5CKHA

E. coli mazf e24a form iib
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
103
Chain Sequence
VSRYVPDMGDLIWVDFQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
total genus 25
structure length 103
sequence length 110
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ckhA00
3TCJA 4MZTA 5CKBA 1M1FA 5CKDA 5CK9A 5CCAA 5HK0A 1X75C 3JRZA 5HKCA 4ELYC 2VUBA 3VUBA 3G7ZA 4VUBA 2MF2A 2KMTA 4ELZC 3HPWA 5CKEA 4MZPA 2C06A 4OF1A 5CQXA 5CKFA 1NE8A 5DLOA 5CR2A 5CO7A 4MZMA 4ME7A 1UB4A 4HKEA 1VUBA 5CQYA 3JSCA 4MDXA 5HK3A 5CKHA 3NFCA
chains in the Genus database with same CATH superfamily
2GFAA 2EWNA 3MP8A 2O2OA 3H9NA 2ATCB 2WSCE 3NMZC 1TU0B 1B34B 2JT4A 1RI0A 3GNFB 1Q95G 5L8RE 2DTOA 3Q1JA 3FJ5A 1VA7A 3PIOA 5CO7A 5IAYA 1OU9A 5GMKh 4II1A 4LDYA 4DA4A 2BE7D 1IGUA 2RN8A 2KRNA 2X4JA 4J9HA 2P0PA 4F14A 2MIOA 2QI2A 4ESRA 1AWXA 3VUBA 2VXEA 5D6XA 2QG9B 2QAZA 3M5AA 4PLLA 2DMOA 3EG3A 2RQUA 2OTLT 4FSXA 1WX6A 1QVFA 1OU8A 3CD6T 1Y0MA 5FRNA 1NYFA 3SWNA 3T9NA 4LUDA 4EIKA 1JRIA 2DZ9A 2P4RA 4M7AB 2QGFB 1NBEB 2RJCA 2GQVA 1BBZA 1YWOA 4D8DA 2EW3A 4N0AA 3NGPA 3CCLA 2DXUA 2D6FA 4XU3A 2LTOA 3EGDA 3QBYA 3SFMA 4IUVA 5CVIA 4M75D 1JQQA 1M90U 2CP5A 3A8OB 4M7DE 2SRCA 1M30A 4XTUA 4J5YA 3CCUQ 1N8RC 2ABLA 1O9SA 5C6SA 1Q82U 4OGEA 3F70A 1HK9A 3RKXA 2E64A 2RPNA 3X24B 2E70A 1NLOC 2RF0A 3BFMA 3CC4A 4BE2A 1SF9A 2L0AA 1YJWT 1UJYA 5LJ5f 3CCET 1RAFB 1VQNT 3VU3C 1M5Q1 4QQGA 1VQOT 2XHCA 3JB9F 3GIBA 4LUEA 4C92D 1AZGB 1M1GA 1I8FA 2XK0A 1ZBJA 3EG0A 5GAN4 4L5GA 5FW9A 1Q81U 2RHYA 1G3SA 1RL2A 4RUGA 5GANd 1Z9ZA 4PJOA 5GMKj 1LVKA 5CKHA 4F16A 2DYBA 3M59A 3S3MA 3H8ZA 1VOMA 1WLPB 2DXCA 4BDYA 4AFUC 2HZYA 5HK0A 3CCRQ 1YJ9A 2ZPGB 2AKLA 4LD6A 2FPEA 2A3LA 1QVFS 2KVQG 4RTWA 1K8AC 2KT8A 5GAN8 4MDXA 4M7DD 1Y96A 1NJIU 4CC3A 4FW2A 4KGVB 1K4US 2VWFA 1OX8A 2YUOA 1VQ4Q 5CK9A 3CC2T 1K73U 2DD4A 4CC7A 3QYHB 4BY6B 1NYGA 2VB6A 1VIFA 2ESWA 1R77A 4JJDA 1ABQA 2KY9A 1WYXA 3MP6A 4CRIA 2NWMA 2A7YA 1YIJT 2V1RA 1M1KR 1QLYA 4F7UG 3I5SA 3FJPA 1ZX6A 3HSBA 1RACB 3QHSA 3JB9G 2LQNA 4UC4A 3PFSA 4OB1B 2DBMA 2OTLA 4V2SA 3CMAQ 3C0CA 3CXCA 2CUBA 3CD6A 4C5HA 1YFNA 2JW4A 2X4YA 3OYBA 2L89A 4PLIA 2O31A 5L23A 2K2VA 2KT1A 2F2WA 4X9DA 3RNJA 2JTMA 5IT9E 3MKDA 4C8QF 4M75B 2COWA 4M78E 2ENMA 3QDFA 3U23A 1GFCA 2VGNA 3WXMB 2XU8A 2O4XB 1Q86R 2CZ7B 4OB0B 4OMNA 3VS1A 1VQPQ 1E6HA 1WGSA 2MF2A 3CBMA 2EPDA 4Y92A 2KRSA 3JCMV 5D6WA 2ED0A 4J9DA 4MDWA 2E65A 3M0UA 2QXFA 4JZ3A 4J83A 4PJNA 2WSEE 2J6FA 1I5OB 2EBPA 4F17A 3VRYA 3PVLA 1VYTA 2HKQB 3M4GA 2X3WD 4C92B 2LT4A 3MJXA 4EDUA 1YITT 5D6YA 5KYUB 5GMKm 2DETA 1DJ7B 3OA6A 1YJWA 2DK3A 1YWPA 3CCEA 1H641 1VQNA 4XTXA 1VQOA 2KGTA 2MWOA 2G3RA 3OS5A 1UGRB 3V7SA 1W4SA 1JB0E 3VJPA 2IG0A 2M0YA 1RADB 4C0FA 1KC8R 3I56Q 1AWWA 4C8QG 1ZUYA 1UECA 1K9MR 2D8HA 3PE0A 1MNEA 4M78D 1T3LA 1PSFA 4M7DB 1QMCA 4J6XA 4XK8E 1VQ6T 3JCMf 1PRLC 1I4K1 1OPLA 1T0JA 3CCJQ 1GCPA 3CXCS 4RTVA 3CPWA 1QVFP 4JDSA 3FEOA 5I22A 1V76A 4RKUE 1M3BA 2RHUA 4KRTA 1BKBA 5EC7A 2KXDA 1K0XA 3L42A 1V1CA 2E4HA 3CC7Q 1EIFA 1K76A 1ZSZA 1S72T 1M2VB 3CC2A 2DRKA 1WHGA 2AK5A 2EYWA 4J9IA 3PMTA 3HFOA 1OZ2A 5GANh 3EFSA 1YIJA 3BDUA 1Q82C 2OJ2A 4JRPA 2EJ9A 5LJ5d 4L6V5 1SG5A 2FPDA 3HHTB 3L2ZA 4OMOA 5GMKl 1MMGA 3EAEA 4EMKB 2JOYA 1RLQC 2DL8A 2P0QA 4C5GA 2RQTA 3OYHA 3LX7A 4C0DC 5GMKi 3RESA 1S1NA 2L2PA 3DLLA 4ELZC 1VQLT 2YRDA 1IGQA 2CSQA 5GAMh 1VQ9T 2V8JA 4N4HA 4M4ZA 1Q81C 1M4ZA 2R57A 5KYWA 3SHWA 4E2FB 2AZVA 2R58A 2XIDA 3JCMQ 2W0ZA 4RTUA 3CCQT 3CCSQ 2FHDA 1F1BB 3EG9B 4IUPA 3CPFA 4JJCA 1VQMT 2CGHA 2LDMA 1N8RR 3E9GA 2LCCA 4F7UE 3UA7A 3ER0A 2CREA 1CSKA 1GRIA 2MK5A 2PUKB 3E9FA 2E1HA 1W6XA 1YITA 1NJIC 1B34A 4RCCA 3LWIA 4ELYC 2OI3A 4JLGA 2BZXA 1AOJA 2HSEB 3CPWS 2GCXA 3GOXA 2KAFA 3MPUB 1B3QA 4P5NA 4DQ2A 2QGGA 1VQKT 4C0ZA 1N9RA 3C95A 3OBYA 5GAOp 1KHIA 1YI2Q 3A98A 1EZZB 4Y28E 5CIUA 2BZ8A 2C0OA 4OMQA 4BB7A 3M0RA 2D1XA 5GANj 3E2UA 1WA7A 1R0CB 4PJJA 3L2UA 3ME9A 3I9QA 2CSIA 3MCAB 1YJNQ 1VQ6A 2HQEA 4M7AA 4IIOA 3EGUA 1WHMA 2YUPA 3CXCP 1TG0A 3CMEQ 2GBQA 3CBOA 3VRZA 4BY6C 3A8GB 5GANf 1WJSA 1E6GA 1K8AR 2QEXT 2DYIA 3X20B 1S72A 2EGAA 2CT3A 2RQRA 5HY6A 4RTYA 1PWTA 2F2VA 2GNCA 4Q5WA 1YBYA 2V8KA 4M78F 2YUNA 1W1FA 4EPCA 2LCSA 4A53A 3META 4IKFA 5IXBA 2DAQA 1RABB 1PD1A 4FL6A 3UA6A 3JB9D 3CCVQ 1OI1A 2EJFA 1VQ7T 3A8LB 4J9CA 1ZA1B 2CZ0B 2CYZB 3CCMT 5GMKe 1QQJA 5GAMf 4XTYA 4C8QE 5KYNA 1KD1U 4M75C 1Y57A 2PVDB 3CC4T 2A37A 2V1QA 1NZ9A 3PMIA 3EG1A 3ZEHA 1N5ZA 4GY5A 3BW1A 2COYA 3SDZA 1N9SA 1VQ9A 1D0XA 2RHZA 4J6YA 2CS7A 1NE8A 3SD4A 3JCMd 5J39A 1CKAA 3MEUA 3CCQA 1RAAB 2DL7A 2OTJA 3ZBDA 1VQMA 1XNIA 1ABOA 2HL5C 3L2VA 2XG8D 5GAOm 3OYGA 2QA4A 1QKWA 4NL2A 3INZA 3G4SA 4EMGA 1TH7A 2DBKA 1YHQA 4JS5A 3X25B 1YJ9T 3M58A 3OS1A 2NUTB 1G8XA 4IUTA 1P92A 4Y91A 3GPLA 3FLGA 2Y90A 2BE9B 1UDLA 2EAYA 3M54A 3CPWP 3E19A 1D3BB 3HFNA 3CCLQ 1VQKA 3OY9A 3MHXA 3V8KA 2I2LA 1PKSA 2K57A 3LLRA 1FXXA 5LJ3h 1SHGA 1KFZA 3ZFJA 4C8QD 1WIEA 4C5IA 3DKMA 4M7DC 2XI9A 1Y07A 1AVZC 3I5RA 3PVQA 2RH2A 4LN2A 3KXTA 3HL8A 3RDVA 4BI4A 2CDTA 5GAN5 2KNBB 2NUZA 2JTFA 2CZ1B 4R56A 3RMQA 2X35A 2O4XA 1QVGS 5LL6S 5GAN3 1FX7A 2PNIA 2EGCA 3REAB 2JM9A 2QEXA 2B86A 2I0NA 1W2BA 2YT6A 2BIVA 3OYDA 4C0DB 1SPKA 2HL3A 3JB9I 1WFWA 1MGQA 2PU9B 2A36A 2RJFA 4CC2A 3TU4K 3TEEA 2GQIA 4Z89A 1VQ8T 1U1SA 1M90R 5KYXB 5GAOl 1OYXA 2K2MA 5I2MA 3CCRT 3RERA 2K5FA 5FU7B 3OYAA 2KI7A 2YHTA 1AT1B 4QQ6A 1EFNA 3FIFA 4EMKC 1HD3A 1MV3A 1Q82R 1VQ7A 2L3RA 2EGEA 2QTVA 2C0IA 4C92A 5LJ5j 3CCMA 1X6GA 2HD0A 3FDRA 2JMAA 3UPUA 3M0QA 2RK1A 4J9GA 1U8RA 5DLQE 3OYIA 1VQ4T 1KQ1A 2HKNA 1C6VX 2F5TX 1E7OA 5IXFA 1SHFA 2MWPA 4MZMA 5GANg 1KQSA 4F7UF 1VUBA 2E10A 3A8HB 4AFZC 1X27A 2FZKB 5CKDA 1VQ5Q 3KFVA 4J7IA 1GFDA 1Q81R 2RO0A 3R6OA 2EYQA 4LDXA 4HVWA 2KEAA 5DLOA 1MMAA 2CKKA 5IH2A 2PZ1A 2VV5A 5J3BA 4FYYB 2DJQA 1KJWA 3CD6Q 3QYGB 4O5VA 1J3TA 4KUIA 4JRIA 4LDUA 2EKOA 1M2VA 1TTHB 2YRCA 1BU1A 2HAXA 5LJ3f 2EQJA 2EVRA 1NJIR 2MAMA 4HT9A 4KBMB 4DBRA 2K5LA 5KE3A 4C8QB 3JCMb 2DKGA 4M78C 2KBTA 3CCUA 2J06A 3HRUA 3JCMh 1QWEA 3I55T 1W2BS 3OYNA 5GAMd 1LNXA 4GLKA 1IHVA 2KROA 3OS0A 1WQWA 2FB7A 3JCMX 4PKCC 3JB9J 3JCMJ 4JLIA 2D9TA 3N5BB 2ROLA 1AD5A 4EMHA 2MI6A 1KD1C 2ZGWA 4JS4A 2K7AA 3URGA 1C1AA 1JBMA 2LJ0A 3CQTA 4K11A 2L3PA 4WTOB 5IHIA 5DM7R 3M9QA 3S3NA 2NUPA 1YJWQ 1KQ2A 