5CKDA

E. coli mazf e24a form iii
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
SRYVPDMGDLIWVDFDPTKGSAQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
molecule keywords Endoribonuclease MazF
total genus 27
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ckdA00
3HPWA 2MF2A 3JSCA 4VUBA 5CKEA 3NFCA 4ME7A 5CK9A 3VUBA 5CQYA 3G7ZA 5HK0A 1X75C 5CKBA 4MDXA 4MZPA 5CO7A 2C06A 5CKHA 4ELYC 4ELZC 5CKFA 5CQXA 5CR2A 1UB4A 5HKCA 4MZMA 3JRZA 4OF1A 3TCJA 5CCAA 2VUBA 1M1FA 5CKDA 4HKEA 5DLOA 5HK3A 2KMTA 1NE8A 1VUBA 4MZTA
chains in the Genus database with same CATH superfamily
2ZPBB 1M9SA 1GBRA 4C8QA 2O4XA 4JZ3A 3OW2P 1QVGS 1D09B 3GIBA 1YCYA 2V8JA 1SHGA 1VQMT 4OGCA 1AOJA 4DA4A 2F2XA 2RPNA 3JB9F 1BIAA 1NPPA 1M8MA 4OMLA 3CCEA 1QVPA 3M0TA 4QT7A 2K79A 3LLRA 1JB0E 4X34A 1ARKA 1UEBA 2MAMA 1AEYA 3JCMW 2FB7A 1VQPT 4MMLA 5CR2A 4EIKA 2LTOA 3S6WA 3MO8A 2OI3A 1VIEA 3A8GB 1WHJA 3CPWA 3RERA 2G6FX 4Q5WA 3BDLA 3FDRA 2JMAA 5CKEA 2ECZA 2DJQA 1WLPB 2RHXA 1Q7YR 1K8AU 3OY9A 1QP3A 1X6GA 5KYWA 4XQ3A 1AWXA 4NL2A 3MP1A 3MKDA 2P0PA 3EAEA 3MEUA 2LQKA 2X9HA 2BE9B 4E7LA 2I0NA 4HKEA 3CMEA 4IIMA 4C5IA 2RJCA 3EGXB 2O31A 2KAFA 2M16A 2AZSA 1BI3A 3PVQA 2KR3A 1G5VA 4L59A 3I56Q 2QG9B 1UUEA 3JCMg 1M90U 3INZA 4LDVA 3ME9A 2JNGA 1Q7YU 1ZBJA 2DYIA 3G71A 2DLPA 3EGDB 4LDYA 1MMDA 3VYGA 1Y0MA 1QP2A 2DMOA 3DKMA 3NGPA 4C92C 4LD9K 5J39A 2CUDA 4LUEA 2AZVA 2EYYA 2DAQA 3EG9B 2K3XA 2DPPB 3BY7A 2KK4A 4ANJA 3CCRT 2FZGB 2NUTA 4N4GA 1X75C 2X4JA 5GAOq 4KT0E 4B6MA 2K5FA 4ZGEB 1ZUUA 3OYEA 2QTVA 3OYIA 4II1A 3UA7A 2GF7A 1GCPA 1SRMA 3GF5A 4JJBA 2KDSA 2AKLA 3X26B 1EFNA 3M4YA 1VQ9A 2RQRA 4C8QF 2YSQA 4RG2A 3CC2A 4BUGA 4QQ6A 5CVIA 2MCNA 1YI2Q 1FMVA 2EBPA 2CUBA 3E2UA 1ZX6A 3CCRA 5CKDA 4FW2A 3VRYA 1JU5C 1E6HA 4J9CA 3VS4A 1OZ2A 3M57A 3OYMA 2QDYB 1ZQ1A 3CCVQ 3QSUA 2LX9A 1RLPC 3EG3A 1ZSGA 3MP6A 1IGQA 1OYXA 4M75D 2ZCFB 3WVDB 3OMGA 4M78G 2E64A 2KY9A 4OP0A 1YCSB 3CXCP 2JMCA 4M75G 1D0ZA 1LVKA 4DEXA 3CCJT 3GOXA 2LJ3A 2JM8A 3PMTA 3CC7T 3O8VA 4C8QB 1GRIA 2CSQA 4ZGJB 1D3BB 3UATA 1B3QA 2KGTA 2PUOB 4UC4A 5CQXA 1OU9A 5GAMd 1XJWB 3JAME 2MIOA 2YUQA 1YHQT 2HQEA 2LVMA 3HRTA 1M5Q1 2K6DA 1WQ7A 1PRMC 2XDBA 3ZBDA 2HKNA 3CQTA 3JCMX 1QMCA 3S3MA 2HEQA 4A53A 2CP7A 1UTIA 1UG1A 3L2ZA 2QEXT 2XKOC 1RAAB 3CBPA 3EGDA 3TREA 2DIGA 2D8JA 1K1ZA 2A36A 5J26A 3VS0A 5GAMg 4M77G 3CCUA 4OF1A 3I56T 1RAFB 2XDDA 3EFOA 1NZ9A 2C0TA 3RNJA 4HT9A 1PHTA 2QK0A 3LWHA 2OTLA 3UDCA 4VUBA 2NUZA 2LCLA 4RG8A 3M54A 2L8DA 4XTXA 3A98A 4C5EA 3X20B 3G7ZA 2DJZA 4A4FA 2M1HA 1TH7A 3OQ5A 3HTRA 2B8AA 1M1KR 5D6YA 4ELZC 2A28A 3VS3A 3G6EQ 1VQLT 2DZCA 1H3HA 1T0JA 2VWFA 3TCJA 4XTZA 1C1AA 3I56A 3A8OB 1TXQA 4CC4B 4HXJA 2JXBA 4K11A 2CP0A 4BE1A 1AVZC 1W70A 4OMNA 5KYNA 3LX7A 4QVDA 1KK7A 2DF6A 3HKSA 1VQ8T 1T3LA 3CCJA 3T9NA 1ZSZB 2L0AA 2KEAA 2GQIA 3EG0A 1IO6A 2WSEE 1M27C 2KRMA 2FZCB 1KC8U 1VQ8Q 4IIOA 1N8RU 4C5HA 1Y57A 1W2BS 1I1JA 5GAOr 1PD0A 1NJIR 2BZ8A 3N5BB 3DLMA 3LW5E 1K9AA 2VGNA 2E6NA 2CREA 4QQGA 3I55T 4J83A 3Q1JA 3QWYA 3CCLA 4M7AD 1T3SA 3JCMd 1KC8C 4PJOF 4M77F 2FZKB 1R8OB 1U06A 1YJWT 4KGVB 2K2MA 5HCKA 2DL4A 1WYXA 1W6XA 5C6SA 5FU7C 2L3RA 4JZ4A 3REAB 1IGUA 1UGPB 2HQHA 2YRCA 3CCLT 2LNVA 2NYSA 2ATCB 3NMZC 1UGRB 2QA4Q 1K0XA 3CCQT 1M1GA 3NTKA 2LCSA 3JCMc 2VVKA 5LJ5d 3JCMh 4AFSC 1UGVA 2K4YA 2QA4T 5LJ5h 1Q81R 2IIMA 1WHLA 5KYUA 4C8QC 3VJPA 1KHCA 4EMKB 1MMNA 3ASKA 1VQLQ 2CH4W 2KMTA 2RHIA 3VS6A 1QLYA 2XDPA 5LJ3g 2J6FA 2MK5A 1ZA2B 2RQUA 4C8QE 2BUDA 2DL7A 1UECA 2ABLA 3CCMA 3X28B 3J81E 1UHFA 2E65A 3KFVA 2PU9B 2RK1A 5IXBA 1NPRA 2CT3A 1G83A 4KBMB 1YJ9A 4PJOD 4OB2B 2LZ6B 1XOVA 2X4XA 5IHNA 3LH0A 1RACB 2YUOA 4PJOG 2DETA 1VQKQ 1D1BA 1BIBA 2V1QA 3CPWP 1NEBA 4A4EA 5CAIA 1PSEA 2G3RA 2DRKA 5GAOl 4EDUA 4D8DA 3QXEB 1SRLA 1QQJA 2DXTA 2OX7A 2GBQA 2CKKA 2EGCA 3C95A 4LE9A 2FEIA 1EX4A 2RHZA 1MUZA 1YWOA 2M9UA 2CZ1B 1HYOA 5GAOm 1M3BA 2EGAA 2WSCE 4JLGA 2OTLQ 1O75A 2GNCA 2W0ZA 2AHJB 1UGQB 2DBMA 1RUWA 1Q82U 3BE3A 1GCQA 5M9OA 5HK0A 3M58A 4N0AC 2OTJT 1G2BA 1UHCA 2ZPGB 5FWCA 3CCEQ 4RTXA 4C92D 3CCMQ 1SHFA 4OB1B 2QQBA 2MOXA 4ZNXA 2CSIA 1B07A 4XU3A 2QDLA 1B34A 2PUKB 2JW4A 3MEWA 1M2VA 1OULA 2YXYA 1Q86U 3JB9J 2XHCA 3M53A 1M8VA 2OAWA 1YITQ 2KE9A 4C8QD 4F16A 2SEMA 3CC4Q 1Z9ZA 2E1HA 3OMCA 4EPCA 4F7UB 2A7YA 2XU8A 1Y07A 2COYA 2R58A 5GAMe 1MV3A 1PG5B 3QKJA 1NLOC 1A0NB 1IHVA 4M77D 5GANj 2RJDA 2YT6A 3EG9A 2RK2A 4M78F 3TQ7P 5KE3A 2CP2A 2EKOA 2D0QB 5D6WA 2O4XB 4M75F 1W2BA 2XD0A 1OI1A 1WFWA 5CCAA 2W10A 3M0UA 3UT1A 4IUVA 4PJOC 1I8FA 3SWNA 4PK4A 4M7AC 5IXFA 4C0ZA 4PJNA 4FL6A 2RI2A 1ZBXA 2DBKA 4XTYA 5FLXE 1BCMA 3CMEQ 4JS4A 3H8ZA 3DB4A 4A4HA 2NUPB 1VQ6A 1ZUKA 1JJ2S 1Y96B 5GMKe 2X3XD 4HCBA 3J80E 1N9RA 3A5ZB 4BY6C 2EJFA 3JB9G 1D0XA 3C94A 4DBQA 3TU4K 2D9TA 2JOYA 1D1AA 3V7SA 3PTAA 1UE9A 3CCQA 1Y7XA 1TOVA 3JB9I 1KQSA 4EMGA 4HCCA 1AZGB 2QGFB 4DOWA 2RI3A 2E12A 3LWIA 5FRNA 2FHDA 3UA6A 4PL6A 2L3SA 2PQWA 2EYQA 2DKGA 3L2QA 2JTEA 4N0AA 3EHRA 1M3CA 3CPWS 4M7AE 2V26A 1SG5A 3FJPA 1UDLA 3P8DA 1WHKA 3H9NA 4ZGDB 3SFMA 4BE2A 3E1SA 1GFCA 3L2VA 2VV5A 2EAYA 2GCXA 3LGFA 3R6OA 2RNAA 1WQWA 4V2SA 1SKUB 2LNHB 4FYYB 1YJ9Q 4QVCA 4PJOE 2JJ9A 2KQWA 1X69A 4XTVA 5I21A 1V76A 3I9QA 3QBYA 1VQPA 3URGA 2XK0A 5GAN8 1Q82R 3QUIA 2LT1A 5FU6C 1WHMA 1VQ7T 3OYHA 2F5KA 4BI3A 3H0IA 3CXCS 1FYNA 2PVOB 1DJ7B 2H3EB 4J9FA 4DOVA 3ZFJA 5LJ3h 3H0HA 4PFZA 2Y4YA 3L42A 1VQMA 1VQ5T 3QWXX 4PJLA 1HD3A 1VQ4A 3JCMb 2D0NA 2DD4A 2GGRA 2YRVA 1M1KC 4Z88A 1VQMQ 2LDMA 1VQ9T 3HSBA 2DVEA 1WPYA 2AIRB 1R0CB 4R0KA 3META 2QQRA 4CRIA 2YWWA 3P8BB 5KYYB 1WXBA 3RKYA 3M55A 4M7DA 1X43A 1D1CA 4NL3A 1PSFA 3CBOA 1RAEB 3PNWC 4F7UF 2KRNA 1RI9A 3VV0A 2DK3A 3PT9A 2LJ0A 1KD1R 1IHWA 5GANe 1VQPQ 1K73U 3GBQA 3OYNA 4E7HA 1M1KU 2VC8A 4LDWA 1VQ7A 4N4HA 3X25B 3H41A 1SPKA 1YFNA 4C92B 4M78D 2CH4A 2KVQG 2P0KA 4E6RA 4Y28E 5A2QE 4XTUA 1BBZA 2A0FB 1VOMA 3CCVT 2E6ZA 1QVFA 1AZEA 3G1JA 5I2SA 1IB8A 2L3PA 4JDSA 4F7UE 1YJNA 2EQIA 1LNXA 1KC8R 4PNOA 3OA6A 4RKUE 5GJVB 2IPOB 2VASA 4OB0B 2OJ2A 3A8LB 3OW2S 4LDXA 4AFZC 3L2WA 4FYVB 2HMAA 2ZPFB 1KJWA 3J7AF 2KT1A 3CCVA 2H8HA 1M3AA 4J9GA 1U3OA 4M77A 2E3HA 1Q86R 3SB2A 1VYVA 1K8AC 4XK8E 3WXMB 2LMJA 3NFCA 4HA8A 2LT4A 4M7DE 3HL8A 4XU2A 1KQSS 2OTJA 3SHWA 3NTIA 2LX7A 2RQTA 4KGZB 3MHXA 1AT1B 3RESA 2VKNA 4FYWB 2DRMA 1YWPA 4LN2A 1X6BA 