 1JALA 2DWQA 4ZKDA 1DADA 3B2EA 4HUQB 4PPNA 2GCPA 5SZJA 3GQBA 4TL8A 2C5LA 1UF9A 2CCJA 3E70C 4OHZA 3QSYA 3L8ZA 2D7CA 3TK1A 4AG5A 4F4JA 1EGAA 5AUQA 3RVBA 1LNZA 3OZXA 5IT5A 3U3KA 2C96A 5GVSA 2OCAA 2VBCA 2F9LA 2CL6X 2JLQA 3VTKA 4PSVA 1AZSC 3WYAA 1TUEA 1CIPA 2WWIA 3TAHA 3RYTC 1E9RA 1JPJA 2NO6A 4FIDA 3P20A 4N0DA 5FTNA 3KKNA 2WWFA 4QGHA 3GFOA 3O8CA 1E9AA 2CK3A 3LLMA 3NDBB 5JCZA 3SC3A 3L82B 1WQ1R 1YZUA 5IHPA 5JLJA 5F9HA 1NKSA 4Z1MD 3VNUA 2X2EA 4HI0E 1VKJA 2WPDD 4JJZA 4NE2A 5KSOA 1HEIA 1MV5A 1RYHA 4ZCIA 3CRMA 1DEKA 1T6NA 4EJSB 2F43A 1EFRD 1P75A 1Z29A 4NYJQ 1FX0A 2W00A 3EXAA 5JSZA 1GKUB 3JZMA 3B82A 4LDJA 1VG8A 3MWYW 1D5CA 5LD2C 3U4QA 4HDQB 1BO6A 2CJWA 2VHCA 1DO2A 2W6JA 3DDCA 5CM8B 2O8CB 5FH9A 4Q4HB 1FP6A 1E79A 4A9AA 4DLYA 2ZSFA 2XZLA 4Q1FA 3CH4B 4M53A 4RD4A 2DFTA 1WDTA 3KJGA 1UEIA 2RHDA 3HR7A 1JXOA 2PBRA 1DAMA 2GEUA 721PA 4M1WA 4C0KA 3BH7A 3OIWA 4RKFA 5SZHB 4YDHB 1NIPA 3PEWA 1KY3A 4N3NA 3BB3A 4M2LA 5LB4A 1N6HA 1JQJC 4AYTA 1TADA 5CJPA 4HAVA 5K8UA 1U99A 1SXJE 4WW0A 2G9NA 2ZRLA 5K8TA 4DIDA 2DHRA 4E07A 5DGXA 3IEUA 2IW3A 3AVTA 4FMDB 2NPFA 1OB5A 4QGFA 1FPMA 4OBEA 1U0JA 2GCOA 1CU1A 3B6EA 3SHFA 4B2IA 3M6AA 1UPTA 2OUKA 2QQEA 4HAUA 1X8LA 5TB5A 2WAYA 1IN6A 5GVRA 5EXTA 3CONA 4WOPA 1JEDA 1XD2B 2YWHA 4HDOB 4V0ME 3WMEA 3SJCA 2FMXA 1DG3A 4M9SA 4JLNA 3RS5A 5L8VA 4HATA 4A2PA 2EWWA 4PZYA 3U60B 3PCRB 1TMKA 1JECA 4Q7LA 4G5QA 4QOSA 1XDBA 1NVWQ 3BFXA 2N1BA 4PC7A 1OXVA 3FE2A 4V02A 4Z8XA 3SEAA 4WXPA 1YRBA 5FUWA 1P9NA 1KI2A 2JJ2D 4JVLA 3TBKA 4ACAA 3V00A 2ODWA 3LVQE 2FEMA 4Q9LA 1G8YA 3RHFA 1S1CA 3OEED 4M9ZA 3FHTA 1P2VA 1DAEA 2RCNA 3MWKA 5B58C 1IN8A 1OYWA 3B78A 2QENA 5C4MA 4WZ6A 3KDSE 4W5WA 2BKEA 2J0SA 4B33A 5KUTA 2FOLA 1KSHA 4DEYA 1OXUA 2F55A 1Z08A 1CJVC 4BLQA 1D2MA 2F43B 4LOAA 1BMFA 2HUPA 4I1SA 4U00A 2QROA 3FHOA 2RGEA 1Z2CA 2BMFA 4TMXA 2GNOA 1U8YA 2E1RA 2GXAA 3DM9B 3ICQB 3QF7A 4ON9A 3ZH9B 4NPHA 3U4QB 4WA7A 1E1RD 2QP4A 4PC2A 1HUQA 4M1TA 4PHFA 1RJ9A 5EE3A 4PSKA 4RD0A 4TL7A 3C41J 5DYGA 3WY9A 2V55B 4D2IA 1XTRA 2JA1A 2CEAA 3NH9A 2AFHE 2VSOA 1TQDA 4N0EA 3D3QA 2A30A 3VHLB 2IYXA 2ZJ5A 4A2QA 5FTKA 4LJ7A 2QRNA 3AKYA 4YC7A 2R62A 1G5RA 4B75A 4MYHA 3E1SA 1E2LA 3Q8XB 1UKVY 4LV8B 1KDRA 2IL1A 2V7QD 3T06B 5IRCD 1XBTA 4DC9A 1SGWA 2HT6A 5DE3A 1P6XA 3KXLA 3MAAC 4TSFD 4DJTA 3U5ZB 3OIUA 5BN4A 1OW3B 1COWD 3UANA 1II9A 3VKWA 2GCOB 4KBGA 5JEEA 1E2NA 2VH5R 2IUUA 5CDFA 2QRZA 4LWZA 2CL0X 5EE1A 3GPLA 4KFRA 2PX0A 5SZKB 5E7IA 2HCJB 2XNSA 4AIIA 2QN6A 1ZW6A 4II7A 2HT1A 4X8MA 2YWGA 3CIOA 3CNOA 3AKCA 4B32A 1SVIA 5C1BA 4Q1BA 1T0JB 1KI1A 4TWZA 4OQXA 2QMEA 3IO5A 2Z43A 1BYUA 1K5DA 2TMKA 3GCGA 3BB4A 2ORWA 4M9XA 5HE9A 4S35A 4JYCA 3T15A 2Z5FA 3TW4A 2V6JA 1XMVA 2GF0A 2P5TB 4BGDA 1AS3A 1MRSA 1WA5A 4MKFA 1NG9A 3AM1A 3EPJA 3K53A 1L8QA 1TF2A 3B85A 4R7ZA 3OESA 4OI0A 1HQCA 1I2MA 1RRFA 1XMIA 3A8TA 2NOAA 4RZXA 4BFVA 1E0JA 1DE0A 1TUIA 1E99A 2OILA 4IFBA 4DDWA 4C0BA 2W6ID 4M1YA 1R5BA 4JLDA 1YZNA 2R6GA 5FPYA 3AVXA 3ZGXA 4CEHA 4B6FA 2H16A 1GRQA 5FL7D 2B6HA 1J70A 4WXRA 2GCNA 1PLKA 3OEHD 3PFIA 3EW9A 3RSLA 1NBME 4NDZA 2C2HA 2J41A 3A58B 2ZJ2A 1BKDR 3QXSA 3NC0C 4C3ZA 5J4VA 1F6BA 2WAXA 5F98A 1Z0AA 4ZDKA 4JKYA 4RKEA 3LH5A 1TAGA 2VHUA 1Q3HA 4IKEA 1HTWA 4BLSA 1SXJD 4H9GA 2GJKA 5TV2A 4W5HA 2IYUA 1ZBDA 1E6CA 2FG5A 2ZYWX 3C15C 3KB1A 3MJRA 1CJTC 2WPDA 4HB0A 2AFIE 5FBQB 2PMKA 3TVDA 1EWQA 3C16C 1OFUX 4DIEA 1SQ5A 2QP9X 3QBVA 2OHFA 4RFSB 5CIQA 4DLZA 4AYWA 1EFRA 4TL9A 1ZINA 1DO0A 4KJZA 3K1JA 1UBEA 4DXAA 1GAJA 4BEJA 3AVYA 2CNWD 4PQYA 5EP3A 1G8HA 3A1WA 3FTQA 3JVUA 5AUOB 4KVGA 3SQWA 4AG6A 1P9WA 3SE0A 3LA6A 1G6HA 2CMKA 3PQCA 4X8OA 4CYMA 2Q0HA 4NBSA 2ONJA 1NJFA 3B1YA 1OXSC 1T0HB 3HU3A 1AKYA 4NMMA 1N5LA 4ESVA 1Z8FA 2QE7D 3NWJA 2QMHA 1E2DA 1CJUC 1XWIA 1YRAA 5ELXA 1Z07A 3BGWA 3ADKA 4CZ2A 3G0HA 1KI9A 2XJ9A 1G3RA 3X1ZA 4Q1AA 1OFTA 3QXCA 5F2EA 2RGGA 2IS2A 1HE8B 1HT2E 2F1IA 4GZMA 3ADCA 2D4HA 4JT2A 4KLZA 1S1MA 2BM1A 1RRGA 3SJAA 1C9KA 1FUUA 1KO4A 4PO9A 2WWWA 3KJIA 3N2IA 2HEIA 3AP3A 3LBNA 4B3CA 2OXRA 2XJ4A 2P6NA 1VPLA 2IX3A 1YZTA 121PA 2F1JA 2OXCA 2GJSA 4JL5A 1US8A 2NZ8A 3LV8A 1VG9B 3AEZA 1FW6A 3GLGE 4TYQA 4TYYA 4QL3A 1E0AA 3C8UA 4AKGA 1R8QA 1VIYA 1XP8A 2Z4SA 3CWQA 2HDNB 2PEZA 3PEVA 4BASA 1DELA 1GL7A 2O8EA 2BBSA 4TTQA 4UNQA 3R20A 1I4LD 5K8IA 1GFIA 4JZKA 3R9WA 4HB3A 2QY9A 4Q7JB 2JJ2A 2D2EA 1D2EA 3I72A 3RS2A 3FFBA 3C14C 1FQKA 1Q1QA 4LC0A 1W49A 2GHIA 2XB2A 2Q9BA 1GKIA 3ZJYA 3CH5A 3OEEA 2WSSD 2F3RA 3U61B 5JWHA 4TL6A 2BJWA 3X2SA 3MGCA 2PT7A 3MWLA 4QHSA 2ZSBA 1Z2AA 1NN3A 4DSTA 1G3IA 5F3WB 1II8B 3AF1A 4DSNA 2CHGA 5DSZA 4QHTA 1KO1A 5JWRA 5FOSA 1K5GA 5AK0A 4UNPA 4KAXA 4DRZA 2BBWA 4URXR 3F0TA 3R8CA 1E1RA 5DI3B 1OF1A 4LYAA 4Q4AA 2OT3B 1EX7A 3LFUA 2AD1A 2ODEA 3TMKA 5HPYB 2HYIC 3BRWD 2GJ9A 2WOJA 2YINC 3QF4B 2H17A 3QUSA 3RABA 3U44A 4K81B 5AJVB 3SFZA 1YR6A 2OLKA 5EJEA 4B35A 2ZI9A 4A8JA 4JLPA 1XU4A 4MQBA 2RGXA 2ZU0C 2C03A 4FI3C 4MGIR 1D9ZA 2HCBA 3FFAA 