2DIQA 4M77A 1VQNQ 1VQOQ 2K3YA 1QVGP 5I21A 2KYMA 1KQSS 2W10A 4CI0C 5GAN7 3VS4A 5GJVB 4M7AG 4QVZA 5A0GA 3EGXA 3QXEB 2F2XA 3QJ6A 4MZTA 1WPYA 4ANJA 1LOJA 2QQRA 3LWHA 1OV3A 1M8MA 1VQ8A 2BTTA 2IVWA 4QT7A 3CCRA 3PGGA 4BD3A 1JJ2A 4E7JA 2X4XA 4A4HA 2JVVA 4J8OA 2PVGB 3GF5A 1XOVA 1ZUUA 1LPLA 1Z9QA 2E6ZA 2DE0X 1UJ0A 2HNIA 3OYFA 3JB9H 3C12A 2KR3A 1Q7YU 4YTLA 1PHTA 3RR6A 4KH1B 3CEYA 4ZNXA 3SWNB 3ASKA 3OYJA 4J9FA 2OAUA 2K3BA 5GANe 2YLBA 3ZL7C 3S3OA 1VQ4A 4RMOA 1UEBA 2A28A 1X01A 2EYYA 4ZN1A 3RBBB 1PCXA 3O5ZA 5CQXA 2DRMA 3CC2Q 3G71T 1Y71A 4J9EA 2RQVA 2L3SA 3UATA 4QVDA 4A4FA 1FWZA 1R8OB 4X9CA 5A0LA 2XMFA 1QWFA 1UHFA 2M1HA 2RJEA 3EH1A 5GAN2 5C0MA 2J6KA 2EKHA 2P84A 2CP0A 3JAME 2JMCA 3C4SA 2RM4A 4FYWB 4J9BA 1YP5A 3RIRA 3EFRA 2DEQA 3OYLA 3V7RA 2LZ6B 4A4EA 3G1JA 3EHRA 1VQPA 2H3JA 4PFZA 1WI7A 5LJ5g 2HQHA 1WHJA 2LJ1A 2DNUA 3CCST 5CKFA 1G3YA 2OX7A 1KC8U 2HSPA 2J6OA 4N4IA 2ECZA 3UF4A 2GTJA 3NPFA 3VS7A 3JSCA 3I55A 1NEBA 1W2BP 4PNOA 4L59A 4PFOA 1M90C 2HEQA 2IPOB 4KT0E 4HVUA 1MHNA 3A8MB 1VYVA 4IUQA 3GNGA 1JJ2S 1CKBA 2M9UA 4MZPA 3REBB 1IZ6A 2LQKA 4MMKA 4RG2A 4R55A 4HA8A 5GAOn 1FYNA 1C0MA 3KUFA 4ZGEB 2LCLA 2YUQA 4A63B 2B8AA 1PC0A 4TVRA 4BE1A 2CP7A 2E5QA 1YITQ 5EG2A 2F1LA 2FRYA 1T0HA 5A2QE 2ZCFB 1M1FA 1Y96B 1JXMA 4HXJA 3VUZA 2RI3A 4B9XA 3G7ZA 5KE2A 3NTKA 2ZPFB 3RKYA 1KQSP 3RKWA 1G3TA 3PNWC 3ULRB 2LQ8A 2R5AA 3FRNA 3I56A 5FU7C 2KDSA 3UWNA 1XQHA 2IIMA 4PJOF 2DM1A 1QCNA 4HCZA 3NFCA 4E7ZA 2MMPA 3A5ZB 4IURA 4XQ3A 2DJZA 3V8LA 4PL6A 1M3AA 3OYMA 2LVMA 5LJ3d 6AT1B 3A1PA 2LQWA 2OTJT 1X2KA 8ATCB 1K1ZA 5KYYA 3C94A 4FM4B 4N4GA 2GGRA 2JXBA 2NUTA 2Y4YA 4DOVA 4B9WA 2EYXA 1WXUA 1GXIE 2P0KA 2QA4T 3L1AA 3G4ST 1WJQA 2FZGB 3L2RA 3O8VA 4E47A 1YHQT 1TWBA 5IHKA 1PG5B 3FB9A 3LH5A 3P8BB 4C92G 2CUDA 3JRZA 5FROA 2VC8A 3OS2A 1OX9A 1GCQC 1SSFA 3NTHA 1K73C 3G71A 2C06A 1NG2A 5IN1A 2CZ6B 1FMVA 1G2BA 1IRXA 2DVJA 5GAOq 4ME7A 4M7AE 2CH4A 2LJ3A 4M78B 1RAGB 2Z0WA 4DBHA 3LGLA 4M77F 3M53A 1AHJB 3QZ9B 3LGFA 3HRTA 1ZBXA 5IHNA 2LMJA 2ZAEA 4PJOG 3J7AF 4FU6A 2PTKA 3LW5E 4NOYA 4C8QC 5LJ5e 3DLMA 1VQLQ 3OB9A 3OSVA 4PJLA 2L8DA 4ATOA 1PSEA 1WHLA 1VQ9Q 2ZZDA 2QDYB 3G6EQ 2AZSA 3CCSA 4WCIA 1UUEA 4LNPA 2NYSA 3EG2A 1G3WA 3OMCA 3CCQQ 4DBFA 2HBPA 2JJ9A 2CP6A 2HQXA 1UB4A 1D0YA 2F69A 5GAMj 4FYVB 5J26A 1VQMQ 1QP2A 1Q7YC 2RA2A 4ZN3A 2QK0A 1ARKA 4HT8A 1JJ2P 2DL4A 3M0PA 4BACA 2NLUA 2AKKA 3QJYA 1PM3A 2YDLA 4JUVA 2BUDA 2JTEA 1YN8A 3PT9A 1K9AA 1KD1R 3JCMg 4A4KA 2D0QB 2HDAA 1NEGA 2FRWA 3EFOB 1B7TA 1I1JA 1ZSZB 2KYBA 4M7AD 2LRQA 1QVGA 1JU5C 2DL3A 2QTXA 1TXQA 2RK2A 3S6WA 4AG1C 1KSWA 4ORZA 4VUBA 3WVEB 1VIEA 3OYEA 4C0GA 4M77G 4XTVA 1OQKA 2BZYA 2LC4A 1HSQA 2DA9A 4LDVA 1IO6A 5ECAA 1QKXA 5KCHA 2LX7A 2EQKA 3TVTA 2J05A 1GBRA 3SWNC 2ZPIB 5A0DA 3QUIA 2VXFA 2ZPHB 1FMKA 1X43A 3R6NA 4ZTFA 4AFQC 1UGVA 4N0AC 1W70A 4ZGDB 1KK7A 4IUUA 4ZTJA 1QW1A 2PQWA 2WACA 1EX4A 2L3QA 2CH4W 2QEXQ 5KYWB 3TCJA 2FEIA 1PNJA 1QP3A 4BI3A 5FU6B 3QIIA 1ZHIA 3BDLA 2WSFE 3CCUT 1ZLMA 3HKSA 1U06A 4E6RA 2E41A 2MCNA 5GAN6 2JS0A 1OULA 1SKUB 2VASA 1VQ7Q 2H3EB 3OQ5A 2V8IA 2MPXC 4XAXB 5CCAA 3EH2A 3CCMQ 2K9GA 2RD1A 4CC4B 1D09B 3JCMW 1UG1A 3OSSC 3LH0A 2K3XA 3VS5A 2AIRB 4PK4A 2K6DA 2QYZA 2O01E 3CC4Q 2DF6A 2EYZA 1VQ5T 8AT1B 2FVUA 4NS5A 4M75A 1H3ZA 3MEAA 2MYSA 4PJOC 3H0FA 4F7UB 2XDPA 4HCBA 2K79A 1PRMC 2J7IA 4C92E 4HCCA 1X2QA 2COZA 3DB3A 2XDDA 4AMCA 1VYUA 1OEBA 3QO3A 1RI9A 2VYTA 2GTOA 1BCOA 2FYKA 2DTHA 4JRQA 1MMDA 3VKIA 3HRSA 2Y4XA 1M8VA 1N6AA 4KULA 3JCMe 4FW1A 1Y7XA 1YJ9Q 2JNGA 1TS9A 2KE9A 3TSZA 5KYUA 4DBQA 2E3IA 4E7SA 2K4YA 1UGPB 2DL5A 1BI3A 1YNZA 1GBQA 1OOTA 5CQYA 4PJOE 4FIBA 1MV0B 4PFPA 1KG1A 2R5MA 3GLXA 4RTZA 1M9SA 4Z8AA 1UTIA 1UGQB 2DEUA 2LT1A 4M77C 1IB8A 1RAEB 2YLCA 3CMAT 5LJ3j 1ZQ1A 4M7DA 3H41A 4XU1A 4M7AF 2DXTA 2OTLQ 5CKBA 2FPFA 1A0NB 5HCKA 5GAMg 1N27A 1I07A 5FWBA 4BDZA 2X51A 1IHWA 4D6WA 3OW2A 1HYOA 1IXDA 4RCBA 1V29B 4KH0B 1VQPT 1BYMA 1T3SA 3QWYA 3M0TA 2E6NA 5HK3A 3JCMP 1TUGB 2MOXA 1K73R 2KSSA 3JV3A 3MEVA 1JXOA 1VQ8Q 4J6WA 2DX1A 2GFUA 3VS2A 3WVDB 2ED1A 2O88A 4E7LA 3VS3A 2DILA 4M77E 4E7IA 1MMNA 1AWJA 5I2SA 1WDXA 4A54A 1RUWA 4EMKA 4OMMA 1QVPA 2C0TA 4PJOD 2O9VA 1QCOA 2EIFA 3QZ5B 1UHCA 5CAIA 4XU2A 1D1BA 4QQDA 2QDLA 1X75C 3P8DA 1VQ5A 1U5SA 2KK4A 2X3XD 2GF7A 1SRLA 3CCEQ 2JZ2A 3D7SB 2JM8A 2K5IA 1M1KU 4DEYA 3NTIA 3I56T 3EG9A 1H3HA 2O9SA 1OPKA 3M0SA 2QQ9A 3QDRB 1MUZA 1XJWB 1AWOA 2EFIA 1Q7YR 1WXTA 3J80E 3TQ7P 2ROTA 3CCJT 2DERA 2VVKA 3OYKA 1ZSZC 5AT1B 2D8JA 1O75A 3OYYA 5FLXE 3CC7T 1SSHA 4QVCA 2CP2A 1Q86U 1K0SA 2KMTA 3X28B 2V26A 4LD9K 3OW2S 4M77D 1D1AA 1I0CA 1R0BG 3I55Q 2AHJB 1BB9A 1NPRA 7AT1B 3EGDB 4M78A 1XTDA 2EQIA 1PD0A 9ATCB 1YIJQ 2E5KA 4RTXA 2L5QA 1I81A 3M57A 3CMAA 5FWCA 2SEMA 5DY9A 5GAMe 2DXBA 2DO3A 3THKA 4M75F 4FT4A 1G83A 2E3HA 3M56A 2LNHB 3QSUA 5FU6C 2VKNA 3M55A 5GJWB 4NL3A 2KQWA 2FO0A 2QQAA 4DEXA 1BK2A 3IQLA 3EHQA 4MMLA 4F04B 1BIBA 1WNLA 2LX9A 2PVOB 4J7FA 1BI2A 1TSFA 1WXBA 4JZ4A 2RJDA 1X69A 2BKDN 1RAHB 3OYCA 4WF2A 1I5LA 3GBQA 4OB2B 1K9MU 1ZUKA 4KGZB 4PJOB 2YSQA 1YCSB 2OAWA 3MP1A 4C92F 4HVVA 2A08A 2DD5A 3HPWA 1LJOA 4FYXB 3QPHA 5KH6A 3EFOA 4JPBW 2M51A 3V8JA 1TUCA 3M4YA 2FL7A 1QCFA 3SB2A 3P8HA 4JRKA 5LJ3g 2M16A 4AT1B 1HXDA 3G71Q 1YCYA 2M0OA 1YI2T 4OP0A 3NHNA 2DZCA 5FRMA 3JCMc 4BI8B 4M75G 2AT1B 4XTZA 4GLMA 3OBWA 4M7DF 1U1TA 2EQMA 1D0ZA 4X1VA 2X4WA 4M7AC 4KUDK 3UT1A 4LDWA 3PTAA 5GAOr 3L2QA 5M9OA 5HKCA 1BCMA 1YJNT 3VYGA 4E7HA 2RHXA 1ZA2B 4Z88A 5CKEA 2QQSA 3CCJA 2JN0A 4OMFB 2NUPB 3CMET 5CR2A 2LNVA 4M77B 3FC3A 1VQ6Q 3MEWA 4A4GA 3G6ET 1WJRA 4FCYA 2KRMA 5I11A 3CC7A 2FZCB 3EGXB 1D3BA 1WQ7A 3VS0A 2X9HA 3OW2P 1S72Q 2ZPBB 3VS6A 3BY7A 4FSSA 2DIGA 1KHCA 1NPPA 1BI0A 3CCVT 4OMLA 2KXCA 3HP9A 1N8RU 3H0HA 4ZGJB 1H8KA 4IIMA 4DOWA 1SRMA 4O6JA 3H6ZA 1WZOA 1ACMB 4JJBA 2RNAA 2VUBA 2EQUA 2RQWA 4AFSC 1D1CA 3L2WA 4OMPA 3E1SA 1NLPC 1X6OA 4AG2C 3X26B 4F7UA 3BE3A 4FT2A 4M7DG 1ZSGA 1RAIB 3HTRA 3AHUA 4HCKA 2H8HA 2DFUA 1M1KC 2YRVA 4LE9A 3H0IA 2XKOC 2QASA 5D7UA 1TOVA 5KYXA 4XU0A 3GP8A 3CBPA 1MNDA 4OB3B 2OTJQ 1RLPC 3MO8A 1M27C 1G5VA 1AZEA 1JEGA 2CT4A 1LCKA 2QA4Q 3G4SQ 2M02A 1YHQQ 4QW2A 3KBGA 1PKTA 2DTIA 4D8KA 5LJ3e 1Q86C 4Z02A 1K8AU 4OVAA 1UGSB 2RMOA 2LP5A 4RTTA 3CCLT 3VYHB 2HCKA 1WHHA 2F5KA 2D0NA 1U3OA 2QQBA 3AT1B 1YI2A 2HBWA 1M3CA 3DB4A 3QKJA 3RUXA 4C5EA 4E7KA 1VQKQ 1GCQA 3V7CA 2EJGA 4PJMA 3PIPA 4BUGA 3I35A 2VGMA 2G6FX 4B6MA 4R0KA 3J81E 4BE0A 2HMAA 4OGCA 2XICA 1M2OA 4JJNK 2JUFA 4HKEA 5AYFA 1TUDA 1YJNA 4GBQA 3OMGA 4LXCA 1VQLA 2RI5A 2E12A 2YWWA 1HJDA 3CMEA 3QG1A 4QKUA 1NM7A 3G6EA 2DLPA 1AEYA 3TSWA 2YXYA 4RG8A 1WHKA 2DPPB 2RHIA 3SEMA 3LYIA 4C8QA 3QWXX 1FMWA 1X6BA 2A0FB 2RI2A 1KC8C 5LJ5h 1IREB 1SEMA 1UE9A 2DVEA 3VV0A 1OZ3A 1KIKA 1JO8A 1K9MC 2PUOB 4C92C 1H92A 3TREA 2CP3A 1UFFA 1GL5A 3CCVA 1BIAA 5KYYB 1BI1A 4OF1A 3UDCA 2XD0A 2JS2A 1B07A 5KCOA 2FG0A 4M75E 2XDBA 4X34A 2ZPEB 4XTWA 4M78G 2RB6A 3RMSA 2P4TA 4KGXB
