5CKHA

E. coli mazf e24a form iib
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
103
Chain Sequence
b'VSRYVPDMGDLIWVDFQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
molecule tags Hydrolase
source organism Escherichia coli k-12
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
total genus 25
structure length 103
sequence length 110
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ckhA00
2C06A 3TCJA 5HK0A 4MZTA 4OF1A 5CKEA 3HPWA 2MF2A 5CR2A 1VUBA 4MZMA 4MDXA 5CKDA 3JSCA 5HK3A 1NE8A 3G7ZA 5CKBA 5CQYA 3JRZA 5CKFA 5DLOA 5CKHA 2VUBA 4MZPA 3VUBA 4ME7A 4ELZC 5CQXA 4ELYC 4VUBA 5CCAA 5CO7A 4HKEA 3NFCA 1UB4A 2KMTA 1X75C 5CK9A 5HKCA 1M1FA
chains in the Genus database with same CATH superfamily
5GAOm 1N5ZA 3VRYA 4E7KA 2GFUA 5C6SA 3SB2A 4JRKA 1VQ8A 3JCMJ 4J6WA 2O9SA 5CQYA 2K3YA 3CMAQ 1SKUB 1X27A 4Y92A 1KSWA 5FU7C 2FZGB 1I0CA 3G1JA 4C8QE 3S3MA 2DLPA 1D09B 4M75A 3VS1A 2E41A 2P0PA 4IUTA 3MHXA 5GAN2 3QO3A 4M78C 2HL5C 2DEQA 2E6NA 3MP8A 2EBPA 4OMNA 5CQXA 1ZLMA 4E7ZA 5CCAA 2P4RA 1WLPB 2KBTA 3I9QA 2COYA 4B6MA 1OULA 5KE3A 2P84A 3CCJA 1UE9A 1ZA2B 2KRSA 2NUPB 4P5NA 2KE9A 1VIFA 1QVPA 4XTYA 2O4XA 4PJNA 1M2OA 2IIMA 4CC4B 1YJWQ 3Q1JA 2CP6A 5A0DA 4JJDA 4YTLA 4CC7A 4EMKC 1UGRB 3CCRT 4F04B 4HCBA 5A0GA 5DLQE 1HD3A 2YUNA 4PKCC 3G4SA 1KQSA 1YJ9Q 1SEMA 2OX7A 2E70A 2PU9B 1VQ4T 5GAN3 2KDSA 3I55A 3VUBA 1N6AA 3MEUA 5CAIA 2YT6A 5AYFA 4XU1A 3CPWS 4F7UA 2VGMA 1QVFS 4RKUE 5GJWB 1W6XA 4OMLA 2XDBA 1V76A 2BZXA 1QCOA 1WHGA 2J06A 2FPFA 3CCLT 3F70A 1RABB 3DB4A 1D3BB 3QWXX 1RLPC 2EJGA 2JMCA 4JLIA 1I5LA 2EIFA 1ZX6A 4GLKA 3QG1A 4KGVB 2FG0A 1E6GA 2K2MA 4M75E 3H41A 4C8QD 4C92B 2ED1A 1NM7A 2P0QA 3QZ9B 4J9BA 3A8LB 4FYVB 4J9CA 1GXIE 4J6YA 2B8AA 2XICA 2E6ZA 4M75D 2K57A 1OPKA 1ZSGA 1M8MA 2GTOA 5CKHA 3OA6A 4AT1B 1VQPT 1M3BA 2FPDA 3VV0A 1IHVA 2MYSA 2LJ3A 3H9NA 4F7UG 2HEQA 3RNJA 3LGFA 4MDWA 4PL6A 1Y71A 4A4KA 4PJOC 2RQVA 4R56A 4RTYA 4M7DB 2MCNA 5GAMh 4C92F 1WYXA 3O8VA 2VUBA 2DNUA 1B34A 1Q86U 1M1KC 1W1FA 2LMJA 1SHGA 2V1QA 1WZOA 1ZUKA 4RCBA 2JOYA 1ZQ1A 2LCLA 4RTTA 3X28B 4DOWA 1RUWA 5LJ5h 2DL3A 1NEBA 3EGDB 1JBMA 3CCMA 2L3SA 1VYTA 3QDFA 2ROTA 3PTAA 3VS5A 3G71T 1BI2A 1GFCA 3C4SA 3BDUA 1K9AA 1U1SA 1MMGA 1M8VA 1UEBA 2IVWA 2JJ9A 4OMQA 3LGLA 3KFVA 1AEYA 4NS5A 1RAAB 2PVOB 2HQHA 4AG1C 2H3JA 3EHRA 4L59A 7AT1B 2QDYB 1VQ5Q 1BI0A 1E7OA 3MKDA 3TCJA 1TUCA 2JTMA 5CKEA 2DA9A 1IGUA 2KYMA 3EGUA 2LDMA 3CCUQ 3JCMW 4LE9A 4C8QG 2XKOC 4FW1A 4LDVA 4FL6A 2COZA 1NJIR 1D0ZA 1KC8R 3X20B 2EYQA 1OPLA 1XOVA 2FRWA 4AMCA 2KRNA 1I5OB 2F69A 4FYXB 4MDXA 2GQIA 2QK0A 3RERA 1QP2A 2QGGA 3M0UA 2VWFA 5FWCA 2CSQA 3CC4Q 3A8OB 2M51A 2QASA 1MUZA 1D1CA 1U06A 1UTIA 4IUUA 2WSCE 3RESA 3DLLA 2BKDN 1X2KA 1M27C 3M5AA 2PVGB 1TU0B 1H3ZA 2D0QB 2R58A 3QUIA 1UJYA 4MMLA 3R6OA 4Q5WA 4CI0C 1SRMA 3CCVT 4X1VA 5I11A 2LCCA 3I56T 3X25B 4MZPA 2QEXT 1OZ3A 2L8DA 1QCFA 3JCMc 4R55A 1A0NB 3I56A 3EG9A 2K6DA 1YNZA 1G83A 3UWNA 1TWBA 2ZAEA 5IT9E 3OMGA 1M1FA 1PRLC 1S72A 4PJOD 1U3OA 2DKGA 4ZNXA 1NPPA 1D1BA 5CKBA 4BUGA 1P92A 3RMSA 2HKNA 4HA8A 4OB3B 3VRZA 4KGXB 5GAOq 4OB0B 3R6NA 5FRMA 4JZ3A 5FW9A 1V29B 2BIVA 4XTXA 1O9SA 3PMIA 3D7SB 3SWNC 2HMAA 1YI2T 2GCXA 1VQ5A 3JB9G 5GANj 3CC7A 5I21A 3GNFB 1VQOA 3P8DA 3CCUA 2DMOA 4E7IA 3OYYA 5L23A 1T0HA 2R57A 2XHCA 4J9GA 4EPCA 3E1SA 4OMMA 2E1HA 2MI6A 2DEUA 5IXBA 2C0IA 2CP3A 2EYZA 4E47A 2RHXA 2DERA 3JCMf 4C5HA 2HZYA 3M54A 5LJ3j 1NE8A 2QA4T 3A1PA 3ULRB 3G71Q 4N0AC 4F7UF 3JCMQ 5CO7A 4J9FA 3OYCA 3CC4A 2JT4A 1JEGA 1B3QA 2HBWA 2JZ2A 1N9RA 1K9MR 3VYHB 1M90C 3CPWA 2KT1A 3GF5A 2AZSA 1VQ6Q 2YRVA 4HCCA 2AKLA 2FL7A 1VQ9T 5GANg 3CCVA 3ASKA 1SHFA 2DETA 4QVDA 2RHYA 1IRXA 4FSSA 1SG5A 3ME9A 4OMOA 3OW2A 3OYDA 3E9GA 1PWTA 4PJLA 5KCHA 2RQUA 3CC2T 2C06A 1GFDA 4X9CA 4OF1A 5J3BA 2KXCA 3JSCA 1FWZA 3QWYA 1VQKA 5A0LA 2EWNA 5FU6C 5GANh 3NMZC 3OB9A 1U1TA 3HRSA 4M78E 4M75F 2A7YA 4EMKB 1RL2A 3A8MB 2E12A 1YHQA 2GFAA 1YIJQ 1HXDA 4JUVA 1KD1R 1Q95G 2CKKA 4M7AE 3QPHA 2G6FX 1JJ2P 3C12A 3DB3A 5D6YA 3CXCP 4XK8E 4M4ZA 4Z8AA 2DZ9A 4XTUA 3CCEQ 1ZSZA 4QQDA 5GAMj 4E6RA 2D9TA 4II1A 3VS2A 4DOVA 3QZ5B 3VS0A 4XAXB 3NPFA 2QA4Q 4M75B 3SD4A 1G5VA 5IHIA 4M77F 4OP0A 4RMOA 1VA7A 1PNJA 4B9WA 3LW5E 2A28A 1WFWA 3M0QA 5IXFA 2JW4A 2EQKA 2V26A 3G4ST 3KBGA 2L3QA 5HK0A 4J9DA 4ZTJA 1M1GA 2DF6A 4BD3A 3PIOA 4JZ4A 2BE7D 1KHCA 2RPNA 1MGQA 2DO3A 5A2QE 1R0BG 3NGPA 2VKNA 3PVLA 1WJQA 4C5IA 3OYJA 1H8KA 5LJ3f 4C8QC 4RG8A 1GBRA 2K4YA 2LT1A 2C0OA 3I5RA 2PQWA 2V8KA 4OMFB 2YSQA 2ZPBB 3HTRA 4QVZA 2EW3A 4QVCA 3OBWA 2E65A 1VQ7A 4B9XA 1AWOA 5IHNA 1XNIA 1AZGB 2C0TA 2J05A 3M0PA 2JNGA 4A63B 3REAB 2QEXQ 2RD1A 3FIFA 3J80E 1K73U 3FRNA 2F5TX 2MWPA 3EGDA 3M4YA 3PIPA 5GAOn 2ZZDA 3HFNA 3EH2A 3UT1A 1W4SA 2ZPGB 3CMAA 3A8HB 1JXMA 3OS1A 1XJWB 1VQ9Q 1QVFP 2LZ6B 2MAMA 2HKQB 4EMKA 4E7JA 3CCEA 4OB2B 2CUDA 5LJ5j 4A4FA 4OMPA 3X26B 2KQWA 4ZN3A 4ORZA 1UGPB 4C92C 3CMEQ 2O88A 2GGRA 1NJIC 3A5ZB 2MWOA 2EQUA 5FROA 1PG5B 1WQWA 4PJOF 2X35A 3OYKA 5FWBA 3LWHA 4N4GA 4J83A 2E64A 2CYZB 1T3LA 2QDLA 2COWA 1IZ6A 2RK2A 4BACA 2EGEA 4AG2C 3EG2A 4ATOA 1H641 2CZ6B 