4NCIA 3QVVA 2B7BA 3K9LA 4B48A 3K09C 4M0LA 1NJGA 4GNKA 3L0IB 2WJJA 4HZIA 4FN5A 3W6PA 2BC9A 2N42A 4US1R 4B76A 3Q3JB 1IJFA 1S2MA 5IK2D 2CLDX 2R2AA 1XTIA 2PLFA 3EIQA 4XD7D 2W58A 4US2R 5CB8A 3F8TA 4TZ6A 1G64A 3AP1A 1KI7A 1Z0DA 2OZEA 4TSFA 3L0SA 3OF5A 1COWA 1HE1C 3WYGA 4HAZA 3HU2A 2CE2X 3ADBA 2FGJA 4JLAA 3ZDQA 1QHSA 2ZI5A 4LJ8A 4QNMA 4JSTA 1G5TA 2O0KA 2WZQA 2B21A 1J99A 2PZFA 2WJVA 1IY2A 1NBMD 1M6NA 1O3YA 3K0AB 5HE8A 5BXQC 5DN6D 4GMDA 2OBLA 4A0FA 3KX2A 3LO5A 4JKIA 4URVR 2OE2A 1OH5A 2P6UA 5DISB 3UWOA 1HT1E 3EIHA 1EX6A 2XEXA 3KQKA 1XRJA 2QU8A 2PLRA 1NP6A 4RD6A 2J0UB 4ACBA 1KMHB 5JHHB 3VKHA 2J5XA 1ZRHA 1TQ6A 1UBFA 2NIPA 1LS6A 1VCOA 2QI9C 4N1AA 4PHGA 3KFVA 2GK6A 1QVRA 2W6JD 2F7SA 4E09A 3U3JA 3U3MA 4NYJR 4JLOA 4EQ6B 4TQUS 3L0OA 4OHVA 4RD1A 1W36C 3RWOA 4QC2A 4A0HA 2AD5A 1XMJA 3KUDA 4F4IA 3OIVA 4YMWA 5KPDA 5FUVA 2HLDD 2G0NA 4GOXA 3AVUA 1LF5A 4G3XA 2H5EA 5FL7A 3FB4A 4BFWA 1Z47A 3TR0A 4CGZA 1S9HA 4LBWA 4GDFA 4IDNA 5KDDA 4JLKA 1AQUA 1SKQA 2ZREA 4CEIB 3JVVA 3Q7PA 3FYHA 2ODNA 3THYA 2FPMA 1DOAA 1IAQA 2D7DA 1X1RA 3FGNA 1SXJA 3N70A 4Q9JA 2W0SA 3A1SA 3ZQ6A 1IJEA 3QKSB 5JCPA 3U7FB 2EFEB 1KJZA 4G5OA 4A4DA 2KWIA 2YWFA 2QEQA 3DO6A 4LHXA 2KSQA 1CR1A 3VU9A 1P73A 3IBYA 3LWNA 2ZSDA 1GL9B 2EU8A 1FL9A 1G4UR 2JLSA 3KKMA 3LVRE 4XVUA 1Z22A 2ZQ5A 3GJ6A 3FDIA 1MRNA 4NH0A 1XPUA 2QAGA 2CNWA 2CVHA 1KK3A 1NNEA 2GXUA 2RAPA 4V0MA 3TRFA 4B73A 4PO8A 5CITA 3W9YA 3CZPA 2R8RA 1KYIA 4S2EA 5HR5A 3QG5A 5BYKA 2GBLA 5J4HA 1QG2A 1GKYA 1U2RA 1AN0A 2RMKA 4LJ6A 4HB4A 3PUVA 5EUQB 1IOZA 1MH1A 3I8SA 1GZSA 5TXGA 2O52A 2QE7A 4DCUA 2FFQA 1KSGA 1SVWA 1ZAKA 5EZ6B 1N25A 2H92A 1JXMA 1YZGA 1E2JA 1Z3IX 3Q5EA 1U8AA 2O8BA 1CR2A 3WNDA 1RKBA 2X8AA 2YKGA 3GP8A 1G18A 5AJYA 1WRBA 4EAQA 2G6BA 4ZI3A 4YMTA 1E2IA 3QQ5A 3NXSA 1C4OA 4OQMA 1OH8A 4Q9IA 1YJ5A 2RB4A 4GSYA 1OE0A 2GZAA 2MMCA 2PEYA 2VO1A 2W2XA 1KNQA 2YZ2A 1KJWA 3TUZC 1W48A 3QG1A 4LHZA 3VR3A 2ZR0A 3QKRB 2F1RA 2H1LA 3RWMB 4NZYA 1G5PA 2IHBA 3TJZA 2DR3A 4F38A 1G41A 5LB2A 2Q3HA 1NG1A 1MR3F 4PO1A 2IYVA 4O0MA 3DKVA 3U3RA 1YQTA 4CEJA 3QEOA 4MGKR 2AX4A 4IVPA 3R9XA 3K0SA 3BORA 1E96A 1JR3E 5DIFA 1AKEA 4AC9A 4B44A 4A1FA 4DLVA 3CF6R 4YMUA 2VL7A 1KOFA 3EZFA 2XITA 1ESNA 3THYB 3PJRA 4Q4HA 2DWPA 3EA0A 3ZYCA 1IXRC 3RAPR 3SYLA 1SXJB 4XOIA 2WSSA 4ILEA 3TAUA 3QKUA 4OKSA 1UDXA 1S9DA 3GEHA 3RRNA 3CF2A 3U7EB 4Z51A 2RGBA 1OIXA 3GJ3A 3VU9B 2V1XA 2K5UA 3P1JA 2ZYUX 1YZKA 3U3OA 5K8LA 1W4CA 4BLPA 2IYRA 4BZQA 1UDWA 2ZRGA 2VYFA 4DKXA 5JRZA 2Z6VA 4XSHA 3KXKA 821PA 2JJ1D 4RZUA 2QAGB 4QBIA 4V0NA 4D6PA 1XTJA 5DO9A 4RZ2A 5BW8A 4LBZA 4P0TA 5M04A 2OESA 3VX3A 4IHQA 1VYTA 3L0PA 3S1AA 3M4YA 3HR8A 4V03A 3O8RA 4AY2A 1AK2A 2Z83A 1TNDA 1RVDA 1HH4A 4DLTA 4L4UA 5EE0A 1XD2A 1FTNA 1Z63A 5G3YA 4A6PA 1WP9A 5IK2A 2O8BB 1W4RA 2DCUA 3K0CA 4L15A 4XD7A 4A8JC 4XTCS 2JDID 1M7GA 4ZCMA 1IQPA 1Z0IA 4LCBA 3GJXC 1U94A 2CDNA 1V5WA 3KZ1E 3QPWA 4XJXA 4D4KA 2FN4A 2JLUA 4HDCA 4DCVA 1W46A 1N6PA 5TY0A 3WP0A 4URZR 3SYKA 1FNNA 4IDPA 2IS6A 1NBMA 5DN6A 2QQ0A 2ZETA 1D8TA 4IDOA 1S0UA 1RYFA 3GLIA 1T5IA 1CXZA 3CW2A 3IIJA 2IYWA 1EFCA 1R4AA 3TIFA 4CEJB 1XTSA 1PJRA 4U7DA 4IXMA 4L5BA 2GF9A 4JLJA 4FCVA 4FMDF 2V8OA 2CXXA 3QPVA 5JJIA 3EC2A 5B57C 1NMZA 2J7KA 3ZD7A 1G7RA 2I4IA 2BEJA 4NKRA 3OAAD 3AF2A 3MFYA 3DMNA 1GIAA 2BWJA 3FWYA 3GJ0A 3NEYA 4IOLA 2DYKA 1JAHA 1ZJ6A 2PCLA 4FCTA 4D0GA 1E69A 3FPAA 1W1WA 3MLEA 4LHWA 4M1KA 5FPHA 2XXAA 2Z4RA 3H4MA 2A78A 3MRSA 2BVNA 4TYWA 2ZJOA 4DLXA 4RFVA 1D9XA 5EP2A 1WF3A 3PITA 4UJ5A 5C46F 2HLDA 2WWHA 1A2KC 2AL7A 3EWSA 3K8YA 4KVAA 4IRUB 3AQ4A 3UMRA 1DVRA 2NPIA 5KDOA 1OJLA 5CLLA 3V9PA 3A1VA 2A5YB 3B1WA 4WBSA 1X86B 3FMPB 3BFVA 3ZS8A 3IIMA 1OB2A 1Z28A 1E9CA 3BC1A 1EFHA 4KCGA 1N6KA 4NONA 5EUMA 3ZVRA 1IBRA 1BYIA 3DMDA 2G1JA 2IT1A 4HLQB 4X8HA 2RH5A 4OL0A 1Q1EA 2AWOA 4GBMA 3S1AB 1U9IA 3OIYA 4OQFA 4C0LA 4XVRA 3P4XA 5D3MA 5HTKA 1E9DA 5A0FA 2XSZD 5KNCA 1FMLA 2ZR9A 3NVAA 3THWB 2WIBA 3B9PA 4HLUC 1G291 2GVDC 2REBA 5CK4A 1OPXA 1XZPA 4FINA 2GJAA 2QP3A 4EKDA 1ZC4A 1K6MA 4MYUA 2VP2A 3KQNA 1UJ2A 2XNDA 1I4TD 4DVGA 2ZR7A 5AWFC 3UKDA 3RNLA 3D6TB 3GLGA 2O5VA 1ZUIA 3OHMA 2GRJA 4WVFA 2IK8A 2BBOA 1NVUQ 3RSOA 1G3MA 1ZD1A 4Q7MB 1JR3D 4CT4B 3WXMA 3P4YA 3L8YA 3WMFA 3ZZTA 5C2JB 4UNSA 2JLRA 3HPQA 3GLIB 3BXZA 2IS1A 1Q1BA 2GBLC 5HCIA 3OFND 5J5CA 4IFEA 1FTSA 2L0XA 1MO5A 4MUBA 3IPYA 4URUR 1KMQA 1H65A 3NH6A 4DCTA 2G0TA 4LYHA 3EZ9A 3C5HA 4Q1EA 4Q1CA 2XZOA 3REGA 2Q9AA 2AN9A 3T1OA 1UKYA 1QG4A 3NHBA 4U5XA 2HF9A 1NVVQ 2XXAB 4PR0A 4IEEA 4Q47A 1IXZA 3SFVA 3THOA 5KNDA 4BQSA 1AIPA 1YVDA 2JEOA 1DARA 1WXQA 2C95A 2JASA 1RZ3A 2ZJ8A 2FFBA 3SU8A 1W5SA 1FNMA 2R65A 2WM9B 5DNYB 2RGDA 2BCGY 3IGFA 4PHTA 5GADl 3KQLA 3LX8A 1KHTA 4LBVA 5G53C 4PX9A 4RFSA 2ZAMA 4DLRA 1XPRA 1VG1A 3AH8A 4EUNA 3CB4A 1N6OA 4H1VA 4DCNA 4FMCB 2O8FB 4L9SA 4PAOA 3I73A 3WHKA 1JEEA 1T5LA 2QORA 2ZI6A 5L3RA 2AK2A 4RSGA 2OAP1 2OFXA 5FPKA 2WOOA 2GXQA 1SVMA 3CRVA 2ZAOA 3H86A 3AVQA 2VEDA 