chains in the Genus database with same CATH topology
2GFAA 3C4SA 4Y28E 2RM4A 2KSSA 2EWNA 3MP8A 3MEVA 3RIRA 2WSCE 3EFRA 5CIUA 4J6WA 2GFUA 2DEQA 3OYLA 3V7RA 4A4EA 3WVDB 4BB7A 4E7LA 5GANj 1VQPA 1B34B 1RI0A 2H3JA 3L2UA 3GNFB 3ME9A 5LJ5g 5L8RE 2DTOA 4M77E 4E7IA 3Q1JA 5I2SA 3CCST 5CKFA 1G3YA 4A54A 3PIOA 1KC8U 5CO7A 4N4IA 5IAYA 5GMKh 4EMKA 3MCAB 4II1A 4LDYA 4DA4A 1QVPA 1VQ6A 3JSCA 3I55A 4PJOD 2HQEA 4M7AA 2EIFA 3QZ5B 2X4JA 4PNOA 2P0PA 4L59A 5CAIA 4XU2A 1M90C 4QQDA 1X75C 3P8DA 3CBOA 4KT0E 1VQ5A 1MHNA 2QI2A 3A8MB 3A8GB 4BY6C 5GANf 1WJSA 3VUBA 4IUQA 2KK4A 2VXEA 2GF7A 3GNGA 5D6XA 3M5AA 4PLLA 2QEXT 1JJ2S 2M9UA 4MZPA 2OTLT 3X20B 1S72A 1IZ6A 2LQKA 4FSXA 4MMKA 4RG2A 4R55A 4HA8A 5GAOn 3KUFA 5HY6A 2JZ2A 1QVFA 4ZGEB 2LCLA 3CD6T 2B8AA 4Q5WA 5FRNA 2K5IA 4TVRA 1YBYA 4BE1A 3SWNA 1M1KU 2E5QA 2V8KA 4M78F 5EG2A 3T9NA 3NTIA 1JRIA 4EPCA 5A2QE 2DZ9A 2ZCFB 1M1FA 1Y96B 4A53A 3I56T 3META 4IKFA 4M7AB 2DAQA 4FL6A 3VUZA 2RI3A 3JB9D 1OI1A 2RJCA 2EJFA 2GQVA 2QQ9A 3G7ZA 3QDRB 4B9XA 3A8LB 3NTKA 4N0AA 5KE2A 1VQ7T 2EFIA 2ZPFB 3RKYA 3CCLA 2CZ0B 2CYZB 3CCMT 2DXUA 2D6FA 4XU3A 1G3TA 3RKWA 3PNWC 2LTOA 5GMKe 2LQ8A 2R5AA 3QBYA 3FRNA 3SFMA 3J80E 5FU7C 5GAMf 3I56A 2KDSA 3UWNA 4IUVA 5CVIA 4M75D 4XTYA 4C8QE 3CCJT 1KD1U 1XQHA 4M75C 4PJOF 3OYKA 3A8OB 1M90U 4M7DE 4HCZA 3NFCA 2PVDB 3CC4T 2MMPA 3A5ZB 4XTUA 4IURA 4J5YA 2DJZA 1O75A 1NZ9A 4XQ3A 3OYYA 3V8LA 1N8RC 4PL6A 3PMIA 3OYMA 1O9SA 5C6SA 3ZEHA 2LVMA 5FLXE 3JCMP 5LJ3d 3CC7T 1Q82U 4GY5A 4OGEA 3F70A 2OTJT 1HK9A 3BW1A 3RKXA 4QVCA 1Q86U 2E64A 3C94A 3X24B 4FM4B 3SDZA 1N9SA 2KMTA 3X28B 1VQ9A 4N4GA 4LD9K 2E70A 2Y4YA 4DOVA 3OW2S 4B9WA 2RHZA 3BFMA 4M77D 4J6YA 2CS7A 3CC4A 1GXIE 1NE8A 2P0KA 3SD4A 3JCMd 5J39A 2QA4T 4MDXA 3L1AA 2AHJB 4BE2A 3G4ST 1WJQA 3MEUA 1NPRA 3CCQA 3L2RA 3O8VA 4E47A 1YHQT 2OTJA 4M78A 1YJWT 3FB9A 5LJ5f 3CCET 1XTDA 3P8BB 1VQNT 4C92G 3VU3C 3ZBDA 1M5Q1 4QQGA 1VQOT 2XHCA 1VQMA 1XNIA 3JRZA 3JB9F 5FROA 3GIBA 3L2VA 4C92D 2VC8A 2XG8D 3OS2A 5GAOm 3OYGA 1M1GA 1I8FA 2L5QA 2XK0A 1I81A 2QA4A 1SSFA 4NL2A 3INZA 3NTHA 3G4SA 1K73C 5GAN4 3M57A 4L5GA 3G71A 3CMAA 4EMGA 1TH7A 2C06A 5IN1A 1YHQA 4JS5A 1Q81U 5DY9A 5GAMe 2CZ6B 3X25B 1YJ9T 2DXBA 2RHYA 3M58A 3OS1A 2DO3A 4M75F 5GAOq 4FT4A 1G3SA 4ME7A 1RL2A 5GANd 4IUTA 1P92A 4Y91A 3GPLA 3FLGA 4PJOA 5GMKj 2Y90A 5CKHA 3M56A 4M7AE 3M59A 3S3MA 3H8ZA 2EAYA 2DXCA 3M54A 3QSUA 3E19A 5FU6C 3M55A 4M78B 4BDYA 5HK0A 4NL3A 1D3BB 1YJ9A 2KQWA 2ZPGB 3HFNA 2QQAA 1VQKA 3OY9A 3MHXA 4MMLA 4LD6A 3V8KA 2I2LA 1BIBA 3LGLA 1WNLA 2A3LA 2K57A 4M77F 2LX9A 2PVOB 3LLRA 1FXXA 4J7FA 1BI2A 1QVFS 3M53A 1AHJB 3QZ9B 5LJ3h 3LGFA 3HRTA 2RJDA 2KVQG 2BKDN 4M7DD 1ZBXA 4PJOG 3ZFJA 1K8AC 4C8QD 3J7AF 4C5IA 4FU6A 3LW5E 4NOYA 4C8QC 5LJ5e 1Y96A 5GAN8 3OYCA 3DLMA 4WF2A 3DKMA 1NJIU 1I5LA 4M7DC 2XI9A 4OB2B 1K9MU 1Y07A 4PJOB 3OB9A 3OSVA 2L8DA 5CK9A 3MP1A 3CC2T 1K73U 1PSEA 4C92F 2RH2A 2DD4A 4ATOA 3QYHB 3KXTA 3HL8A 2ZZDA 2QDYB 4BY6B 3CCSA 2DD5A 4BI4A 1VIFA 3HPWA 1LJOA 3QPHA 1G3WA 5KH6A 2KY9A 3MP6A 5GAN5 4CRIA 3OMCA 2A7YA 1YIJT 4F7UG 2HBPA 2JTFA 2CZ1B 4R56A 3V8JA 2HQXA 1UB4A 2FL7A 3M4YA 3RMQA 2F69A 3FJPA 5GAMj 2X35A 2O4XA 5J26A 3HSBA 3SB2A 1QP2A 1QVGS 5LL6S 3P8HA 5GAN3 1FX7A 1Q7YC 2RA2A 4JRKA 4ZN3A 3QHSA 2QEXA 3JB9G 4UC4A 2M16A 3PFSA 4OB1B 5LJ3g 2OTLA 4HT8A 1HXDA 4BACA 1W2BA 2BIVA 4V2SA 3OYDA 1YCYA 2NLUA 4C0DB 3CXCA 2M0OA 3QJYA 3CD6A 3JB9I 4C5HA 3OYBA 1YI2T 1MGQA 2PU9B 2L89A 2X4YA 2RJFA 4OP0A 4JUVA 4PLIA 2BUDA 2DZCA 3TU4K 5FRMA 3TEEA 3JCMc 2K2VA 3PT9A 4X9DA 1VQ8T 4BI8B 1U1SA 4M75G 3JCMg 4A4KA 2JTMA 4XTZA 1OYXA 5I2MA 5GAOl 3CCRT 5IT9E 4C8QF 2D0QB 2K5FA 5FU7B 3OYAA 3OBWA 3RERA 2YHTA 4M7DF 1U1TA 4QQ6A 3JB9H 3FIFA 2EQMA 4M75B 4EMKC 4M78E 4M7AD 2LRQA 2VGNA 2X4WA 1QVGA 1VQ7A 4KUDK 3UT1A 3WXMB 4M7AC 2QTXA 2L3RA 2XU8A 4LDWA 2O4XB 5GAOp 3PTAA 5LJ5j 4C92A 2RK2A 3S6WA 5GAOr 3L2QA 5M9OA 5HKCA 2HD0A 3CCMA 2CZ7B 3FDRA 4OB0B 1YJNT 3VYGA 3UPUA 4E7HA 2RK1A 2RHXA 4VUBA 1U8RA 5DLQE 3WVEB 1VIEA 1WGSA 2MF2A 3CBMA 3OYEA 5CKEA 4C0GA 4M77G 2QQSA 3CCJA 3OYIA 4XTVA 1VQ4T 2JN0A 1KQ1A 4OMFB 3CMET 3JCMV 2LC4A 5D6WA 4LDVA 2F5TX 5CR2A 2LNVA 4M77B 2MWPA 2E65A 4MDWA 3MEWA 4MZMA 4A4GA 1WJRA 5GANg 4F7UF 5KCHA 3FC3A 3G6ET 1KQSA 1VUBA 2E10A 2EQKA 3A8HB 3CC7A 2QXFA 4J83A 3SWNC 2WSEE 2ZPIB 1D3BA 5CKDA 5A0DA 1WQ7A 3QUIA 2VXFA 2ZPHB 4J7IA 4ZTFA 3M4GA 4C92B 2LT4A 2ZPBB 4EDUA 1YITT 4N0AC 5D6YA 5GMKm 4ZGDB 3BY7A 4IUUA 4ZTJA 2RO0A 1QW1A 1DJ7B 2EYQA 3R6OA 2DIGA 1KHCA 3OA6A 1YJWA 4LDXA 5DLOA 2DK3A 2PQWA 2WACA 1NPPA 3CCEA 1H641 1VQNA 1BI0A 4XTXA 3CCVT 1VQOA 3HP9A 1N8RU 2CKKA 4ZGJB 2MWOA 2VV5A 3TCJA 4DOWA 2G3RA 4O6JA 3H6ZA 1QP3A 3OS5A 1UGRB 3V7SA 5J3BA 4BI3A 1W4SA 5FU6B 3QYGB 4O5VA 2VUBA 2EQUA 3QIIA 1ZHIA 3BDLA 1JB0E 4KUIA 3VJPA 2IG0A 4JRIA 2WSFE 4LDUA 2EKOA 3L2WA 3CCUT 3HKSA 4C0FA 3E1SA 2E41A 1X6OA 2HAXA 5LJ3f 2EQJA 5GAN6 4C8QG 3X26B 2MAMA 4HT9A 4KBMB 4F7UA 4M7DG 4FT2A 3OQ5A 2K5LA 2V8IA 5KE3A 4XAXB 4C8QB 4M78D 5CCAA 3AHUA 3JCMb 2DKGA 4M78C 1PSFA 4M7DB 1M1KC 2RD1A 2YRVA 4J6XA 4XK8E 3JCMW 1VQ6T 3JCMf 3CCUA 3HRUA 3JCMh 1I4K1 3I55T 2XKOC 1W2BS 3OYNA 5GAMd 3OSSC 3LH0A 1LNXA 2K3XA 3CXCS 3CPWA 4GLKA 4JDSA 3OS0A 3FEOA 1WQWA 4RKUE 2O01E 2RHUA 2FB7A 1VQ5T 1BKBA 4XU0A 3CBPA 3GP8A 3L42A 3JCMX 4PKCC 3JB9J 3JCMJ 2FVUA 4JLIA 1EIFA 4NS5A 4M75A 4OB3B 2D9TA 3N5BB 1S72T 1H3ZA 3MEAA 3CC2A 3MO8A 4EMHA 4PJOC 1G5VA 4F7UB 2MI6A 2XDPA 1KD1C 2ZGWA 4HCBA 4JS4A 3URGA 3PMTA 4C92E 1JBMA 4HCCA 3HFOA 1OZ2A 5DM7R 5GANh 3DB3A 3EFSA 2XDDA 1YIJA 3M9QA 3S3NA 3BDUA 4QW2A 3KBGA 1Q82C 3QO3A 4JRPA 2DTIA 1KQ2A 2DIQA 2EJ9A 2VYTA 4M77A 4Z02A 5LJ3e 5LJ5d 1Q86C 1K8AU 4L6V5 4OVAA 1UGSB 2K3YA 3HHTB 2FYKA 5I21A 1KQSS 2DTHA 4CI0C 