2LT4A 2NUZA 1XTDA 2OTLA 1Q82R 2BTTA 4C0GA 2OTLT 3JCMd 1RAEB 4KH0B 3AT1B 1ZA1B 4PJMA 3V8JA 2LX7A 2K3BA 3EH1A 1X69A 1YJWA 3L42A 2DTHA 5GJVB 3OY9A 1Q7YC 2RHUA 2LQNA 5GAN4 4DA4A 1DJ7B 3X24B 1QKXA 2FEIA 4A4EA 5HK3A 4F7UB 1D1AA 5J39A 3I5SA 3ZFJA 4XTVA 4DBQA 4VUBA 1PSEA 5KYXB 2NUTA 3CCET 2M16A 1KQSP 2DVJA 2FVUA 4FM4B 4KRTA 1YCYA 3REBB 2K9GA 1C1AA 1VQ7Q 3MP1A 1GRIA 1HYOA 4L6V5 1YIJT 3OSVA 2DJZA 4J7FA 1EIFA 2A0FB 2O01E 4WCIA 4JRPA 4LD6A 1KQSS 3HRUA 2RHIA 1RI0A 2JN0A 1T0JA 3WVEB 5LJ5d 3UA7A 4LUEA 4M77G 3UPUA 1EFNA 2YRCA 2MPXC 1KJWA 2NLUA 3UA6A 1IHWA 1VQ9A 2YDLA 3OYLA 2PUOB 4M7DC 2D8HA 2MIOA 3CC2Q 2QXFA 1KQ1A 8AT1B 2ABLA 2HL3A 3OW2S 1YFNA 1WJRA 1Q7YU 4EMHA 3CMEA 2DYIA 3M58A 1V1CA 1QKWA 2EJFA 3CC4T 4C8QB 3EHQA 5HKCA 5C0MA 1VQ7T 1NBEB 1J3TA 2DX1A 3META 3RKWA 1RACB 1FMVA 5DM7R 4C92D 3BDLA 2OJ2A 1N8RC 4RTVA 2RJCA 2KXDA 3GPLA 2EQMA 3EGXA 2KYBA 4NL3A 3L2QA 3L2RA 1WHKA 2KMTA 1BIBA 1KHIA 2ZGWA 3EG9B 2J6FA 3CPFA 1X6BA 2RO0A 4PK4A 4DBFA 8ATCB 4L5GA 4HCZA 1Y57A 3MP6A 2EJ9A 1QW1A 2DRKA 4JPBW 2JS0A 2SRCA 3FJ5A 4PLIA 1AHJB 3EG0A 2LCSA 2VV5A 1NYFA 4DQ2A 1KC8U 1C0MA 2AZVA 4KH1B 2L3PA 1YI2Q 3QYHB 2FO0A 2CREA 4J6XA 1NYGA 5KYXA 3E9FA 1SRLA 1W2BS 1K0XA 2DL4A 2YWWA 2YUPA 3JAME 2CS7A 1ZSZC 1CKBA 3OYNA 4M78F 3L2VA 1PRMC 1RADB 5LJ3e 1YJNQ 2KSSA 2D6FA 2YUQA 3QJYA 1VQNT 3M59A 3CMET 2W10A 2EKHA 2X3XD 3UDCA 1BI1A 1I1JA 4RCCA 1VQKT 4V2SA 3J7AF 1UG1A 2LJ1A 3HPWA 4BDYA 1HJDA 1KFZA 2FRYA 1VOMA 4N4HA 4ZTFA 2F2WA 4C0FA 4J7IA 3A98A 5GAOl 4ELZC 2HAXA 1HSQA 2EQIA 2KEAA 1E6HA 1M1KR 3M0TA 1YCSB 3ZBDA 2LQKA 5GAN5 2ENMA 1TOVA 2JTEA 2CGHA 2EFIA 4A4HA 1I81A 2KROA 1ZSZB 1K1ZA 2YXYA 4F7UE 5FLXE 4K11A 1Y96A 2LTOA 1OZ2A 2J6OA 4C92A 2ESWA 2ZPFB 5GAMg 1JRIA 2ZCFB 3INZA 4BE0A 1UHFA 3MEAA 1Q82U 1K0SA 2MMPA 4PJOA 4J9IA 1QVFA 2LP5A 1YITT 3M55A 3QBYA 2FPEA 1U5SA 3GNGA 3CCLA 4QQ6A 2VXFA 3FC3A 3OS5A 4GLMA 3M0SA 4M77E 1G3TA 3VS6A 5GMKj 4C0DC 3JCMb 3JRZA 2RI2A 2VXEA 1WJSA 3RDVA 1YI2A 2RI3A 4QKUA 4E2FB 2QTVA 4NL2A 3PFSA 3SWNA 4HVVA 4CRIA 4RTWA 3PE0A 2OAUA 2KY9A 1VQMA 1YITQ 2E5QA 2HNIA 1UGQB 5CR2A 1YJNA 2LQWA 1M90U 5AT1B 2BZYA 4E7LA 2P4TA 1TS9A 2CZ1B 2QAZA 1BBZA 2DM1A 4C8QA 4F17A 3GLXA 5EC7A 1N9SA 2E4HA 4HKEA 2HD0A 2AT1B 2CP0A 3NFCA 1FMWA 3CCMT 2QTXA 1Y96B 2Z0WA 4M78D 1WX6A 5GMKm 3BW1A 1H3HA 2K3XA 4J9HA 2DZCA 1UGVA 4HXJA 1BIAA 4HCKA 1RI9A 3JB9I 3JCMe 4CC2A 5D6XA 1NLOC 4PJJA 1VYVA 2PNIA 1PKSA 4M7AA 3CCVQ 2K7AA 2DTIA 1KC8C 1B07A 3QJ6A 3OYHA 3MEVA 2RQRA 2DRMA 1M9SA 2HCKA 5CKFA 2DFUA 2DXCA 4AFUC 2M9UA 5IH2A 5FU6B 4LN2A 1VQKQ 3H0IA 2D8JA 5KYNA 3PMTA 3JB9J 1G3YA 2RQTA 3DLMA 1BB9A 5LJ3g 3MO8A 3OS2A 2RJEA 3LLRA 1G8XA 3CCLQ 1OYXA 2ATCB 2FZKB 3QSUA 2YRDA 3MCAB 3EG3A 1AZEA 1WPYA 2R5AA 2YLCA 5EG2A 5IN1A 3OYMA 3HL8A 2XD0A 1TSFA 2J7IA 2XG8D 4N4IA 1YN8A 1ARKA 4IKFA 1PM3A 2XIDA 4RG2A 3J81E 4O6JA 2CUBA 2A36A 1AT1B 4LD9K 4M77A 5KYWA 3VKIA 3GP8A 1FXXA 2I2LA 4UC4A 2SEMA 1ZBJA 1VQMQ 1T3SA 1YITA 3EGXB 2QA4A 1Q86C 4JLGA 4JS5A 1RAFB 2OTJA 2PVDB 4JS4A 2K5LA 2ZPIB 2EGAA 1QMCA 1PHTA 3VS3A 2VB6A 1UECA 1JXOA 3QHSA 2PTKA 1Z9QA 1VQOT 3CC7T 1YP5A 1QWEA 1R77A 1F1BB 3PGGA 2GF7A 1OX9A 1D0XA 1NZ9A 1ZUUA 1BCMA 2RF0A 2K5IA 1PC0A 5CVIA 1VQPA 2DPPB 2BUDA 4FYWB 4DBHA 5IAYA 1QLYA 1G3SA 1AD5A 2RMOA 1IXDA 1MV0B 2M02A 1I4K1 3I35A 3M57A 2GTJA 3UF4A 3JCMV 4J5YA 3RKXA 1WHLA 4KT0E 1YHQT 1GL5A 4D8KA 2H8HA 3JV3A 5KE2A 2KRMA 1FYNA 4XQ3A 1MHNA 2L3RA 3KXTA 1G3WA 1N27A 3O5ZA 3OBYA 3OYIA 2DTOA 1AOJA 2RI5A 1WNLA 4RTUA 2RM4A 1M90R 1K9MC 4BDZA 4M77C 1M4ZA 1VQ6T 1ABOA 3HKSA 2LNVA 1UB4A 1YWOA 3CCST 2AKKA 3FJPA 1QQJA 2CDTA 3EFOB 2E3IA 2D1XA 3JCMg 3P8BB 2DD5A 3FB9A 5KYYB 1Z9ZA 4JRQA 2NWMA 2FZCB 3NTIA 2LC4A 3SHWA 2QGFB 2QYZA 4XTWA 4C0DB 3M9QA 5KH6A 2EYYA 2HBPA 5D6WA 5GMKl 1VQ4Q 1I8FA 1FMKA 2HSPA 1K8AU 3CCUT 4BE2A 3EG1A 2FHDA 5KCOA 1M5Q1 1SSHA 4PJOG 2QG9B 4HVWA 2YHTA 4MZMA 3CCRQ 2JXBA 2EVRA 4EDUA 1G2BA 3C95A 4M75C 1OV3A 5FRNA 2OTLQ 3GIBA 1OU8A 1M2VA 3KUFA 1WXUA 2KT8A 1X2QA 1YJWT 4FU6A 2XI9A 1C6VX 2EAYA 2AK5A 4C92G 2CT3A 1UFFA 3BFMA 5GAMf 1IREB 2NUTB 2LX9A 1R8OB 2DL8A 3H6ZA 5M9OA 4AFSC 1PD1A 3A8GB 5IHKA 3QKJA 5CKDA 3H0HA 1WGSA 1EZZB 2XU8A 3PVQA 2MK5A 1W70A 1TTHB 1BCOA 1WI7A 1U8RA 1VQ8Q 4FIBA 3VYGA 1X75C 3HRTA 4BI8B 3URGA 1QVGS 4FCYA 4JRIA 1OU9A 2RJDA 2RA2A 2A37A 4AFQC 1VIEA 4IIMA 3CXCS 2JS2A 3T9NA 4ELYC 1CSKA 4M7DE 2KNBB 4M7DF 2F1LA 1Q82C 5KYYA 4IUVA 1BI3A 1QVGP 3FLGA 3VJPA 3S6WA 3CPWP 1X6OA 4GY5A 3V8KA 3TSWA 3OYAA 2VC8A 1GCQA 1Q86R 3LH0A 3TQ7P 2E3HA 4OGCA 1MNEA 2Y4YA 2DJQA 4RTZA 2YLBA 3CCJQ 4FW2A 1K73R 3QXEB 2B86A 1QVGA 1WA7A 4A54A 3CC2A 4PFOA 2F5KA 2KR3A 1EX4A 4LDUA 1WIEA 2QQSA 1VQ4A 1IO6A 2OTJT 1K76A 4M78B 3BY7A 3IQLA 4FT4A 4EMGA 3SDZA 2LVMA 5KYUA 4BY6B 4Z88A 1NPRA 2WSFE 5J26A 1GCQC 5GANf 1RAHB 4HVUA 2X4XA 5CIUA 2DD4A 1B34B 3JCMX 3G4SQ 1YJ9A 1M30A 3TU4K 2HQXA 2Y4XA 2K5FA 3HHTB 3I55Q 1YJ9T 2K2VA 1OI1A 3H0FA 1IB8A 3M53A 1AWXA 3CD6T 4QW2A 3TREA 2DXTA 4KBMB 5GAN6 3M56A 3CD6A 1KG1A 2LNHB 3FDRA 2LJ0A 1NLPC 2O31A 2DAQA 2VGNA 4PFPA 4X34A 4J9EA 3EFRA 2X4JA 1JO8A 4EIKA 1BK2A 1WQ7A 2GBQA 2HQEA 