4EJSC 2ANBA 3EARA 4PHHA 4KO8A 4O25A 3FVQA 1VHLA 5CYPA 4F7WA 2F6RA 5D3MB 5EE9A 1G6OA 1XJQA 1ZMXA 2QTHA 4HAXA 3X1WA 4BLTA 1ZNWA 2FJUA 5KSZA 1Q21A 5GJBA 2LWIA 2PZGA 1XTKA 4LJYA 4OQNA 3THXB 1Q44A 2A7QA 4JVMA 3BFKA 2RGCA 3GD7A 3WYFA 5FPTA 4I1OA 3ZQJA 3K0FA 2JGNA 3WNCA 4TMKA 3DEFA 1OLOA 1TU4A 2JJ1A 1IN5A 4OK6A 4DT1B 2FPLA 3GLGB 4B3GA 3CX8A 3CBQA 2ZRPA 1FUKA 3F3YA 2WWYA 4I81A 4A15A 4I99A 2KBFA 2ATXA 4ARZA 4KBFA 3NG1A 3PR1A 1P72A 1ZNXA 5EP4A 2ZM5A 2ZRMA 2VP6A 3A4LA 3H0KA 3EZ7A 4LYFA 1VTKA 1M2OB 4A92A 1W7AA 1T8UA 4PSAA 2IC5A 4EPRA 3T12A 2BJVA 2J9RA 4UXIA 3KB2A 4M9QA 1Z6XA 4JLMA 1LY1A 1AS2A 5FBWB 4MDEA 5E7MA 2REXB 1MT0A 3CLVA 1N6RA 5DHFA 2JDIA 2VP4A 1GUAA 4Y0VA 4LRWA 1IN4A 4GFDA 1KO5A 4LHYA 3VMFA 4A2WA 4IDHA 5FOUA 1ZM3A 3LQQA 1LB1B 3GLIE 1DAIA 1YR8A 4ZPXA 2GWHA 2EVWX 3K0CC 2VHJA 2ZJAA 5KNBA 4Q19A 3W6OA 1Z6AA 3BWDD 2O8DB 1C1YA 5KPJA 1NF3A 4LPKA 4XSGA 4FCWA 3RRMA 1KTVA 4XIGS 5KSYA 3VAAA 2CHQA 1II8A 4IOJA 3EASA 3LLUA 1XXHB 1XCMA 3Q7QA 2GKSA 3SS8A 1BOFA 2IEYA 3IILA 3TSZA 4FWTA 3RLFA 4AD8A 2P0EA 4D25A 2MSEB 2JLYA 2J46A 3OAAA 4DZZA 3AP2A 3KJEA 5DI3A 4P3YA 4Q03A 1KK0A 1WBBA 3HWSA 1KI3A 1LS1A 5LDDC 1PUJA 2HXYA 1NI3A 3BK7A 5FTLA 2OAQ1 1ZD8A 4BFSA 4YMVA 3UXMA 5GJWC 5BQ5A 3QF4A 1ZUNB 4KSBA 3GLHE 1WMSA 5C18A 1YHNA 1G21E 1JJ7A 3B7GA 3ASZA 1IN7A 2BKUA 4RD2A 2R6FA 4BZXA 5AUPB 1FFHA 2AWNA 2GEVA 3AF0A 3BB1A 1KZ7B 1DTSA 1T3LA 4ZCLA 5E3HA 4D82A 2WWGA 2JLWA 3W3ZB 2DFKB 4I1UA 3K0FB 3C7KA 4BZPA 1ZCAA 4OQLA 3LBIA 2B8TA 1N6NA 3SHWA 4BPBA 1K8RA 3AUYA 4OK5A 2ASEA 2J45A 2J1LA 2QPAA 4ARZB 5FL3A 4AWXA 4YXWD 3U2QA 1M8PA 2VP0A 1VYUA 2BMDA 2ZITA 1QHXA 3KKQA 3CRQA 4NL4H 2YOHA 4JMPA 3GFTA 3MCAA 2W0MA 2XSZA 3K0AA 1IHUA 4UXHA 5G41A 5AJWA 4C0QC 1OXTA 3TVTA 1OT3A 2R6AA 3UMSA 2DWOA 4KSCA 2IUSA 4Q1DA 1GP2A 1ZCBA 3W6NA 4BFYA 5DYIA 2NQ2C 1GRNA 1U9IC 4FW9A 4LYJA 2WWXA 2JAQA 5LPNA 2PJZA 1PZNA 3CX7A 1ELOA 4PAQA 1MABB 4A0RA 3K70B 1A1VA 1P9RA 1ZU4A 1ZM9A 1KMHA 2J0UA 2Q21A 3D31A 5KOYA 3DL0A 5TVKA 3W34A 2WV9A 2KI5A 3BOSA 4W7SA 1F60A 1R5OA 4OI2A 4RCZA 2ZSEA 1M1YE 3TUIC 3B8HA 4P4UA 1P4SA 1JR3A 3I3SR 3TQFA 4DBLC 4EQ6A 3A1TA 4C7OA 1G3UA 2FH5B 4QKQA 4BRUA 1UBCA 4O2RA 4OJQA 4B3DA 2FF7A 2GILA 4HB2A 3QXHA 4B2PA 1W5TA 3HJNA 1U0LA 5J40A 4NCKA 2X77A 1FOEB 3TGPA 1VMAA 2FGKA 3OFNA 3AKEA 1E4VA 2NTYC 3VR6A 1XMSA 3C4JA 4TT3D 1ANKA 2EQBA 4JLVA 1ZM4A 4LZZA 3AF4A 4P32A 4IOKA 1G4AE 4CEIA 3RS3A 1JBKA 2YC2C 5JBQA 4UKDA 3AV0B 1UAAA 1FMJA 2IXGA 2WTUA 2ATVA 4QJ3A 1B0UA 4HZUB 4QJ5A 1XXHE 2NO9A 3RDPA 1UBGA 3T1VA 1YKSA 3QKSA 2WBLC 5ANRB 3TUJC 4BEBA 2BBTA 4DEXA 1OH6A 1AJEA 2ZE5A 2Q3FA 2ZU6A 4JL6A 4NYMQ 4YLGA 5FR2A 1QHHA 3QKTA 2G83A 1YR7A 1Q0UA 4G5GA 5JEDA 4QXAA 1HYQA 1KDPA 1Z06A 221PA 2W2TA 2ZTSA 3CRRA 3DPUA 2FFAA 3VR5A 2Q9CA 4D0LB 2FE4A 4HAYA 5JFGA 1N5IA 2CCGA 1KDTA 3Q85A 1RRCA 2HJGA 1R0ZA 4MRVA 4L8GA 2C8VA 2QNRA 2EFGA 4HEJA 4AK9A 3O8DA 2J7PD 4HLDA 4F4CA 1G19A 1GTVA 5KTYA 1E4YA 1CS4C 2JCSA 5A4JA 2QTVB 1CP2A 1TU3A 3AVOA 3VQTA 1TF5A 1WB9A 3B1VA 2ZANA 4RCYA 1F48A 4KYIB 1LF0A 2WJHA 4CW7A 1XNJA 3IBGA 4C0JA 1JJVA 5DHAA 5UKDA 2ZI4A 2GZDA 5DLQC 1OXXK 4BUJA 2BMJA 2VSFA 3UK6A 4MITA 4ZKEA 5G40A 3U7GA 1TL7C 4IVRA 2V54A 1KSJA 1XTQA 4FWIB 3KXIA 4V0OA 1E2PA 1TF7A 1UFQA 2Q3MA 4TQ9A 4G1UC 1UKEA 4DUGD 1ESMA 2IYTA 2KE5A 3QIAA 4PC6A 4EPWA 4C7OB 2OSBA 5JECA 3QKRA 5C4GB 2B7CA 2PZEA 3QXJA 4B34A 2OBNA 3B1ZA 1G8PA 3CM0A 1T3SA 4LV5B 2EFDB 4FMBB 3T5GA 2V3CC 1KK2A 3SNHA 3BH0A 2ZEJA 1P7CA 3CUEF 3D7MA 2D3WA 3EX7C 1OYYA 1G7TA 4PPQA 2ECKA 4A0GA 5IF9A 3EAQA 4XWAA 1XF9A 2YJTD 3RRYA 4Q7KA 4Z54A 3W90A 2JATA 2VQSA 1QHYA 3E2IA 4D4MA 4GPTA 4NYIQ 5JRJA 4TTPA 3PIRA 3PUZA 2I1QA 4OI4A 2UKDA 1U8ZA 1QHHB 4EIWA 1ONBA 3QENA 3WBKA 4ERNA 1W4AA 2QBYB 1Q3TA 2FU5C 4TQAA 3PUWA 2NMVA 4QG7A 1D6JA 2FSHA 2MSCB 1E9FA 2XNDD 2AXPA 4ZI2A 3BBPA 4XWOA 5J4KA 2VA8A 5KU1A 3X1YA 2PL3A 4M1MA 1WCV1 4AKHA 4CF7A 3M0EA 3ZD6A 1S96A 3HYTA 1RIFA 4Q4LA 3AVVA 3RS0A 5HZHA 1XEWX 2GAAA 4MYTA 5GJVC 2XZPA 1I4DD 3LXXA 3T1TA 1CEEA 4NTZA 4MKIA 4UNRA 4GI7A 2IYSA 1ZD9A 2QL6A 4C0AC 1ZYUA 3L2OB 2WKRA 1W2HA 1E9EA 3VFDA 3AVWA 2HYDA 1GSIA 2R6DA 1ZP6A 2R44A 1H8HD 3GLFE 3CF0A 1P5ZB 1VECA 4ZV4A 4F92B 4HYYA 2ONKA 2IF2A 4GMXA 2AKAB 2YYZA 1F2UB 4MUAA 3TSOA 1N5JA 4YMSA 2WKQA 5DH9A 1KNXA 4YXWA 1QBKC 3I5XA 1NL3A 1EFUA 5H70A 4IW3B 5KSPA 2H57A 2AR7A 3P27A 4DDVA 1CRQA 5LD2B 2BMEA 4PZLA 3FMIA 1N5KA 3CZQA 4MKGA 3CRW1 1GVNB 2H18A 1M34E 2GETA 3B60A 3K9GA 4C9BA 1X6VA 1G1MA 1E94E 4W5JA 3MG9A 1T9HA 3WBJA 2ZRFA 1DAGA 1XB2A 5CM9C 1GM5A 5EXXA 4BWYA 3GFPA 1SVKA 2FX3A 3ND9A 4P31A 2D06A 2GAOA 3IUYA 3QNUA 1W47A 3NHAA 2ANCA 1I2DA 3Q9LA 4ABYA 2ORIA 4LI0A 1JB1A 4FD2A 1SULA 2IA5A 2ZRIA 2ZRNA 4KYUA 4R2HA 4TMWA 3KQUA 3NBYC 4TN1A 2GA8A 2FV8A 3MSXA 4Q5IA 4Y0AA 3PEYA 2ZRJA 3CX6A 2WVJA 5CYOA 3UG7A 1SHKA 3CPJB 4FXPA 4Z8YA 4HLCA 3W8NA 1NY6A 1QF9A 2V6IA 1QVAA 2XAUA 2X1VA 2NO7A 3B13B 4RJLA 4AKIA 3CO5A 1QRAA 2QPOA 3TLXA 2QSYA 