5GAN7 3CCLT 4JRQA 3VYHB 3L2ZA 2F5KA 4M7AG 4QVZA 5GMKl 5A0GA 3VKIA 3HRSA 3QXEB 3EAEA 4EMKB 2JOYA 3QJ6A 2Y4XA 1M8VA 1N6AA 2QQBA 4KULA 4MZTA 1WPYA 3JCMe 2P0QA 4C5GA 1LOJA 1YI2A 1Y7XA 3DB4A 2QQRA 3LX7A 3OYHA 3QKJA 2JNGA 3LWHA 4C0DC 3RUXA 4C5EA 5GMKi 4E7KA 3RESA 3V7CA 1VQ8A 2IVWA 2EJGA 3DLLA 3PIPA 3PGGA 4BD3A 4ELZC 3CCRA 4BUGA 4E7JA 1JJ2A 2VGMA 2X4XA 4A4HA 1VQLT 2JVVA 4J8OA 2PVGB 2K4YA 3GF5A 1XOVA 3J81E 1UGPB 4BE0A 5GAMh 2E6ZA 1VQ9T 1BI3A 2V8JA 2HNIA 2XICA 4N4HA 4OGCA 3OYFA 4JJNK 2JUFA 1M4ZA 2R57A 3C12A 4HKEA 1Q7YU 5CQYA 4YTLA 5AYFA 1Q81C 4PJOE 4FIBA 3CEYA 1YJNA 2R58A 3SWNB 3ASKA 2XIDA 3OMGA 3JCMQ 3OYJA 2R5MA 3GLXA 1KG1A 2OAUA 5GANe 3CCQT 1VQLA 2YLBA 3S3OA 2RI5A 1VQ4A 2E12A 2FHDA 1M9SA 4RMOA 3CMEA 1UEBA 3QG1A 4IUPA 3CPFA 1UGQB 1X01A 1VQMT 4ZN1A 3G6EA 2CGHA 2LT1A 4RG8A 4M77C 5CQXA 2LDMA 2DPPB 2RHIA 3E9GA 2LCCA 2YLCA 3LYIA 3G71T 1Y71A 4F7UE 4C8QA 3CMAT 5LJ3j 1ZQ1A 3ER0A 4M7DA 4QVDA 4XU1A 2RI2A 1KC8C 4M7AF 2DXTA 5LJ5h 1IREB 3E9FA 2PUKB 4A4FA 5CKBA 2E1HA 2DVEA 3VV0A 1OZ3A 1YITA 5HK3A 1NJIC 1B34A 1FWZA 1R8OB 4RCCA 4X9CA 5A0LA 1N27A 2PUOB 4C92C 4ELYC 5GAMg 3TREA 3LWIA 4JLGA 1K9MC 4BDZA 2M1HA 2GCXA 3GOXA 3CPWS 2KAFA 2RJEA 5GAN2 3CCVA 1BIAA 4D6WA 5C0MA 3OW2A 1BI1A 4OF1A 4P5NA 3UDCA 2XD0A 4DQ2A 4RCBA 1V29B 1VQKT 3JAME 1VQPT 5KCOA 4M75E 2XDBA 1BYMA 4C0ZA 4X34A 2ZPEB 4XTWA 1N9RA 4M78G 3C95A 2E6NA 3OBYA 2RB6A 3RMSA 2P4TA 1KHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCJ A;  4MZT A;  5CKB A;  1M1F A;  5CKD A;  5CK9 A;  5CCA A;  5HK0 A;  1X75 C;  3JRZ A;  5HKC A;  4ELY C;  2VUB A;  3VUB A;  3G7Z A;  4VUB A;  2MF2 A;  2KMT A;  4ELZ C;  3HPW A;  5CKE A;  4MZP A;  2C06 A;  4OF1 A;  5CQX A;  5CKF A;  1NE8 A;  5DLO A;  5CR2 A;  5CO7 A;  4MZM A;  4ME7 A;  1UB4 A;  4HKE A;  1VUB A;  5CQY A;  3JSC A;  4MDX A;  5HK3 A;  5CKH A;  3NFC A; 
#chains in the Genus database with same CATH topology
 2GFA A;  2EWN A;  3MP8 A;  2O2O A;  3H9N A;  2ATC B;  2WSC E;  3NMZ C;  1TU0 B;  1B34 B;  2JT4 A;  1RI0 A;  3GNF B;  1Q95 G;  5L8R E;  2DTO A;  3Q1J A;  3FJ5 A;  1VA7 A;  3PIO A;  5CO7 A;  5IAY A;  1OU9 A;  5GMK h;  4II1 A;  4LDY A;  4DA4 A;  2BE7 D;  1IGU A;  2RN8 A;  2KRN A;  2X4J A;  4J9H A;  2P0P A;  4F14 A;  2MIO A;  2QI2 A;  4ESR A;  1AWX A;  3VUB A;  2VXE A;  5D6X A;  2QG9 B;  2QAZ A;  3M5A A;  4PLL A;  2DMO A;  3EG3 A;  2RQU A;  2OTL T;  4FSX A;  1WX6 A;  1QVF A;  1OU8 A;  3CD6 T;  1Y0M A;  5FRN A;  1NYF A;  3SWN A;  3T9N A;  4LUD A;  4EIK A;  1JRI A;  2DZ9 A;  2P4R A;  4M7A B;  2QGF B;  1NBE B;  2RJC A;  2GQV A;  1BBZ A;  1YWO A;  4D8D A;  2EW3 A;  4N0A A;  3NGP A;  3CCL A;  2DXU A;  2D6F A;  4XU3 A;  2LTO A;  3EGD A;  3QBY A;  3SFM A;  4IUV A;  5CVI A;  4M75 D;  1JQQ A;  1M90 U;  2CP5 A;  3A8O B;  4M7D E;  2SRC A;  1M30 A;  4XTU A;  4J5Y A;  3CCU Q;  1N8R C;  2ABL A;  1O9S A;  5C6S A;  1Q82 U;  4OGE A;  3F70 A;  1HK9 A;  3RKX A;  2E64 A;  2RPN A;  3X24 B;  2E70 A;  1NLO C;  2RF0 A;  3BFM A;  3CC4 A;  4BE2 A;  1SF9 A;  2L0A A;  1YJW T;  1UJY A;  5LJ5 f;  3CCE T;  1RAF B;  1VQN T;  3VU3 C;  1M5Q 1;  4QQG A;  1VQO T;  2XHC A;  3JB9 F;  3GIB A;  4LUE A;  4C92 D;  1AZG B;  1M1G A;  1I8F A;  2XK0 A;  1ZBJ A;  3EG0 A;  5GAN 4;  4L5G A;  5FW9 A;  1Q81 U;  2RHY A;  1G3S A;  1RL2 A;  4RUG A;  5GAN d;  1Z9Z A;  4PJO A;  5GMK j;  1LVK A;  5CKH A;  4F16 A;  2DYB A;  3M59 A;  3S3M A;  3H8Z A;  1VOM A;  1WLP B;  2DXC A;  4BDY A;  4AFU C;  2HZY A;  5HK0 A;  3CCR Q;  1YJ9 A;  2ZPG B;  2AKL A;  4LD6 A;  2FPE A;  2A3L A;  1QVF S;  2KVQ G;  4RTW A;  1K8A C;  2KT8 A;  5GAN 8;  4MDX A;  4M7D D;  1Y96 A;  1NJI U;  4CC3 A;  4FW2 A;  4KGV B;  1K4U S;  2VWF A;  1OX8 A;  2YUO A;  1VQ4 Q;  5CK9 A;  3CC2 T;  1K73 U;  2DD4 A;  4CC7 A;  3QYH B;  4BY6 B;  1NYG A;  2VB6 A;  1VIF A;  2ESW A;  1R77 A;  4JJD A;  1ABQ A;  2KY9 A;  1WYX A;  3MP6 A;  4CRI A;  2NWM A;  2A7Y A;  1YIJ T;  2V1R A;  1M1K R;  1QLY A;  4F7U G;  3I5S A;  3FJP A;  1ZX6 A;  3HSB A;  1RAC B;  3QHS A;  3JB9 G;  2LQN A;  4UC4 A;  3PFS A;  4OB1 B;  2DBM A;  2OTL A;  4V2S A;  3CMA Q;  3C0C A;  3CXC A;  2CUB A;  3CD6 A;  4C5H A;  1YFN A;  2JW4 A;  2X4Y A;  3OYB A;  2L89 A;  4PLI A;  2O31 A;  5L23 A;  2K2V A;  2KT1 A;  2F2W A;  4X9D A;  3RNJ A;  2JTM A;  5IT9 E;  3MKD A;  4C8Q F;  4M75 B;  2COW A;  4M78 E;  2ENM A;  3QDF A;  3U23 A;  1GFC A;  2VGN A;  3WXM B;  2XU8 A;  2O4X B;  1Q86 R;  2CZ7 B;  4OB0 B;  4OMN A;  3VS1 A;  1VQP Q;  1E6H A;  1WGS A;  2MF2 A;  3CBM A;  2EPD A;  4Y92 A;  2KRS A;  3JCM V;  5D6W A;  2ED0 A;  4J9D A;  4MDW A;  2E65 A;  3M0U A;  2QXF A;  4JZ3 A;  4J83 A;  4PJN A;  2WSE E;  2J6F A;  1I5O B;  2EBP A;  4F17 A;  3VRY A;  3PVL A;  1VYT A;  2HKQ B;  3M4G A;  2X3W D;  4C92 B;  2LT4 A;  3MJX A;  4EDU A;  1YIT T;  5D6Y A;  5KYU B;  5GMK m;  2DET A;  1DJ7 B;  3OA6 A;  1YJW A;  2DK3 A;  1YWP A;  3CCE A;  1H64 1;  1VQN A;  4XTX A;  1VQO A;  2KGT A;  2MWO A;  2G3R A;  3OS5 A;  1UGR B;  3V7S A;  1W4S A;  1JB0 E;  3VJP A;  2IG0 A;  2M0Y A;  1RAD B;  4C0F A;  1KC8 R;  3I56 Q;  1AWW A;  4C8Q G;  1ZUY A;  1UEC A;  1K9M R;  2D8H A;  3PE0 A;  1MNE A;  4M78 D;  1T3L A;  1PSF A;  4M7D B;  1QMC A;  4J6X A;  4XK8 E;  1VQ6 T;  3JCM f;  1PRL C;  1I4K 1;  1OPL A;  1T0J A;  3CCJ Q;  1GCP A;  3CXC S;  4RTV A;  3CPW A;  1QVF P;  4JDS A;  3FEO A;  5I22 A;  1V76 A;  4RKU E;  1M3B A;  2RHU A;  4KRT A;  1BKB A;  5EC7 A;  2KXD A;  1K0X A;  3L42 A;  1V1C A;  2E4H A;  3CC7 Q;  1EIF A;  1K76 A;  1ZSZ A;  1S72 T;  1M2V B;  3CC2 A;  2DRK A;  1WHG A;  2AK5 A;  2EYW A;  4J9I A;  3PMT A;  3HFO A;  1OZ2 A;  5GAN h;  3EFS A;  1YIJ A;  3BDU A;  1Q82 C;  2OJ2 A;  4JRP A;  2EJ9 A;  5LJ5 d;  4L6V 5;  1SG5 A;  2FPD A;  3HHT B;  3L2Z A;  4OMO A;  5GMK l;  1MMG A;  3EAE A;  4EMK B;  2JOY A;  1RLQ C;  2DL8 A;  2P0Q A;  4C5G A;  2RQT A;  3OYH A;  3LX7 A;  4C0D C;  5GMK i;  3RES A;  1S1N A;  2L2P A;  3DLL A;  4ELZ C;  1VQL T;  2YRD A;  1IGQ A;  2CSQ A;  5GAM h;  1VQ9 T;  2V8J A;  4N4H A;  4M4Z A;  1Q81 C;  1M4Z A;  2R57 A;  5KYW A;  3SHW A;  4E2F B;  2AZV A;  2R58 A;  2XID A;  3JCM Q;  2W0Z A;  4RTU A;  3CCQ T;  3CCS Q;  2FHD A;  1F1B B;  3EG9 B;  4IUP A;  3CPF A;  4JJC A;  1VQM