2C0OA 4Y92A 2EQMA 3EHQA 3O5ZA 1CSKA 2FRWA 1FX7A 1QKXA 3KBGA 2L89A 2XI9A 2ZPIB 5GAOp 2GFUA 3DLLA 2BZXA 3JCMV 2BTTA 4QVZA 4ESRA 2K7AA 5DY9A 2X4YA 2YUPA 1RI0A 2ZGWA 3VUZA 1TTHB 2EJ9A 1VUBA 1M1FA 3PMIA 4X1VA 1VQKT 4OMMA 1TWBA 2EFIA 3TSWA 1AWJA 1VQ9Q 3QO3A 2DVJA 3HP9A 4QQDA 4ZTFA 3QDRB 3PFSA 1I0CA 2QAZA 2BKDN 1YITT 1X27A 3CCUT 3FRNA 5DLOA 2XG8D 4PFPA 3JV3A 5HKCA 4JJCA 2V8IA 3HPWA 3OYYA 2RA2A 2RQVA 1PD1A 2A08A 2E5QA 3CCUQ 3ER0A 2EGEA 3NPFA 4C92G 3CCMT 4M77C 1Q82C 2LP5A 2LQWA 4O6JA 4X9DA 1MNEA 3OYAA 1MNDA 1WXUA 3QPHA 1N8RR 1LJOA 3ZL7C 2HSPA 4E2FB 4C0DB 4F04B 3CC2T 2DIQA 2LC4A 2MYSA 2BIVA 2KYMA 3OYJA 5A0LA 4XTWA 3BW1A 3OYDA 1ACMB 4FIBA 1R0BG 4E7ZA 3D7SB 1VA7A 4PJMA 2X3WD 1Y71A 2D8HA 2J6KA 2EIFA 1Q81C 1GXIE 3M0SA 2DILA 5DM7R 1PCXA 3OSVA 2DL3A 1K8AR 3MEVA 2GFAA 3P8HA 1N6AA 5FU7B 3U23A 1PM3A 2RHUA 3FIFA 1QWEA 4PJOA 2LRQA 3OS1A 2ED1A 3G71Q 3M0PA 2E70A 5CKHA 3BFMA 2DYBA 1EZZB 2E41A 2KSSA 4FW1A 4M7DD 3EH1A 4P5NA 3HFOA 4RTWA 4GLMA 1BI0A 3SEMA 4GY5A 4BDYA 3V8JA 3LGLA 1OQKA 2JZ2A 3NTHA 3CMET 1ZUYA 4J9DA 5C0MA 4D6WA 4B9XA 2ZPHB 4KRTA 1O9SA 3JCMQ 1VQNA 4RUGA 4KUIA 2DO3A 4FT4A 2MWPA 1SSHA 2OTJQ 3EGXA 1SF9A 2EQKA 1WA7A 4OMOA 2FPDA 3OYLA 1WIEA 3EFRA 2FO0A 1EIFA 4O5VA 1Q95G 2DXBA 4DQ2A 4MZPA 1HXDA 2RJEA 2PZ1A 1QWFA 1BU1A 4C92A 3GPLA 1VQ5Q 4N4IA 2FL7A 1V29B 2JTMA 1W2BP 1X2QA 2CT4A 1RADB 4B9WA 4PJOB 3RMSA 2DTHA 3OB9A 2EYWA 3LYIA 1H92A 1NYGA 2DTIA 4Z8AA 5LJ3j 2LQ8A 4LUDA 1Q7YC 1ABQA 3CC4A 3RR6A 1H641 4MDWA 5AYFA 4IUQA 1I81A 1GFDA 2GQVA 2DX1A 3SD4A 3CMAT 4PFOA 2KI7A 4KUDK 5FRMA 2A3LA 1VQ4T 1U8RA 4F14A 4C0FA 1ZLMA 3JB9H 1LCKA 1K0SA 4KULA 2YLCA 2LCCA 4OMFB 2DERA 2HZYA 4A4GA 2CS7A 4AG1C 1QVGP 4F17A 1MMGA 5GAMh 2HBPA 2X4WA 5FU6B 3L2RA 5LJ5g 4M7AA 4M77E 4DBRA 3TEEA 2K5LA 4J7IA 1LOJA 3FLGA 3VS2A 4A63B 5A0GA 5CKBA 5IAYA 3CCJQ 2EYZA 2BE7D 2DTOA 2ED0A 3REBB 2K3BA 5GMKj 1TS9A 1VYUA 2O01E 3JCMJ 5L23A 1IZ6A 3C4SA 1J3TA 1WX6A 3V8KA 2KXCA 3I55Q 1W4SA 4HVUA 4MDXA 2F2VA 2MWOA 2E4HA 2CP5A 2VB6A 1M2VB 2ESWA 2M0OA 3UPUA 3HRSA 4J9HA 1S1NA 3TSZA 1G3TA 3I35A 2KROA 2FPFA 3M56A 2EPDA 2YRDA 1WDXA 2DEQA 2E3IA 3GNGA 4HVWA 4CC2A 3GP8A 1VQOA 1YHQA 3PE0A 2O9VA 4RCCA 1YJ9T 5CO7A 4A54A 1BI1A 3CMAA 4AG2C 4FYXB 2DZ9A 1Y96A 1AWOA 2EWNA 4L6V5 1JO8A 5GANd 1N9SA 3FB9A 2X35A 3IQLA 5I22A 4ZN3A 2L5QA 1OPKA 3VUBA 3V7CA 1JXOA 3PVLA 1OZ3A 1QVFS 1PKTA 1MHNA 1M90R 3JB9D 3PIOA 3VS5A 2KBTA 4XAXB 1K9MR 1UJYA 2CZ7B 2GTOA 4AMCA 1OEBA 4KH1B 4C0GA 3AT1B 3EG2A 1F1BB 2QXFA 4M7DG 5KH6A 1M2OA 3MEAA 3A1PA 2QEXA 4JRIA 1AD5A 3BDUA 1G8XA 3ULRB 5GMKm 2EVRA 1IXDA 3EFOB 4MZMA 3JRZA 1NBEB 1K73C 5GAN3 3OS2A 1SEMA 1KD1C 2JUFA 1X2KA 1K9MU 4J5YA 2DXUA 3CCLQ 5LJ3e 3VU3C 4XU0A 2WACA 9ATCB 4DBFA 5D7UA 2K9GA 1VQLA 1FMKA 1WI7A 4RCBA 3OYKA 3RIRA 3FEOA 2CP6A 1KFZA 4E7JA 4EMKA 2QTXA 3QZ9B 2IG0A 4XU1A 2FYKA 5KYXA 4WF2A 5GAMj 4M75A 3ZEHA 1C6VX 1TU0B 4BI8B 1I5LA 1M4ZA 2DA9A 3LH5A 1JJ2A 2ROTA 3C12A 3M5AA 4M78A 3G4ST 4BE0A 1YI2A 2PTKA 5GANg 1B7TA 1OX8A 1NJIU 5LL6S 4E7IA 1VQOT 1E7OA 2HQXA 1QCOA 3NHNA 4DEYA 1VQNQ 1M90C 2I2LA 5LJ5f 2FG0A 1RLQC 1FXXA 2YUNA 1UGSB 3RMQA 2NLUA 5CKFA 3F70A 1WJSA 5A0DA 4D8KA 3AHUA 2Y4XA 2EKHA 3OBYA 5KE2A 4RTVA 2CDTA 1IREB 2D6FA 2FRYA 5GMKl 1ZHIA 4FM4B 5GMKi 1MMAA 4FSSA 3OYCA 2P0QA 4CI0C 4JPBW 2OTLT 5IHKA 5ECAA 2QGGA 2RJFA 4ELYC 5DLQE 8ATCB 4JRQA 4JUVA 5GAN7 5EG2A 4ZN1A 1VIFA 4M75C 2QQ9A 5IT9E 2ZAEA 3FJ5A 3HRUA 1VQ7Q 3A8HB 2GTJA 2WSFE 3RKWA 4M75B 1JQQA 4EMKC 1E6GA 2A37A 2EQJA 5FW9A 3VKIA 2CGHA 2MMPA 2RN8A 7AT1B 3M0QA 2ENMA 2PVDB 3OW2A 3I5SA 1AWWA 4MZTA 4RTUA 2COWA 3VS7A 1KQ1A 1N5ZA 2Y90A 1D0YA 3RUXA 2EJGA 3JCMe 1G3SA 1TUCA 5EC7A 1WZOA 1FMWA 2RH2A 4C8QG 3CD6Q 3MCAB 1JRIA 2JN0A 3CC7Q 3L1AA 2MPXC 1NE8A 2H3JA 2DE0X 4RTTA 2HBWA 2K2VA 1Q86C 4JS5A 1N8RC 1BKBA 4OMQA 4OB3B 5GJWB 4AFUC 1RAHB 2HNIA 2KYBA 2YHTA 5CQYA 3M9QA 3RKXA 3M59A 3G6ET 1X6OA 3CEYA 1I4K1 1YITA 1TSFA 5GMKh 4HCZA 2M51A 3R6NA 1AHJB 1OX9A 4MMKA 5HK3A 2HL3A 1YIJA 3G4SQ 4DBHA 5J3BA 2ZPEB 3C0CA 3E9FA 1KIKA 2B86A 2P4TA 4FSXA 3PGGA 1K4US 3QDFA 2JM9A 4M4ZA 2ZZDA 3QYHB 3CXCA 5LJ5j 4IKFA 2DEUA 3V7RA 1BI2A 4BACA 3CCSQ 1YJWA 3A8MB 2RQWA 5KCOA 5I11A 2NUTB 2DL8A 2LJ1A 1XQHA 2V8KA 4C92E 4QW2A 5KYXB 2J7IA 4JJNK 1K76A 5D6XA 3OSSC 4NOYA 1VQKA 2L3QA 2C06A 2HL5C 1NYFA 1P92A 4WCIA 1UB4A 3QHSA 4M7DC 1HJDA 2HDAA 3SWNC 1VQNT 1C0MA 4KH0B 1FWZA 1NLPC 1IRXA 2M0YA 4F7UG 5LJ3f 2QEXQ 2QA4A 1I07A 1N27A 3SWNB 2P84A 2C0IA 3WVEB 2O88A 4RMOA 1X01A 1V1CA 3CC4T 3CC7A 1RAGB 3EG1A 1YNZA 1JJ2P 2PNIA 4J9BA 4RTZA 3VS1A 5GAOn 3QYGB 1VQ8A 1QW1A 1WXTA 1U5SA 4OVAA 3CBMA 4ATOA 3GNFB 1T0HA 4BD3A 4E47A 1KD1U 2X51A 2DNUA 4R55A 2R5AA 3I5RA 3H6ZA 2L2PA 5GAN4 2K5IA 1YIJT 4LDUA 1S72A 2F2WA 4IUPA 4HCKA 3KXTA 4EMHA 2KXDA 2F5TX 2K3YA 1PNJA 1D3BA 1YIJQ 2JT4A 3HHTB 3EFSA 1WJRA 3CC2Q 2VXFA 3UF4A 1HK9A 1S72Q 4PLIA 4ORZA 2HAXA 2KNBB 2RI5A 1LPLA 1H8KA 2J05A 3UWNA 4L5GA 4OMPA 5GANh 3CCRQ 4PLLA 2F69A 2E10A 1WJQA 1Z9QA 1JXMA 5FROA 1OV3A 1HSQA 1PC0A 3THKA 4Z02A 2O2OA 3QG1A 2JS0A 4J6YA 2MF2A 1I5OB 4M7DB 2KT8A 1ZSZA 3QJYA 4ME7A 1KQSP 3JCMP 2P4RA 3TVTA 1MV0B 5KCHA 1MGQA 4CC7A 2FVUA 1W1FA 2VXEA 1YHQQ 2DM1A 3G71T 2K57A 5KYUB 1UJ0A 4TVRA 6AT1B 1QVGA 2DFUA 2QI2A 2HSEB 2J06A 3JSCA 1KG1A 2AK5A 2EYXA 1WNLA 1QKWA 3QZ5B 4JJDA 3X24B 5AT1B 3PIPA 3G6EA 4X9CA 4IUUA 1QCNA 3M0RA 1JBMA 3H0FA 3SDZA 1VQOQ 4RTYA 4BDZA 2RO0A 3CCSA 4C5GA 3CCET 2RF0A 3OYFA 2RHYA 4AFQC 4IUTA 8AT1B 4JRKA 3QJ6A 3S3OA 2IVWA 3EGUA 3OBWA 1CKAA 3CCQQ 2DL5A 1BYMA 4BY6B 1WHHA 4E7KA 2QQSA 3E9GA 2VYTA 3HFNA 3DB3A 2M02A 4J9IA 4Z89A 1K73R 4HT8A 3G4SA 1YI2T 1PKSA 1QCFA 4HVVA 4FCYA 1KSWA 1WGSA 5FWBA 2F1LA 2AT1B 1VQ6T 4CC3A 4J6WA 4J7FA 1XTDA 5GANf 1VQ5A 5LJ3d 5LJ5e 4E7SA 4J9EA 4WTOB 1CKBA 5GAN6 1S72T 3RDVA 2QYZA 1YJWQ 4C92F 1YN8A 3E19A 5KYYA 1JEGA 3QIIA 1RABB 1BCOA 2QASA 5IN1A 3MP8A 1KQ2A 4GLKA 2BZYA 1KHIA 2E5KA 2FPEA 3GLXA 5KYWB 1RL2A 4M78C 3CD6A 1GCQC 1TUDA 5CK9A 1UFFA 2MI6A 5IH2A 2R57A 1ZA1B 4PKCC 4KGXB 1BK2A 1NJIC 2LQNA 1OU8A 4M78B 1OPLA 3VYHB 2AKKA 4Y91A 5I2MA 2D1XA 2JS2A 4M7AB 1OOTA 4M78E 2O9SA 4R56A 1NG2A 3OS0A 3VRZA 2RD1A 1ABOA 1M30A 4NS5A 4J6XA 4M75E 3I55A 2Z0WA 4M7AG 2CZ6B 3S3NA 1BB9A 1SSFA 2YLBA 3CD6T 2VGMA 2CP3A 2CZ0B 1GBQA 4A4KA 1PWTA 4FU6A 4YTLA 5GAN5 4PJJA 2HCKA 1VQ6Q 3MPUB 3MJXA 4IURA 3OS5A 2ROLA 5GAN2 2NWMA 3FC3A 1G3YA 2KRSA 1K9MC 2PVGB 2JTFA 2DXCA 3OYBA 5L8RE 4LXCA 4LD6A 1YJNQ 2JVVA 3CMAQ 2XMFA 3KUFA 3JCMf 2V1RA 4QKUA 4M77B 2VUBA 5HY6A 1QVFP 2HD0A 5IHIA 1ZSZC 1B34B 2DD5A 4OGEA 4JRPA 5GAMf 4C0DC 1WHGA 2QQAA 3CCST 3V8LA 3OYGA 2SRCA 2EW3A 2OAUA 2CYZB 2EQUA 4AT1B 1G3WA 2J6OA 4LNPA 1TUGB 1PRLC 1H3ZA 1Q81U 4M7AF 1U1TA 1R77A 2COZA 4M7DF 1XNIA 2NUPA 4ZTJA 1RAIB 1VQ4Q 1YJNT 1GL5A 2YDLA 1NEGA 3M4GA 2RMOA 1YBYA 2HKQB 4FT2A 1VYTA 2RB6A 4F7UA 3L2UA 3CPFA 1TG0A 2RM4A 2XICA 1YP5A 2XIDA 3RBBB 3EH2A 4J8OA 4BI4A 1U1SA 4GBQA 5CIUA 2R5MA 1NM7A 4BB7A 4JLIA