1CULC 1ZM2A 1MOZA 1F2TB 1JNYA 4L16A 4JL8A 4TT3A 3FKQA 2ZRAA 4Q02A 2FA9A 5AR1A 4M1OA 2ZI3A 4QHYA 3HP1A 4BFTA 2A5GA 3B1XA 2IXEA 1PUIA 4E03A 2WHXA 4LUCA 3DZDA 3A37A 1HURA 1OKKD 5H68A 1JAIA 5FUXA 2YHSA 4Q18A 6Q21A 3THWA 1XEXB 2PT5A 3TR5A 2DFLA 3SDZA 4YQFA 3F5FA 2XGJA 1A7JA 4JVNA 2OCBA 1A2BA 4KITB 2J87A 4PZZA 1W36D 1NSFA 1CR0A 4LPSA 3WRYC 5E7JA 2C98A 4KFSA 2MMGA 2X19A 3G5UA 2BCJQ 3K70D 1EESA 1EG7A 3N2EA 2RGNA 2J3EA 2HF8A 1R10A 2OFWA 2XX3A 3LX5A 4KODA 4PAMA 2J7PA 2OCYC 4R98A 4Q21A 5H8WA 4D26A 1N0VC 1NY5A 4Q4JB 4D4JA 3T61A 3W5IA 1X1SA 2EFCB 3JZAA 1ZC3A 1NLZA 1LVGA 2VF8A 1KO8A 3PEUA 2C04A 2BOVA 3KJHA 2KB0A 2BM0A 1IXSB 4MYCA 5FI0B 4R2IA 3MMPA 1RFLA 1ZVQA 4A82A 2EYUA 3QE0A 4TZ0A 1NKTA 1LW7A 3NBXX 2QMOA 3UATA 1MO3A 3O47A 4B3FX 3LY5A 3D8BA 1S3GA 4GP7A 3TKLA 2I1VB 1CR4A 1G17A 4Q9KA 2CLSA 2H7VA 3SI7A 4DUGA 3AKDA 1IM2A 1A82A 4LX0A 3EG5A 1ZNZA 4P33A 2WMOB 3ZVNA 3NBZC 2VLIA 4OJKA 1Q22A 5JZVA 1GNRA 2PJRA 4LGMA 1H8ED 4KFUA 2FSIA 1XJ0A 3ZIAD 3GLHA 3QI2A 2XTZA 2JLVA 4PTLA 3BERA 4A6XA 2O8FA 1PLLA 1W0KD 1Z5ZA 2IWHA 3B5JA 2DFNA 1WE2A 1KSFX 2QPTA 1VG0B 2PH1A 3K0EA 3BD9A 5JI3E 4UQOA 3MD0A 2ZPTX 4QGGA 1X3SA 4CIDA 1DAHA 3R7WB 2ZVPX 2P6RA 5F9FA 1HV8A 1NSTA 5FOVA 2UVQA 4P4SB 1KKMA 4G5RA 5E4FA 2AKYA 1KY2A 1GNPA 1UADA 5CK5A 4DB4A 2VTKA 5FPSA 1VYVA 4EFMA 3IHLA 1G7CA 1SVSA 3THXA 1YU9A 3HPRA 4WZAE 4ZDWA 1EXMA 4V0KA 2G3YA 1SXJC 2C9YA 1CRPA 4TLCA 3BS4A 1DPFA 1OSNA 3AB3A 4IOMA 4JS0A 4DT1A 2ZUDA 3LAWA 3C5CA 4NU0A 2ERXA 4ITRC 3UG6A 3MWJA 1TQ4A 1E0SA 2ZXUA 1MO6A 2YC4C 3FOZA 3VNVA 3DVLA 5H1YA 1TTTA 1KDOA 3IDQA 2ZE7A 1AGPA 2OEPA 1P2TA 3WRXC 1F5NA 1Z6TA 2C9OA 3W3AA 2QAGC 4FMCF 4NHOA 3U6KA 1AM4D 1YR9A 4Q01A 1MKYA 4DHEA 1AGRA 1GG2A 2A9KA 3NC1C 3ASYA 4G0NA 4JSYA 1A5TA 2RKOA 4QFMA 3A6PC 1H8HA 1Q57A 4DLUA 4B2LA 1M7HA 4M1SA 3A4MA 3KL4A 2A5DA 1OFHA 2DPXA 4POAA 3DOFA 1IY0A 1J2JA 1NN0A 4IJMA 3IQXA 4JT4A 1J7KA 1KJYA 1AZTA 1PV4A 2HJVA 2YWEA 3CWZA 3OE7D 3QBTA 1N3BA 3QVUA 1SKYB 2B8WA 2F3TA 3QPUA 4XH9B 4HUTA 2XTNA 3HU1A 1W0JD 1L2TA 3I5YA 2O8DA 5TDHA 5FOXA 4JBWA 1KI8A 2YOFA 2ZJZA 2O0HA 4LBYA 4I4LA 2CBZA 1FX0B 2JLZA 2ZRKA 5JSZB 5BN3A 2HXSA 4OYHA 2IBMA 3VR1A 1XXHA 4RZ3A 3GLHB 3U7HB 1EK0A 1P3JA 1UKZA 2IYZA 3I1FA 1T8TA 2CJWB 5KDLA 4DSUA 1V43A 2XOKD 3BE4A 3W8RA 3EA5A 1NN1A 4NYMR 4TMZA 3K09A 4IEIA 1GWNA 4DDTA 5BWMA 3PV0A 4QBFA 4C0SA 1P2SA 4URYR 3REFA 4GOKA 3CPHA 4BRWA 3IEVA 1G20E 1J8MF 3BIFA 4UNNA 5L3SA 1Y3AA 2FSFA 4CDGA 4IVQA 2G1KA 4B74A 3SOPA 1IY1A 4ZIRA 3LW7A 1TX4B 3T35A 2NO1A 3R8FA 1P60A 2LCFA 2SHKA 4QJ4A 1L7VC 3RC8A 1R0WA 4BLRA 5KHOC 2IF0A 2WJGA 2IXFA 2C77A 1O87A 2VPPA 3RS4A 1XD8A 4AI6A 4GRAA 4JLBA 4LK2A 4LSGA 1XEFA 3LD9A 1R2QA 1HQYE 3FKSD 1XCPA 3TQCA 3CNNA 1PVOA 2FZ4A 2AHOA 1XX6A 4TLAA 3IPXA 3I32A 4DB2A 2F9MA 1OKKA 2ZE8A 5FBVB 1GNQA 1OV4A 1Z83A 4NCJA 3HDTA 5L3QA 4JVSB 2CLCX 5EXPA 3UIEA 3HYRA 3KTAA 3DOEA 5EQTA 2P2LA 521PA 5KYKA 2DB3A 4MRSA 3GMTA 2A5JA 1RE0A 3PUXA 3GEIA 1YZQA 4RD3A 3DZ8A 1ZIOA 1SZPA 2HV8A 1R6BX 4PQFA 3QEJA 2G88A 2E9SA 1MABA 3KKPA 4U02A 3NTUA 1U90A 2NG1A 3BH6A 1OIWA 3SN6A 2WJYA 1N0WA 4X8LA 3M1IA 1KAOA 3IO3A 4G5SA 2ZS7A 1KO7A 1E2MA 1W44A 1OH7A 2ZRCA 3UPUA 4JIMA 2IYYA 4PXAA 3T5DA 1OHHD 1CJMA 1QHGA 1T3HA 2OM2A 2ORVA 2ZRBA 5HKKD 3GEEA 2J0QA 2IEZA 4C0HA 3LBHA 1Z0KA 2RGNC 1BIFA 4JBYA 1M74A 1RPZA 5A5GA 2QTFA 2OCPA 2R6CA 4TMVA 5EP1A 3T1QA 1DG1G 1E1QD 4NYIR 4MRRA 4LY6A 4TLDA 2ZYTX 4C2TA 1L4UA 2GVZC 1XEWY 1RJ9B 1SKYE 1DBSA 1M7BA 3K9HA 5CLQA 5L3VA 5JHGB 3NIBA 2JJ8A 4Q66C 1GL6A 4MGZR 3IIKA 1J8YF 3FMOB 1VCIA 3MUFA 5FR1A 3VR4A 4XWKA 5CB6A 2REOA 2RGAA 3NDPA 2C99A 5L3SB 3H2YA 1N0UA 1E2FA 3ND8A 4HZUA 1P61B 3VR2A 1HA3A 3G82C 1F3OA 3CNLA 1VDZA 4ZIRB 2UZ3A 2WSMA 5EE5B 2Q6TA 4BLOA 4ZO4A 3VHXA 2ZUCA 4IDQA 1H8EA 1Y63A 1UM8A 5DI9A 1Q12A 2P65A 3PVSA 3X1XA 1ODFA 1NVXQ 1ZUHA 2AK3A 3ECCA 3O8BA 4Q48A 4TMTA 3ZIAA 2WICA 1CF4A 1N6IA 2I3BA 4G01B 1W0KA 2W83A 3K9NA 3QY0A 5FBRB 3LXRA 4YONB 4B47A 4C4PA 4TLBA 3EWAA 2V1UA 2JLXA 4L9WA 3SYNA 2ZJYA 2CVFA 3RRZA 4ASUD 3N5CA 3DHWC 4OHYA 3GLFA 4JYBA 4B71A 2ZVQX 1FQJA 4GOJA 1E9SA 5L3QB 1SVOA 1ZNYA 4WIAA 1XFAA 1XJCA 2IHYA 3SR0A 4BFZA 2XTMA 1G8FA 2WJIA 1G9XA 3KTAB 4NCHA 2VP9A 4PPGA 5HCNA 3ZVMA 5JMTA 1L4YA 4PC1A 2GK7A 2C78A 3SJBA 5HZKA 1NIJA 3I62A 2ZRHA 1W36B 3ADDA 2VF7A 3ZZ0A 4QNRA 3E5HA 1E2EA 3EZ6A 4US0R 2PX3A 4LC1A 4PPFA 5KO2A 4MDFA 4DLSA 4O2LA 5FTMA 4BFXA 2GZHA 1E98A 4R9UC 1KGDA 4EPVA 2J59A 4EFLA 1U98A 2ZRDA 2IS4A 3UWKA 1IONA 4R71A 2QGZA 2EWVA 5TMPA 2QMUA 3R9IA 5P21A 1WBDA 1KAGA 3LRPA 4KI0A 3Q72A 2FEOA 1U81A 1E2GA 3GJ7A 3FHCB 4CEHB 3QXXA 4YDSA 1TQ2A 2A2ZA 1G3QA 4D4LA 3ONWA 4TTRA 1ETUA 4QM6A 2QT1A 4ESHA 2LKDA 4M8NE 2P5SA 4KXFB 4Q9HA 3AF3A 5FTJA 2JIZD 2QUZA 4HSEA 3I92A 4PQRA 5AJXA 3WMGA 4HAWA 2QT0A 2P67A 4DLWA 4OK3A 4CRWB 3OE7A 4AKEA 5EZ5A 1NLFA 1G8GA 2YVUA 2W2VA 1TEVA 2CCKA 3VKGA 1W0JA 1KKLA 2VHQA 4K46A 1SVLA 5D3QA 5J4YA 3KKOA 5BN5A 1G7SA 5JJLA 1SHZA 4F91B 