T;  2CGH A;  2LDM A;  1N8R R;  3E9G A;  2LCC A;  4F7U E;  3UA7 A;  3ER0 A;  2CRE A;  1CSK A;  1GRI A;  2MK5 A;  2PUK B;  3E9F A;  2E1H A;  1W6X A;  1YIT A;  1NJI C;  1B34 A;  4RCC A;  3LWI A;  4ELY C;  2OI3 A;  4JLG A;  2BZX A;  1AOJ A;  2HSE B;  3CPW S;  2GCX A;  3GOX A;  2KAF A;  3MPU B;  1B3Q A;  4P5N A;  4DQ2 A;  2QGG A;  1VQK T;  4C0Z A;  1N9R A;  3C95 A;  3OBY A;  5GAO p;  1KHI A;  1YI2 Q;  3A98 A;  1EZZ B;  4Y28 E;  5CIU A;  2BZ8 A;  2C0O A;  4OMQ A;  4BB7 A;  3M0R A;  2D1X A;  5GAN j;  3E2U A;  1WA7 A;  1R0C B;  4PJJ A;  3L2U A;  3ME9 A;  3I9Q A;  2CSI A;  3MCA B;  1YJN Q;  1VQ6 A;  2HQE A;  4M7A A;  4IIO A;  3EGU A;  1WHM A;  2YUP A;  3CXC P;  1TG0 A;  3CME Q;  2GBQ A;  3CBO A;  3VRZ A;  4BY6 C;  3A8G B;  5GAN f;  1WJS A;  1E6G A;  1K8A R;  2QEX T;  2DYI A;  3X20 B;  1S72 A;  2EGA A;  2CT3 A;  2RQR A;  5HY6 A;  4RTY A;  1PWT A;  2F2V A;  2GNC A;  4Q5W A;  1YBY A;  2V8K A;  4M78 F;  2YUN A;  1W1F A;  4EPC A;  2LCS A;  4A53 A;  3MET A;  4IKF A;  5IXB A;  2DAQ A;  1RAB B;  1PD1 A;  4FL6 A;  3UA6 A;  3JB9 D;  3CCV Q;  1OI1 A;  2EJF A;  1VQ7 T;  3A8L B;  4J9C A;  1ZA1 B;  2CZ0 B;  2CYZ B;  3CCM T;  5GMK e;  1QQJ A;  5GAM f;  4XTY A;  4C8Q E;  5KYN A;  1KD1 U;  4M75 C;  1Y57 A;  2PVD B;  3CC4 T;  2A37 A;  2V1Q A;  1NZ9 A;  3PMI A;  3EG1 A;  3ZEH A;  1N5Z A;  4GY5 A;  3BW1 A;  2COY A;  3SDZ A;  1N9S A;  1VQ9 A;  1D0X A;  2RHZ A;  4J6Y A;  2CS7 A;  1NE8 A;  3SD4 A;  3JCM d;  5J39 A;  1CKA A;  3MEU A;  3CCQ A;  1RAA B;  2DL7 A;  2OTJ A;  3ZBD A;  1VQM A;  1XNI A;  1ABO A;  2HL5 C;  3L2V A;  2XG8 D;  5GAO m;  3OYG A;  2QA4 A;  1QKW A;  4NL2 A;  3INZ A;  3G4S A;  4EMG A;  1TH7 A;  2DBK A;  1YHQ A;  4JS5 A;  3X25 B;  1YJ9 T;  3M58 A;  3OS1 A;  2NUT B;  1G8X A;  4IUT A;  1P92 A;  4Y91 A;  3GPL A;  3FLG A;  2Y90 A;  2BE9 B;  1UDL A;  2EAY A;  3M54 A;  3CPW P;  3E19 A;  1D3B B;  3HFN A;  3CCL Q;  1VQK A;  3OY9 A;  3MHX A;  3V8K A;  2I2L A;  1PKS A;  2K57 A;  3LLR A;  1FXX A;  5LJ3 h;  1SHG A;  1KFZ A;  3ZFJ A;  4C8Q D;  1WIE A;  4C5I A;  3DKM A;  4M7D C;  2XI9 A;  1Y07 A;  1AVZ C;  3I5R A;  3PVQ A;  2RH2 A;  4LN2 A;  3KXT A;  3HL8 A;  3RDV A;  4BI4 A;  2CDT A;  5GAN 5;  2KNB B;  2NUZ A;  2JTF A;  2CZ1 B;  4R56 A;  3RMQ A;  2X35 A;  2O4X A;  1QVG S;  5LL6 S;  5GAN 3;  1FX7 A;  2PNI A;  2EGC A;  3REA B;  2JM9 A;  2QEX A;  2B86 A;  2I0N A;  1W2B A;  2YT6 A;  2BIV A;  3OYD A;  4C0D B;  1SPK A;  2HL3 A;  3JB9 I;  1WFW A;  1MGQ A;  2PU9 B;  2A36 A;  2RJF A;  4CC2 A;  3TU4 K;  3TEE A;  2GQI A;  4Z89 A;  1VQ8 T;  1U1S A;  1M90 R;  5KYX B;  5GAO l;  1OYX A;  2K2M A;  5I2M A;  3CCR T;  3RER A;  2K5F A;  5FU7 B;  3OYA A;  2KI7 A;  2YHT A;  1AT1 B;  4QQ6 A;  1EFN A;  3FIF A;  4EMK C;  1HD3 A;  1MV3 A;  1Q82 R;  1VQ7 A;  2L3R A;  2EGE A;  2QTV A;  2C0I A;  4C92 A;  5LJ5 j;  3CCM A;  1X6G A;  2HD0 A;  3FDR A;  2JMA A;  3UPU A;  3M0Q A;  2RK1 A;  4J9G A;  1U8R A;  5DLQ E;  3OYI A;  1VQ4 T;  1KQ1 A;  2HKN A;  1C6V X;  2F5T X;  1E7O A;  5IXF A;  1SHF A;  2MWP A;  4MZM A;  5GAN g;  1KQS A;  4F7U F;  1VUB A;  2E10 A;  3A8H B;  4AFZ C;  1X27 A;  2FZK B;  5CKD A;  1VQ5 Q;  3KFV A;  4J7I A;  1GFD A;  1Q81 R;  2RO0 A;  3R6O A;  2EYQ A;  4LDX A;  4HVW A;  2KEA A;  5DLO A;  1MMA A;  2CKK A;  5IH2 A;  2PZ1 A;  2VV5 A;  5J3B A;  4FYY B;  2DJQ A;  1KJW A;  3CD6 Q;  3QYG B;  4O5V A;  1J3T A;  4KUI A;  4JRI A;  4LDU A;  2EKO A;  1M2V A;  1TTH B;  2YRC A;  1BU1 A;  2HAX A;  5LJ3 f;  2EQJ A;  2EVR A;  1NJI R;  2MAM A;  4HT9 A;  4KBM B;  4DBR A;  2K5L A;  5KE3 A;  4C8Q B;  3JCM b;  2DKG A;  4M78 C;  2KBT A;  3CCU A;  2J06 A;  3HRU A;  3JCM h;  1QWE A;  3I55 T;  1W2B S;  3OYN A;  5GAM d;  1LNX A;  4GLK A;  1IHV A;  2KRO A;  3OS0 A;  1WQW A;  2FB7 A;  3JCM X;  4PKC C;  3JB9 J;  3JCM J;  4JLI A;  2D9T A;  3N5B B;  2ROL A;  1AD5 A;  4EMH A;  2MI6 A;  1KD1 C;  2ZGW A;  4JS4 A;  2K7A A;  3URG A;  1C1A A;  1JBM A;  2LJ0 A;  3CQT A;  4K11 A;  2L3P A;  4WTO B;  5IHI A;  5DM7 R;  3M9Q A;  3S3N A;  2NUP A;  1YJW Q;  1KQ2 A;  2DIQ A;  4M77 A;  1VQN Q;  1VQO Q;  2K3Y A;  1QVG P;  5I21 A;  2KYM A;  1KQS S;  2W10 A;  4CI0 C;  5GAN 7;  3VS4 A;  5GJV B;  4M7A G;  4QVZ A;  5A0G A;  3EGX A;  3QXE B;  2F2X A;  3QJ6 A;  4MZT A;  1WPY A;  4ANJ A;  1LOJ A;  2QQR A;  3LWH A;  1OV3 A;  1M8M A;  1VQ8 A;  2BTT A;  2IVW A;  4QT7 A;  3CCR A;  3PGG A;  4BD3 A;  1JJ2 A;  4E7J A;  2X4X A;  4A4H A;  2JVV A;  4J8O A;  2PVG B;  3GF5 A;  1XOV A;  1ZUU A;  1LPL A;  1Z9Q A;  2E6Z A;  2DE0 X;  1UJ0 A;  2HNI A;  3OYF A;  3JB9 H;  3C12 A;  2KR3 A;  1Q7Y U;  4YTL A;  1PHT A;  3RR6 A;  4KH1 B;  3CEY A;  4ZNX A;  3SWN B;  3ASK A;  3OYJ A;  4J9F A;  2OAU A;  2K3B A;  5GAN e;  2YLB A;  3ZL7 C;  3S3O A;  1VQ4 A;  4RMO A;  1UEB A;  2A28 A;  1X01 A;  2EYY A;  4ZN1 A;  3RBB B;  1PCX A;  3O5Z A;  5CQX A;  2DRM A;  3CC2 Q;  3G71 T;  1Y71 A;  4J9E A;  2RQV A;  2L3S A;  3UAT A;  4QVD A;  4A4F A;  1FWZ A;  1R8O B;  4X9C A;  5A0L A;  2XMF A;  1QWF A;  1UHF A;  2M1H A;  2RJE A;  3EH1 A;  5GAN 2;  5C0M A;  2J6K A;  2EKH A;  2P84 A;  2CP0 A;  3JAM E;  2JMC A;  3C4S A;  2RM4 A;  4FYW B;  4J9B A;  1YP5 A;  3RIR A;  3EFR A;  2DEQ A;  3OYL A;  3V7R A;  2LZ6 B;  4A4E A;  3G1J A;  3EHR A;  1VQP A;  2H3J A;  4PFZ A;  1WI7 A;  5LJ5 g;  2HQH A;  1WHJ A;  2LJ1 A;  2DNU A;  3CCS T;  5CKF A;  1G3Y A;  2OX7 A;  1KC8 U;  2HSP A;  2J6O A;  4N4I A;  2ECZ A;  3UF4 A;  2GTJ A;  3NPF A;  3VS7 A;  3JSC A;  3I55 A;  1NEB A;  1W2B P;  4PNO A;  4L59 A;  4PFO A;  1M90 C;  2HEQ A;  2IPO B;  4KT0 E;  4HVU A;  1MHN A;  3A8M B;  1VYV A;  4IUQ A;  3GNG A;  1JJ2 S;  1CKB A;  2M9U A;  4MZP A;  3REB B;  1IZ6 A;  2LQK A;  4MMK A;  4RG2 A;  4R55 A;  4HA8 A;  5GAO n;  1FYN A;  1C0M A;  3KUF A;  4ZGE B;  2LCL A;  2YUQ A;  4A63 B;  2B8A A;  1PC0 A;  4TVR A;  4BE1 A;  2CP7 A;  2E5Q A;  1YIT Q;  5EG2 A;  2F1L A;  2FRY A;  1T0H A;  5A2Q E;  2ZCF B;  1M1F A;  1Y96 B;  1JXM A;  4HXJ A;  3VUZ A;  2RI3 A;  4B9X A;  3G7Z A;  5KE2 A;  3NTK A;  2ZPF B;  3RKY A;  1KQS P;  3RKW A;  1G3T A;  3PNW C;  3ULR B;  2LQ8 A;  2R5A A;  3FRN A;  3I56 A;  5FU7 C;  2KDS A;  3UWN A;  1XQH A;  2IIM A;  4PJO F;  2DM1 A;  