chains in the Genus database with same CATH topology
5GAOl 2ZPBB 3OYJA 1M9SA 4C8QA 4EDUA 2O4XA 5A0LA 4XTWA 3QXEB 3BW1A 3OYDA 2DXTA 1QVGS 3GIBA 1YCYA 2CKKA 2V8JA 1KQ1A 1VQMT 4FIBA 4OGCA 2Y90A 3C95A 4DA4A 3RUXA 2EJGA 3JCMe 1Y71A 1G3SA 2RHZA 3JB9F 2RH2A 4C8QG 1BIAA 1NPPA 2EIFA 2M9UA 1Q81C 1GXIE 3MCAB 3CCEA 5DM7R 2CZ1B 5GAOm 1JRIA 1QVPA 2JN0A 2WSCE 3OSVA 4JLGA 3L1AA 1NE8A 2H3JA 3MEVA 1O75A 2GFAA 2K2VA 3LLRA 1Q86C 4JS5A 1JB0E 1N6AA 3P8HA 4X34A 2AHJB 1BKBA 5FU7B 1N8RC 3FIFA 2RHUA 1UGQB 4OB3B 4PJOA 1Q82U 1UEBA 2HNIA 2MAMA 2LRQA 2YHTA 3M9QA 5CQYA 3M59A 3RKXA 5M9OA 5HK0A 3OS1A 3JCMW 1X6OA 2FB7A 3M58A 1VQPT 4MMLA 4N0AC 2OTJT 2ZPGB 2E70A 5CKHA 3BFMA 3CEYA 1I4K1 5CR2A 4C92D 1YITA 4OB1B 2LTOA 2QQBA 3S6WA 3MO8A 5GMKh 2E41A 1VIEA 2KSSA 4M7DD 4P5NA 4HCZA 5HK3A 3HFOA 1AHJB 4XU3A 4MMKA 3A8GB 3CPWA 1B34A 3RERA 1YIJA 1BI0A 2PUKB 3MEWA 4GY5A 3V8JA 4BDYA 4Q5WA 3LGLA 3BDLA 3FDRA 5J3BA 5CKEA 2JZ2A 1Q86U 2RHXA 3JB9J 2XHCA 3M53A 1K8AU 2ZPEB 3OY9A 1QP3A 3NTHA 1M8VA 3E9FA 3CMET 4C8QD 2P4TA 4FSXA 3PGGA 4XQ3A 5C0MA 2E1HA 4NL2A 3OMCA 3MP1A 2ZZDA 3QYHB 3CXCA 4EPCA 4D6WA 5LJ5j 2P0PA 4B9XA 2A7YA 2ZPHB 4F7UB 3V7RA 3EAEA 3MEUA 2XU8A 1O9SA 1Y07A 2R58A 1BI2A 4BACA 3JCMQ 2LQKA 1VQNA 1YJWA 3A8MB 4E7LA 5KCOA 4HKEA 3CMEA 4KUIA 4C5IA 5GAMe 2DO3A 4FT4A 2RJCA 3QKJA 2MWPA 1XQHA 2V8KA 2KAFA 4M77D 2EQKA 5GANj 2M16A 2RJDA 1BI3A 4C92E 3OYLA 1G5VA 3EFRA 4L59A 1EIFA 2RK2A 4O5VA 4QW2A 4M78F 3JCMg 2DXBA 5KE3A 4JJNK 2EKOA 2D0QB 1M90U 5D6WA 3INZA 4LDVA 4DQ2A 2O4XB 5D6XA 3OSSC 1HXDA 2JNGA 3ME9A 4M75F 2RJEA 4MZPA 4NOYA 1W2BA 1Q7YU 2C06A 1VQKA 1OI1A 2XD0A 1P92A 1UB4A 3QHSA 4M7DC 3G71A 3SWNC 3VYGA 4LDYA 1VQNT 4ATOA 1FWZA 1QP2A 5CCAA 3DKMA 4LD9K 4C92C 4C92A 3GPLA 5J39A 4F7UG 5LJ3f 3UT1A 4IUVA 4PJOC 1I8FA 4N4IA 3SWNA 2FL7A 2QA4A 1V29B 1N27A 2JTMA 3SWNB 3WVEB 3CCUA 4M7AC 4RMOA 1X01A 2DAQA 3CC4T 3CC7A 4C0ZA 2K3XA 4B9WA 4FL6A 3CCET 2DPPB 2RI2A 2KK4A 3BY7A 3CCRT 4PJOB 1ZBXA 4N4GA 3RMSA 1X75C 2X4JA 5GAOq 2DTHA 5GAOn 4XTYA 3QYGB 3OB9A 5FLXE 4KT0E 1VQ8A 3LYIA 1QW1A 2K5FA 2DTIA 5LJ3j 4ZGEB 4JS4A 2LQ8A 1Q7YC 3CC4A 3H8ZA 3DB4A 4A4HA 1H641 4OVAA 1VQ6A 3CBMA 3OYEA 4MDWA 1JJ2S 1Y96B 5GMKe 3GNFB 5AYFA 4IUQA 1I81A 4II1A 4BD3A 4E47A 3OYIA 1KD1U 2GQVA 2GF7A 4HCBA 3GF5A 3J80E 1N9RA 3A5ZB 4BY6C 4R55A 3SD4A 3CMAT 2KDSA 2R5AA 2EJFA 3X26B 3JB9G 3C94A 3M4YA 1VQ9A 4C8QF 3TU4K 3H6ZA 4KUDK 2D9TA 4RG2A 3CC2A 2JOYA 5FRMA 4BUGA 5GAN4 4QQ6A 5CVIA 3V7SA 2A3LA 1VQ4T 3PTAA 2K5IA 1YIJT 3CCQA 1U8RA 1Y7XA 4C0FA 4LDUA 3G6EA 3JB9H 3JB9I 1S72A 4IUPA 1KQSA 4KULA 4EMGA 4HCCA 2YLCA 2LCCA 4OMFB 3KXTA 3CCRA 4DOWA 5CKDA 2RI3A 4EMHA 2E12A 2F5TX 4A4GA 3LWIA 2CS7A 2K3YA 5FRNA 2FHDA 1OZ2A 1D3BA 3M57A 5GAMh 2HBPA 2X4WA 3HHTB 3EFSA 4PL6A 5FU6B 5LJ5g 3L2RA 3OYMA 4M7AA 1WJRA 2PQWA 1ZQ1A 2EYQA 2QDYB 4M77E 2DKGA 3L2QA 3TEEA 4N0AA 2K5LA 3QSUA 2VXFA 2LX9A 3CPWS 1HK9A 1LOJA 4J7IA 4M7AE 3FLGA 3MP6A 4PLIA 2HAXA 3FJPA 1OYXA 4M75D 2RI5A 2ZCFB 5CKBA 5A0GA 3P8DA 3UWNA 3WVDB 4ZGDB 5IAYA 4L5GA 5GANh 4PLLA 2F69A 3SFMA 2DTOA 4BE2A 2E10A 3OMGA 3E1SA 1WJQA 3L2VA 4M78G 2E64A 2EAYA 2GCXA 2KY9A 2VV5A 3LGFA 5FROA 4OP0A 4Z02A 3R6OA 3QG1A 1WQWA 4V2SA 4M75G 5GMKj 2O01E 4QVCA 4J6YA 3CCJT 3GOXA 2MF2A 4PJOE 3JCMJ 1IZ6A 3C4SA 4M7DB 2KQWA 4XTVA 3V8KA 3PMTA 3CC7T 5I21A 3QJYA 4ME7A 3O8VA 4C8QB 3QBYA 4ZGJB 1W4SA 3JCMP 1D3BB 2XK0A 3URGA 5GAN8 1VQPA 4MDXA 5KCHA 1MGQA 2PUOB 2LT1A 3QUIA 5FU6C 1VQ7T 2MWOA 2FVUA 2VXEA 4UC4A 5CQXA 5GAMd 3OYHA 3G71T 2F5KA 4BI3A 3JAME 2K57A 2M0OA 3UPUA 3HRSA 4TVRA 3CXCS 1QVGA 1YHQT 2PVOB 2HQEA 2LVMA 1DJ7B 1G3TA 2QI2A 3HRTA 1M5Q1 4DOVA 3JSCA 3ZFJA 1KG1A 5LJ3h 1WQ7A 3M56A 2XDBA 3ZBDA 4M7DE 3JCMX 3S3MA 2DEQA 3GNGA 4A53A 1WNLA 3GP8A 2Y4YA 3L42A 1VQOA 1YHQA 3L2ZA 1VQMA 2QEXT 1VQ5T 1VQ4A 3QZ5B 4RCCA 2XKOC 3JCMb 1YJ9T 3CBPA 5CO7A 3TREA 4A54A 1BI1A 2DD4A 2DIGA 2YRVA 3CMAA 3X24B 1M1KC 2LDMA 5J26A 1VQ9T 2DZ9A 3PIPA 1Y96A 3HSBA 5GAMg 4M77G 2DVEA 1WPYA 4OF1A 4IUUA 2EWNA 4L6V5 4X9CA 3I56T 2XDDA 3META 2QQRA 4CRIA 5GANd 1NZ9A 3P8BB 1N9SA 3RKYA 3M55A 4M7DA 3FB9A 4HT9A 2OTLA 1JBMA 3LWHA 4NL3A 3UDCA 2X35A 1PSFA 3CBOA 4VUBA 3SDZA 4ZN3A 2L5QA 3PNWC 2LCLA 4RG8A 4BDZA 3M54A 2L8DA 4XTXA 2RO0A 3CCSA 4C5EA 4C5GA 3VUBA 3X20B 3V7CA 4F7UF 3G7ZA 2DJZA 3OYFA 4A4FA 2RHYA 2M1HA 1TH7A 4IUTA 4JRKA 1OZ3A 3QJ6A 3VV0A 3OQ5A 2IVWA 3OBWA 3S3OA 1QVFS 2DK3A 2B8AA 3PT9A 1MHNA 5D6YA 4BY6B 4ELZC 1VQLT 1BYMA 2DZCA 3JB9D 3PIOA 5GANe 4E7KA 2QQSA 1K73U 3E9GA 3OYNA 2VYTA 4E7HA 1M1KU 2VC8A 3HFNA 3DB3A 4XAXB 4XTZA 3A8OB 3TCJA 3I56A 2CZ7B 4LDWA 4HT8A 3G4SA 1YI2T 1VQ7A 4N4HA 3X25B 4BE1A 1WGSA 4C0GA 3LX7A 4C92B 2QXFA 4QVDA 1VQ6T 4M78D 4M7DG 4J6WA 4J7FA 1XTDA 5KH6A 2KVQG 2P0KA 3MEAA 5GANf 2QEXA 1VQ5A 4Y28E 5LJ3d 4JRIA 3HKSA 5LJ5e 5A2QE 4XTUA 1VQ8T 3BDUA 3CCJA 3T9NA 5GMKm 5GAN6 1S72T 4C92F 3CCVT 2E6ZA 3E19A 4MZMA 2WSEE 3JRZA 1QVFA 3QIIA 1K73C 5I2SA 5GAN3 4JDSA 5IN1A 3MP8A 1KC8U 3OS2A 4F7UE 1N8RU 4C5HA 1KQ2A 1YJNA 4GLKA 1KD1C 1KHIA 2JUFA 3GLXA 1LNXA 1RL2A 1W2BS 4J5YA 1K9MU 2DXUA 4M78C 4PNOA 5LJ3e 3OA6A 3CD6A 5CK9A 3VU3C 4RKUE 2MI6A 4XU0A 5GAOr 3N5BB 2R57A 2WACA 4MZTA 3DLMA 4OB0B 3A8LB 3LW5E 4PKCC 3OW2S 4LDXA 3L2WA 2VGNA 1NJIC 4M78B 1VQLA 2E6NA 4QQGA 3VYHB 3I55T 2ZPFB 4Y91A 5I2MA 4J83A 4RCBA 3Q1JA 4M7AB 3OYKA 3CCVA 3J7AF 3RIRA 3FEOA 4M78E 4E7JA 4R56A 3OS0A 3CCLA 2RD1A 4M77A 4EMKA 4M7AD 2QTXA 3QZ9B 4NS5A 4J6XA 2IG0A 4M75E 4XU1A 3SB2A 3G6ET 2FYKA 3JCMd 1KC8C 3I55A 4PJOF 1K8AC 4M77F 4WF2A 4XK8E 1R8OB 4M7AG 2CZ6B 3WXMB 4IKFA 3NFCA 3S3NA 1YJWT 4HA8A 2LT4A 1SSFA 2YLBA 5GAMj 4M75A 3ZEHA 3HL8A 4BI8B 1I5LA 3CD6T 2VGMA 1M4ZA 4XU2A 1KQSS 2CZ0B 1JJ2A 2OTJA 3C12A 3M5AA 4M78A 4A4KA 3G4ST 5C6SA 3NTIA 