4W9MC 2RHMA 3WHLA 4K8OA 2FDCA 2QBYA 3A1UA 4E22A 1P62B 2ZI7A 1BH2A 4TLEA 3I61A 2XOKA 1GDDA 1QDEA 1Z6YA 1E0KA 1KIMA 1R0YA 4XVQA 1P2UA 2ZIAA 3A4NA 1S3SA 1W4BA 3B9QA 2ZE6A 2G77B 3PG5A 1GILA 4LV6A 3CKLA 3TE6A 3GLFB 1LTQA 5FUYA 2Y8EA 2YOGA 2XB4A 1GOTA 4WAUA 5B64A 3SZRA 2ZSAA 4B43A 4GP6A 8OHMA 5TARA 3ICEA 3ZZUA 3H1TA 3ZLJA 1NMXA 2C9CA 3I8XA 3KFXA 2V7QA 4A36A 2EW1A 4J0QA 2WKPA 4GZLA 4MKHA 1AA9A 5IDVA 3RS7A 5CDFE 1OIVA 2D74A 3LDAA 2GXSA 2FWRA 1S8FA 4QBHA 4D81A 3FKSA 3Q5DA 4EPXA 2QM8A 3V4RA 3PENA 3AUXA 4TYPA 1F2UA 1QHNA 4BECA 3EPLA 3AGPA 2CK3D 2QSZA 4KHZA 3WP1B 1EWRA 2GTPA 1US8B 2FZLA 3UMFA 2FNAA 3NEJA 2D2FA 2V4ZA 5FFMA 3SJZA 1J90A 3CR7A 5BYJA 3AVPA 2BDTA 3WNBA 1D2NA 1NRJB 4LJ4A 3QOFA 1N2CE 2NZJA 1XD9A 3RANA 3ZS9A 1DAFA 2O8EB 1FZQA 4MA4A 3EPKA 2WMNB 4B3XA 2O0JA 3ETLA 2CL7X 4PANA 2BV3A 1AQYA 2E87A 2F1HA 5JJKA 2EYQA 4URWR 4PC3A 1R5NA 3GJ5A 3LW8A 4H1UA 3GJ8A 4DWJA 4MGYR 3LQRA 2KJQA 1DAKA 4KFTA 4CT5A 2R9VA 1E79D 4CVNA 3EC1A 5CJ2A 2GDJA 4M21A 3RC3A 5FBLB 1OHHA 1Q20A 3EZ2A 3ZVLA 5HKKA 3SQXA 4QGAA 2W6IA 3K70C 1A4RA 4M4SA 5GJCA 2VIIA 4Q00A 2WIAA 3SBEA 1KI6A 2IYQA 2QGNA 4OHWA 1R8SA 1ZIPA 4XTRA 3PXGA 4AURA 1RRPA 2OO7A 1BS1A 2QA5A 3OEHA 1ZM7A 2VP5A 3DKPA 2OBMA 2N46A 1E1QA 5E95A 1F2TA 4D0NA 1E3MA 3J81k 4C2UA 4HLUA 4M22A 1QZXA 4Q4AB 3T34A 2AXNA 4TYNA 1XCGB 1DS6A 1NN5A 4NCNA 4Z1MA 4EFNA 2MSDB 4NP6A 3U44B 1E9BA 1VIAA 4KU4A 4PFSA 4A8JB 621PA 3P32A 1CKEA 2BEKA 2OV2A 2IUTA 3AGQA 3A36A 3IKJA 4LJAA 4C30A 2PCJA 1X8KA 3PUYA 1G16A 3X1DA 4BE7B 1Z6GA 1N6LA 1MO4A 1VHTA 2CE7A 4DCSA 4LJ9A 2NGRA 1E32A 5AJZA 1U0HC
chains in the Genus database with same CATH superfamily
2J4CA 4GX5A 4JBNA 2Y99A 1ZGCA 3DWEX 1XEXA 2PMDA 2YY5A 4WBXC 4D4IA 2A67A 3U3ZA 5DOVA 4EHKA 2Z0MA 2RGRA 3H84A 1ONOA 3UJDA 2W4MA 5AHOA 3HXKA 1JQLB 2JK1A 3GWGA 1O94A 2F62A 3N2KA 2GESA 3K1TA 1UDCA 3C3JA 3GNSA 1JMYA 4PX5A 3B53X 1J0AA 5ALLA 4ZVOA 2BRUC 3W5JA 1DXOA 3G1TA 4OHXA 4A0SA 4C2BA 3HBJA 2R1ZA 3BMQB 3A1DA 4J7UA 4EG1A 1NRWA 1XZEA 1SHJA 4P2BA 2NSLA 4BVFA 4MWOA 4GMGA 3RVKA 3VR6H 4C0XA 5JWOA 1UC4B 5CNJA 2M32A 3IPAA 1ODKA 4NBUA 3G6KA 2V9PA 2HPAA 1H9BA 4GX0A 2ZYVX 5YASA 1EFTA 2FTKE 4V0RA 4Q4JA 5I7HA 5JI2E 2HNAA 3EY9A 1EWTA 3V1NA 3VAYA 1CLUA 3R5HA 1DV2A 1YZ3A 3CSUA 4GPIB 4QYSA 2PA3A 2B25A 2HQOA 1A71A 2Z2XA 3KTDA 4KL8S 3FMFA 4LGCA 4ZJZA 5J4LA 3WGNA 3PLNA 1EFDN 3CMMA 5LBIA 3T7DA 4V0LA 3AEUA 2RI6A 5FUBA 4FFNA 5EHXA 3V1UA 4W7HA 4UHDA 1QP0A 4LOJA 4KH0A 3IQWA 4F93B 1G9SA 2FN8A 2II6A 4GL2A 4NAHA 1JR6A 4RUKA 3FNBA 4EPYA 5HRAA 3WL6A 3EPHA 5CTJA 4CKZA 1JI0A 2DT8A 3AUUA 5FI1B 3LTEA 2MYUA 2NZVG 1DZ3A 1KYXA 3HVIA 3U6BA 1X7YB 1UK7A 2WF5A 3I4LA 3QFRA 1RE1A 1WUKS 3PJEA 1RC8A 1K7XB 1OUMA 3Q3VA 5FOTA 1AS0A 2QRUA 4DMMA 1U1IA 2ZS8A 3Q3CA 2OK7A 3LUGA 1BX3A 3QVJA 1WW2A 2GA9A 1KI6B 2BCEA 4QRHA 3V4FA 4KZKA 2NW6A 3NEAA 1VCMA 3O5AA 1P1HA 4Z0HO 3A2KA 1E2HA 1MEEA 5CVTA 1TYBE 4BFUA 2Q8PA 3EDRA 2LKCA 2Y0CA 1J0CA 4NHEA 4D57A 4DR3B 1IZ7A 4DREA 3T1HB 3DL4A 1MB9A 2AB0A 1CZKA 3GJ4A 3OTOB 1NLYA 1QHIA 1FP7A 5EXSA 3RAGA 5JS7A 2YS6A 2HIAA 2ZUBA 3AFIA 4HQNA 4OSPA 4CF4A 5LQNA 4YMIA 3QWBA 1RYZA 1W2GA 4MRNA 4PBRA 1WTAA 2FSGA 3HYSA 3FPLA 2Y1DA 4GM4A 3DM5A 4HOYA 4NMHA 5CXSA 1RWMA 3WGQA 4WKBA 4L3WA 4QOEA 2P3SA 3JAMA 2FFHA 2J0VA 4K6HA 3N74A 4TV8A 3TTUA 4RJJA 3H8VA 3D8HA 4MYDA 4U2EA 3U4IA 4XUEA 3RJ5A 3WSWA 1ZCZA 3N39C 5TS2A 3M5WA 3DZBA 1GUZA 1K7CA 1QO7A 3ZLUA 4MIYA 1H3FA 3FMVA 1EDEA 2I3ZA 3KQMA 1OLSA 13PKA 3L9WA 4JJ4A 3TLZA 4YAKA 5KZMB 4NARA 1EE1A 2QM7A 2H2AA 3NWBA 2FP4A 3PFWO 4RMJA 4AYXA 2JANA 3C6XA 5D7BA 1GRRA 4BNHA 4BATA 1R0XA 4YAIA 4ZKDA 4HUQB 3IAS1 3QYAA 1ZRSA 2GCPA 5EIHA 1ZXBA 3O91A 1RKUA 2BI4A 4ICIA 2FLVA 1NU6A 1KF0A 1TLFA 1OBFO 4MCAA 1CVLA 1V25A 3FYDA 5HJ7A 1FRFS 1C4XA 1JSCA 3WLFA 4ND2A 5A4AA 2PR2A 3TK1A 4AG5A 4F4JA 4J3JA 1H3NA 3V1LA 1EGAA 2PDAA 4NU5A 1LNZA 2YFQA 4MKRA 1Y8RA 2ERCA 1JEQA 2ZYRA 2AVDA 5LYYA 2XF2A 1AG9A 1KEEB 2CWDA 2DPLA 2JLQA 3ANSA 3SBXA 1XKQA 5LMZA 3T3MB 4ZOEA 3WYAA 1IWBB 5JNVA 3TAHA 3DAYA 4ND4A 2D59A 4LXYA 1E9RA 5BW5A 3H2KA 1JDPA 1JPJA 1JQAA 1OBOA 3D7SA 1AOXA 3H13A 3PGLA 3S8MA 4AULA 4PS0A 2XLBA 3KKNA 1YDWA 1L1QA 1TW2A 3DE0X 3LU1A 1YC2A 1NF2A 4Q3CA 5EZYB 2Y27A 4ZD6A 1WVGA 1YB5A 2W90A 3RGGA 1PJ8A 1TA9A 5J23A 1JEYB 1WQ1R 1YZUA 1I2CA 2QLNA 3CC8A 5KTNA 1NKSA 1PT8A 1Y7TA 4MO9A 2H54A 3AKZA 1Y9DA 4HI0E 3VNUA 2WPDD 4JJZA 3MRXA 4TPKA 4L8FA 3BSWA 2VUHB 3I64A 2NXCA 5D87A 1T6NA 4DQUA 3L6BA 1GPAA 4BV3A 2YXEA 1P75A 4JT9A 5BUSA 2W00A 3EXAA 3TX6A 1JF8A 1IQ0A 1G60A 1GKUB 1O58A 3R76A 3MGAA 4B79A 2EDAA 4U0JA 3MWYW 3Q7SA 1E6KA 1WXEA 3H04A 1IXYA 4IO1A 1MOQA 1TO2E 5FTWA 3GJZA 5CM8B 2O8CB 1M8KA 4Q4HB 1XMOB 1R6TA 2IPOA 3M5CA 4M89A 4M7RA 4OB6A 5IUKC 4UAUA 3DE7X 4ZVTA 1AMOA 3Q41A 2XZLA 5CDHA 2CVZA 3ZKWB 4HDRB 1N75A 2XMBA 4KGDA 2RHDA 4DEVA 5F7ZA 2C94A 4RK6A 4BLUA 2P9FA 1IUNA 4RKFA 5SZHB 3D3JA 1NIPA 1KY3A 4N3NA 2QT9A 1ZPDA 1SBCA 3U56A 4XCVA 3L4KA 