1QCN A;  4HCZ A;  3NFC A;  4E7Z A;  2MMP A;  3A5Z B;  4IUR A;  4XQ3 A;  2DJZ A;  3V8L A;  4PL6 A;  1M3A A;  3OYM A;  2LVM A;  5LJ3 d;  6AT1 B;  3A1P A;  2LQW A;  2OTJ T;  1X2K A;  8ATC B;  1K1Z A;  5KYY A;  3C94 A;  4FM4 B;  4N4G A;  2GGR A;  2JXB A;  2NUT A;  2Y4Y A;  4DOV A;  4B9W A;  2EYX A;  1WXU A;  1GXI E;  2P0K A;  2QA4 T;  3L1A A;  3G4S T;  1WJQ A;  2FZG B;  3L2R A;  3O8V A;  4E47 A;  1YHQ T;  1TWB A;  5IHK A;  1PG5 B;  3FB9 A;  3LH5 A;  3P8B B;  4C92 G;  2CUD A;  3JRZ A;  5FRO A;  2VC8 A;  3OS2 A;  1OX9 A;  1GCQ C;  1SSF A;  3NTH A;  1K73 C;  3G71 A;  2C06 A;  1NG2 A;  5IN1 A;  2CZ6 B;  1FMV A;  1G2B A;  1IRX A;  2DVJ A;  5GAO q;  4ME7 A;  4M7A E;  2CH4 A;  2LJ3 A;  4M78 B;  1RAG B;  2Z0W A;  4DBH A;  3LGL A;  4M77 F;  3M53 A;  1AHJ B;  3QZ9 B;  3LGF A;  3HRT A;  1ZBX A;  5IHN A;  2LMJ A;  2ZAE A;  4PJO G;  3J7A F;  4FU6 A;  2PTK A;  3LW5 E;  4NOY A;  4C8Q C;  5LJ5 e;  3DLM A;  1VQL Q;  3OB9 A;  3OSV A;  4PJL A;  2L8D A;  4ATO A;  1PSE A;  1WHL A;  1VQ9 Q;  2ZZD A;  2QDY B;  3G6E Q;  2AZS A;  3CCS A;  4WCI A;  1UUE A;  4LNP A;  2NYS A;  3EG2 A;  1G3W A;  3OMC A;  3CCQ Q;  4DBF A;  2HBP A;  2JJ9 A;  2CP6 A;  2HQX A;  1UB4 A;  1D0Y A;  2F69 A;  5GAM j;  4FYV B;  5J26 A;  1VQM Q;  1QP2 A;  1Q7Y C;  2RA2 A;  4ZN3 A;  2QK0 A;  1ARK A;  4HT8 A;  1JJ2 P;  2DL4 A;  3M0P A;  4BAC A;  2NLU A;  2AKK A;  3QJY A;  1PM3 A;  2YDL A;  4JUV A;  2BUD A;  2JTE A;  1YN8 A;  3PT9 A;  1K9A A;  1KD1 R;  3JCM g;  4A4K A;  2D0Q B;  2HDA A;  1NEG A;  2FRW A;  3EFO B;  1B7T A;  1I1J A;  1ZSZ B;  2KYB A;  4M7A D;  2LRQ A;  1QVG A;  1JU5 C;  2DL3 A;  2QTX A;  1TXQ A;  2RK2 A;  3S6W A;  4AG1 C;  1KSW A;  4ORZ A;  4VUB A;  3WVE B;  1VIE A;  3OYE A;  4C0G A;  4M77 G;  4XTV A;  1OQK A;  2BZY A;  2LC4 A;  1HSQ A;  2DA9 A;  4LDV A;  1IO6 A;  5ECA A;  1QKX A;  5KCH A;  2LX7 A;  2EQK A;  3TVT A;  2J05 A;  1GBR A;  3SWN C;  2ZPI B;  5A0D A;  3QUI A;  2VXF A;  2ZPH B;  1FMK A;  1X43 A;  3R6N A;  4ZTF A;  4AFQ C;  1UGV A;  4N0A C;  1W70 A;  4ZGD B;  1KK7 A;  4IUU A;  4ZTJ A;  1QW1 A;  2PQW A;  2WAC A;  1EX4 A;  2L3Q A;  2CH4 W;  2QEX Q;  5KYW B;  3TCJ A;  2FEI A;  1PNJ A;  1QP3 A;  4BI3 A;  5FU6 B;  3QII A;  1ZHI A;  3BDL A;  2WSF E;  3CCU T;  1ZLM A;  3HKS A;  1U06 A;  4E6R A;  2E41 A;  2MCN A;  5GAN 6;  2JS0 A;  1OUL A;  1SKU B;  2VAS A;  1VQ7 Q;  2H3E B;  3OQ5 A;  2V8I A;  2MPX C;  4XAX B;  5CCA A;  3EH2 A;  3CCM Q;  2K9G A;  2RD1 A;  4CC4 B;  1D09 B;  3JCM W;  1UG1 A;  3OSS C;  3LH0 A;  2K3X A;  3VS5 A;  2AIR B;  4PK4 A;  2K6D A;  2QYZ A;  2O01 E;  3CC4 Q;  2DF6 A;  2EYZ A;  1VQ5 T;  8AT1 B;  2FVU A;  4NS5 A;  4M75 A;  1H3Z A;  3MEA A;  2MYS A;  4PJO C;  3H0F A;  4F7U B;  2XDP A;  4HCB A;  2K79 A;  1PRM C;  2J7I A;  4C92 E;  4HCC A;  1X2Q A;  2COZ A;  3DB3 A;  2XDD A;  4AMC A;  1VYU A;  1OEB A;  3QO3 A;  1RI9 A;  2VYT A;  2GTO A;  1BCO A;  2FYK A;  2DTH A;  4JRQ A;  1MMD A;  3VKI A;  3HRS A;  2Y4X A;  1M8V A;  1N6A A;  4KUL A;  3JCM e;  4FW1 A;  1Y7X A;  1YJ9 Q;  2JNG A;  1TS9 A;  2KE9 A;  3TSZ A;  5KYU A;  4DBQ A;  2E3I A;  4E7S A;  2K4Y A;  1UGP B;  2DL5 A;  1BI3 A;  1YNZ A;  1GBQ A;  1OOT A;  5CQY A;  4PJO E;  4FIB A;  1MV0 B;  4PFP A;  1KG1 A;  2R5M A;  3GLX A;  4RTZ A;  1M9S A;  4Z8A A;  1UTI A;  1UGQ B;  2DEU A;  2LT1 A;  4M77 C;  1IB8 A;  1RAE B;  2YLC A;  3CMA T;  5LJ3 j;  1ZQ1 A;  4M7D A;  3H41 A;  4XU1 A;  4M7A F;  2DXT A;  2OTL Q;  5CKB A;  2FPF A;  1A0N B;  5HCK A;  5GAM g;  1N27 A;  1I07 A;  5FWB A;  4BDZ A;  2X51 A;  1IHW A;  4D6W A;  3OW2 A;  1HYO A;  1IXD A;  4RCB A;  1V29 B;  4KH0 B;  1VQP T;  1BYM A;  1T3S A;  3QWY A;  3M0T A;  2E6N A;  5HK3 A;  3JCM P;  1TUG B;  2MOX A;  1K73 R;  2KSS A;  3JV3 A;  3MEV A;  1JXO A;  1VQ8 Q;  4J6W A;  2DX1 A;  2GFU A;  3VS2 A;  3WVD B;  2ED1 A;  2O88 A;  4E7L A;  3VS3 A;  2DIL A;  4M77 E;  4E7I A;  1MMN A;  1AWJ A;  5I2S A;  1WDX A;  4A54 A;  1RUW A;  4EMK A;  4OMM A;  1QVP A;  2C0T A;  4PJO D;  2O9V A;  1QCO A;  2EIF A;  3QZ5 B;  1UHC A;  5CAI A;  4XU2 A;  1D1B A;  4QQD A;  2QDL A;  1X75 C;  3P8D A;  1VQ5 A;  1U5S A;  2KK4 A;  2X3X D;  2GF7 A;  1SRL A;  3CCE Q;  2JZ2 A;  3D7S B;  2JM8 A;  2K5I A;  1M1K U;  4DEY A;  3NTI A;  3I56 T;  3EG9 A;  1H3H A;  2O9S A;  1OPK A;  3M0S A;  2QQ9 A;  3QDR B;  1MUZ A;  1XJW B;  1AWO A;  2EFI A;  1Q7Y R;  1WXT A;  3J80 E;  3TQ7 P;  2ROT A;  3CCJ T;  2DER A;  2VVK A;  3OYK A;  1ZSZ C;  5AT1 B;  2D8J A;  1O75 A;  3OYY A;  5FLX E;  3CC7 T;  1SSH A;  4QVC A;  2CP2 A;  1Q86 U;  1K0S A;  2KMT A;  3X28 B;  2V26 A;  4LD9 K;  3OW2 S;  4M77 D;  1D1A A;  1I0C A;  1R0B G;  3I55 Q;  2AHJ B;  1BB9 A;  1NPR A;  7AT1 B;  3EGD B;  4M78 A;  1XTD A;  2EQI A;  1PD0 A;  9ATC B;  1YIJ Q;  2E5K A;  4RTX A;  2L5Q A;  1I81 A;  3M57 A;  3CMA A;  5FWC A;  2SEM A;  5DY9 A;  5GAM e;  2DXB A;  2DO3 A;  3THK A;  4M75 F;  4FT4 A;  1G83 A;  2E3H A;  3M56 A;  2LNH B;  3QSU A;  5FU6 C;  2VKN A;  3M55 A;  5GJW B;  4NL3 A;  2KQW A;  2FO0 A;  2QQA A;  4DEX A;  1BK2 A;  3IQL A;  3EHQ A;  4MML A;  4F04 B;  1BIB A;  1WNL A;  2LX9 A;  2PVO B;  4J7F A;  1BI2 A;  1TSF A;  1WXB A;  4JZ4 A;  2RJD A;  1X69 A;  2BKD N;  1RAH B;  3OYC A;  4WF2 A;  1I5L A;  3GBQ A;  4OB2 B;  1K9M U;  1ZUK A;  4KGZ B;  4PJO B;  2YSQ A;  1YCS B;  2OAW A;  3MP1 A;  4C92 F;  4HVV A;  2A08 A;  2DD5 A;  3HPW A;  1LJO A;  4FYX B;  3QPH A;  5KH6 A;  3EFO A;  4JPB W;  2M51 A;  3V8J A;  1TUC A;  3M4Y A;  2FL7 A;  1QCF A;  3SB2 A;  3P8H A;  4JRK A;  5LJ3 g;  2M16 A;  4AT1 B;  1HXD A;  3G71 Q;  1YCY A;  2M0O A;  1YI2 T;  4OP0 A;  3NHN A;  2DZC A;  5FRM A;  3JCM c;  4BI8 B;  4M75 G;  2AT1 B;  4XTZ A;  4GLM A;  3OBW A;  4M7D F;  1U1T A;  2EQM A;  1D0Z A;  4X1V A;  2X4W A;  4M7A C;  4KUD K;  3UT1 A;  4LDW A;  3PTA A;  5GAO r;  3L2Q A;  5M9O A;  5HKC A;  1BCM A;  1YJN T;  3VYG A;  4E7H A;  2RHX A;  1ZA2 B;  4Z88 A;  5CKE A;  2QQS A;  3CCJ A;  2JN0 A;  4OMF B;  2NUP B;  3CME T;  5CR2 A;  2LNV A;  4M77 B;  3FC3 A;  1VQ6 Q;  3MEW A;  4A4G A;  3G6E T;  1WJR A;  4FCY A;  2KRM A;  5I11 A;  3CC7 A;  2FZC B;  3EGX B;  1D3B A;  1WQ7 A;  3VS0 A;  2X9H A;  3OW2 P;  1S72 Q;  2ZPB B;  3VS6 A;  