4BE0A 1YI2A 5GANg 5FU7C 4FU6A 4YTLA 2L3RA 1NJIU 5GAN5 3MHXA 3RESA 1UGPB 5LL6S 4IURA 4E7IA 1VQOT 3CCLT 2LNVA 3OS5A 5GAN2 2EQMA 2HQXA 1G3YA 1UGRB 3FC3A 1K9MC 2PVGB 3CCQT 1FX7A 2JTFA 1M1GA 2DXCA 3KBGA 3NTKA 5L8RE 3OYBA 2L89A 2XI9A 2ZPIB 1M90C 4LD6A 3JCMc 2I2LA 5LJ5f 5GAOp 2JVVA 5LJ5d 3JCMh 1FXXA 1UGSB 3RMQA 2GFUA 3DLLA 2K4YA 2NLUA 3KUFA 3JCMV 5LJ5h 2QA4T 4QVZA 3JCMf 5CKFA 3F70A 4C8QC 1WJSA 3VJPA 5A0DA 1KHCA 5DY9A 3AHUA 4M77B 4EMKB 2Y4XA 2VUBA 2X4YA 1RI0A 3ASKA 5HY6A 2HD0A 2ZGWA 2KMTA 2RHIA 3VUZA 2EJ9A 1VUBA 1M1FA 3PMIA 1VQKT 3OBYA 1B34B 2XDPA 5KE2A 5LJ3g 2DD5A 4OGEA 1IREB 2EFIA 5GAMf 4C0DC 4JRPA 2D6FA 2QQAA 3CCST 3V8LA 5GMKl 4C8QE 3OYGA 1ZHIA 4FM4B 2BUDA 3QO3A 5GMKi 3OYCA 3CCMA 3X28B 2OAUA 3HP9A 2CYZB 2P0QA 4QQDA 4CI0C 2EQUA 2OTLT 4ZTFA 1G3WA 3QDRB 3J81E 2E65A 2RJFA 3PFSA 4ELYC 5DLQE 2BKDN 1YITT 4JRQA 2PU9B 3CCUT 1H3ZA 2RK1A 3FRNA 1Q81U 4M7AF 1NPRA 1U1TA 4JUVA 5DLOA 5GAN7 2XG8D 5EG2A 4M7DF 4KBMB 1XNIA 4ZTJA 5HKCA 4ZN1A 1VIFA 4M75C 1YJ9A 4PJOD 2QQ9A 2V8IA 3HPWA 3OYYA 2RA2A 5IT9E 3HRUA 1YJNT 3M4GA 4OB2B 1YBYA 3A8HB 1XOVA 4FT2A 2E5QA 2RB6A 3ER0A 4F7UA 2X4XA 2WSFE 3RKWA 3L2UA 4C92G 3CCMT 4M75B 3LH0A 4M77C 3CPFA 4EMKC 1Q82C 2EQJA 4O6JA 4X9DA 4PJOG 2RM4A 3VKIA 3OYAA 2CGHA 2MMPA 2XICA 3QPHA 2XIDA 1LJOA 4J8OA 4BI4A 1BIBA 1U1SA 2PVDB 2R5MA 5CIUA 4C0DB 3OW2A 3CC2T 2DIQA 4A4EA 5CAIA 1PSEA 2G3RA 2LC4A 4BB7A 4JLIA 2BIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPW A;  2MF2 A;  3JSC A;  4VUB A;  5CKE A;  3NFC A;  4ME7 A;  5CK9 A;  3VUB A;  5CQY A;  3G7Z A;  5HK0 A;  1X75 C;  5CKB A;  4MDX A;  4MZP A;  5CO7 A;  2C06 A;  5CKH A;  4ELY C;  4ELZ C;  5CKF A;  5CQX A;  5CR2 A;  1UB4 A;  5HKC A;  4MZM A;  3JRZ A;  4OF1 A;  3TCJ A;  5CCA A;  2VUB A;  1M1F A;  5CKD A;  4HKE A;  5DLO A;  5HK3 A;  2KMT A;  1NE8 A;  1VUB A;  4MZT A; 
#chains in the Genus database with same CATH topology
 2ZPB B;  1M9S A;  1GBR A;  4C8Q A;  2O4X A;  4JZ3 A;  3OW2 P;  1QVG S;  1D09 B;  3GIB A;  1YCY A;  2V8J A;  1SHG A;  1VQM T;  4OGC A;  1AOJ A;  4DA4 A;  2F2X A;  2RPN A;  3JB9 F;  1BIA A;  1NPP A;  1M8M A;  4OML A;  3CCE A;  1QVP A;  3M0T A;  4QT7 A;  2K79 A;  3LLR A;  1JB0 E;  4X34 A;  1ARK A;  1UEB A;  2MAM A;  1AEY A;  3JCM W;  2FB7 A;  1VQP T;  4MML A;  5CR2 A;  4EIK A;  2LTO A;  3S6W A;  3MO8 A;  2OI3 A;  1VIE A;  3A8G B;  1WHJ A;  3CPW A;  3RER A;  2G6F X;  4Q5W A;  3BDL A;  3FDR A;  2JMA A;  5CKE A;  2ECZ A;  2DJQ A;  1WLP B;  2RHX A;  1Q7Y R;  1K8A U;  3OY9 A;  1QP3 A;  1X6G A;  5KYW A;  4XQ3 A;  1AWX A;  4NL2 A;  3MP1 A;  3MKD A;  2P0P A;  3EAE A;  3MEU A;  2LQK A;  2X9H A;  2BE9 B;  4E7L A;  2I0N A;  4HKE A;  3CME A;  4IIM A;  4C5I A;  2RJC A;  3EGX B;  2O31 A;  2KAF A;  2M16 A;  2AZS A;  1BI3 A;  3PVQ A;  2KR3 A;  1G5V A;  4L59 A;  3I56 Q;  2QG9 B;  1UUE A;  3JCM g;  1M90 U;  3INZ A;  4LDV A;  3ME9 A;  2JNG A;  1Q7Y U;  1ZBJ A;  2DYI A;  3G71 A;  2DLP A;  3EGD B;  4LDY A;  1MMD A;  3VYG A;  1Y0M A;  1QP2 A;  2DMO A;  3DKM A;  3NGP A;  4C92 C;  4LD9 K;  5J39 A;  2CUD A;  4LUE A;  2AZV A;  2EYY A;  2DAQ A;  3EG9 B;  2K3X A;  2DPP B;  3BY7 A;  2KK4 A;  4ANJ A;  3CCR T;  2FZG B;  2NUT A;  4N4G A;  1X75 C;  2X4J A;  5GAO q;  4KT0 E;  4B6M A;  2K5F A;  4ZGE B;  1ZUU A;  3OYE A;  2QTV A;  3OYI A;  4II1 A;  3UA7 A;  2GF7 A;  1GCP A;  1SRM A;  3GF5 A;  4JJB A;  2KDS A;  2AKL A;  3X26 B;  1EFN A;  3M4Y A;  1VQ9 A;  2RQR A;  4C8Q F;  2YSQ A;  4RG2 A;  3CC2 A;  4BUG A;  4QQ6 A;  5CVI A;  2MCN A;  1YI2 Q;  1FMV A;  2EBP A;  2CUB A;  3E2U A;  1ZX6 A;  3CCR A;  5CKD A;  4FW2 A;  3VRY A;  1JU5 C;  1E6H A;  4J9C A;  3VS4 A;  1OZ2 A;  3M57 A;  3OYM A;  2QDY B;  1ZQ1 A;  3CCV Q;  3QSU A;  2LX9 A;  1RLP C;  3EG3 A;  1ZSG A;  3MP6 A;  1IGQ A;  1OYX A;  4M75 D;  2ZCF B;  3WVD B;  3OMG A;  4M78 G;  2E64 A;  2KY9 A;  4OP0 A;  1YCS B;  3CXC P;  2JMC A;  4M75 G;  1D0Z A;  1LVK A;  4DEX A;  3CCJ T;  3GOX A;  2LJ3 A;  2JM8 A;  3PMT A;  3CC7 T;  3O8V A;  4C8Q B;  1GRI A;  2CSQ A;  4ZGJ B;  1D3B B;  3UAT A;  1B3Q A;  2KGT A;  2PUO B;  4UC4 A;  5CQX A;  1OU9 A;  5GAM d;  1XJW B;  3JAM E;  2MIO A;  2YUQ A;  1YHQ T;  2HQE A;  2LVM A;  3HRT A;  1M5Q 1;  2K6D A;  1WQ7 A;  1PRM C;  2XDB A;  3ZBD A;  2HKN A;  3CQT A;  3JCM X;  1QMC A;  3S3M A;  2HEQ A;  4A53 A;  2CP7 A;  1UTI A;  1UG1 A;  3L2Z A;  2QEX T;  2XKO C;  1RAA B;  3CBP A;  3EGD A;  3TRE A;  2DIG A;  2D8J A;  1K1Z A;  2A36 A;  5J26 A;  3VS0 A;  5GAM g;  4M77 G;  3CCU A;  4OF1 A;  3I56 T;  1RAF B;  2XDD A;  3EFO A;  1NZ9 A;  2C0T A;  3RNJ A;  4HT9 A;  1PHT A;  2QK0 A;  3LWH A;  2OTL A;  3UDC A;  4VUB A;  2NUZ A;  2LCL A;  4RG8 A;  3M54 A;  2L8D A;  4XTX A;  3A98 A;  4C5E A;  3X20 B;  3G7Z A;  2DJZ A;  4A4F A;  2M1H A;  1TH7 A;  3OQ5 A;  3HTR A;  2B8A A;  1M1K R;  5D6Y A;  4ELZ C;  2A28 A;  3VS3 A;  3G6E Q;  1VQL T;  2DZC A;  1H3H A;  1T0J A;  2VWF A;  3TCJ A;  4XTZ A;  1C1A A;  3I56 A;  3A8O B;  1TXQ A;  4CC4 B;  4HXJ A;  2JXB A;  4K11 A;  2CP0 A;  4BE1 A;  1AVZ C;  1W70 A;  4OMN A;  5KYN A;  3LX7 A;  4QVD A;  1KK7 A;  2DF6 A;  3HKS A;  1VQ8 T;  1T3L A;  3CCJ A;  3T9N A;  1ZSZ B;  2L0A A;  2KEA A;  2GQI A;  3EG0 A;  1IO6 A;  2WSE E;  1M27 C;  2KRM A;  2FZC B;  1KC8 U;  1VQ8 Q;  4IIO A;  1N8R U;  4C5H A;  1Y57 A;  1W2B S;  1I1J A;  5GAO r;  1PD0 A;  1NJI R;  2BZ8 A;  3N5B B;  3DLM A;  3LW5 E;  1K9A A;  2VGN A;  2E6N A;  2CRE A;  4QQG A;  3I55 T;  4J83 A;  3Q1J A;  3QWY A;  3CCL A;  4M7A D;  1T3S A;  3JCM d;  1KC8 C;  4PJO F;  4M77 F;  2FZK B;  1R8O B;  1U06 A;  1YJW T;  4KGV B;  2K2M A;  5HCK A;  2DL4 A;  1WYX A;  1W6X A;  5C6S A;  5FU7 C;  2L3R A;  4JZ4 A;  3REA B;  1IGU A;  1UGP B;  2HQH A;  2YRC A;  3CCL T;  2LNV A;  2NYS A;  2ATC B;  3NMZ C;  1UGR B;  2QA4 Q;  1K0X A;  3CCQ T;  1M1G A;  3NTK A;  2LCS A;  3JCM c;  2VVK A;  5LJ5 d;  3JCM h;  4AFS C;  1UGV A;  2K4Y A;  2QA4 T;  5LJ5 h;  1Q81 R;  2IIM A;  1WHL A;  5KYU A;  4C8Q C;  3VJP A;  1KHC A;  4EMK B;  1MMN A;  3ASK A;  1VQL Q;  2CH4 W;  2KMT A;  2RHI A;  3VS6 A;  1QLY A;  2XDP A;  5LJ3 g;  2J6F A;  2MK5 A;  1ZA2 B;  2RQU A;  4C8Q E;  2BUD A;  2DL7 A;  1UEC A;  2ABL A;  3CCM A;  3X28 B;  3J81 E;  1UHF A;  2E65 