1W2BP 9ATCB 1BKBA 3JB9D 4PJOE 1B7TA 4E7HA 1OOTA 2V8IA 4LDWA 3ZL7C 4M7DD 4N0AA 4M7AG 1RLQC 4A53A 2D0NA 2CH4A 5I2MA 1M1KU 4HT9A 5LJ5e 4M7AF 5LJ3h 3PT9A 4C92E 5FU7B 4FT2A 2ECZA 3L1AA 4BI3A 4AFZC 2PZ1A 1N8RU 3LWIA 3RMQA 4JJNK 3QIIA 4Y91A 2M0YA 3V7RA 1XQHA 1X43A 2F2XA 4KUDK 2Y90A 3CMAT 3U23A 4LXCA 2R5MA 3M4GA 3GOXA 3MJXA 3LX7A 3QYGB 3CXCA 2CSIA 4JJBA 4QQGA 5I22A 4BB7A 1Y07A 2DK3A 2VYTA 4F16A 2BZ8A 3AHUA 2X4YA 2IPOB 3TSZA 4F14A 1MMAA 2X9HA 5ECAA 4DEXA 2LRQA 3VS7A 1PD0A 3CCMQ 1VQLT 2EQJA 1WXTA 1TH7A 4ANJA 2X51A 4OB1B 1TXQA 2RHZA 3G6ET 2PUKB 2LQ8A 4LUDA 4J8OA 2H3EB 3OYEA 1UUEA 2AIRB 4OVAA 1BU1A 1RAGB 2RQWA 1VQNA 1K8AR 1SSFA 4PNOA 3TVTA 2EKOA 3CD6Q 1D3BA 3WVDB 4HT8A 1R0CB 2JM9A 2XDPA 3JCMh 2NUPA 2QQRA 4BE1A 5GAMd 1AVZC 3I55T 1X6GA 6AT1B 1D0YA 1PKTA 2CZ7B 3SWNB 1OX8A 3G7ZA 2FYKA 1SF9A 2RH2A 2JVVA 3OS0A 5GMKi 2JMAA 3V7CA 5LJ5f 4Y28E 3JB9H 1IGQA 1WHHA 5GAMe 2QI2A 2RN8A 1I07A 4M75G 1UHCA 1WXBA 3CBPA 2MOXA 2F2VA 3G6EQ 1K73C 3HP9A 4Z02A 1VUBA 3ER0A 4JJCA 3OYFA 4PJOB 3LH5A 4RUGA 1SPKA 1GBQA 2EYXA 4ZGEB 2KK4A 4O5VA 5GMKe 2L0AA 3CCJT 3L2ZA 2DVEA 3GBQA 4M7DA 3PNWC 4M78A 2V8JA 4C5EA 3M0RA 1ACMB 1ZBXA 3CCQT 2ROLA 2DL5A 1PSFA 1WHMA 4MZTA 3HSBA 5GMKh 1BYMA 2MF2A 3SEMA 1K9MU 3I56Q 2RJFA 1S72T 4IUQA 2WSEE 4NOYA 2DIGA 1KD1U 3RKYA 2KGTA 2VASA 4MMKA 1M3CA 2P0KA 3CBMA 1NJIU 3UATA 1S72Q 2JM8A 1Q81C 1OEBA 4C5GA 1NEGA 2DXUA 1H92A 2QQBA 5GANe 1PCXA 2CP2A 1VQ8T 4M7AB 1JU5C 2W0ZA 1LJOA 3C0CA 4BI4A 4OGEA 5GANd 3P8HA 1QP3A 3EFSA 5HCKA 3RBBB 3CCQA 2I0NA 5GAN7 4KUIA 1VQNQ 3TEEA 1YJNT 2J6KA 3LYIA 4IIOA 3HFOA 4TVRA 2CH4W 3CQTA 1VQOQ 3CC7Q 3MEWA 2DIQA 1QCNA 5LJ3d 1JJ2A 1S1NA 3SFMA 3L2UA 3N5BB 4GBQA 1VQ5T 3OMCA 3NTKA 4A4GA 1Y7XA 4XTZA 2RK1A 3E2UA 2M0OA 5CK9A 2V1RA 4XU3A 2DBKA 3H8ZA 3G71A 2KAFA 2DE0X 2E5KA 1VYUA 1LVKA 2DXBA 4LNPA 3VUZA 3E19A 5LL6S 2XMFA 4M7AC 3G6EA 1NG2A 1MNDA 5GAN8 1YBYA 1MMNA 4M78G 2E10A 1LCKA 2OI3A 1KK7A 1VQ6A 2JUFA 4C0ZA 4DBRA 1X01A 3VU3C 1KD1C 1LNXA 1WDXA 4PFZA 1ZHIA 4QT7A 2KVQG 2GNCA 3VS4A 4BY6C 2RNAA 3OQ5A 4D8DA 2OTJQ 3MPUB 2HSEB 2EPDA 4DEYA 3RUXA 3EAEA 2CP5A 3V7SA 1O75A 4IUPA 2O9VA 1FX7A 5GAOr 1AWJA 2L2PA 1UGSB 3NTHA 1UJ0A 3JB9F 2L5QA 2XK0A 1VQLA 3WXMB 2XDDA 4ZGJB 2KI7A 4XU0A 5KYWB 3CCSA 3JCMP 1VQPQ 2DYBA 1JQQA 1K4US 5DLOA 2QQAA 4Z89A 4PLLA 1ABQA 4FSXA 3BE3A 1YHQQ 4M7AD 4ESRA 2NYSA 2HDAA 2DBMA 1YIJA 2ED0A 3S3NA 3RIRA 2L89A 1Q7YR 1M3AA 1JB0E 4LDXA 2X4WA 4X9DA 1TUDA 3CCQQ 2EGCA 5KYUB 5HY6A 2IG0A 3S3OA 3OYGA 3EFOA 1MV3A 4ME7A 1Q81U 3NHNA 2ZPHB 1JJ2S 4WF2A 1KIKA 5GAOp 3CEYA 1MMDA 4IURA 2WACA 2DL7A 2BE9B 2O4XB 2K79A 4M77D 2CP7A 1LOJA 4R0KA 2DILA 4D6WA 2GQVA 2M1HA 3THKA 2AHJB 1QWFA 4E7SA 2CT4A 3V8LA 5I2SA 4KGZB 1KQ2A 1TG0A 2O2OA 1WHJA 5L8RE 1VQMT 1M2VB 2EYWA 1TUGB 1ZUYA 3OSSC 3OYBA 1GCPA 1YWPA 2G3RA 1OQKA 4CC3A 2ZPEB 4M7DG 5LJ5g 2QQ9A 4XU2A 4ZGDB 3C94A 1Q81R 5DY9A 4KULA 1AWWA 3CCRA 1UDLA 1HK9A 2A3LA 3DKMA 1LPLA 2CZ0B 4C8QF 1RAIB 2VVKA 2FB7A 3OW2P 1K8AC 1CKAA 4FYYB 1Y0MA 3CBOA 3ZEHA 4M77B 1VQLQ 3L2WA 1N8RR 3RR6A 4ZN1A 4JDSA 3CCSQ 2JTFA 2OAWA 1W2BA 4WTOB 2RB6A 2QEXA 3QDRB 2YUOA 3FEOA 2A08A 4LDYA 5D7UA 2X3WD 4RTXA
chains in the Genus database with same CATH topology
4JUVA 5GAOm 4E7KA 3EFRA 2X4JA 2GFUA 2CKKA 4M7AE 3QPHA 3SB2A 5C6SA 3C12A 3DB3A 4JRKA 5D6YA 4M77E 4XK8E 1G3TA 4J6WA 3JCMJ 1WQ7A 5GMKj 4C0DC 5CQYA 2K3YA 3JRZA 2RI2A 2VXEA 3JCMb 1WJSA 2HQEA 2DZ9A 1YI2A 1BKBA 3JB9D 4PJOE 2RI3A 5FU7C 4XTUA 4E7HA 2V8IA 4QQDA 4NL2A 4LDWA 5GAMj 4M7DD 3PFSA 4C8QE 3S3MA 3SWNA 4CRIA 4N0AA 4M75A 4M7AG 2D9TA 4II1A 2E41A 4A53A 2OAUA 2P0PA 2KY9A 1VQMA 4DOVA 3QZ5B 5I2MA 4IUTA 3MHXA 1VQ8A 2E5QA 4XAXB 1M1KU 4HT9A 2HNIA 5GAN2 1UGQB 5CR2A 1YJNA 5LJ5e 4M7AF 5LJ3h 4M75B 3QO3A 3PT9A 3SD4A 1M90U 4C92E 4M77F 1G5VA 4OP0A 4M78C 5FU7B 4RMOA 4E7LA 2P4TA 4FT2A 2DEQA 2E6NA 3L1AA 3MP8A 2CZ1B 4BI3A 4B9WA 5CQXA 4C8QA 3LW5E 3GLXA 1N8RU 3LWIA 1N9SA 5CCAA 3RMQA 4JJNK 3QIIA 4Y91A 4HKEA 3V7RA 1XQHA 4KUDK 2HD0A 2Y90A 5KE3A 2EQKA 3CMAT 3NFCA 3CCJA 2R5MA 3G4ST 3M4GA 3GOXA 3CCMT 3KBGA 2QTXA 4P5NA 1Y96B 3LX7A 5HK0A 4ZTJA 3QYGB 1VIFA 1M1GA 3CXCA 1QVPA 4M78D 5GMKm 4QQGA 3BW1A 4BD3A 4XTYA 2O4XA 4BB7A 3PIOA 2K3XA 1Y07A 2DZCA 1BIAA 2DK3A 3JB9I 2VYTA 3AHUA 1KHCA 2X4YA 3Q1JA 3JCMe 5A0DA 1MGQA 2DO3A 5D6XA 5A2QE 2LRQA 4YTLA 4EMKC 1UGRB 1WJQA 4C5IA 1VQLT 2EQJA 3OYJA 4M7AA 3CCRT 1TH7A 2DTIA 4HCBA 5A0GA 5LJ3f 5DLQE 1KC8C 4C8QC 4RG8A 3QJ6A 4PKCC 3OYHA 4OB1B 3G4SA 3MEVA 1KQSA 2K4YA 1M9SA 3GP8A 2E70A 2LT1A 2RHZA 3G6ET 2PU9B 5CKFA 2PUKB 2LQ8A 2PQWA 2V8KA 4J8OA 2KDSA 4OMFB 5GAN3 3OYEA 3I55A 1VQ4T 4OVAA 3VUBA 2DXCA 1N6AA 1VQNA 3MEUA 2M9UA 2ZPBB 5FU6B 5CAIA 4QVZA 1SSFA 4QVCA 5AYFA 3OBWA 2E65A 4PNOA 4B9XA 4XU1A 3CPWS 1VQ7A 4F7UA 2EKOA 3PMTA 1D3BA 2VGMA 4RKUE 1G3YA 3WVDB 3JB9J 4HT8A 1QVFS 1XNIA 3DLMA 2XDBA 2XDPA 2JNGA 3JCMh 5LJ3g 2QQRA 3CCLT 2RD1A 4BE1A 5GAMd 3F70A 3FIFA 3MO8A 3J80E 2RJEA 3DB4A 3LLRA 3OS2A 1D3BB 1OYXA 3I55T 2CZ7B 1K73U 3SWNB 3G7ZA 2FYKA 2EJGA 3FRNA 4JLIA 1I5LA 3QSUA 2EIFA 2F5TX 2MWPA 3M4YA 2RH2A 3MCAB 4GLKA 3QG1A 2JVVA 3OS0A 5GMKi 3PIPA 