5FKJA 1JQJC 2A9QA 1U5CA 3GGDA 4HXGA 3WGTA 1TM1E 3GZJA 4P7GA 5IBCA 4HAVA 3E7XA 2Z98A 2GLTA 1G98A 4TX1A 1ICEA 4UNIA 3WOHA 1MGPA 3ZNNA 5E7QA 2G9NA 4C6RA 1QH8B 4BDSA 5ES4B 2DHRA 4RC9A 4ND3A 1UQTA 2F90A 2JD0A 2IW3A 4WNYA 5ALTA 3P2MA 1YB1A 2XCTB 3FCYA 1ZCFA 4ZEOA 1OB5A 1ECPA 5FFNA 4WOCA 2WFLA 2JFFA 1UMKA 1KEPA 4RMGA 1ZKMA 2H59A 4QDUA 1W6RA 3N7TA 1W1IA 2HMUA 2YQ5A 3ED5A 2XDWA 1JFFA 4NESA 4KGXA 5FD8A 4UBJA 4DM3A 3WMEA 2HK7A 2QZ9A 1DG3A 3ESQA 4M9SA 4JLNA 1A8HA 5L8VA 2O57A 1RXEA 3GI1A 4A2PA 1Y7PA 2ZQYA 4CKEA 2WNHA 3FPEA 3WNQA 5KMGA 3GRCA 2OOSA 3D8TA 4PC7A 2V3VA 5EJ8A 4ENPA 2VAVA 1OXVA 4LVOA 3G2OA 1JHQA 4Z8XA 1T2VA 2IU4A 3SS9X 2PFGA 4XRGA 1J2RA 1KI2A 1ODJA 1QJ4A 1JILA 1ZOOA 2INGX 1XZNA 2IEAA 3AFGA 3V00A 4Q9LA 4M9ZA 1M2JA 5IN5A 2RCNA 3PE6A 2ZTUA 5HEKA 5G0WA 3S2SA 2R66A 5C4MA 2OXFA 3WLMA 3O95A 5L6MB 3SEQA 2P9BA 4F3CA 4A26A 3ZQ4A 5KUTA 1OXUA 2EZ8A 2NT4A 3IMEA 1CJVC 2F55A 3AFHA 4X20A 5CHYA 4U00A 4G0XA 3V1MA 3G5LA 3KHTA 1Z2CA 3NUQA 4FGKA 1EFLA 3A10A 2BEWA 4N82A 4JLSA 1U8YA 2E1RA 1VL1A 3G8CA 4X3CA 4YR9A 1AV7A 4QDJA 4NPHA 2BH2A 1YXMA 1E1RD 3NBMA 4WA7A 2QP4A 4OHRA 3E05A 4GH5A 4X71A 4I4CA 4UDNA 4YRFA 5EE3A 2WWVD 3VSBA 2ZWOA 5B1SA 1WSDA 4BZZA 5LQDA 4GECA 1OXMA 2PJDA 3FNRA 2A0WA 2ZBFA 2XLCA 3K92A 3QVGB 4G25A 4KK3A 4TL7A 1HNWB 1Y7HA 2CEAA 1WOYA 2P6MA 3IV6A 2QTAA 2AFHE 5DHPA 3KEFA 1QYVA 5D6OA 1YBAA 2FSUA 2QRNA 3PKZA 4YC7A 1QQTA 1RFGE 3PHCA 2R62A 3OO0A 1QQAA 4B3RB 4R8MA 4RQBA 3DLBA 2JBHA 2GEBA 1GFWA 4LV8B 1RPNA 2QRJA 1AUPA 1X7ZB 2IL1A 4H77A 2V7QD 5IRCD 1T1JA 4DGSA 3CT4A 1VLZA 1SGWA 3W5AA 3L0ZA 2XUDA 2Z1NA 3M4ZA 2J30A 1O0BA 2IDZA 4HP8A 5FPPA 4UCXA 1SUAA 4RTOA 3MAAC 4M0CA 2FPRA 4TSFD 3FYUC 4DJTA 3U5ZB 5BWCA 4J91A 4INPA 3A3NA 2GCOB 4RX1A 1X2EA 1NJ1A 2ZB3A 2JGEA 3CUKA 3DE6X 2PRSA 2QRZA 2CL0X 1JIKA 1G2OA 3EVZA 5CX1B 5CDFA 5B2EA 1Q6ZA 2N0SA 2HTEA 3F7MA 2HCJB 1NJ8A 1BDJA 5FA8A 4D5GA 4AMBA 4C7VA 5CFPA 9GPBA 4KZPA 1ECLA 1LX6A 2X0NA 3DAOA 1AN9A 5FNVF 4HV4A 1Y1LA 5C1BA 1EJ6A 3R3YA 5K4HA 4F5ZA 1T0JB 5EMHA 4TV9B 1SA0B 1I5EA 2TMKA 3GCGA 4M9XA 3OQOA 4C3UA 3HA5A 2DQYA 4PRYA 5LIRA 4S35A 3T15A 2V6JA 5I8WA 4RO0A 1XMVA 1E1NA 2CFIA 4BGDA 1W85A 1ZK0A 3AEKA 1J2YA 3HCOA 5JAIA 3ABZA 2UYYA 1LDBA 3FUXA 4WTOA 3OQIB 1TF2A 3IX7A 1QRTA 5D85A 2REQB 2BFFB 1PJBA 1HQCA 1CSEE 2G0AA 2VDNB 4MR7A 5GZ1A 2FPOA 4J2TA 4XE5A 1S8AA 2GYUA 3U9TA 4HNAB 4IFBA 1V4NA 3IP1A 4C0BA 1HDXA 2DQSA 5CBPA 1R5BA 4CU2A 3DBOB 3ETHA 1O77A 2R6GA 3CNBA 5FPYA 1J07A 1G0NA 3JZFA 4IV8A 5EXDA 2NUAB 9LDTA 3QRWA 1QANA 1A2QA 5C7IO 3ZPXA 5GINE 1PJLA 1P19A 3P8ZA 2QN7A 3OEHD 1WHSB 4BGIA 1EVQA 3A58B 4S12A 2QVLA 1H5QA 2EG9A 4NC9A 5JAPA 3FYSA 5J4VA 3WBBA 3NC0C 1F6BA 3GUVA 3LPDA 1U1DA 4BVHA 1XRLA 4JKYA 4NR0A 3LH5A 4H1TA 2ZBDA 1ADCA 4G9EA 1GPWB 3JWEA 4BLSA 5E9JA 2WJ4A 4W5HA 3KC2A 2IYUA 2P68A 2FG5A 1DRKA 1GZVA 1GLNA 2WPDA 4PN7A 2PMKA 3DAFA 5TGZA 3V4SA 5F1PA 2OHFA 4MR8B 2DPMA 1PR4A 3V8NA 4UTNA 3LFHA 2O8VA 2Q45A 5AXCA 3SJ7A 4IJ5A 1X7XA 1Z2EA 2C0CA 5EL0A 1ZINA 5KKNB 4TKMA 1J2EA 2HSDA 4IIHA 4P3OA 1L4MA 2HCFA 4I55B 4C0WA 4D8TA 4I9FA 2W6OA 2J33A 1E1YA 1T8YA 3AVYA 4H3VA 1DEOA 1CV2A 2CNWD 2ZATA 3N8GA 3H5OA 4PQYA 4WGFA 2BDEA 5FNZA 3SG0A 1ZI6A 1OBVA 5B55A 1DKMA 2VFAA 3C2QA 1MN6A 4YTEA 5AUOB 3MCUA 3RQIA 1N5RA 1VXRA 3I76A 4X1IB 2CMKA 1MB4A 3BMXA 4P9NA 1NJFA 2VCYA 1RBQA 4ESVA 2TECE 3AV3A 4IGKA 2C92A 4FSHA 4NMMA 3CLTD 5JXJA 2WIFA 2GF2A 4P5DA 1E2DA 1YRAA 1XWIA 3W7BA 5ELXA 3IPLA 4D9IA 2WG0A 4P0PB 3ADKA 1KU6A 3S0JA 2FLWA 1OFTA 1XAJA 3EZLA 4FDVA 3W8FA 4XKJA 3R23A 4R8RA 3AOEC 2IS2A 2BF4A 3DZIA 1TA4A 1S1MA 3HB4X 2GPAA 3OQHA 4I5GA 1CS0A 1JPUA 1N2CB 2ZULA 4H7EA 3LIIA 4QOGA 3HLKA 3FLAA 3AP3A 3N2IA 1KA9H 1YRLA 3FTDA 2NU7A 2OXRA 4YWJA 1VPLA 1YZTA 5KKCA 121PA 2HA0A 3X2FA 1K6IA 1ZH8A 3PGA1 1VG9B 3AEZA 3FNHA 4HMPA 1E63A 4E6EA 2C4VA 4TYQA 5F12A 1O6FA 3I30X 4LZNA 2YXPX 1N7HA 2CD9A 1MAAA 1QU3A 1BMDA 3C8UA 4AKGA 1WNTA 2V6GA 3H8WA 2EX1A 3HB7A 4KO2S 4DA7A 3MIZA 4K6KA 2ZTHA 2ZVJA 3ECAA 1C41A 5T64A 5JVDA 1N2JA 1S89A 3DXYA 2O8EA 5BQXA 1FVXA 4TTQA 4YHBA 1FFGA 3Q8LA 1GFIA 3PNBA 3GFFA 4UHEA 3FN4A 5AKZA 3R9WA 1NUUA 3MNFA 2W2OA 4HB3A 1LZLA 3DTYA 1NVBA 2RAFA 4KXVA 4DLKA 2ZAGA 1PYGA 4B46A 2BSAA 4JN6B 4KGZA 1E8MA 2RK3A 2WTAA 3N6VA 5DWQA 3ZDYB 5K5EA 5MDHA 1D2EA 2Y1LA 3DMHA 3I72A 5HMLA 3RS2A 4BRZA 3KP1A 4WN3A 4YO8A 3T3GA 1MNAA 3L92A 3VUEA 2XYGA 4YLYA 5K1ZA 4NAUA 1A9PA 5L51A 5C7LO 3UHJA 2A14A 3CH5A 2VDJA 3RLIA 5JWHA 4TL6A 2P2CA 4R1UA 1EFPB 1CDDA 2BM9A 5EQFA 4DSTA 2W22A 4MLPA 4O33A 5CT6A 3AG5A 4MUIA 3SQOA 2I33A 4F0JA 4EB8A 3QNMA 3SC2A 4EO4A 1Q17A 5C80A 1K5GA 5KYGA 4L08A 3QBJA 1V1MA 1G63A 4IYRA 4QICA 2M6RA 3ZGNA 4UNPA 5EWLA 2B99A 4BMVA 3CVWA 1A4UA 3BE6A 3TIXB 1HI9A 3GVHA 1RWXA 5HXAA 1E1RA 2AVNA 2QIOA 1OF1A 1NTOA 2PBFA 3MVEA 3U7QB 5JSFA 3LFUA 3HWX1 4H7FA 2VDPB 5AQEA 2HYIC 1USKA 3ITKA 4L8VA 3T3PB 3KRTA 2A1UB 5JNUA 3G23A 3HJCA 2L17A 3IH5A 3P2YA 1IWPB 2PQ0A 2XZTA 4J76A 