3BY7 A;  4FSS A;  2DIG A;  1KHC A;  1NPP A;  1BI0 A;  3CCV T;  4OML A;  2KXC A;  3HP9 A;  1N8R U;  3H0H A;  4ZGJ B;  1H8K A;  4IIM A;  4DOW A;  1SRM A;  4O6J A;  3H6Z A;  1WZO A;  1ACM B;  4JJB A;  2RNA A;  2VUB A;  2EQU A;  2RQW A;  4AFS C;  1D1C A;  3L2W A;  4OMP A;  3E1S A;  1NLP C;  1X6O A;  4AG2 C;  3X26 B;  4F7U A;  3BE3 A;  4FT2 A;  4M7D G;  1ZSG A;  1RAI B;  3HTR A;  3AHU A;  4HCK A;  2H8H A;  2DFU A;  1M1K C;  2YRV A;  4LE9 A;  3H0I A;  2XKO C;  2QAS A;  5D7U A;  1TOV A;  5KYX A;  4XU0 A;  3GP8 A;  3CBP A;  1MND A;  4OB3 B;  2OTJ Q;  1RLP C;  3MO8 A;  1M27 C;  1G5V A;  1AZE A;  1JEG A;  2CT4 A;  1LCK A;  2QA4 Q;  3G4S Q;  2M02 A;  1YHQ Q;  4QW2 A;  3KBG A;  1PKT A;  2DTI A;  4D8K A;  5LJ3 e;  1Q86 C;  4Z02 A;  1K8A U;  4OVA A;  1UGS B;  2RMO A;  2LP5 A;  4RTT A;  3CCL T;  3VYH B;  2HCK A;  1WHH A;  2F5K A;  2D0N A;  1U3O A;  2QQB A;  3AT1 B;  1YI2 A;  2HBW A;  1M3C A;  3DB4 A;  3QKJ A;  3RUX A;  4C5E A;  4E7K A;  1VQK Q;  1GCQ A;  3V7C A;  2EJG A;  4PJM A;  3PIP A;  4BUG A;  3I35 A;  2VGM A;  2G6F X;  4B6M A;  4R0K A;  3J81 E;  4BE0 A;  2HMA A;  4OGC A;  2XIC A;  1M2O A;  4JJN K;  2JUF A;  4HKE A;  5AYF A;  1TUD A;  1YJN A;  4GBQ A;  3OMG A;  4LXC A;  1VQL A;  2RI5 A;  2E12 A;  2YWW A;  1HJD A;  3CME A;  3QG1 A;  4QKU A;  1NM7 A;  3G6E A;  2DLP A;  1AEY A;  3TSW A;  2YXY A;  4RG8 A;  1WHK A;  2DPP B;  2RHI A;  3SEM A;  3LYI A;  4C8Q A;  3QWX X;  1FMW A;  1X6B A;  2A0F B;  2RI2 A;  1KC8 C;  5LJ5 h;  1IRE B;  1SEM A;  1UE9 A;  2DVE A;  3VV0 A;  1OZ3 A;  1KIK A;  1JO8 A;  1K9M C;  2PUO B;  4C92 C;  1H92 A;  3TRE A;  2CP3 A;  1UFF A;  1GL5 A;  3CCV A;  1BIA A;  5KYY B;  1BI1 A;  4OF1 A;  3UDC A;  2XD0 A;  2JS2 A;  1B07 A;  5KCO A;  2FG0 A;  4M75 E;  2XDB A;  4X34 A;  2ZPE B;  4XTW A;  4M78 G;  2RB6 A;  3RMS A;  2P4T A;  4KGX B; 
#chains in the Genus database with same CATH homology
 2GFA A;  3C4S A;  4Y28 E;  2RM4 A;  2KSS A;  2EWN A;  3MP8 A;  3MEV A;  3RIR A;  2WSC E;  3EFR A;  5CIU A;  4J6W A;  2GFU A;  2DEQ A;  3OYL A;  3V7R A;  4A4E A;  3WVD B;  4BB7 A;  4E7L A;  5GAN j;  1VQP A;  1B34 B;  1RI0 A;  2H3J A;  3L2U A;  3GNF B;  3ME9 A;  5LJ5 g;  5L8R E;  2DTO A;  4M77 E;  4E7I A;  3Q1J A;  5I2S A;  3CCS T;  5CKF A;  1G3Y A;  4A54 A;  3PIO A;  1KC8 U;  5CO7 A;  4N4I A;  5IAY A;  5GMK h;  4EMK A;  3MCA B;  4II1 A;  4LDY A;  4DA4 A;  1QVP A;  1VQ6 A;  3JSC A;  3I55 A;  4PJO D;  2HQE A;  4M7A A;  2EIF A;  3QZ5 B;  2X4J A;  4PNO A;  2P0P A;  4L59 A;  5CAI A;  4XU2 A;  1M90 C;  4QQD A;  1X75 C;  3P8D A;  3CBO A;  4KT0 E;  1VQ5 A;  1MHN A;  2QI2 A;  3A8M B;  3A8G B;  4BY6 C;  5GAN f;  1WJS A;  3VUB A;  4IUQ A;  2KK4 A;  2VXE A;  2GF7 A;  3GNG A;  5D6X A;  3M5A A;  4PLL A;  2QEX T;  1JJ2 S;  2M9U A;  4MZP A;  2OTL T;  3X20 B;  1S72 A;  1IZ6 A;  2LQK A;  4FSX A;  4MMK A;  4RG2 A;  4R55 A;  4HA8 A;  5GAO n;  3KUF A;  5HY6 A;  2JZ2 A;  1QVF A;  4ZGE B;  2LCL A;  3CD6 T;  2B8A A;  4Q5W A;  5FRN A;  2K5I A;  4TVR A;  1YBY A;  4BE1 A;  3SWN A;  1M1K U;  2E5Q A;  2V8K A;  4M78 F;  5EG2 A;  3T9N A;  3NTI A;  1JRI A;  4EPC A;  5A2Q E;  2DZ9 A;  2ZCF B;  1M1F A;  1Y96 B;  4A53 A;  3I56 T;  3MET A;  4IKF A;  4M7A B;  2DAQ A;  4FL6 A;  3VUZ A;  2RI3 A;  3JB9 D;  1OI1 A;  2RJC A;  2EJF A;  2GQV A;  2QQ9 A;  3G7Z A;  3QDR B;  4B9X A;  3A8L B;  3NTK A;  4N0A A;  5KE2 A;  1VQ7 T;  2EFI A;  2ZPF B;  3RKY A;  3CCL A;  2CZ0 B;  2CYZ B;  3CCM T;  2DXU A;  2D6F A;  4XU3 A;  1G3T A;  3RKW A;  3PNW C;  2LTO A;  5GMK e;  2LQ8 A;  2R5A A;  3QBY A;  3FRN A;  3SFM A;  3J80 E;  5FU7 C;  5GAM f;  3I56 A;  2KDS A;  3UWN A;  4IUV A;  5CVI A;  4M75 D;  4XTY A;  4C8Q E;  3CCJ T;  1KD1 U;  1XQH A;  4M75 C;  4PJO F;  3OYK A;  3A8O B;  1M90 U;  4M7D E;  4HCZ A;  3NFC A;  2PVD B;  3CC4 T;  2MMP A;  3A5Z B;  4XTU A;  4IUR A;  4J5Y A;  2DJZ A;  1O75 A;  1NZ9 A;  4XQ3 A;  3OYY A;  3V8L A;  1N8R C;  4PL6 A;  3PMI A;  3OYM A;  1O9S A;  5C6S A;  3ZEH A;  2LVM A;  5FLX E;  3JCM P;  5LJ3 d;  3CC7 T;  1Q82 U;  4GY5 A;  4OGE A;  3F70 A;  2OTJ T;  1HK9 A;  3BW1 A;  3RKX A;  4QVC A;  1Q86 U;  2E64 A;  3C94 A;  3X24 B;  4FM4 B;  3SDZ A;  1N9S A;  2KMT A;  3X28 B;  1VQ9 A;  4N4G A;  4LD9 K;  2E70 A;  2Y4Y A;  4DOV A;  3OW2 S;  4B9W A;  2RHZ A;  3BFM A;  4M77 D;  4J6Y A;  2CS7 A;  3CC4 A;  1GXI E;  1NE8 A;  2P0K A;  3SD4 A;  3JCM d;  5J39 A;  2QA4 T;  4MDX A;  3L1A A;  2AHJ B;  4BE2 A;  3G4S T;  1WJQ A;  3MEU A;  1NPR A;  3CCQ A;  3L2R A;  3O8V A;  4E47 A;  1YHQ T;  2OTJ A;  4M78 A;  1YJW T;  3FB9 A;  5LJ5 f;  3CCE T;  1XTD A;  3P8B B;  1VQN T;  4C92 G;  3VU3 C;  3ZBD A;  1M5Q 1;  4QQG A;  1VQO T;  2XHC A;  1VQM A;  1XNI A;  3JRZ A;  3JB9 F;  5FRO A;  3GIB A;  3L2V A;  4C92 D;  2VC8 A;  2XG8 D;  3OS2 A;  5GAO m;  3OYG A;  1M1G A;  1I8F A;  2L5Q A;  2XK0 A;  1I81 A;  2QA4 A;  1SSF A;  4NL2 A;  3INZ A;  3NTH A;  3G4S A;  1K73 C;  5GAN 4;  3M57 A;  4L5G A;  3G71 A;  3CMA A;  4EMG A;  1TH7 A;  2C06 A;  5IN1 A;  1YHQ A;  4JS5 A;  1Q81 U;  5DY9 A;  5GAM e;  2CZ6 B;  3X25 B;  1YJ9 T;  2DXB A;  2RHY A;  3M58 A;  3OS1 A;  2DO3 A;  4M75 F;  5GAO q;  4FT4 A;  1G3S A;  4ME7 A;  1RL2 A;  5GAN d;  4IUT A;  1P92 A;  4Y91 A;  3GPL A;  3FLG A;  4PJO A;  5GMK j;  2Y90 A;  5CKH A;  3M56 A;  4M7A E;  3M59 A;  3S3M A;  3H8Z A;  2EAY A;  2DXC A;  3M54 A;  3QSU A;  3E19 A;  5FU6 C;  3M55 A;  4M78 B;  4BDY A;  5HK0 A;  4NL3 A;  1D3B B;  1YJ9 A;  2KQW A;  2ZPG B;  3HFN A;  2QQA A;  1VQK A;  3OY9 A;  3MHX A;  4MML A;  4LD6 A;  3V8K A;  2I2L A;  1BIB A;  3LGL A;  1WNL A;  2A3L A;  2K57 A;  4M77 F;  2LX9 A;  2PVO B;  3LLR A;  1FXX A;  4J7F A;  1BI2 A;  1QVF S;  3M53 A;  1AHJ B;  3QZ9 B;  5LJ3 h;  3LGF A;  3HRT A;  2RJD A;  2KVQ G;  2BKD N;  4M7D D;  1ZBX A;  4PJO G;  3ZFJ A;  1K8A C;  4C8Q D;  3J7A F;  4C5I A;  4FU6 A;  3LW5 E;  4NOY A;  4C8Q C;  5LJ5 e;  1Y96 A;  5GAN 8;  3OYC A;  3DLM A;  4WF2 A;  3DKM A;  1NJI U;  1I5L A;  4M7D C;  2XI9 A;  4OB2 B;  1K9M U;  1Y07 A;  4PJO B;  3OB9 A;  3OSV A;  2L8D A;  5CK9 A;  3MP1 A;  3CC2 T;  1K73 U;  1PSE A;  4C92 F;  2RH2 A;  2DD4 A;  4ATO A;  3QYH B;  3KXT A;  3HL8 A;  2ZZD A;  2QDY B;  4BY6 B;  3CCS