1WPYA 2R5AA 2YLCA 5EG2A 5GAOn 3V7CA 2ZZDA 3HFNA 4M75E 5IN1A 4Y28E 4C8QD 5LJ5f 3OYMA 4C92B 3JB9H 3HL8A 3UT1A 1W4SA 2ZPGB 2XD0A 5GAMe 3CMAA 2QI2A 2P0QA 2XG8D 3A8HB 3QZ9B 4M75G 4N4IA 3OS1A 3A8LB 2MAMA 4EMKA 4IKFA 4E7JA 1GXIE 2XIDA 3CCEA 4OB2B 4RG2A 3J81E 3CBPA 4O6JA 4J6YA 5LJ5j 4A4FA 1K73C 3X26B 2B8AA 2XICA 2KQWA 3HP9A 2E6ZA 4Z02A 4LD9K 1VUBA 3ER0A 4M77A 3VKIA 1FXXA 4M75D 2K57A 4ZN3A 2I2LA 4UC4A 1UGPB 3OYFA 4C92C 4PJOB 1NJIC 3A5ZB 5CKHA 3OA6A 2MWOA 2EQUA 5FROA 1YITA 1WQWA 4PJOF 2X35A 3OYKA 3LWHA 1VQPT 4N4GA 4J83A 2E64A 2CYZB 2QA4A 1Q86C 4ZGEB 3VV0A 1IZ6A 2KK4A 4O5VA 5GMKe 2RK2A 4JLGA 4BACA 3CCJT 3L2ZA 2DVEA 4ATOA 4F7UG 3LGFA 1H641 4JS5A 4M7DA 2CZ6B 4MDWA 4PL6A 3PNWC 2OTJA 4M78A 2PVDB 2V8JA 2LT4A 4C5EA 1Y71A 2K5LA 4JS4A 4A4KA 1XTDA 2ZPIB 1ZBXA 2OTLA 3CCQT 4PJOC 1PSFA 4R56A 4MZTA 3HSBA 5GMKh 1BYMA 2MF2A 4M7DB 5GAMh 4C0GA 3QHSA 4PJOA 4C92F 1K9MU 3O8VA 2RJFA 3JCMd 1S72T 4IUQA 2OTLT 2WSEE 4NOYA 2DIGA 2VUBA 3RKYA 1VQOT 1KD1U 1B34A 3CC7T 1Q86U 1M1KC 3PGGA 3V8JA 2GF7A 4MMKA 2P0KA 1NZ9A 4RCBA 2JOYA 1ZQ1A 2LCLA 3CBMA 2K5IA 1NJIU 3X28B 5CVIA 1VQPA 1Q81C 1YJWA 2DPPB 4DOWA 2BUDA 3L42A 4C5GA 5LJ5h 2DTHA 5IAYA 3OY9A 1Q7YC 1G3SA 2DXUA 2RHUA 5GAN4 2QQBA 1DJ7B 4DA4A 3X24B 3CCMA 1JBMA 5GANe 4A4EA 3PTAA 5HK3A 3G71T 4F7UB 1BI2A 1I4K1 3C4SA 5J39A 3BDUA 1VQ8T 1U1SA 3M57A 4M7AB 3ZFJA 4XTVA 1M8VA 1LJOA 4VUBA 1UEBA 2IVWA 4BI4A 4J5YA 1PSEA 3RKXA 3JCMV 3LGLA 4OGEA 5GANd 3P8HA 4KT0E 4NS5A 1YHQT 1QP3A 3EFSA 2PVOB 3CCQA 3CCET 2H3JA 2M16A 5GAN7 4L59A 5KE2A 4KUIA 2QDYB 3TEEA 1YJNT 4XQ3A 3LYIA 1BI0A 2FVUA 3TCJA 4FM4B 1MHNA 2L3RA 1YCYA 3HFOA 2JTMA 3KXTA 4TVRA 5CKEA 1G3WA 1N27A 3MP1A 3OBYA 3OYIA 3MEWA 2DTOA 2LDMA 2RI5A 1WNLA 2DIQA 3JCMW 4L6V5 5LJ3d 1YIJT 3OSVA 2DJZA 2XKOC 4C8QG 4LDVA 1JJ2A 3SFMA 4FL6A 3L2UA 2RM4A 3N5BB 1EIFA 4J7FA 4BDZA 1K9MC 2O01E 4M77C 1M4ZA 3X20B 2EYQA 4JRPA 1XOVA 4LD6A 1VQ6T 1VQ5T 3OMCA 1KQSS 3HRUA 3NTKA 4A4GA 2RHIA 1RI0A 1Y7XA 4XTZA 3HKSA 2RK1A 2JN0A 2LNVA 2F69A 1UB4A 3CCST 2M0OA 5CK9A 3WVEB 3FJPA 5LJ5d 4XU3A 4MDXA 4M77G 3UPUA 3H8ZA 3JCMg 3G71A 2NLUA 3P8BB 3RERA 2KAFA 1QP2A 1VQ9A 3OYLA 2DD5A 2PUOB 3FB9A 4M7DC 2DXBA 3VUZA 3A8OB 3E19A 5LL6S 2QXFA 4JRQA 1KQ1A 3G6EA 4M7AC 3NTIA 2LC4A 5GAN8 4IUUA 3OW2S 2WSCE 4XTWA 3RESA 1WJRA 4C0DB 3DLLA 1Q7YU 3M9QA 5KH6A 1YBYA 5GANh 2HBPA 4EMHA 3CMEA 5D6WA 5GMKl 1I8FA 3M58A 4M78G 2E10A 2BKDN 1VQ6A 1K8AU 2EJFA 2JUFA 4C0ZA 3CCUT 3CC4T 3M5AA 4C8QB 1X01A 3VU3C 1KD1C 5HKCA 1LNXA 2PVGB 5C0MA 4BE2A 1VQ7T 1H3ZA 2D0QB 2FHDA 2R58A 3QUIA 5KCOA 1M5Q1 3META 4MMLA 4PJOG 1ZHIA 2KVQG 3R6OA 4Q5WA 4CI0C 2YHTA 3OQ5A 4MZMA 4BY6C 3CCVT 3RKWA 4EDUA 3C95A 4M75C 2LCCA 5DM7R 5FRNA 4C92D 3X25B 4MZPA 3RUXA 3I56T 3EAEA 3BDLA 2QEXT 1OZ3A 1N8RC 3GIBA 2RJCA 3KUFA 2L8DA 3V7SA 1O75A 4IUPA 3JCMc 4R55A 1YJWT 4FU6A 3GPLA 3I56A 2XI9A 1FX7A 2EQMA 5GAOr 2EAYA 1UGSB 3NTHA 4NL3A 3L2QA 3L2RA 4C92G 3JB9F 2KMTA 3UWNA 1BIBA 1KHIA 2ZGWA 5IT9E 2L5QA 1M1FA 2XK0A 3OMGA 3WXMB 3BFMA 2XDDA 5GAMf 1VQLA 4ZGJB 1IREB 4XU0A 3CCSA 2LX9A 1R8OB 3H6ZA 3JCMP 5M9OA 3CPFA 1S72A 4PJOD 2DKGA 3A8GB 1NPPA 3QKJA 5CKDA 2RO0A 5CKBA 4BUGA 4L5GA 1WGSA 4HCZA 5DLOA 2QQAA 4PLLA 3MP6A 1P92A 4FSXA 3RMSA 2EJ9A 1QW1A 2XU8A 4M7AD 1YIJA 4HA8A 4OB3B 5GAOq 4PLIA 4OB0B 1AHJB 2L89A 3RIRA 3S3NA 2VV5A 4DQ2A 1U8RA 1KC8U 4FIBA 1JB0E 4LDXA 2X4WA 3VYGA 1X75C 5FRMA 3HRTA 4BI8B 4X9DA 3URGA 1QVGS 1V29B 4JRIA 2BIVA 4XTXA 3QYHB 1O9SA 4J6XA 2RJDA 3PMIA 2RA2A 3SWNC 1YI2T 3E9FA 1W2BS 1VIEA 5HY6A 2IG0A 3S3OA 2GCXA 3OYGA 1VQ5A 3JB9G 3JAME 3CXCS 2CS7A 1JJ2S 4ME7A 3T9NA 1Q81U 2ZPHB 4ELYC 3CC7A 5I21A 3GNFB 4M78F 3OYNA 3L2VA 5GANj 1VQOA 4M7DE 3P8DA 4M7DF 4WF2A 3CCUA 1Q82C 4IUVA 4E7IA 1BI3A 3OYYA 3FLGA 3VJPA 5LJ3e 2KSSA 2D6FA 3QJYA 2R57A 3S6WA 1VQNT 2XHCA 3M59A 4EPCA 3CMET 1X6OA 3E1SA 4GY5A 3V8KA 3CEYA 5GAOp 2E1HA 3UDCA 2MI6A 1BI1A 4RCCA 3OYAA 2VC8A 4IURA 1VQKT 2WACA 4E47A 2O4XB 4V2SA 2RHXA 4M77D 3J7AF 3HPWA 3JCMf 4C5HA 3M54A 1LOJA 5LJ3j 3LH0A 4BDYA 1NE8A 2QA4T 4N4HA 4ZTFA 4OGCA 2Y4YA 4D6WA 4C0FA 2GQVA 2M1HA 4J7IA 5GAOl 2YLBA 4N0AC 4ELZC 4F7UF 2AHJB 2HAXA 3JCMQ 3QXEB 1QVGA 3V8LA 5I2SA 5CO7A 1KQ2A 3CC4A 3OYCA 4A54A 3CC2A 2F5KA 5L8RE 1VQMT 4LDUA 2JZ2A 2QQSA 3ZBDA 1N9RA 2LQKA 3OSSC 5GAN5 1VQ4A 2OTJT 1M90C 3VYHB 3OYBA 3CPWA 2G3RA 4M7DG 3GF5A 2ZPEB 4M78B 3BY7A 2YRVA 4FT4A 2QQ9A 4EMGA 5LJ5g 4XU2A 4HCCA 3SDZA 2LVMA 2CGHA 4ZGDB 3C94A 4BY6B 5DY9A 2EFIA 4A4HA 1NPRA 2FL7A 2WSFE 5J26A 1I81A 1VQ9T 5GANg 4KULA 3CCVA 3ASKA 5GANf 4F7UE 3CCRA 5FLXE 4QVDA 1Y96A 2LTOA 2RHYA 1OZ2A 1HK9A 2A3LA 2X4XA 5CIUA 3ME9A 3DKMA 2DD4A 4C92A 1B34B 3JCMX 3OW2A 1YJ9A 2CZ0B 3OYDA 2ZPFB 3E9GA 5GAMg 4C8QF 3TU4K 2HQXA 2Y4XA 1JRIA 2K5FA 2ZCFB 3HHTB 5KCHA 3CC2T 2C06A 3INZA 1YJ9T 2K2VA 1OI1A 2FB7A 4X9CA 4OF1A 4BE0A 1K8AC 3M53A 3MEAA 5J3BA 3JSCA 1FWZA 3CBOA 1VQKA 3ZEHA 5A0LA 4M77B 3CD6T 1Q82U 2EWNA 2MMPA 3L2WA 4QW2A 5FU6C 3TREA 4ZN1A 2DXTA 3OB9A 2JTFA 4JDSA 3M56A 4KBMB 5GAN6 1U1TA 3HRSA 4M78E 1W2BA 1QVFA 3CD6A 4M75F 1KG1A 1YITT 3M55A 2RB6A 2A7YA 4EMKB 3FDRA 2QEXA 3QDRB 1RL2A 3A8MB 3FEOA 3QBYA 2DAQA 2E12A 3GNGA 4LDYA 3CCLA 4QQ6A 1YHQA 2GFAA 2VGNA 2VXFA 3FC3A 4X34A 1HXDA 3OS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C06 A;  3TCJ A;  5HK0 A;  4MZT A;  4OF1 A;  5CKE A;  3HPW A;  2MF2 A;  5CR2 A;  1VUB A;  4MZM A;  4MDX A;  5CKD A;  3JSC A;  5HK3 A;  1NE8 A;  3G7Z A;  5CKB A;  5CQY A;  3JRZ A;  5CKF A;  5DLO A;  5CKH A;  2VUB A;  4MZP A;  3VUB A;  4ME7 A;  4ELZ C;  5CQX A;  4ELY C;  4VUB A;  5CCA A;  5CO7 A;  4HKE A;  3NFC A;  1UB4 A;  2KMT A;  1X75 C;  5CK9 A;  5HKC A;  1M1F A; 