A;  3KFV A;  2PU9 B;  2RK1 A;  5IXB A;  1NPR A;  2CT3 A;  1G83 A;  4KBM B;  1YJ9 A;  4PJO D;  4OB2 B;  2LZ6 B;  1XOV A;  2X4X A;  5IHN A;  3LH0 A;  1RAC B;  2YUO A;  4PJO G;  2DET A;  1VQK Q;  1D1B A;  1BIB A;  2V1Q A;  3CPW P;  1NEB A;  4A4E A;  5CAI A;  1PSE A;  2G3R A;  2DRK A;  5GAO l;  4EDU A;  4D8D A;  3QXE B;  1SRL A;  1QQJ A;  2DXT A;  2OX7 A;  2GBQ A;  2CKK A;  2EGC A;  3C95 A;  4LE9 A;  2FEI A;  1EX4 A;  2RHZ A;  1MUZ A;  1YWO A;  2M9U A;  2CZ1 B;  1HYO A;  5GAO m;  1M3B A;  2EGA A;  2WSC E;  4JLG A;  2OTL Q;  1O75 A;  2GNC A;  2W0Z A;  2AHJ B;  1UGQ B;  2DBM A;  1RUW A;  1Q82 U;  3BE3 A;  1GCQ A;  5M9O A;  5HK0 A;  3M58 A;  4N0A C;  2OTJ T;  1G2B A;  1UHC A;  2ZPG B;  5FWC A;  3CCE Q;  4RTX A;  4C92 D;  3CCM Q;  1SHF A;  4OB1 B;  2QQB A;  2MOX A;  4ZNX A;  2CSI A;  1B07 A;  4XU3 A;  2QDL A;  1B34 A;  2PUK B;  2JW4 A;  3MEW A;  1M2V A;  1OUL A;  2YXY A;  1Q86 U;  3JB9 J;  2XHC A;  3M53 A;  1M8V A;  2OAW A;  1YIT Q;  2KE9 A;  4C8Q D;  4F16 A;  2SEM A;  3CC4 Q;  1Z9Z A;  2E1H A;  3OMC A;  4EPC A;  4F7U B;  2A7Y A;  2XU8 A;  1Y07 A;  2COY A;  2R58 A;  5GAM e;  1MV3 A;  1PG5 B;  3QKJ A;  1NLO C;  1A0N B;  1IHV A;  4M77 D;  5GAN j;  2RJD A;  2YT6 A;  3EG9 A;  2RK2 A;  4M78 F;  3TQ7 P;  5KE3 A;  2CP2 A;  2EKO A;  2D0Q B;  5D6W A;  2O4X B;  4M75 F;  1W2B A;  2XD0 A;  1OI1 A;  1WFW A;  5CCA A;  2W10 A;  3M0U A;  3UT1 A;  4IUV A;  4PJO C;  1I8F A;  3SWN A;  4PK4 A;  4M7A C;  5IXF A;  4C0Z A;  4PJN A;  4FL6 A;  2RI2 A;  1ZBX A;  2DBK A;  4XTY A;  5FLX E;  1BCM A;  3CME Q;  4JS4 A;  3H8Z A;  3DB4 A;  4A4H A;  2NUP B;  1VQ6 A;  1ZUK A;  1JJ2 S;  1Y96 B;  5GMK e;  2X3X D;  4HCB A;  3J80 E;  1N9R A;  3A5Z B;  4BY6 C;  2EJF A;  3JB9 G;  1D0X A;  3C94 A;  4DBQ A;  3TU4 K;  2D9T A;  2JOY A;  1D1A A;  3V7S A;  3PTA A;  1UE9 A;  3CCQ A;  1Y7X A;  1TOV A;  3JB9 I;  1KQS A;  4EMG A;  4HCC A;  1AZG B;  2QGF B;  4DOW A;  2RI3 A;  2E12 A;  3LWI A;  5FRN A;  2FHD A;  3UA6 A;  4PL6 A;  2L3S A;  2PQW A;  2EYQ A;  2DKG A;  3L2Q A;  2JTE A;  4N0A A;  3EHR A;  1M3C A;  3CPW S;  4M7A E;  2V26 A;  1SG5 A;  3FJP A;  1UDL A;  3P8D A;  1WHK A;  3H9N A;  4ZGD B;  3SFM A;  4BE2 A;  3E1S A;  1GFC A;  3L2V A;  2VV5 A;  2EAY A;  2GCX A;  3LGF A;  3R6O A;  2RNA A;  1WQW A;  4V2S A;  1SKU B;  2LNH B;  4FYY B;  1YJ9 Q;  4QVC A;  4PJO E;  2JJ9 A;  2KQW A;  1X69 A;  4XTV A;  5I21 A;  1V76 A;  3I9Q A;  3QBY A;  1VQP A;  3URG A;  2XK0 A;  5GAN 8;  1Q82 R;  3QUI A;  2LT1 A;  5FU6 C;  1WHM A;  1VQ7 T;  3OYH A;  2F5K A;  4BI3 A;  3H0I A;  3CXC S;  1FYN A;  2PVO B;  1DJ7 B;  2H3E B;  4J9F A;  4DOV A;  3ZFJ A;  5LJ3 h;  3H0H A;  4PFZ A;  2Y4Y A;  3L42 A;  1VQM A;  1VQ5 T;  3QWX X;  4PJL A;  1HD3 A;  1VQ4 A;  3JCM b;  2D0N A;  2DD4 A;  2GGR A;  2YRV A;  1M1K C;  4Z88 A;  1VQM Q;  2LDM A;  1VQ9 T;  3HSB A;  2DVE A;  1WPY A;  2AIR B;  1R0C B;  4R0K A;  3MET A;  2QQR A;  4CRI A;  2YWW A;  3P8B B;  5KYY B;  1WXB A;  3RKY A;  3M55 A;  4M7D A;  1X43 A;  1D1C A;  4NL3 A;  1PSF A;  3CBO A;  1RAE B;  3PNW C;  4F7U F;  2KRN A;  1RI9 A;  3VV0 A;  2DK3 A;  3PT9 A;  2LJ0 A;  1KD1 R;  1IHW A;  5GAN e;  1VQP Q;  1K73 U;  3GBQ A;  3OYN A;  4E7H A;  1M1K U;  2VC8 A;  4LDW A;  1VQ7 A;  4N4H A;  3X25 B;  3H41 A;  1SPK A;  1YFN A;  4C92 B;  4M78 D;  2CH4 A;  2KVQ G;  2P0K A;  4E6R A;  4Y28 E;  5A2Q E;  4XTU A;  1BBZ A;  2A0F B;  1VOM A;  3CCV T;  2E6Z A;  1QVF A;  1AZE A;  3G1J A;  5I2S A;  1IB8 A;  2L3P A;  4JDS A;  4F7U E;  1YJN A;  2EQI A;  1LNX A;  1KC8 R;  4PNO A;  3OA6 A;  4RKU E;  5GJV B;  2IPO B;  2VAS A;  4OB0 B;  2OJ2 A;  3A8L B;  3OW2 S;  4LDX A;  4AFZ C;  3L2W A;  4FYV B;  2HMA A;  2ZPF B;  1KJW A;  3J7A F;  2KT1 A;  3CCV A;  2H8H A;  1M3A A;  4J9G A;  1U3O A;  4M77 A;  2E3H A;  1Q86 R;  3SB2 A;  1VYV A;  1K8A C;  4XK8 E;  3WXM B;  2LMJ A;  3NFC A;  4HA8 A;  2LT4 A;  4M7D E;  3HL8 A;  4XU2 A;  1KQS S;  2OTJ A;  3SHW A;  3NTI A;  2LX7 A;  2RQT A;  4KGZ B;  3MHX A;  1AT1 B;  3RES A;  2VKN A;  4FYW B;  2DRM A;  1YWP A;  4LN2 A;  1X6B A;  2C0O A;  4Y92 A;  2EQM A;  3EHQ A;  3O5Z A;  1CSK A;  2FRW A;  1FX7 A;  1QKX A;  3KBG A;  2L89 A;  2XI9 A;  2ZPI B;  5GAO p;  2GFU A;  3DLL A;  2BZX A;  3JCM V;  2BTT A;  4QVZ A;  4ESR A;  2K7A A;  5DY9 A;  2X4Y A;  2YUP A;  1RI0 A;  2ZGW A;  3VUZ A;  1TTH B;  2EJ9 A;  1VUB A;  1M1F A;  3PMI A;  4X1V A;  1VQK T;  4OMM A;  1TWB A;  2EFI A;  3TSW A;  1AWJ A;  1VQ9 Q;  3QO3 A;  2DVJ A;  3HP9 A;  4QQD A;  4ZTF A;  3QDR B;  3PFS A;  1I0C A;  2QAZ A;  2BKD N;  1YIT T;  1X27 A;  3CCU T;  3FRN A;  5DLO A;  2XG8 D;  4PFP A;  3JV3 A;  5HKC A;  4JJC A;  2V8I A;  3HPW A;  3OYY A;  2RA2 A;  2RQV A;  1PD1 A;  2A08 A;  2E5Q A;  3CCU Q;  3ER0 A;  2EGE A;  3NPF A;  4C92 G;  3CCM T;  4M77 C;  1Q82 C;  2LP5 A;  2LQW A;  4O6J A;  4X9D A;  1MNE A;  3OYA A;  1MND A;  1WXU A;  3QPH A;  1N8R R;  1LJO A;  3ZL7 C;  2HSP A;  4E2F B;  4C0D B;  4F04 B;  3CC2 T;  2DIQ A;  2LC4 A;  2MYS A;  2BIV A;  2KYM A;  3OYJ A;  5A0L A;  4XTW A;  3BW1 A;  3OYD A;  1ACM B;  4FIB A;  1R0B G;  4E7Z A;  3D7S B;  1VA7 A;  4PJM A;  2X3W D;  1Y71 A;  2D8H A;  2J6K A;  2EIF A;  1Q81 C;  1GXI E;  3M0S A;  2DIL A;  5DM7 R;  1PCX A;  3OSV A;  2DL3 A;  1K8A R;  3MEV A;  2GFA A;  3P8H A;  1N6A A;  5FU7 B;  3U23 A;  1PM3 A;  2RHU A;  3FIF A;  1QWE A;  4PJO A;  2LRQ A;  3OS1 A;  2ED1 A;  3G71 Q;  3M0P A;  2E70 A;  5CKH A;  3BFM A;  2DYB A;  1EZZ B;  2E41 A;  2KSS A;  4FW1 A;  4M7D D;  3EH1 A;  4P5N A;  3HFO A;  4RTW A;  4GLM A;  1BI0 A;  3SEM A;  4GY5 A;  4BDY A;  3V8J A;  3LGL A;  1OQK A;  2JZ2 A;  3NTH A;  3CME T;  1ZUY A;  4J9D A;  5C0M A;  4D6W A;  4B9X A;  2ZPH B;  4KRT A;  1O9S A;  3JCM Q;  1VQN A;  4RUG A;  4KUI A;  2DO3 A;  4FT4 A;  2MWP A;  1SSH A;  2OTJ Q;  3EGX A;  1SF9 A;  2EQK A;  1WA7 A;  4OMO A;  2FPD A;  3OYL A;  1WIE A;  3EFR A;  2FO0 A;  1EIF A;  4O5V A;  1Q95 G;  2DXB A;  4DQ2 A;  4MZP A;  1HXD A;  2RJE A;  2PZ1 A;  1QWF A;  1BU1 A;  4C92 A;  3GPL A;  1VQ5 Q;  4N4I A;  2FL7 A;  1V29 B;  2JTM A;  1W2B P;  1X2Q A;  2CT4 A;  1RAD B;  4B9W A;  4PJO B;  3RMS A;  2DTH A;  3OB9 A;  2EYW A;  3LYI A;  1H92 A;  1NYG A;  2DTI