3RABA 2CZQA 5EJEA 2OLKA 2DHDA 4G4GA 5M3BA 3LECA 4CU5A 1XU4A 2VWGA 4ZC1A 1QTIA 2C03A 1RABA 4FI3C 2ZT7A 4Y6SA 3FY4A 3BXOA 1UBJS 2HCBA 1BGVA 2B7BA 2ZIXB 2WF8A 4M0LA 1NJGA 1KYYA 2WJJA 4C6SA 4Z3KA 1N1GA 1Z45A 1IJFA 3DKKA 3G0CA 3ZXYA 4OSEA 2I9PA 1XZJA 5JYEA 4LYGA 1E3JA 1JEAA 5CB8A 3MYRA 4ZOLF 5LWHA 2OZEA 4TSFA 1XZIA 1LH0A 1MIOB 2DQZA 5BSMA 3T7JA 5CW1A 3S28A 3WKDA 4AM8A 2JGFA 3HKBB 5AHRA 2RHRA 4KIGA 1HE1C 1FLNA 1OWLA 2P8SA 4JP5A 1ISIA 1Z33A 4G37A 4ZU1X 1PNTA 5L4SA 3OOJA 1A50B 1XZMA 4D9JA 1RQ2A 4G9BA 1F51E 1G5TA 3IJPA 4MAFA 4BQQA 2WJVA 1J99A 3EH1A 4UQLA 1IY2A 1F12A 3GUYA 4KQWA 3WLQA 5JROA 4DR5B 5HZGA 4EF5A 4AS1A 2C9MA 2OBLA 5E6SB 5LP6B 4BEWA 2AG1A 4JKIA 4J0KA 2OZKA 3AR8A 3VOTA 1M2NA 2CXNA 4CG2A 5IKMA 2FCAA 1X1TA 3AFNA 3ONVA 3AJ8A 2CUNA 4G0QA 2NU8B 2QU8A 2C2KA 4GR4A 4GRIA 3M70A 3VJLA 3SBOA 4J1NA 4HEA6 2E21A 1KMHB 2NPOA 3I3OA 4ACBA 1VIVA 1ZRHA 1TQ6A 4HFMA 1PRYA 4EARA 1LS6A 1VCOA 2HK8A 1K1EA 2YN0A 2Q6OA 4N1AA 3U16A 2I4RA 4X90A 3DL7A 1OI3A 4JP3A 3MF4A 1QVRA 2HMWA 2OO3A 2P9JA 2W6JD 3JVIA 2QUBA 5AOCA 2ZYAA 2FG7C 5CA0B 3LTNC 1U2TA 2OC4A 1RM4A 1Y6JA 1J25A 2DPGA 3I01M 2APJA 5BQFA 1B3RA 4JLOA 4NYJR 4LYDA 3OJEA 4OMFG 3RFFA 3QU9A 5EINA 2QM0A 1TCUA 3HA3A 3RWOA 3WV5A 2GZ1A 2H1CA 5JLAA 1ZL2A 1DIOB 2ZP1A 1P7WA 3P9IA 4E1AA 5H0IA 1Q77A 4FGLA 2XDAA 4LOKA 4UPVA 4TTJA 3GLRA 1X7WA 4RYLA 3UMGA 2G0NA 1FSSA 3KEOA 4TKVB 3E9QA 4RPIA 3FGOA 3F78A 4UBIA 2AMLA 4BFWA 2WUVA 5AI6A 3TR0A 5H81A 2QRVA 3WG9A 4CGZA 1IZ8A 1I3CA 5I5GA 1CHDA 1N9KA 4YQZA 1CJBA 2NXNA 3RYIA 1ID8A 5BNWA 2EGGA 1A8IA 4CLOB 4ZQEA 5KDDA 3PD7A 1CQZA 5BSTA 2B4RO 2ID8A 3JVVA 4HTFA 5KJEA 5KYYA 1QR6A 2R1VB 4YI3A 4J9VA 3WXBA 3G17A 4KAJA 1M0EA 2ECQA 3O9VA 4QRDA 3WO1A 3C24A 1X1RA 2GZMA 2JIPA 3FGNA 5TR9A 1L4GA 3SR4A 1JG4A 3N70A 5IULC 3A1SA 1IJEA 3UK7A 4E94A 2Y0PA 1J09A 4M87A 5LLDA 5H4HA 5TMDA 1FC0A 1EGVB 3FR7A 4BNWA 1XCJA 3PRYA 3PXUA 2AH5A 3KB6A 1Q19A 3LWNA 1N7IA 1G4UR 2JLSA 2HRRA 3PSAA 3LVRE 4R1TA 3H2JA 1Z22A 4YRRA 1SCNE 1OR8A 2GBIA 3UYLA 4PNHA 5CNIA 3E8SA 1LI4A 2F3UA 4OMUA 2Z8YM 1A76A 3H5VA 3OD1A 5HG0A 4H15A 3BILA 1XPUA 2CNWA 2GHTA 4YDRA 2FMFA 2RAPA 4ZGGA 1RQXA 3KOXA 4PO8A 4EK9A 3G8YA 3SHVA 5LQUA 5LVAA 3DW3X 3TGLA 2QVYX 4S2EA 1M6YA 5HR5A 3QG5A 4PLFA 2WWTA 5CVDA 4ED9A 1X8XA 4B9AA 2RHHA 2B7LA 1ZOIA 2HEGA 3PUVA 2XE6A 4HDNA 5C8ZA 1NHGA 5TXGA 4DCUA 5J2TB 4ZTZB 2FFQA 2WVGA 4ZEXA 1NQAO 1QONA 3CLRC 2GNAA 4I9GA 3EVEA 2WHYA 2P9QA 5MGBA 2MWMA 1ZG3A 1SUEA 5KNLA 3KWJA 3WOVA 3L49A 1PSZA 4UARA 1HRDA 1N2XA 2WB4A 3QYFA 4I3HA 5KVAA 1EWYA 3BWYA 1QGUB 3L0DA 4J6FA 5AJYA 4HDSA 4EAQA 1VB5A 3T9CA 2OBYA 3TBFA 4B7XA 3WE7A 3MJFA 3NXSA 4C6HA 1BHJA 1C4OA 1JI3A 1VBNA 2GM3A 3GT3A 3NC4A 4OQMA 3RSQA 3WHPA 2IHVA 2WT8A 1OH8A 4BO9A 2ZOSA 4GSYA 2YHIA 1OE0A 3LP8A 5EIFA 4DBVO 1PG5A 3CA8A 1P7ZA 2Z08A 1OVMA 3GRUA 3PEFA 3TQSA 3PDHA 4A8TA 2Q8QA 4L5IA 4I9UA 3ZYZA 4KXNA 2RH9B 1P2BA 1JG1A 1G5PA 2IHBA 2C2OA 3NAMA 2QR5A 4LQCA 1XGKA 4PO1A 1T4CA 4LVCA 3ODPA 4NY1A 2NNWB 3QEOA 1D4AA 2OPHA 1MG0A 1SUCA 4AS3A 3FZQA 5A62A 1TUGA 2B1GA 2QXTA 2AFHA 2NV2B 4HG2A 1JR3E 2N75A 5FRDA 5G0SA 1Y1KE 4O1IA 1XIVA 2GS9A 4KLAA 4F6CA 4B44A 4QZVA 1EM8A 3R3HA 1RI2A 1ZJYA 2BKLA 2VT2A 3FPGA 3FFXA 5SICE 3WTCA 3P9CA 4IM7A 1KQ3A 1XZCA 4Z0TA 4YMUA 3ZWWA 1KOFA 1PR3A 3O8OA 4F4UA 1L8OA 3H97A 5TQ2A 3N7AA 1C7JA 2ZUSA 5KYWB 2H85A 3FDZA 3RAPR 4DQDA 2PSEA 4UM8B 1IOLA 4XOIA 1TFUA 3DQQA 5IYZA 1QRRA 1RC0A 2RAVA 3GFGA 3NGXA 1DKUA 3EOZA 3ROKA 1S9DA 2J09A 3VO8A 1I7PA 1K2WA 2HA7A 1QCYA 2OHGA 3GEHA 4YPFA 3U7EB 3ZV3A 4Z51A 4IIFA 4PSUA 3TLGA 8LDHA 3VU9B 3MJTA 3P1JA 4FJ2A 3GVCA 2RIPA 3UAYA 4DNPA 1YZKA 3U3OA 1EGMB 4BOYA 3QY9A 5IAKA 1QH1A 2E5FA 2ZB4A 3N5KA 3OTGA 4BLPA 2ZWMA 5C1OA 5EY5B 2G1PA 3FI9A 4BZQA 1UDWA 3CVJA 2VYFA 4NFLA 5JRZA 1QYWA 5DYNA 4ENVA 5JD6A 3KXKA 4MO2A 4LNUB 3T3HA 4Q3KA 821PA 2WUWE 2QAGB 4RZUA 3EFOA 4QBIA 3SXUB 2O0LA 1XTJA 1NVEA 1T6BY 4LBZA 1GSAA 3CLHA 2JL1A 1WUTA 5K8VA 3MS4A 3H2HA 1E8NA 4YEDA 3M4YA 5HFAA 2GM4A 2QMQA 2VCHA 4R41A 1ZK3A 4G8DA 4IEFB 4V03A 3F73A 4IKOA 1Z5GA 2ENWA 3I2HA 2Z83A 3PR2B 3PFHA 4D74A 5F76A 1HH4A 5LMCA 4HADA 1DQPA 4JVOA 2JGKA 2XIQA 1XD2A 4IIEA 5EE0A 3STVA 5BMVB 1EUZA 1I13A 1T5SA 2ECPA 5F4BA 3WLKX 1BDIA 4WBNF 4ZV7A 2UYHA 2O8BB 4FYKA 1R0KA 3DQZA 2HH9A 1LRJA 2PKQO 4A8JC 5A4KA 2IEBA 3JRWA 1ECGA 1DP4A 4XTCS 3FWZA 1YVEI 1M7GA 1GA1A 2JDID 2Z5GA 4LZJA 1IUKA 1Z0IA 2BP7B 4E3WA 3IR7A 3T3DA 4G86A 3RUPA 2Y1XA 4XJXA 1IQUA 1C0EA 3R6GA 5B1HA 2YXLA 1Z7WA 1N57A 4L85A 3MT0A 1GAEO 1LJUA 1N6PA 1RADA 2PVPA 4GWKA 1BGWA 4AJ9A 1CE8B 4ARAA 2UAGA 3G5MA 3BMCB 1R4ZA 1TQHA 4RENA 1V5FA 1UBKS 2IYOA 3GIWA 2B36A 4NATA 1YHYA 2GHRA 1Y9AA 4Q3BA 5AHKA 1Z5NA 4MQUA 3TIFA 4HH0A 4HNTA 4FU0A 4YAJA 4EA6A 5JJIA 4LS3A 3KZOA 1B14A 2V8OA 3QPVA 4B6JA 3F9RA 5DNUA 5KAMA 5B57C 5KVCA 3EUAA 3QVMA 1BJKA 4KIFA 4CKBB 5BOVA 3ETDA 5CFLA 5CG1A 1KAMA 1TIKA 3CH6A 3HGQA 1T6XA 2QQFA 3DMNA 3EZNA 4ZEMA 1QLJA 3FD8A 3GJ0A 4OYRA 