A;  2DD5 A;  4BI4 A;  1VIF A;  3HPW A;  1LJO A;  3QPH A;  1G3W A;  5KH6 A;  2KY9 A;  3MP6 A;  5GAN 5;  4CRI A;  3OMC A;  2A7Y A;  1YIJ T;  4F7U G;  2HBP A;  2JTF A;  2CZ1 B;  4R56 A;  3V8J A;  2HQX A;  1UB4 A;  2FL7 A;  3M4Y A;  3RMQ A;  2F69 A;  3FJP A;  5GAM j;  2X35 A;  2O4X A;  5J26 A;  3HSB A;  3SB2 A;  1QP2 A;  1QVG S;  5LL6 S;  3P8H A;  5GAN 3;  1FX7 A;  1Q7Y C;  2RA2 A;  4JRK A;  4ZN3 A;  3QHS A;  2QEX A;  3JB9 G;  4UC4 A;  2M16 A;  3PFS A;  4OB1 B;  5LJ3 g;  2OTL A;  4HT8 A;  1HXD A;  4BAC A;  1W2B A;  2BIV A;  4V2S A;  3OYD A;  1YCY A;  2NLU A;  4C0D B;  3CXC A;  2M0O A;  3QJY A;  3CD6 A;  3JB9 I;  4C5H A;  3OYB A;  1YI2 T;  1MGQ A;  2PU9 B;  2L89 A;  2X4Y A;  2RJF A;  4OP0 A;  4JUV A;  4PLI A;  2BUD A;  2DZC A;  3TU4 K;  5FRM A;  3TEE A;  3JCM c;  2K2V A;  3PT9 A;  4X9D A;  1VQ8 T;  4BI8 B;  1U1S A;  4M75 G;  3JCM g;  4A4K A;  2JTM A;  4XTZ A;  1OYX A;  5I2M A;  5GAO l;  3CCR T;  5IT9 E;  4C8Q F;  2D0Q B;  2K5F A;  5FU7 B;  3OYA A;  3OBW A;  3RER A;  2YHT A;  4M7D F;  1U1T A;  4QQ6 A;  3JB9 H;  3FIF A;  2EQM A;  4M75 B;  4EMK C;  4M78 E;  4M7A D;  2LRQ A;  2VGN A;  2X4W A;  1QVG A;  1VQ7 A;  4KUD K;  3UT1 A;  3WXM B;  4M7A C;  2QTX A;  2L3R A;  2XU8 A;  4LDW A;  2O4X B;  5GAO p;  3PTA A;  5LJ5 j;  4C92 A;  2RK2 A;  3S6W A;  5GAO r;  3L2Q A;  5M9O A;  5HKC A;  2HD0 A;  3CCM A;  2CZ7 B;  3FDR A;  4OB0 B;  1YJN T;  3VYG A;  3UPU A;  4E7H A;  2RK1 A;  2RHX A;  4VUB A;  1U8R A;  5DLQ E;  3WVE B;  1VIE A;  1WGS A;  2MF2 A;  3CBM A;  3OYE A;  5CKE A;  4C0G A;  4M77 G;  2QQS A;  3CCJ A;  3OYI A;  4XTV A;  1VQ4 T;  2JN0 A;  1KQ1 A;  4OMF B;  3CME T;  3JCM V;  2LC4 A;  5D6W A;  4LDV A;  2F5T X;  5CR2 A;  2LNV A;  4M77 B;  2MWP A;  2E65 A;  4MDW A;  3MEW A;  4MZM A;  4A4G A;  1WJR A;  5GAN g;  4F7U F;  5KCH A;  3FC3 A;  3G6E T;  1KQS A;  1VUB A;  2E10 A;  2EQK A;  3A8H B;  3CC7 A;  2QXF A;  4J83 A;  3SWN C;  2WSE E;  2ZPI B;  1D3B A;  5CKD A;  5A0D A;  1WQ7 A;  3QUI A;  2VXF A;  2ZPH B;  4J7I A;  4ZTF A;  3M4G A;  4C92 B;  2LT4 A;  2ZPB B;  4EDU A;  1YIT T;  4N0A C;  5D6Y A;  5GMK m;  4ZGD B;  3BY7 A;  4IUU A;  4ZTJ A;  2RO0 A;  1QW1 A;  1DJ7 B;  2EYQ A;  3R6O A;  2DIG A;  1KHC A;  3OA6 A;  1YJW A;  4LDX A;  5DLO A;  2DK3 A;  2PQW A;  2WAC A;  1NPP A;  3CCE A;  1H64 1;  1VQN A;  1BI0 A;  4XTX A;  3CCV T;  1VQO A;  3HP9 A;  1N8R U;  2CKK A;  4ZGJ B;  2MWO A;  2VV5 A;  3TCJ A;  4DOW A;  2G3R A;  4O6J A;  3H6Z A;  1QP3 A;  3OS5 A;  1UGR B;  3V7S A;  5J3B A;  4BI3 A;  1W4S A;  5FU6 B;  3QYG B;  4O5V A;  2VUB A;  2EQU A;  3QII A;  1ZHI A;  3BDL A;  1JB0 E;  4KUI A;  3VJP A;  2IG0 A;  4JRI A;  2WSF E;  4LDU A;  2EKO A;  3L2W A;  3CCU T;  3HKS A;  4C0F A;  3E1S A;  2E41 A;  1X6O A;  2HAX A;  5LJ3 f;  2EQJ A;  5GAN 6;  4C8Q G;  3X26 B;  2MAM A;  4HT9 A;  4KBM B;  4F7U A;  4M7D G;  4FT2 A;  3OQ5 A;  2K5L A;  2V8I A;  5KE3 A;  4XAX B;  4C8Q B;  4M78 D;  5CCA A;  3AHU A;  3JCM b;  2DKG A;  4M78 C;  1PSF A;  4M7D B;  1M1K C;  2RD1 A;  2YRV A;  4J6X A;  4XK8 E;  3JCM W;  1VQ6 T;  3JCM f;  3CCU A;  3HRU A;  3JCM h;  1I4K 1;  3I55 T;  2XKO C;  1W2B S;  3OYN A;  5GAM d;  3OSS C;  3LH0 A;  1LNX A;  2K3X A;  3CXC S;  3CPW A;  4GLK A;  4JDS A;  3OS0 A;  3FEO A;  1WQW A;  4RKU E;  2O01 E;  2RHU A;  2FB7 A;  1VQ5 T;  1BKB A;  4XU0 A;  3CBP A;  3GP8 A;  3L42 A;  3JCM X;  4PKC C;  3JB9 J;  3JCM J;  2FVU A;  4JLI A;  1EIF A;  4NS5 A;  4M75 A;  4OB3 B;  2D9T A;  3N5B B;  1S72 T;  1H3Z A;  3MEA A;  3CC2 A;  3MO8 A;  4EMH A;  4PJO C;  1G5V A;  4F7U B;  2MI6 A;  2XDP A;  1KD1 C;  2ZGW A;  4HCB A;  4JS4 A;  3URG A;  3PMT A;  4C92 E;  1JBM A;  4HCC A;  3HFO A;  1OZ2 A;  5DM7 R;  5GAN h;  3DB3 A;  3EFS A;  2XDD A;  1YIJ A;  3M9Q A;  3S3N A;  3BDU A;  4QW2 A;  3KBG A;  1Q82 C;  3QO3 A;  4JRP A;  2DTI A;  1KQ2 A;  2DIQ A;  2EJ9 A;  2VYT A;  4M77 A;  4Z02 A;  5LJ3 e;  5LJ5 d;  1Q86 C;  1K8A U;  4L6V 5;  4OVA A;  1UGS B;  2K3Y A;  3HHT B;  2FYK A;  5I21 A;  1KQS S;  2DTH A;  4CI0 C;  5GAN 7;  3CCL T;  4JRQ A;  3VYH B;  3L2Z A;  2F5K A;  4M7A G;  4QVZ A;  5GMK l;  5A0G A;  3VKI A;  3HRS A;  3QXE B;  3EAE A;  4EMK B;  2JOY A;  3QJ6 A;  2Y4X A;  1M8V A;  1N6A A;  2QQB A;  4KUL A;  4MZT A;  1WPY A;  3JCM e;  2P0Q A;  4C5G A;  1LOJ A;  1YI2 A;  1Y7X A;  3DB4 A;  2QQR A;  3LX7 A;  3OYH A;  3QKJ A;  2JNG A;  3LWH A;  4C0D C;  3RUX A;  4C5E A;  5GMK i;  4E7K A;  3RES A;  3V7C A;  1VQ8 A;  2IVW A;  2EJG A;  3DLL A;  3PIP A;  3PGG A;  4BD3 A;  4ELZ C;  3CCR A;  4BUG A;  4E7J A;  1JJ2 A;  2VGM A;  2X4X A;  4A4H A;  1VQL T;  2JVV A;  4J8O A;  2PVG B;  2K4Y A;  3GF5 A;  1XOV A;  3J81 E;  1UGP B;  4BE0 A;  5GAM h;  2E6Z A;  1VQ9 T;  1BI3 A;  2V8J A;  2HNI A;  2XIC A;  4N4H A;  4OGC A;  3OYF A;  4JJN K;  2JUF A;  1M4Z A;  2R57 A;  3C12 A;  4HKE A;  1Q7Y U;  5CQY A;  4YTL A;  5AYF A;  1Q81 C;  4PJO E;  4FIB A;  3CEY A;  1YJN A;  2R58 A;  3SWN B;  3ASK A;  2XID A;  3OMG A;  3JCM Q;  3OYJ A;  2R5M A;  3GLX A;  1KG1 A;  2OAU A;  5GAN e;  3CCQ T;  1VQL A;  2YLB A;  3S3O A;  2RI5 A;  1VQ4 A;  2E12 A;  2FHD A;  1M9S A;  4RMO A;  3CME A;  1UEB A;  3QG1 A;  4IUP A;  3CPF A;  1UGQ B;  1X01 A;  1VQM T;  4ZN1 A;  3G6E A;  2CGH A;  2LT1 A;  4RG8 A;  4M77 C;  5CQX A;  2LDM A;  2DPP B;  2RHI A;  3E9G A;  2LCC A;  2YLC A;  3LYI A;  3G71 T;  1Y71 A;  4F7U E;  4C8Q A;  3CMA T;  5LJ3 j;  1ZQ1 A;  3ER0 A;  4M7D A;  4QVD A;  4XU1 A;  2RI2 A;  1KC8 C;  4M7A F;  2DXT A;  5LJ5 h;  1IRE B;  3E9F A;  2PUK B;  4A4F A;  5CKB A;  2E1H A;  2DVE A;  3VV0 A;  1OZ3 A;  1YIT A;  5HK3 A;  1NJI C;  1B34 A;  1FWZ A;  1R8O B;  4RCC A;  4X9C A;  5A0L A;  1N27 A;  2PUO B;  4C92 C;  4ELY C;  5GAM g;  3TRE A;  3LWI A;  4JLG A;  1K9M C;  4BDZ A;  2M1H A;  2GCX A;  3GOX A;  3CPW S;  2KAF A;  2RJE A;  5GAN 2;  3CCV A;  1BIA A;  4D6W A;  5C0M A;  3OW2 A;  1BI1 A;  4OF1 A;  4P5N A;  3UDC A;  2XD0 A;  4DQ2 A;  4RCB A;  1V29 B;  1VQK T;  3JAM E;  1VQP T;  5KCO A;  4M75 E;  2XDB A;  1BYM A;  4C0Z A;  4X34 A;  2ZPE B;  4XTW A;  1N9R A;  4M78 G;  3C95 A;  2E6N A;  3OBY A;  2RB6 A;  3RMS A;  2P4T A;  1KHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...