A;  4Z8A A;  5LJ3 j;  2LQ8 A;  4LUD A;  1Q7Y C;  1ABQ A;  3CC4 A;  3RR6 A;  1H64 1;  4MDW A;  5AYF A;  4IUQ A;  1I81 A;  1GFD A;  2GQV A;  2DX1 A;  3SD4 A;  3CMA T;  4PFO A;  2KI7 A;  4KUD K;  5FRM A;  2A3L A;  1VQ4 T;  1U8R A;  4F14 A;  4C0F A;  1ZLM A;  3JB9 H;  1LCK A;  1K0S A;  4KUL A;  2YLC A;  2LCC A;  4OMF B;  2DER A;  2HZY A;  4A4G A;  2CS7 A;  4AG1 C;  1QVG P;  4F17 A;  1MMG A;  5GAM h;  2HBP A;  2X4W A;  5FU6 B;  3L2R A;  5LJ5 g;  4M7A A;  4M77 E;  4DBR A;  3TEE A;  2K5L A;  4J7I A;  1LOJ A;  3FLG A;  3VS2 A;  4A63 B;  5A0G A;  5CKB A;  5IAY A;  3CCJ Q;  2EYZ A;  2BE7 D;  2DTO A;  2ED0 A;  3REB B;  2K3B A;  5GMK j;  1TS9 A;  1VYU A;  2O01 E;  3JCM J;  5L23 A;  1IZ6 A;  3C4S A;  1J3T A;  1WX6 A;  3V8K A;  2KXC A;  3I55 Q;  1W4S A;  4HVU A;  4MDX A;  2F2V A;  2MWO A;  2E4H A;  2CP5 A;  2VB6 A;  1M2V B;  2ESW A;  2M0O A;  3UPU A;  3HRS A;  4J9H A;  1S1N A;  3TSZ A;  1G3T A;  3I35 A;  2KRO A;  2FPF A;  3M56 A;  2EPD A;  2YRD A;  1WDX A;  2DEQ A;  2E3I A;  3GNG A;  4HVW A;  4CC2 A;  3GP8 A;  1VQO A;  1YHQ A;  3PE0 A;  2O9V A;  4RCC A;  1YJ9 T;  5CO7 A;  4A54 A;  1BI1 A;  3CMA A;  4AG2 C;  4FYX B;  2DZ9 A;  1Y96 A;  1AWO A;  2EWN A;  4L6V 5;  1JO8 A;  5GAN d;  1N9S A;  3FB9 A;  2X35 A;  3IQL A;  5I22 A;  4ZN3 A;  2L5Q A;  1OPK A;  3VUB A;  3V7C A;  1JXO A;  3PVL A;  1OZ3 A;  1QVF S;  1PKT A;  1MHN A;  1M90 R;  3JB9 D;  3PIO A;  3VS5 A;  2KBT A;  4XAX B;  1K9M R;  1UJY A;  2CZ7 B;  2GTO A;  4AMC A;  1OEB A;  4KH1 B;  4C0G A;  3AT1 B;  3EG2 A;  1F1B B;  2QXF A;  4M7D G;  5KH6 A;  1M2O A;  3MEA A;  3A1P A;  2QEX A;  4JRI A;  1AD5 A;  3BDU A;  1G8X A;  3ULR B;  5GMK m;  2EVR A;  1IXD A;  3EFO B;  4MZM A;  3JRZ A;  1NBE B;  1K73 C;  5GAN 3;  3OS2 A;  1SEM A;  1KD1 C;  2JUF A;  1X2K A;  1K9M U;  4J5Y A;  2DXU A;  3CCL Q;  5LJ3 e;  3VU3 C;  4XU0 A;  2WAC A;  9ATC B;  4DBF A;  5D7U A;  2K9G A;  1VQL A;  1FMK A;  1WI7 A;  4RCB A;  3OYK A;  3RIR A;  3FEO A;  2CP6 A;  1KFZ A;  4E7J A;  4EMK A;  2QTX A;  3QZ9 B;  2IG0 A;  4XU1 A;  2FYK A;  5KYX A;  4WF2 A;  5GAM j;  4M75 A;  3ZEH A;  1C6V X;  1TU0 B;  4BI8 B;  1I5L A;  1M4Z A;  2DA9 A;  3LH5 A;  1JJ2 A;  2ROT A;  3C12 A;  3M5A A;  4M78 A;  3G4S T;  4BE0 A;  1YI2 A;  2PTK A;  5GAN g;  1B7T A;  1OX8 A;  1NJI U;  5LL6 S;  4E7I A;  1VQO T;  1E7O A;  2HQX A;  1QCO A;  3NHN A;  4DEY A;  1VQN Q;  1M90 C;  2I2L A;  5LJ5 f;  2FG0 A;  1RLQ C;  1FXX A;  2YUN A;  1UGS B;  3RMQ A;  2NLU A;  5CKF A;  3F70 A;  1WJS A;  5A0D A;  4D8K A;  3AHU A;  2Y4X A;  2EKH A;  3OBY A;  5KE2 A;  4RTV A;  2CDT A;  1IRE B;  2D6F A;  2FRY A;  5GMK l;  1ZHI A;  4FM4 B;  5GMK i;  1MMA A;  4FSS A;  3OYC A;  2P0Q A;  4CI0 C;  4JPB W;  2OTL T;  5IHK A;  5ECA A;  2QGG A;  2RJF A;  4ELY C;  5DLQ E;  8ATC B;  4JRQ A;  4JUV A;  5GAN 7;  5EG2 A;  4ZN1 A;  1VIF A;  4M75 C;  2QQ9 A;  5IT9 E;  2ZAE A;  3FJ5 A;  3HRU A;  1VQ7 Q;  3A8H B;  2GTJ A;  2WSF E;  3RKW A;  4M75 B;  1JQQ A;  4EMK C;  1E6G A;  2A37 A;  2EQJ A;  5FW9 A;  3VKI A;  2CGH A;  2MMP A;  2RN8 A;  7AT1 B;  3M0Q A;  2ENM A;  2PVD B;  3OW2 A;  3I5S A;  1AWW A;  4MZT A;  4RTU A;  2COW A;  3VS7 A;  1KQ1 A;  1N5Z A;  2Y90 A;  1D0Y A;  3RUX A;  2EJG A;  3JCM e;  1G3S A;  1TUC A;  5EC7 A;  1WZO A;  1FMW A;  2RH2 A;  4C8Q G;  3CD6 Q;  3MCA B;  1JRI A;  2JN0 A;  3CC7 Q;  3L1A A;  2MPX C;  1NE8 A;  2H3J A;  2DE0 X;  4RTT A;  2HBW A;  2K2V A;  1Q86 C;  4JS5 A;  1N8R C;  1BKB A;  4OMQ A;  4OB3 B;  5GJW B;  4AFU C;  1RAH B;  2HNI A;  2KYB A;  2YHT A;  5CQY A;  3M9Q A;  3RKX A;  3M59 A;  3G6E T;  1X6O A;  3CEY A;  1I4K 1;  1YIT A;  1TSF A;  5GMK h;  4HCZ A;  2M51 A;  3R6N A;  1AHJ B;  1OX9 A;  4MMK A;  5HK3 A;  2HL3 A;  1YIJ A;  3G4S Q;  4DBH A;  5J3B A;  2ZPE B;  3C0C A;  3E9F A;  1KIK A;  2B86 A;  2P4T A;  4FSX A;  3PGG A;  1K4U S;  3QDF A;  2JM9 A;  4M4Z A;  2ZZD A;  3QYH B;  3CXC A;  5LJ5 j;  4IKF A;  2DEU A;  3V7R A;  1BI2 A;  4BAC A;  3CCS Q;  1YJW A;  3A8M B;  2RQW A;  5KCO A;  5I11 A;  2NUT B;  2DL8 A;  2LJ1 A;  1XQH A;  2V8K A;  4C92 E;  4QW2 A;  5KYX B;  2J7I A;  4JJN K;  1K76 A;  5D6X A;  3OSS C;  4NOY A;  1VQK A;  2L3Q A;  2C06 A;  2HL5 C;  1NYF A;  1P92 A;  4WCI A;  1UB4 A;  3QHS A;  4M7D C;  1HJD A;  2HDA A;  3SWN C;  1VQN T;  1C0M A;  4KH0 B;  1FWZ A;  1NLP C;  1IRX A;  2M0Y A;  4F7U G;  5LJ3 f;  2QEX Q;  2QA4 A;  1I07 A;  1N27 A;  3SWN B;  2P84 A;  2C0I A;  3WVE B;  2O88 A;  4RMO A;  1X01 A;  1V1C A;  3CC4 T;  3CC7 A;  1RAG B;  3EG1 A;  1YNZ A;  1JJ2 P;  2PNI A;  4J9B A;  4RTZ A;  3VS1 A;  5GAO n;  3QYG B;  1VQ8 A;  1QW1 A;  1WXT A;  1U5S A;  4OVA A;  3CBM A;  4ATO A;  3GNF B;  1T0H A;  4BD3 A;  4E47 A;  1KD1 U;  2X51 A;  2DNU A;  4R55 A;  2R5A A;  3I5R A;  3H6Z A;  2L2P A;  5GAN 4;  2K5I A;  1YIJ T;  4LDU A;  1S72 A;  2F2W A;  4IUP A;  4HCK A;  3KXT A;  4EMH A;  2KXD A;  2F5T X;  2K3Y A;  1PNJ A;  1D3B A;  1YIJ Q;  2JT4 A;  3HHT B;  3EFS A;  1WJR A;  3CC2 Q;  2VXF A;  3UF4 A;  1HK9 A;  1S72 Q;  4PLI A;  4ORZ A;  2HAX A;  2KNB B;  2RI5 A;  1LPL A;  1H8K A;  2J05 A;  3UWN A;  4L5G A;  4OMP A;  5GAN h;  3CCR Q;  4PLL A;  2F69 A;  2E10 A;  1WJQ A;  1Z9Q A;  1JXM A;  5FRO A;  1OV3 A;  1HSQ A;  1PC0 A;  3THK A;  4Z02 A;  2O2O A;  3QG1 A;  2JS0 A;  4J6Y A;  2MF2 A;  1I5O B;  4M7D B;  2KT8 A;  1ZSZ A;  3QJY A;  4ME7 A;  1KQS P;  3JCM P;  2P4R A;  3TVT A;  1MV0 B;  5KCH A;  1MGQ A;  4CC7 A;  2FVU A;  1W1F A;  2VXE A;  1YHQ Q;  2DM1 A;  3G71 T;  2K57 A;  5KYU B;  1UJ0 A;  4TVR A;  6AT1 B;  1QVG A;  2DFU A;  2QI2 A;  2HSE B;  2J06 A;  3JSC A;  1KG1 A;  2AK5 A;  2EYX A;  1WNL A;  1QKW A;  3QZ5 B;  4JJD A;  3X24 B;  5AT1 B;  3PIP A;  3G6E A;  4X9C A;  4IUU A;  1QCN A;  3M0R A;  1JBM A;  3H0F A;  3SDZ A;  1VQO Q;  4RTY A;  4BDZ A;  2RO0 A;  3CCS A;  4C5G A;  3CCE T;  2RF0 A;  3OYF A;  2RHY A;  4AFQ C;  4IUT A;  8AT1 B;  4JRK A;  3QJ6 A;  3S3O A;  2IVW A;  3EGU A;  3OBW A;  1CKA A;  3CCQ Q;  2DL5 A;  1BYM A;  4BY6 B;  1WHH A;  4E7K A;  2QQS A;  3E9G A;  2VYT A;  3HFN A;  3DB3 A;  2M02 A;  4J9I A;  4Z89 A;  1K73 R;  4HT8 A;  3G4S A;  1YI2 T;  1PKS A;  1QCF A;  4HVV A;  4FCY A;  1KSW A;  1WGS A;  5FWB A;  2F1L