#chains in the Genus database with same CATH topology
 5GAO m;  1N5Z A;  3VRY A;  4E7K A;  2GFU A;  5C6S A;  3SB2 A;  4JRK A;  1VQ8 A;  3JCM J;  4J6W A;  2O9S A;  5CQY A;  2K3Y A;  3CMA Q;  1SKU B;  1X27 A;  4Y92 A;  1KSW A;  5FU7 C;  2FZG B;  1I0C A;  3G1J A;  4C8Q E;  3S3M A;  2DLP A;  1D09 B;  4M75 A;  3VS1 A;  2E41 A;  2P0P A;  4IUT A;  3MHX A;  5GAN 2;  3QO3 A;  4M78 C;  2HL5 C;  2DEQ A;  2E6N A;  3MP8 A;  2EBP A;  4OMN A;  5CQX A;  1ZLM A;  4E7Z A;  5CCA A;  2P4R A;  1WLP B;  2KBT A;  3I9Q A;  2COY A;  4B6M A;  1OUL A;  5KE3 A;  2P84 A;  3CCJ A;  1UE9 A;  1ZA2 B;  2KRS A;  2NUP B;  4P5N A;  2KE9 A;  1VIF A;  1QVP A;  4XTY A;  2O4X A;  4PJN A;  1M2O A;  2IIM A;  4CC4 B;  1YJW Q;  3Q1J A;  2CP6 A;  5A0D A;  4JJD A;  4YTL A;  4CC7 A;  4EMK C;  1UGR B;  3CCR T;  4F04 B;  4HCB A;  5A0G A;  5DLQ E;  1HD3 A;  2YUN A;  4PKC C;  3G4S A;  1KQS A;  1YJ9 Q;  1SEM A;  2OX7 A;  2E70 A;  2PU9 B;  1VQ4 T;  5GAN 3;  2KDS A;  3I55 A;  3VUB A;  1N6A A;  3MEU A;  5CAI A;  2YT6 A;  5AYF A;  4XU1 A;  3CPW S;  4F7U A;  2VGM A;  1QVF S;  4RKU E;  5GJW B;  1W6X A;  4OML A;  2XDB A;  1V76 A;  2BZX A;  1QCO A;  1WHG A;  2J06 A;  2FPF A;  3CCL T;  3F70 A;  1RAB B;  3DB4 A;  1D3B B;  3QWX X;  1RLP C;  2EJG A;  2JMC A;  4JLI A;  1I5L A;  2EIF A;  1ZX6 A;  4GLK A;  3QG1 A;  4KGV B;  2FG0 A;  1E6G A;  2K2M A;  4M75 E;  3H41 A;  4C8Q D;  4C92 B;  2ED1 A;  1NM7 A;  2P0Q A;  3QZ9 B;  4J9B A;  3A8L B;  4FYV B;  4J9C A;  1GXI E;  4J6Y A;  2B8A A;  2XIC A;  2E6Z A;  4M75 D;  2K57 A;  1OPK A;  1ZSG A;  1M8M A;  2GTO A;  5CKH A;  3OA6 A;  4AT1 B;  1VQP T;  1M3B A;  2FPD A;  3VV0 A;  1IHV A;  2MYS A;  2LJ3 A;  3H9N A;  4F7U G;  2HEQ A;  3RNJ A;  3LGF A;  4MDW A;  4PL6 A;  1Y71 A;  4A4K A;  4PJO C;  2RQV A;  4R56 A;  4RTY A;  4M7D B;  2MCN A;  5GAM h;  4C92 F;  1WYX A;  3O8V A;  2VUB A;  2DNU A;  1B34 A;  1Q86 U;  1M1K C;  1W1F A;  2LMJ A;  1SHG A;  2V1Q A;  1WZO A;  1ZUK A;  4RCB A;  2JOY A;  1ZQ1 A;  2LCL A;  4RTT A;  3X28 B;  4DOW A;  1RUW A;  5LJ5 h;  2DL3 A;  1NEB A;  3EGD B;  1JBM A;  3CCM A;  2L3S A;  1VYT A;  3QDF A;  2ROT A;  3PTA A;  3VS5 A;  3G71 T;  1BI2 A;  1GFC A;  3C4S A;  3BDU A;  1K9A A;  1U1S A;  1MMG A;  1M8V A;  1UEB A;  2IVW A;  2JJ9 A;  4OMQ A;  3LGL A;  3KFV A;  1AEY A;  4NS5 A;  1RAA B;  2PVO B;  2HQH A;  4AG1 C;  2H3J A;  3EHR A;  4L59 A;  7AT1 B;  2QDY B;  1VQ5 Q;  1BI0 A;  1E7O A;  3MKD A;  3TCJ A;  1TUC A;  2JTM A;  5CKE A;  2DA9 A;  1IGU A;  2KYM A;  3EGU A;  2LDM A;  3CCU Q;  3JCM W;  4LE9 A;  4C8Q G;  2XKO C;  4FW1 A;  4LDV A;  4FL6 A;  2COZ A;  1NJI R;  1D0Z A;  1KC8 R;  3X20 B;  2EYQ A;  1OPL A;  1XOV A;  2FRW A;  4AMC A;  2KRN A;  1I5O B;  2F69 A;  4FYX B;  4MDX A;  2GQI A;  2QK0 A;  3RER A;  1QP2 A;  2QGG A;  3M0U A;  2VWF A;  5FWC A;  2CSQ A;  3CC4 Q;  3A8O B;  2M51 A;  2QAS A;  1MUZ A;  1D1C A;  1U06 A;  1UTI A;  4IUU A;  2WSC E;  3RES A;  3DLL A;  2BKD N;  1X2K A;  1M27 C;  3M5A A;  2PVG B;  1TU0 B;  1H3Z A;  2D0Q B;  2R58 A;  3QUI A;  1UJY A;  4MML A;  3R6O A;  4Q5W A;  4CI0 C;  1SRM A;  3CCV T;  4X1V A;  5I11 A;  2LCC A;  3I56 T;  3X25 B;  4MZP A;  2QEX T;  1OZ3 A;  2L8D A;  1QCF A;  3JCM c;  4R55 A;  1A0N B;  3I56 A;  3EG9 A;  2K6D A;  1YNZ A;  1G83 A;  3UWN A;  1TWB A;  2ZAE A;  5IT9 E;  3OMG A;  1M1F A;  1PRL C;  1S72 A;  4PJO D;  1U3O A;  2DKG A;  4ZNX A;  1NPP A;  1D1B A;  5CKB A;  4BUG A;  1P92 A;  3RMS A;  2HKN A;  4HA8 A;  4OB3 B;  3VRZ A;  4KGX B;  5GAO q;  4OB0 B;  3R6N A;  5FRM A;  4JZ3 A;  5FW9 A;  1V29 B;  2BIV A;  4XTX A;  1O9S A;  3PMI A;  3D7S B;  3SWN C;  2HMA A;  1YI2 T;  2GCX A;  1VQ5 A;  3JB9 G;  5GAN j;  3CC7 A;  5I21 A;  3GNF B;  1VQO A;  3P8D A;  3CCU A;  2DMO A;  4E7I A;  3OYY A;  5L23 A;  1T0H A;  2R57 A;  2XHC A;  4J9G A;  4EPC A;  3E1S A;  4OMM A;  2E1H A;  2MI6 A;  2DEU A;  5IXB A;  2C0I A;  2CP3 A;  2EYZ A;  4E47 A;  2RHX A;  2DER A;  3JCM f;  4C5H A;  2HZY A;  3M54 A;  5LJ3 j;  1NE8 A;  2QA4 T;  3A1P A;  3ULR B;  3G71 Q;  4N0A C;  4F7U F;  3JCM Q;  5CO7 A;  4J9F A;  3OYC A;  3CC4 A;  2JT4 A;  1JEG A;  1B3Q A;  2HBW A;  2JZ2 A;  1N9R A;  1K9M R;  3VYH B;  1M90 C;  3CPW A;  2KT1 A;  3GF5 A;  2AZS A;  1VQ6 Q;  2YRV A;  4HCC A;  2AKL A;  2FL7 A;  1VQ9 T;  5GAN g;  3CCV A;  3ASK A;  1SHF A;  2DET A;  4QVD A;  2RHY A;  1IRX A;  4FSS A;  1SG5 A;  3ME9 A;  4OMO A;  3OW2 A;  3OYD A;  3E9G A;  1PWT A;  4PJL A;  5KCH A;  2RQU A;  3CC2 