5CLHA 1FYDA 2DYKA 3IA7A 5A0TA 3FVWA 1JAHA 1ZJ6A 1ZD4A 1PNQA 3FPAA 4PICA 2XXAA 1NASA 1NQUA 5FPHA 4ZVMA 2NP7A 1SG9A 2BFDA 5E2BA 1TUBB 3GLVA 3FSGD 1G4HA 5BVHB 4RFVA 1VLLA 3PITA 2DX7A 4YFYA 4H35A 1AVTA 1GYQA 1ZESA 2WWHA 2XB6A 2QD5A 3O4FA 4GW3A 4KVAA 3AQ4A 3JYLA 4OPMA 2ZM6B 4J7CA 3I0MA 4N5HX 4S2UA 3RSGA 1OJLA 1GRCA 5AH0A 2H2HA 1TGYA 1B7GO 1UC5B 2GPBA 4RKRA 3ZUPA 3BFVA 4MHOA 3NBAA 3TMYA 1E9CA 4NONA 1EFHA 4G85A 1TM3E 2I7VA 4FLEA 3K1YA 2I7XA 1IPFA 1RBZA 1UM9B 3EVBA 4NK5A 4MAAA 2LCIA 5EIAA 4ZCTA 3CUTA 2DR2A 4EA7A 2EP5A 4HLQB 2GHQA 4UCWA 4BC1A 3FI0A 2RH5A 5DGHA 1P2GA 1BHO1 1MC5A 4OL0A 1ZFNA 1IAVA 3S1AB 2G71A 2X6TA 1U9IA 3T4XA 4OQFA 1G9TA 4WY8A 1KP2A 1NZFA 4K9QA 5D3MA 3FA2A 2AX3A 3LBAA 1U3CA 5C52B 3SLRA 3BTVA 3TM4A 3WICA 4NJMA 3VPGA 2PU5A 4DLAA 3ANXA 5EIOA 2REBA 3VZQA 5C35A 1FSGA 1Z5VA 2GJAA 3X1MA 4B3IA 5HKAA 4MDHA 1DJPA 2VP2A 2AJBA 3GLQA 3H9EO 3KQNA 3W04A 1PFWA 2XNDA 4WNCA 3ZGZA 4BO3A 4BO5A 1V4BA 4U7GA 4TSRA 3EYAA 2WUEA 4FFDA 1EQAA 1GPMA 2O5VA 1FMTA 3GXOA 3OHMA 4ZN6A 1L5FA 2GRJA 4WVFA 1MDBA 1RRKA 4IDCA 4LQDA 4NFYA 1T3TA 1GGMA 1R88A 1H2HA 5J2UA 1NVUQ 2LXNA 1JR3D 2XAAA 4G97A 4W7IA 4AJIA 3WJAA 3WXMA 3AINA 3I2GA 1YIOA 3Q2IA 3R0XA 4ZVLA 5HF6A 3CWCA 1QVVA 3M9XA 2JLRA 3EDYA 5F4ZA 2IBTA 1Q1NA 1RJDA 4RS4A 3D0KA 3LCUA 3RVQA 2RE8A 2EKPA 3SKYA 2F9FA 1SURA 4B6PA 1LPAB 2FAXA 3OFND 4KTTE 5I51A 4Y2PA 2L0XA 4E2YA 2WSLA 4K9MA 3DP7A 1H0RA 1DQZA 1KMQA 1YMUA 4IHJB 5AJUA 4AICA 1CIVA 3AQIA 5AI0A 3UK1A 1I2ZA 1SUWA 3C5HA 1T2CA 4Q1CA 3PHJA 1NDQA 5CVCA 2D0IA 1RMTA 3NHBA 3EBPA 5C32A 1Q0LA 2EWMA 2HF9A 2DF8A 1FFAA 3EW7A 2GN0A 3LZCA 4JGBA 2I6GA 4PR0A 1NR7A 1KHHA 3OUUA 3REQB 4EKGA 1Y3FE 1E8DA 1AIPA 1SY7A 4OLJA 2JEOA 1Q7GA 4DADA 3BWCA 3ZBTA 5BV1A 5KWSA 1DARA 1HLDA 1WXQA 4MIOA 2YXDA 3OA2A 2C5GA 2HRZA 3P9QA 2WM9B 3QLVA 2XBMA 1R6VA 3F5QA 3PSHA 4QOFA 4JQZA 3ZWDA 1MJFA 5G53C 4HVLA 5IAOA 3FYTA 4M76B 3KQLA 2GCGA 2GEFA 3I2JA 2CLKB 5WRFA 4ZQFA 1AB5A 2Z1MA 3CB4A 3VNRA 4PYOA 2WAMA 1G21B 4H1VA 4FMCB 4DQ0A 2Q6LA 3P2JA 2O8FB 1JSRA 3ZHXA 3HO8A 2CKMA 1IVYA 2WJPA 5CT4A 1T5LA 4BNZA 3ASVA 5FEUA 4MVJP 5L3RA 3OG9A 2JW5A 2OAP1 1S3FA 5JY6A 2BEUA 2DG2A 1FU4A 1VJDA 2GXQA 1QG6A 2F17A 3CRVA 3PDUA 4QUIA 3FCAA 2ANBA 3EARA 1A7KA 4PHHA 2CJYA 4RH0A 5T8KC 5INTA 3K5HA 2VF5X 3WQSB 3EOAI 3PNLA 4XX1A 3KZMA 4ZPJA 3KD2A 2CV2A 2O19A 1XJQA 2PQ2A 3X1WA 3WFZA 1Z18A 1BD3A 2IRWA 1ZNWA 1E58A 5KSZA 1N5MA 3CZCA 2ATIA 4DJFC 1I36A 2CDBA 3NHSA 3NM4A 1O54A 3E7FA 4RPJA 1DQSA 2BM8A 4YK7A 3WGIA 1KQNA 2BDUA 3NPMA 4IIBA 5HQTA 4JVMA 3MGKA 3GD7A 3PVCA 4YALA 2YNMC 3K0FA 1UJ5A 3PNYA 2IYAA 2F1KA 1XTTA 4PLGA 4TMKA 2WIGA 1TU4A 1R9NA 3A0RB 1IN5A 3TQIA 2W37A 4B3GA 1KYTA 2D3TA 2ZRPA 4TM7A 4BRSA 1M83A 2LR0A 2RHJA 1LNSA 2QV7A 3AIMA 1SQSA 2EKQA 5EJ7A 1C3JA 2ATXA 1L4NA 2EQ5A 3JYQA 3ME5A 3NIGB 3JATB 3NG1A 4JA0A 3TD6A 3D4PA 3PR1A 3VSEA 4DV6B 2DKFA 1ZNXA 5EP4A 2ZM5A 2ZRMA 4P93A 3RIGA 1VTKA 5B1EA 3TL3A 4DIBA 3HDJA 2BJVA 4I36A 4YB8A 4OREX 2J9RA 3R0VA 3H1BA 5EUCA 4M9QA 4XQ0A 2IEDA 3JRNA 1LY1A 3ZTYA 1AH2A 3E5MA 4X41A 3WISA 2JI4A 4L8YA 1S8NA 4KXXA 1M5UA 3IT2A 3H19A 3IAHA 4OQQA 5HJ2A 1N6RA 2OY0A 2O8NA 5MF6A 4WACA 4RELA 4U2DA 4QU8A 2JDIA 4YT5A 7MDHA 3UV7A 1IN4A 2B1JA 1KO5A 4L73A 1UH5A 3VMFA 3VZPA 2BHLA 3TCXB 5K0TA 5FOUA 1ZM3A 3QU7A 3GLIE 2FQQA 2QD4A 3KR9A 3KJFA 3M6VA 2IU3A 1YR8A 3B3QA 3SNKA 1SUDA 2LDBA 4EUKA 1DJQA 3V8VA 3K0CC 3AYZB 3ELWA 4NDAA 4Q19A 2O8DB 5KPJA 4J6EA 1JDBB 1EKXA 3RRMA 3SC4A 3ETCA 1KTVA 1MJHA 3F7TA 4FPXA 2AZXA 1IOWA 2CHQA 1II8A 1LPMA 4IOJA 3SLGA 3EASA 4BNFA 5ILQA 4KPGA 2Q5JA 5B3JA 4EB6B 3EG9B 3SS8A 1Z4OA 2IHUA 4BWFB 4C87A 2A9VA 2IEYA 1R16A 2LPMA 3CZ4A 3TSZA 3BCRA 1LSSA 4FWTA 5CX4A 2UUCB 1HOXA 1UDBA 1I4WA 2MSEB 2GNPA 4XEUA 2OYCA 3A27A 5DI3A 2PZBA 2DR0A 1KI3A 1LS1A 2MTBA 2YIMA 2YVAA 5LDDC 4FEYA 1VPEA 4BFSA 1MXHA 1NBEA 3K35A 4MUFA 1R9GA 3MBOA 2PRKA 2H5JA 4OJMX 4ZQBA 5C31A 4KSBA 3UXMA 1DBIA 1NW5A 2GTHA 2XCLA 4H0FA 1A9TA 1N0HA 2GAFA 3FH0A 4J9UE 2WTBA 3GJYA 3AXSA 4YAEA 1YSCA 1I3LA 1IN7A 2R6FA 3EQ7A 4H0NA 4BFCA 4Z4GA 3AF0A 3BB1A 2W5UA 4XUDA 1DTSA 5E3HA 5JDCC 4D82A 3B20A 5CD9A 2XDQB 5DLPA 2DFKB 1TCVA 2DFPA 3HVJA 1BAPA 3CR3C 2H8GA 1DRWA 3MA0A 3WB1A 1AUQA 3GGCA 1T35A 3LBIA 5K8CA 3CV3A 2GN9A 3NNSA 5EKUA 2GYWA 2H2FA 4B7UA 1N6NA 3SM3A 4LFBB 2NWQA 4BPBA 1L5SA 5ALMA 4IO0A 2ASEA 2AC7A 1EDBA 2OXEA 2QPAA 4AWXA 3NAGA 1M8PA 1L5HB 3LC1O 3GPIA 2B37A 1RPTA 1QKJA 3KQWA 3JYPA 3R5JA 5AI9A 2ZITA 1D2RA 3CRQA 1CY2A 3LZ6A 1SC6A 1JQEA 4NL4H 3VVMA 3L04A 2XUIA 4C0QC 3GUCA 3K0AA 3VR3D 2BAGA 4UATA 4XDYA 5AJWA 2Y1KA 4QTZA 4XGQA 1SBYA 2R6AA 3UMSA 4J1TA 3URMA 2VH2A 1YBHA 2NZUG 4YACA 4B4WA 4DDMA 4MRMB 1E7WA 1M3SA 2A0XA 3K73O 3W6NA 4BVKA 5HCUA 1RBYA 1B1AA 4X95A 1FTQA 1UXGA 5K05A 5C34B 2QOEA 2Y67A 4LYJA 1NW9B 1UK8A 2HK9A 3K2BA 2JAQA 5LXTF 4E32A 2D6FA 3CX7A 1ELOA 3DDWA 3HB9A 4ZI7A 1FP2A 1P9RA 2J0UA 1T2FA 3RFTA 4EI8A 3DL0A 2WE8A 4QELA 2FSVC 2KI5A 2FSSA 2VOJA 5F