A;  2AT1 B;  1VQ6 T;  4CC3 A;  4J6W A;  4J7F A;  1XTD A;  5GAN f;  1VQ5 A;  5LJ3 d;  5LJ5 e;  4E7S A;  4J9E A;  4WTO B;  1CKB A;  5GAN 6;  1S72 T;  3RDV A;  2QYZ A;  1YJW Q;  4C92 F;  1YN8 A;  3E19 A;  5KYY A;  1JEG A;  3QII A;  1RAB B;  1BCO A;  2QAS A;  5IN1 A;  3MP8 A;  1KQ2 A;  4GLK A;  2BZY A;  1KHI A;  2E5K A;  2FPE A;  3GLX A;  5KYW B;  1RL2 A;  4M78 C;  3CD6 A;  1GCQ C;  1TUD A;  5CK9 A;  1UFF A;  2MI6 A;  5IH2 A;  2R57 A;  1ZA1 B;  4PKC C;  4KGX B;  1BK2 A;  1NJI C;  2LQN A;  1OU8 A;  4M78 B;  1OPL A;  3VYH B;  2AKK A;  4Y91 A;  5I2M A;  2D1X A;  2JS2 A;  4M7A B;  1OOT A;  4M78 E;  2O9S A;  4R56 A;  1NG2 A;  3OS0 A;  3VRZ A;  2RD1 A;  1ABO A;  1M30 A;  4NS5 A;  4J6X A;  4M75 E;  3I55 A;  2Z0W A;  4M7A G;  2CZ6 B;  3S3N A;  1BB9 A;  1SSF A;  2YLB A;  3CD6 T;  2VGM A;  2CP3 A;  2CZ0 B;  1GBQ A;  4A4K A;  1PWT A;  4FU6 A;  4YTL A;  5GAN 5;  4PJJ A;  2HCK A;  1VQ6 Q;  3MPU B;  3MJX A;  4IUR A;  3OS5 A;  2ROL A;  5GAN 2;  2NWM A;  3FC3 A;  1G3Y A;  2KRS A;  1K9M C;  2PVG B;  2JTF A;  2DXC A;  3OYB A;  5L8R E;  4LXC A;  4LD6 A;  1YJN Q;  2JVV A;  3CMA Q;  2XMF A;  3KUF A;  3JCM f;  2V1R A;  4QKU A;  4M77 B;  2VUB A;  5HY6 A;  1QVF P;  2HD0 A;  5IHI A;  1ZSZ C;  1B34 B;  2DD5 A;  4OGE A;  4JRP A;  5GAM f;  4C0D C;  1WHG A;  2QQA A;  3CCS T;  3V8L A;  3OYG A;  2SRC A;  2EW3 A;  2OAU A;  2CYZ B;  2EQU A;  4AT1 B;  1G3W A;  2J6O A;  4LNP A;  1TUG B;  1PRL C;  1H3Z A;  1Q81 U;  4M7A F;  1U1T A;  1R77 A;  2COZ A;  4M7D F;  1XNI A;  2NUP A;  4ZTJ A;  1RAI B;  1VQ4 Q;  1YJN T;  1GL5 A;  2YDL A;  1NEG A;  3M4G A;  2RMO A;  1YBY A;  2HKQ B;  4FT2 A;  1VYT A;  2RB6 A;  4F7U A;  3L2U A;  3CPF A;  1TG0 A;  2RM4 A;  2XIC A;  1YP5 A;  2XID A;  3RBB B;  3EH2 A;  4J8O A;  4BI4 A;  1U1S A;  4GBQ A;  5CIU A;  2R5M A;  1NM7 A;  4BB7 A;  4JLI A; 
#chains in the Genus database with same CATH homology
 5GAO l;  2ZPB B;  3OYJ A;  1M9S A;  4C8Q A;  4EDU A;  2O4X A;  5A0L A;  4XTW A;  3QXE B;  3BW1 A;  3OYD A;  2DXT A;  1QVG S;  3GIB A;  1YCY A;  2CKK A;  2V8J A;  1KQ1 A;  1VQM T;  4FIB A;  4OGC A;  2Y90 A;  3C95 A;  4DA4 A;  3RUX A;  2EJG A;  3JCM e;  1Y71 A;  1G3S A;  2RHZ A;  3JB9 F;  2RH2 A;  4C8Q G;  1BIA A;  1NPP A;  2EIF A;  2M9U A;  1Q81 C;  1GXI E;  3MCA B;  3CCE A;  5DM7 R;  2CZ1 B;  5GAO m;  1JRI A;  1QVP A;  2JN0 A;  2WSC E;  3OSV A;  4JLG A;  3L1A A;  1NE8 A;  2H3J A;  3MEV A;  1O75 A;  2GFA A;  2K2V A;  3LLR A;  1Q86 C;  4JS5 A;  1JB0 E;  1N6A A;  3P8H A;  4X34 A;  2AHJ B;  1BKB A;  5FU7 B;  1N8R C;  3FIF A;  2RHU A;  1UGQ B;  4OB3 B;  4PJO A;  1Q82 U;  1UEB A;  2HNI A;  2MAM A;  2LRQ A;  2YHT A;  3M9Q A;  5CQY A;  3M59 A;  3RKX A;  5M9O A;  5HK0 A;  3OS1 A;  3JCM W;  1X6O A;  2FB7 A;  3M58 A;  1VQP T;  4MML A;  4N0A C;  2OTJ T;  2ZPG B;  2E70 A;  5CKH A;  3BFM A;  3CEY A;  1I4K 1;  5CR2 A;  4C92 D;  1YIT A;  4OB1 B;  2LTO A;  2QQB A;  3S6W A;  3MO8 A;  5GMK h;  2E41 A;  1VIE A;  2KSS A;  4M7D D;  4P5N A;  4HCZ A;  5HK3 A;  3HFO A;  1AHJ B;  4XU3 A;  4MMK A;  3A8G B;  3CPW A;  1B34 A;  3RER A;  1YIJ A;  1BI0 A;  2PUK B;  3MEW A;  4GY5 A;  3V8J A;  4BDY A;  4Q5W A;  3LGL A;  3BDL A;  3FDR A;  5J3B A;  5CKE A;  2JZ2 A;  1Q86 U;  2RHX A;  3JB9 J;  2XHC A;  3M53 A;  1K8A U;  2ZPE B;  3OY9 A;  1QP3 A;  3NTH A;  1M8V A;  3E9F A;  3CME T;  4C8Q D;  2P4T A;  4FSX A;  3PGG A;  4XQ3 A;  5C0M A;  2E1H A;  4NL2 A;  3OMC A;  3MP1 A;  2ZZD A;  3QYH B;  3CXC A;  4EPC A;  4D6W A;  5LJ5 j;  2P0P A;  4B9X A;  2A7Y A;  2ZPH B;  4F7U B;  3V7R A;  3EAE A;  3MEU A;  2XU8 A;  1O9S A;  1Y07 A;  2R58 A;  1BI2 A;  4BAC A;  3JCM Q;  2LQK A;  1VQN A;  1YJW A;  3A8M B;  4E7L A;  5KCO A;  4HKE A;  3CME A;  4KUI A;  4C5I A;  5GAM e;  2DO3 A;  4FT4 A;  2RJC A;  3QKJ A;  2MWP A;  1XQH A;  2V8K A;  2KAF A;  4M77 D;  2EQK A;  5GAN j;  2M16 A;  2RJD A;  1BI3 A;  4C92 E;  3OYL A;  1G5V A;  3EFR A;  4L59 A;  1EIF A;  2RK2 A;  4O5V A;  4QW2 A;  4M78 F;  3JCM g;  2DXB A;  5KE3 A;  4JJN K;  2EKO A;  2D0Q B;  1M90 U;  5D6W A;  3INZ A;  4LDV A;  4DQ2 A;  2O4X B;  5D6X A;  3OSS C;  1HXD A;  2JNG A;  3ME9 A;  4M75 F;  2RJE A;  4MZP A;  4NOY A;  1W2B A;  1Q7Y U;  2C06 A;  1VQK A;  1OI1 A;  2XD0 A;  1P92 A;  1UB4 A;  3QHS A;  4M7D C;  3G71 A;  3SWN C;  3VYG A;  4LDY A;  1VQN T;  4ATO A;  1FWZ A;  1QP2 A;  5CCA A;  3DKM A;  4LD9 K;  4C92 C;  4C92 A;  3GPL A;  5J39 A;  4F7U G;  5LJ3 f;  3UT1 A;  4IUV A;  4PJO C;  1I8F A;  4N4I A;  3SWN A;  2FL7 A;  2QA4 A;  1V29 B;  1N27 A;  2JTM A;  3SWN B;  3WVE B;  3CCU A;  4M7A C;  4RMO A;  1X01 A;  2DAQ A;  3CC4 T;  3CC7 A;  4C0Z A;  2K3X A;  4B9W A;  4FL6 A;  3CCE T;  2DPP B;  2RI2 A;  2KK4 A;  3BY7 A;  3CCR T;  4PJO B;  1ZBX A;  4N4G A;  3RMS A;  1X75 C;  2X4J A;  5GAO q;  2DTH A;  5GAO n;  4XTY A;  3QYG B;  3OB9 A;  5FLX E;  4KT0 E;  1VQ8 A;  3LYI A;  1QW1 A;  2K5F A;  2DTI A;  5LJ3 j;  4ZGE B;  4JS4 A;  2LQ8 A;  1Q7Y C;  3CC4 A;  3H8Z A;  3DB4 A;  4A4H A;  1H64 1;  4OVA A;  1VQ6 A;  3CBM A;  3OYE A;  4MDW A;  1JJ2 S;  1Y96 B;  5GMK e;  3GNF B;  5AYF A;  4IUQ A;  1I81 A;  4II1 A;  4BD3 A;  4E47 A;  3OYI A;  1KD1 U;  2GQV A;  2GF7 A;  4HCB A;  3GF5 A;  3J80 E;  1N9R A;  3A5Z B;  4BY6 C;  4R55 A;  3SD4 A;  3CMA T;  2KDS A;  2R5A A;  2EJF A;  3X26 B;  3JB9 G;  3C94 A;  3M4Y A;  1VQ9 A;  4C8Q F;  3TU4 K;  3H6Z A;  4KUD K;  2D9T A;  4RG2 A;  3CC2 A;  2JOY A;  5FRM A;  4BUG A;  5GAN 4;  4QQ6 A;  5CVI A;  3V7S A;  2A3L A;  1VQ4 T;  3PTA A;  2K5I A;  1YIJ T;  3CCQ A;  1U8R A;  1Y7X A;  4C0F A;  4LDU A;  3G6E A;  3JB9 H;  3JB9 I;  1S72 A;  4IUP A;  1KQS A;  4KUL A;  4EMG A;  4HCC A;  2YLC A;  2LCC A;  4OMF B;  3KXT A;  3CCR A;  4DOW A;  5CKD A;  2RI3 A;  4EMH A;  2E12 A;  2F5T X;  4A4G A;  3LWI A;  2CS7 A;  2K3Y A;  5FRN A;  2FHD A;  1OZ2 A;  1D3B A;  3M57 A;  5GAM h;  2HBP A;  2X4W A;  3HHT B;  3EFS A;  4PL6 A;  5FU6 B;  5LJ5 g;  3L2R A;  3OYM A;  4M7A A;  1WJR A;  2PQW A;  1ZQ1 A;  2EYQ A;  2QDY B;  4M77 E;  2DKG A;  3L2Q A;  3TEE A;  4N0A A;  2K5L A;  3QSU A;  2VXF A;  2LX9 A;  3CPW S;  1HK9 A;  1LOJ A;  4J7I A;  4M7A E;  3FLG A;  3MP6 A;  4PLI A;  2HAX A;  3FJP A;  1OYX A;  4M75 