T;  2C06 A;  1GFD A;  4X9C A;  4OF1 A;  5J3B A;  2KXC A;  3JSC A;  1FWZ A;  3QWY A;  1VQK A;  5A0L A;  2EWN A;  5FU6 C;  5GAN h;  3NMZ C;  3OB9 A;  1U1T A;  3HRS A;  4M78 E;  4M75 F;  2A7Y A;  4EMK B;  1RL2 A;  3A8M B;  2E12 A;  1YHQ A;  2GFA A;  1YIJ Q;  1HXD A;  4JUV A;  1KD1 R;  1Q95 G;  2CKK A;  4M7A E;  3QPH A;  2G6F X;  1JJ2 P;  3C12 A;  3DB3 A;  5D6Y A;  3CXC P;  4XK8 E;  4M4Z A;  4Z8A A;  2DZ9 A;  4XTU A;  3CCE Q;  1ZSZ A;  4QQD A;  5GAM j;  4E6R A;  2D9T A;  4II1 A;  3VS2 A;  4DOV A;  3QZ5 B;  3VS0 A;  4XAX B;  3NPF A;  2QA4 Q;  4M75 B;  3SD4 A;  1G5V A;  5IHI A;  4M77 F;  4OP0 A;  4RMO A;  1VA7 A;  1PNJ A;  4B9W A;  3LW5 E;  2A28 A;  1WFW A;  3M0Q A;  5IXF A;  2JW4 A;  2EQK A;  2V26 A;  3G4S T;  3KBG A;  2L3Q A;  5HK0 A;  4J9D A;  4ZTJ A;  1M1G A;  2DF6 A;  4BD3 A;  3PIO A;  4JZ4 A;  2BE7 D;  1KHC A;  2RPN A;  1MGQ A;  2DO3 A;  5A2Q E;  1R0B G;  3NGP A;  2VKN A;  3PVL A;  1WJQ A;  4C5I A;  3OYJ A;  1H8K A;  5LJ3 f;  4C8Q C;  4RG8 A;  1GBR A;  2K4Y A;  2LT1 A;  2C0O A;  3I5R A;  2PQW A;  2V8K A;  4OMF B;  2YSQ A;  2ZPB B;  3HTR A;  4QVZ A;  2EW3 A;  4QVC A;  3OBW A;  2E65 A;  1VQ7 A;  4B9X A;  1AWO A;  5IHN A;  1XNI A;  1AZG B;  2C0T A;  2J05 A;  3M0P A;  2JNG A;  4A63 B;  3REA B;  2QEX Q;  2RD1 A;  3FIF A;  3J80 E;  1K73 U;  3FRN A;  2F5T X;  2MWP A;  3EGD A;  3M4Y A;  3PIP A;  5GAO n;  2ZZD A;  3HFN A;  3EH2 A;  3UT1 A;  1W4S A;  2ZPG B;  3CMA A;  3A8H B;  1JXM A;  3OS1 A;  1XJW B;  1VQ9 Q;  1QVF P;  2LZ6 B;  2MAM A;  2HKQ B;  4EMK A;  4E7J A;  3CCE A;  4OB2 B;  2CUD A;  5LJ5 j;  4A4F A;  4OMP A;  3X26 B;  2KQW A;  4ZN3 A;  4ORZ A;  1UGP B;  4C92 C;  3CME Q;  2O88 A;  2GGR A;  1NJI C;  3A5Z B;  2MWO A;  2EQU A;  5FRO A;  1PG5 B;  1WQW A;  4PJO F;  2X35 A;  3OYK A;  5FWB A;  3LWH A;  4N4G A;  4J83 A;  2E64 A;  2CYZ B;  1T3L A;  2QDL A;  2COW A;  1IZ6 A;  2RK2 A;  4BAC A;  2EGE A;  4AG2 C;  3EG2 A;  4ATO A;  1H64 1;  2CZ6 B;  2LT4 A;  2NUZ A;  1XTD A;  2OTL A;  1Q82 R;  2BTT A;  4C0G A;  2OTL T;  3JCM d;  1RAE B;  4KH0 B;  3AT1 B;  1ZA1 B;  4PJM A;  3V8J A;  2LX7 A;  2K3B A;  3EH1 A;  1X69 A;  1YJW A;  3L42 A;  2DTH A;  5GJV B;  3OY9 A;  1Q7Y C;  2RHU A;  2LQN A;  5GAN 4;  4DA4 A;  1DJ7 B;  3X24 B;  1QKX A;  2FEI A;  4A4E A;  5HK3 A;  4F7U B;  1D1A A;  5J39 A;  3I5S A;  3ZFJ A;  4XTV A;  4DBQ A;  4VUB A;  1PSE A;  5KYX B;  2NUT A;  3CCE T;  2M16 A;  1KQS P;  2DVJ A;  2FVU A;  4FM4 B;  4KRT A;  1YCY A;  3REB B;  2K9G A;  1C1A A;  1VQ7 Q;  3MP1 A;  1GRI A;  1HYO A;  4L6V 5;  1YIJ T;  3OSV A;  2DJZ A;  4J7F A;  1EIF A;  2A0F B;  2O01 E;  4WCI A;  4JRP A;  4LD6 A;  1KQS S;  3HRU A;  2RHI A;  1RI0 A;  2JN0 A;  1T0J A;  3WVE B;  5LJ5 d;  3UA7 A;  4LUE A;  4M77 G;  3UPU A;  1EFN A;  2YRC A;  2MPX C;  1KJW A;  2NLU A;  3UA6 A;  1IHW A;  1VQ9 A;  2YDL A;  3OYL A;  2PUO B;  4M7D C;  2D8H A;  2MIO A;  3CC2 Q;  2QXF A;  1KQ1 A;  8AT1 B;  2ABL A;  2HL3 A;  3OW2 S;  1YFN A;  1WJR A;  1Q7Y U;  4EMH A;  3CME A;  2DYI A;  3M58 A;  1V1C A;  1QKW A;  2EJF A;  3CC4 T;  4C8Q B;  3EHQ A;  5HKC A;  5C0M A;  1VQ7 T;  1NBE B;  1J3T A;  2DX1 A;  3MET A;  3RKW A;  1RAC B;  1FMV A;  5DM7 R;  4C92 D;  3BDL A;  2OJ2 A;  1N8R C;  4RTV A;  2RJC A;  2KXD A;  3GPL A;  2EQM A;  3EGX A;  2KYB A;  4NL3 A;  3L2Q A;  3L2R A;  1WHK A;  2KMT A;  1BIB A;  1KHI A;  2ZGW A;  3EG9 B;  2J6F A;  3CPF A;  1X6B A;  2RO0 A;  4PK4 A;  4DBF A;  8ATC B;  4L5G A;  4HCZ A;  1Y57 A;  3MP6 A;  2EJ9 A;  1QW1 A;  2DRK A;  4JPB W;  2JS0 A;  2SRC A;  3FJ5 A;  4PLI A;  1AHJ B;  3EG0 A;  2LCS A;  2VV5 A;  1NYF A;  4DQ2 A;  1KC8 U;  1C0M A;  2AZV A;  4KH1 B;  2L3P A;  1YI2 Q;  3QYH B;  2FO0 A;  2CRE A;  4J6X A;  1NYG A;  5KYX A;  3E9F A;  1SRL A;  1W2B S;  1K0X A;  2DL4 A;  2YWW A;  2YUP A;  3JAM E;  2CS7 A;  1ZSZ C;  1CKB A;  3OYN A;  4M78 F;  3L2V A;  1PRM C;  1RAD B;  5LJ3 e;  1YJN Q;  2KSS A;  2D6F A;  2YUQ A;  3QJY A;  1VQN T;  3M59 A;  3CME T;  2W10 A;  2EKH A;  2X3X D;  3UDC A;  1BI1 A;  1I1J A;  4RCC A;  1VQK T;  4V2S A;  3J7A F;  1UG1 A;  2LJ1 A;  3HPW A;  4BDY A;  1HJD A;  1KFZ A;  2FRY A;  1VOM A;  4N4H A;  4ZTF A;  2F2W A;  4C0F A;  4J7I A;  3A98 A;  5GAO l;  4ELZ C;  2HAX A;  1HSQ A;  2EQI A;  2KEA A;  1E6H A;  1M1K R;  3M0T A;  1YCS B;  3ZBD A;  2LQK A;  5GAN 5;  2ENM A;  1TOV A;  2JTE A;  2CGH A;  2EFI A;  4A4H A;  1I81 A;  2KRO A;  1ZSZ B;  1K1Z A;  2YXY A;  4F7U E;  5FLX E;  4K11 A;  1Y96 A;  2LTO A;  1OZ2 A;  2J6O A;  4C92 A;  2ESW A;  2ZPF B;  5GAM g;  1JRI A;  2ZCF B;  3INZ A;  4BE0 A;  1UHF A;  3MEA A;  1Q82 U;  1K0S A;  2MMP A;  4PJO A;  4J9I A;  1QVF A;  2LP5 A;  1YIT T;  3M55 A;  3QBY A;  2FPE A;  1U5S A;  3GNG A;  3CCL A;  4QQ6 A;  2VXF A;  3FC3 A;  3OS5 A;  4GLM A;  3M0S A;  4M77 E;  1G3T A;  3VS6 A;  5GMK j;  4C0D C;  3JCM b;  3JRZ A;  2RI2 A;  2VXE A;  1WJS A;  3RDV A;  1YI2 A;  2RI3 A;  4QKU A;  4E2F B;  2QTV A;  4NL2 A;  3PFS A;  3SWN A;  4HVV A;  4CRI A;  4RTW A;  3PE0 A;  2OAU A;  2KY9 A;  1VQM A;  1YIT Q;  2E5Q A;  2HNI A;  1UGQ B;  5CR2 A;  1YJN A;  2LQW A;  1M90 U;  5AT1 B;  2BZY A;  4E7L A;  2P4T A;  1TS9 A;  2CZ1 B;  2QAZ A;  1BBZ A;  2DM1 A;  4C8Q A;  4F17 A;  3GLX A;  5EC7 A;  1N9S A;  2E4H A;  4HKE A;  2HD0 A;  2AT1 B;  2CP0 A;  3NFC A;  1FMW A;  3CCM T;  2QTX A;  1Y96 B;  2Z0W A;  4M78 D;  1WX6 A;  5GMK m;  3BW1 A;  1H3H A;  2K3X A;  4J9H A;  2DZC A;  1UGV A;  4HXJ A;  1BIA A;  4HCK A;  1RI9 A;  3JB9 I;  3JCM e;  4CC2 A;  5D6X A;  1NLO C;  4PJJ A;  1VYV A;  2PNI A;  1PKS A;  4M7A A;  3CCV Q;  2K7A A;  2DTI A;  1KC8 C;  1B07 A;  3QJ6 A;  3OYH A;  3MEV A;  2RQR A;  2DRM A;  1M9S A;  2HCK A;  5CKF A;  2DFU A;  2DXC A;  4AFU C;  2M9U A;  5IH2 A;  5FU6 B;  4LN2 A;  1VQK Q;  3H0I A;  2D8J A;  5KYN A;  3PMT A;  3JB9 J;  1G3Y A;  2RQT A;  3DLM A;  1BB9 A;  5LJ3 g;  3MO8 A;  3OS2 A;  2RJE A;  3LLR A;  1G8X A;  3CCL Q;  1OYX A;  2ATC B;  2FZK B;  3QSU A;  2YRD A;  3MCA B;  3EG3 A;  1AZE A;  1WPY A;  2R5A A;  2YLC A;  5EG2 A;  5IN1 A;  3OYM A;  3HL8 A;  2XD0 A;  1TSF A;  2J7I A;  2XG8 D;  4N4I A;  1YN8 A;  1ARK A;  4IKF A;  1PM3 A;  2XID A;  4RG2 A;  3J81 E;  4O6J A;  2CUB A;  2A36 A;  1AT1 B;  4LD9 K;  4M77 A;  5KYW A;  3VKI A;  3GP8 A;  1FXX A;  2I2L A;  4UC4 A;  2SEM A;  1ZBJ A;  1VQM Q;  1T3S A;  1YIT A;  3EGX B;  2QA4 A;  1Q86 C;  4JLG A;  4JS5 A;  1RAF B;  2OTJ A;  2PVD B;  4JS4 A;  2K5L A;  2ZPI B;  2EGA A;  1QMC A;  1PHT A;  3VS3 A;  2VB6 A;  1UEC A;  1JXO A;  3QHS A;  2PTK A;  1Z9Q A;  1VQO T;  3CC7 T;  1YP5 A;  1QWE A;  1R77 A;  1F1B B;  3PGG A;  2GF7 A;  1OX9 A;  1D0X A;  1NZ9 A;  1ZUU A;  1BCM A;  2RF0 A;  2K5I A;  1PC0 A;  5CVI A;  1VQP A;  2DPP B;  2BUD A;  4FYW B;  4DBH A;  5IAY A;  1QLY A;  1G3S A;  1AD5 A;  2RMO A;  1IXD A;  1MV0 B;  2M02 A;  1I4K 1;  3I35 A;  3M57 A;  2GTJ A;  3UF4 A;  3JCM V;  4J5Y A;  3RKX A;  1WHL A;  4KT0 E;  1YHQ T;  1GL5 A;  4D8K A;  2H8H A;  3JV3 A;  5KE2 A;  2KRM A;  1FYN A;  4XQ3 A;  1MHN A;  2L3R A;  3KXT A;  1G3W A;  1N27 A;  3O5Z A;  3OBY A;  3OYI A;  2DTO A;  1AOJ A;  2RI5 A;  1WNL A;  4RTU A;  2RM4 A;  1M90 R;  1K9M C;  4BDZ A;  4M77 C;  1M4Z A;  1VQ6 T;  1ABO A;  3HKS A;  2LNV A;  1UB4 A;  1YWO A;  3CCS T;  2AKK A;  3FJP A;  1QQJ A;  2CDT A;  3EFO B;  2E3I A;  2D1X A;  3JCM g;  3P8B B;  2DD5 A;  3FB9 A;  5KYY B;  1Z9Z A;  4JRQ A;  2NWM A;  2FZC B;  3NTI A;  2LC4 A;  3SHW A;  2QGF B;  2QYZ A;  4XTW A;  4C0D B;  3M9Q A;  5KH6 A;  2EYY A;  2HBP A;  5D6W A;  5GMK l;  1VQ4 Q;  1I8F A;  1FMK A;  2HSP A;  1K8A U;  3CCU T;  4BE2 A;  3EG1 A;  2FHD A;  5KCO A;  1M5Q 1;  1SSH A;  4PJO G;  2QG9 B;  4HVW A;  2YHT A;  4MZM A;  3CCR Q;  2JXB A;  2EVR A;  4EDU A;  1G2B A;  3C95 A;  4M75 C;  1OV3 A;  5FRN A;  2OTL Q;  3GIB A;  1OU8 A;  1M2V A;  3KUF A;  1WXU A;  2KT8 A;  1X2Q A;  1YJW T;  4FU6 A;  2XI9 A;  1C6V X;  2EAY A;  2AK5 A;  4C92 G;  2CT3 A;  1UFF A;  3BFM A;  5GAM f;  1IRE B;  2NUT B;  2LX9 A;  1R8O B;  2DL8 A;  3H6Z A;  5M9O A;  4AFS C;  1PD1 A;  3A8G B;  5IHK A;  3QKJ A;  5CKD A;  3H0H A;  1WGS A;  1EZZ B;  2XU8 A;  3PVQ A;  2MK5 A;  1W70 A;  1TTH B;  1BCO A;  1WI7 A;  1U8R A;  1VQ8 Q;  4FIB A;  3VYG A;  1X75 C;  3HRT A;  4BI8 B;  3URG A;  1QVG S;  4FCY A;  4JRI A;  1OU9 A;  2RJD A;  2RA2 A;  2A37 A;  4AFQ C;  1VIE A;  4IIM A;  3CXC S;  2JS2 A;  3T9N A;  4ELY C;  1CSK A;  4M7D E;  2KNB B;  4M7D F;  2F1L A;  1Q82 C;  5KYY A;  4IUV A;  1BI3 A;  1QVG P;  3FLG A;  3VJP A;  3S6W A;  3CPW P;  1X6O A;  4GY5 A;  3V8K A;  3TSW A;  3OYA A;  2VC8 A;  1GCQ A;  1Q86 R;  3LH0 A;  3TQ7 P;  2E3H A;  4OGC A;  1MNE A;  2Y4Y A;  2DJQ A;  4RTZ A;  2YLB A;  3CCJ Q;  4FW2 A;  1K73 R;  3QXE B;  2B86 A;  1QVG A;  1WA7 A;  4A54 A;  3CC2 A;  4PFO A;  2F5K A;  2KR3 A;  1EX4 A;  4LDU A;  1WIE A;  2QQS A;  1VQ4 A;  1IO6 A;  2OTJ T;  1K76 A;  4M78 B;  3BY7 A;  3IQL A;  4FT4 A;  4EMG A;  3SDZ A;  2LVM A;  5KYU A;  4BY6 B;  4Z88 A;  1NPR A;  2WSF E;  5J26 A;  1GCQ C;  5GAN f;  1RAH B;  4HVU A;  2X4X A;  5CIU A;  2DD4 A;  1B34 B;  3JCM X;  3G4S Q;  1YJ9 A;  1M30 A;  3TU4 K;  2HQX A;  2Y4X A;  2K5F A;  3HHT B;  3I55 Q;  1YJ9 T;  2K2V A;  1OI1 A;  3H0F A;  1IB8 A;  3M53 A;  1AWX A;  3CD6 T;  4QW2 A;  3TRE A;  2DXT A;  4KBM B;  5GAN 6;  3M56 A;  3CD6 A;  1KG1 A;  2LNH B;  3FDR A;  2LJ0 A;  1NLP C;  2O31 A;  2DAQ A;  2VGN A;  4PFP A;  4X34 A;  4J9E A;  3EFR A;  2X4J A;  1JO8 A;  4EIK A;  1BK2 A;  1WQ7 A;  2GBQ A;  2HQE A;  1W2B P;  9ATC B;  1BKB A;  3JB9 D;  4PJO E;  1B7T A;  4E7H A;  1OOT A;  2V8I A;  4LDW A;  3ZL7 C;  4M7D D;  4N0A A;  4M7A G;  1RLQ C;  4A53 A;  2D0N A;  2CH4 A;  5I2M A;  1M1K U;  4HT9 A;  5LJ5 e;  4M7A F;  5LJ3 h;  3PT9 A;  4C92 E;  5FU7 B;  4FT2 A;  2ECZ A;  3L1A A;  4BI3 A;  4AFZ C;  2PZ1 A;  1N8R U;  3LWI A;  3RMQ A;  4JJN K;  3QII A;  4Y91 A;  2M0Y A;  3V7R A;  1XQH A;  1X43 A;  2F2X A;  4KUD K;  2Y90 A;  3CMA T;  3U23 A;  4LXC A;  2R5M A;  3M4G A;  3GOX A;  3MJX A;  3LX7 A;  3QYG B;  3CXC A;  2CSI A;  