D;  2RI5 A;  2ZCF B;  5CKB A;  5A0G A;  3P8D A;  3UWN A;  3WVD B;  4ZGD B;  5IAY A;  4L5G A;  5GAN h;  4PLL A;  2F69 A;  3SFM A;  2DTO A;  4BE2 A;  2E10 A;  3OMG A;  3E1S A;  1WJQ A;  3L2V A;  4M78 G;  2E64 A;  2EAY A;  2GCX A;  2KY9 A;  2VV5 A;  3LGF A;  5FRO A;  4OP0 A;  4Z02 A;  3R6O A;  3QG1 A;  1WQW A;  4V2S A;  4M75 G;  5GMK j;  2O01 E;  4QVC A;  4J6Y A;  3CCJ T;  3GOX A;  2MF2 A;  4PJO E;  3JCM J;  1IZ6 A;  3C4S A;  4M7D B;  2KQW A;  4XTV A;  3V8K A;  3PMT A;  3CC7 T;  5I21 A;  3QJY A;  4ME7 A;  3O8V A;  4C8Q B;  3QBY A;  4ZGJ B;  1W4S A;  3JCM P;  1D3B B;  2XK0 A;  3URG A;  5GAN 8;  1VQP A;  4MDX A;  5KCH A;  1MGQ A;  2PUO B;  2LT1 A;  3QUI A;  5FU6 C;  1VQ7 T;  2MWO A;  2FVU A;  2VXE A;  4UC4 A;  5CQX A;  5GAM d;  3OYH A;  3G71 T;  2F5K A;  4BI3 A;  3JAM E;  2K57 A;  2M0O A;  3UPU A;  3HRS A;  4TVR A;  3CXC S;  1QVG A;  1YHQ T;  2PVO B;  2HQE A;  2LVM A;  1DJ7 B;  1G3T A;  2QI2 A;  3HRT A;  1M5Q 1;  4DOV A;  3JSC A;  3ZFJ A;  1KG1 A;  5LJ3 h;  1WQ7 A;  3M56 A;  2XDB A;  3ZBD A;  4M7D E;  3JCM X;  3S3M A;  2DEQ A;  3GNG A;  4A53 A;  1WNL A;  3GP8 A;  2Y4Y A;  3L42 A;  1VQO A;  1YHQ A;  3L2Z A;  1VQM A;  2QEX T;  1VQ5 T;  1VQ4 A;  3QZ5 B;  4RCC A;  2XKO C;  3JCM b;  1YJ9 T;  3CBP A;  5CO7 A;  3TRE A;  4A54 A;  1BI1 A;  2DD4 A;  2DIG A;  2YRV A;  3CMA A;  3X24 B;  1M1K C;  2LDM A;  5J26 A;  1VQ9 T;  2DZ9 A;  3PIP A;  1Y96 A;  3HSB A;  5GAM g;  4M77 G;  2DVE A;  1WPY A;  4OF1 A;  4IUU A;  2EWN A;  4L6V 5;  4X9C A;  3I56 T;  2XDD A;  3MET A;  2QQR A;  4CRI A;  5GAN d;  1NZ9 A;  3P8B B;  1N9S A;  3RKY A;  3M55 A;  4M7D A;  3FB9 A;  4HT9 A;  2OTL A;  1JBM A;  3LWH A;  4NL3 A;  3UDC A;  2X35 A;  1PSF A;  3CBO A;  4VUB A;  3SDZ A;  4ZN3 A;  2L5Q A;  3PNW C;  2LCL A;  4RG8 A;  4BDZ A;  3M54 A;  2L8D A;  4XTX A;  2RO0 A;  3CCS A;  4C5E A;  4C5G A;  3VUB A;  3X20 B;  3V7C A;  4F7U F;  3G7Z A;  2DJZ A;  3OYF A;  4A4F A;  2RHY A;  2M1H A;  1TH7 A;  4IUT A;  4JRK A;  1OZ3 A;  3QJ6 A;  3VV0 A;  3OQ5 A;  2IVW A;  3OBW A;  3S3O A;  1QVF S;  2DK3 A;  2B8A A;  3PT9 A;  1MHN A;  5D6Y A;  4BY6 B;  4ELZ C;  1VQL T;  1BYM A;  2DZC A;  3JB9 D;  3PIO A;  5GAN e;  4E7K A;  2QQS A;  1K73 U;  3E9G A;  3OYN A;  2VYT A;  4E7H A;  1M1K U;  2VC8 A;  3HFN A;  3DB3 A;  4XAX B;  4XTZ A;  3A8O B;  3TCJ A;  3I56 A;  2CZ7 B;  4LDW A;  4HT8 A;  3G4S A;  1YI2 T;  1VQ7 A;  4N4H A;  3X25 B;  4BE1 A;  1WGS A;  4C0G A;  3LX7 A;  4C92 B;  2QXF A;  4QVD A;  1VQ6 T;  4M78 D;  4M7D G;  4J6W A;  4J7F A;  1XTD A;  5KH6 A;  2KVQ G;  2P0K A;  3MEA A;  5GAN f;  2QEX A;  1VQ5 A;  4Y28 E;  5LJ3 d;  4JRI A;  3HKS A;  5LJ5 e;  5A2Q E;  4XTU A;  1VQ8 T;  3BDU A;  3CCJ A;  3T9N A;  5GMK m;  5GAN 6;  1S72 T;  4C92 F;  3CCV T;  2E6Z A;  3E19 A;  4MZM A;  2WSE E;  3JRZ A;  1QVF A;  3QII A;  1K73 C;  5I2S A;  5GAN 3;  4JDS A;  5IN1 A;  3MP8 A;  1KC8 U;  3OS2 A;  4F7U E;  1N8R U;  4C5H A;  1KQ2 A;  1YJN A;  4GLK A;  1KD1 C;  1KHI A;  2JUF A;  3GLX A;  1LNX A;  1RL2 A;  1W2B S;  4J5Y A;  1K9M U;  2DXU A;  4M78 C;  4PNO A;  5LJ3 e;  3OA6 A;  3CD6 A;  5CK9 A;  3VU3 C;  4RKU E;  2MI6 A;  4XU0 A;  5GAO r;  3N5B B;  2R57 A;  2WAC A;  4MZT A;  3DLM A;  4OB0 B;  3A8L B;  3LW5 E;  4PKC C;  3OW2 S;  4LDX A;  3L2W A;  2VGN A;  1NJI C;  4M78 B;  1VQL A;  2E6N A;  4QQG A;  3VYH B;  3I55 T;  2ZPF B;  4Y91 A;  5I2M A;  4J83 A;  4RCB A;  3Q1J A;  4M7A B;  3OYK A;  3CCV A;  3J7A F;  3RIR A;  3FEO A;  4M78 E;  4E7J A;  4R56 A;  3OS0 A;  3CCL A;  2RD1 A;  4M77 A;  4EMK A;  4M7A D;  2QTX A;  3QZ9 B;  4NS5 A;  4J6X A;  2IG0 A;  4M75 E;  4XU1 A;  3SB2 A;  3G6E T;  2FYK A;  3JCM d;  1KC8 C;  3I55 A;  4PJO F;  1K8A C;  4M77 F;  4WF2 A;  4XK8 E;  1R8O B;  4M7A G;  2CZ6 B;  3WXM B;  4IKF A;  3NFC A;  3S3N A;  1YJW T;  4HA8 A;  2LT4 A;  1SSF A;  2YLB A;  5GAM j;  4M75 A;  3ZEH A;  3HL8 A;  4BI8 B;  1I5L A;  3CD6 T;  2VGM A;  1M4Z A;  4XU2 A;  1KQS S;  2CZ0 B;  1JJ2 A;  2OTJ A;  3C12 A;  3M5A A;  4M78 A;  4A4K A;  3G4S T;  5C6S A;  3NTI A;  4BE0 A;  1YI2 A;  5GAN g;  5FU7 C;  4FU6 A;  4YTL A;  2L3R A;  1NJI U;  5GAN 5;  3MHX A;  3RES A;  1UGP B;  5LL6 S;  4IUR A;  4E7I A;  1VQO T;  3CCL T;  2LNV A;  3OS5 A;  5GAN 2;  2EQM A;  2HQX A;  1G3Y A;  1UGR B;  3FC3 A;  1K9M C;  2PVG B;  3CCQ T;  1FX7 A;  2JTF A;  1M1G A;  2DXC A;  3KBG A;  3NTK A;  5L8R E;  3OYB A;  2L89 A;  2XI9 A;  2ZPI B;  1M90 C;  4LD6 A;  3JCM c;  2I2L A;  5LJ5 f;  5GAO p;  2JVV A;  5LJ5 d;  3JCM h;  1FXX A;  1UGS B;  3RMQ A;  2GFU A;  3DLL A;  2K4Y A;  2NLU A;  3KUF A;  3JCM V;  5LJ5 h;  2QA4 T;  4QVZ A;  3JCM f;  5CKF A;  3F70 A;  4C8Q C;  1WJS A;  3VJP A;  5A0D A;  1KHC A;  5DY9 A;  3AHU A;  4M77 B;  4EMK B;  2Y4X A;  2VUB A;  2X4Y A;  1RI0 A;  3ASK A;  5HY6 A;  2HD0 A;  2ZGW A;  2KMT A;  2RHI A;  3VUZ A;  2EJ9 A;  1VUB A;  1M1F A;  3PMI A;  1VQK T;  3OBY A;  1B34 B;  2XDP A;  5KE2 A;  5LJ3 g;  2DD5 A;  4OGE A;  1IRE B;  2EFI A;  5GAM f;  4C0D C;  4JRP A;  2D6F A;  2QQA A;  3CCS T;  3V8L A;  5GMK l;  4C8Q E;  3OYG A;  1ZHI A;  4FM4 B;  2BUD A;  3QO3 A;  5GMK i;  3OYC A;  3CCM A;  3X28 B;  2OAU A;  3HP9 A;  2CYZ B;  2P0Q A;  4QQD A;  4CI0 C;  2EQU A;  2OTL T;  4ZTF A;  1G3W A;  3QDR B;  3J81 E;  2E65 A;  2RJF A;  3PFS A;  4ELY C;  5DLQ E;  2BKD N;  1YIT T;  4JRQ A;  2PU9 B;  3CCU T;  1H3Z A;  2RK1 A;  3FRN A;  1Q81 U;  4M7A F;  1NPR A;  1U1T A;  4JUV A;  5DLO A;  5GAN 7;  2XG8 D;  5EG2 A;  4M7D F;  4KBM B;  1XNI A;  4ZTJ A;  5HKC A;  4ZN1 A;  1VIF A;  4M75 C;  1YJ9 A;  4PJO D;  2QQ9 A;  2V8I A;  3HPW A;  3OYY A;  2RA2 A;  5IT9 E;  3HRU A;  1YJN T;  3M4G A;  4OB2 B;  1YBY A;  3A8H B;  1XOV A;  4FT2 A;  2E5Q A;  2RB6 A;  3ER0 A;  4F7U A;  2X4X A;  2WSF E;  3RKW A;  3L2U A;  4C92 G;  3CCM T;  4M75 B;  3LH0 A;  4M77 C;  3CPF A;  4EMK C;  1Q82 C;  2EQJ A;  4O6J A;  4X9D A;  4PJO G;  2RM4 A;  3VKI A;  3OYA A;  2CGH A;  2MMP A;  2XIC A;  3QPH A;  2XID A;  1LJO A;  4J8O A;  4BI4 A;  1BIB A;  1U1S A;  2PVD B;  2R5M A;  5CIU A;  4C0D B;  3OW2 A;  3CC2 T;  2DIQ A;  4A4E A;  5CAI A;  1PSE A;  2G3R A;  2LC4 A;  4BB7 A;  4JLI A;  2BIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...