4JJB A;  4QQG A;  5I22 A;  4BB7 A;  1Y07 A;  2DK3 A;  2VYT A;  4F16 A;  2BZ8 A;  3AHU A;  2X4Y A;  2IPO B;  3TSZ A;  4F14 A;  1MMA A;  2X9H A;  5ECA A;  4DEX A;  2LRQ A;  3VS7 A;  1PD0 A;  3CCM Q;  1VQL T;  2EQJ A;  1WXT A;  1TH7 A;  4ANJ A;  2X51 A;  4OB1 B;  1TXQ A;  2RHZ A;  3G6E T;  2PUK B;  2LQ8 A;  4LUD A;  4J8O A;  2H3E B;  3OYE A;  1UUE A;  2AIR B;  4OVA A;  1BU1 A;  1RAG B;  2RQW A;  1VQN A;  1K8A R;  1SSF A;  4PNO A;  3TVT A;  2EKO A;  3CD6 Q;  1D3B A;  3WVD B;  4HT8 A;  1R0C B;  2JM9 A;  2XDP A;  3JCM h;  2NUP A;  2QQR A;  4BE1 A;  5GAM d;  1AVZ C;  3I55 T;  1X6G A;  6AT1 B;  1D0Y A;  1PKT A;  2CZ7 B;  3SWN B;  1OX8 A;  3G7Z A;  2FYK A;  1SF9 A;  2RH2 A;  2JVV A;  3OS0 A;  5GMK i;  2JMA A;  3V7C A;  5LJ5 f;  4Y28 E;  3JB9 H;  1IGQ A;  1WHH A;  5GAM e;  2QI2 A;  2RN8 A;  1I07 A;  4M75 G;  1UHC A;  1WXB A;  3CBP A;  2MOX A;  2F2V A;  3G6E Q;  1K73 C;  3HP9 A;  4Z02 A;  1VUB A;  3ER0 A;  4JJC A;  3OYF A;  4PJO B;  3LH5 A;  4RUG A;  1SPK A;  1GBQ A;  2EYX A;  4ZGE B;  2KK4 A;  4O5V A;  5GMK e;  2L0A A;  3CCJ T;  3L2Z A;  2DVE A;  3GBQ A;  4M7D A;  3PNW C;  4M78 A;  2V8J A;  4C5E A;  3M0R A;  1ACM B;  1ZBX A;  3CCQ T;  2ROL A;  2DL5 A;  1PSF A;  1WHM A;  4MZT A;  3HSB A;  5GMK h;  1BYM A;  2MF2 A;  3SEM A;  1K9M U;  3I56 Q;  2RJF A;  1S72 T;  4IUQ A;  2WSE E;  4NOY A;  2DIG A;  1KD1 U;  3RKY A;  2KGT A;  2VAS A;  4MMK A;  1M3C A;  2P0K A;  3CBM A;  1NJI U;  3UAT A;  1S72 Q;  2JM8 A;  1Q81 C;  1OEB A;  4C5G A;  1NEG A;  2DXU A;  1H92 A;  2QQB A;  5GAN e;  1PCX A;  2CP2 A;  1VQ8 T;  4M7A B;  1JU5 C;  2W0Z A;  1LJO A;  3C0C A;  4BI4 A;  4OGE A;  5GAN d;  3P8H A;  1QP3 A;  3EFS A;  5HCK A;  3RBB B;  3CCQ A;  2I0N A;  5GAN 7;  4KUI A;  1VQN Q;  3TEE A;  1YJN T;  2J6K A;  3LYI A;  4IIO A;  3HFO A;  4TVR A;  2CH4 W;  3CQT A;  1VQO Q;  3CC7 Q;  3MEW A;  2DIQ A;  1QCN A;  5LJ3 d;  1JJ2 A;  1S1N A;  3SFM A;  3L2U A;  3N5B B;  4GBQ A;  1VQ5 T;  3OMC A;  3NTK A;  4A4G A;  1Y7X A;  4XTZ A;  2RK1 A;  3E2U A;  2M0O A;  5CK9 A;  2V1R A;  4XU3 A;  2DBK A;  3H8Z A;  3G71 A;  2KAF A;  2DE0 X;  2E5K A;  1VYU A;  1LVK A;  2DXB A;  4LNP A;  3VUZ A;  3E19 A;  5LL6 S;  2XMF A;  4M7A C;  3G6E A;  1NG2 A;  1MND A;  5GAN 8;  1YBY A;  1MMN A;  4M78 G;  2E10 A;  1LCK A;  2OI3 A;  1KK7 A;  1VQ6 A;  2JUF A;  4C0Z A;  4DBR A;  1X01 A;  3VU3 C;  1KD1 C;  1LNX A;  1WDX A;  4PFZ A;  1ZHI A;  4QT7 A;  2KVQ G;  2GNC A;  3VS4 A;  4BY6 C;  2RNA A;  3OQ5 A;  4D8D A;  2OTJ Q;  3MPU B;  2HSE B;  2EPD A;  4DEY A;  3RUX A;  3EAE A;  2CP5 A;  3V7S A;  1O75 A;  4IUP A;  2O9V A;  1FX7 A;  5GAO r;  1AWJ A;  2L2P A;  1UGS B;  3NTH A;  1UJ0 A;  3JB9 F;  2L5Q A;  2XK0 A;  1VQL A;  3WXM B;  2XDD A;  4ZGJ B;  2KI7 A;  4XU0 A;  5KYW B;  3CCS A;  3JCM P;  1VQP Q;  2DYB A;  1JQQ A;  1K4U S;  5DLO A;  2QQA A;  4Z89 A;  4PLL A;  1ABQ A;  4FSX A;  3BE3 A;  1YHQ Q;  4M7A D;  4ESR A;  2NYS A;  2HDA A;  2DBM A;  1YIJ A;  2ED0 A;  3S3N A;  3RIR A;  2L89 A;  1Q7Y R;  1M3A A;  1JB0 E;  4LDX A;  2X4W A;  4X9D A;  1TUD A;  3CCQ Q;  2EGC A;  5KYU B;  5HY6 A;  2IG0 A;  3S3O A;  3OYG A;  3EFO A;  1MV3 A;  4ME7 A;  1Q81 U;  3NHN A;  2ZPH B;  1JJ2 S;  4WF2 A;  1KIK A;  5GAO p;  3CEY A;  1MMD A;  4IUR A;  2WAC A;  2DL7 A;  2BE9 B;  2O4X B;  2K79 A;  4M77 D;  2CP7 A;  1LOJ A;  4R0K A;  2DIL A;  4D6W A;  2GQV A;  2M1H A;  3THK A;  2AHJ B;  1QWF A;  4E7S A;  2CT4 A;  3V8L A;  5I2S A;  4KGZ B;  1KQ2 A;  1TG0 A;  2O2O A;  1WHJ A;  5L8R E;  1VQM T;  1M2V B;  2EYW A;  1TUG B;  1ZUY A;  3OSS C;  3OYB A;  1GCP A;  1YWP A;  2G3R A;  1OQK A;  4CC3 A;  2ZPE B;  4M7D G;  5LJ5 g;  2QQ9 A;  4XU2 A;  4ZGD B;  3C94 A;  1Q81 R;  5DY9 A;  4KUL A;  1AWW A;  3CCR A;  1UDL A;  1HK9 A;  2A3L A;  3DKM A;  1LPL A;  2CZ0 B;  4C8Q F;  1RAI B;  2VVK A;  2FB7 A;  3OW2 P;  1K8A C;  1CKA A;  4FYY B;  1Y0M A;  3CBO A;  3ZEH A;  4M77 B;  1VQL Q;  3L2W A;  1N8R R;  3RR6 A;  4ZN1 A;  4JDS A;  3CCS Q;  2JTF A;  2OAW A;  1W2B A;  4WTO B;  2RB6 A;  2QEX A;  3QDR B;  2YUO A;  3FEO A;  2A08 A;  4LDY A;  5D7U A;  2X3W D;  4RTX A; 
#chains in the Genus database with same CATH homology
 4JUV A;  5GAO m;  4E7K A;  3EFR A;  2X4J A;  2GFU A;  2CKK A;  4M7A E;  3QPH A;  3SB2 A;  5C6S A;  3C12 A;  3DB3 A;  4JRK A;  5D6Y A;  4M77 E;  4XK8 E;  1G3T A;  4J6W A;  3JCM J;  1WQ7 A;  5GMK j;  4C0D C;  5CQY A;  2K3Y A;  3JRZ A;  2RI2 A;  2VXE A;  3JCM b;  1WJS A;  2HQE A;  2DZ9 A;  1YI2 A;  1BKB A;  3JB9 D;  4PJO E;  2RI3 A;  5FU7 C;  4XTU A;  4E7H A;  2V8I A;  4QQD A;  4NL2 A;  4LDW A;  5GAM j;  4M7D D;  3PFS A;  4C8Q E;  3S3M A;  3SWN A;  4CRI A;  4N0A A;  4M75 A;  4M7A G;  2D9T A;  4II1 A;  2E41 A;  4A53 A;  2OAU A;  2P0P A;  2KY9 A;  1VQM A;  4DOV A;  3QZ5 B;  5I2M A;  4IUT A;  3MHX A;  1VQ8 A;  2E5Q A;  4XAX B;  1M1K U;  4HT9 A;  2HNI A;  5GAN 2;  1UGQ B;  5CR2 A;  1YJN A;  5LJ5 e;  4M7A F;  5LJ3 h;  4M75 B;  3QO3 A;  3PT9 A;  3SD4 A;  1M90 U;  4C92 E;  4M77 F;  1G5V A;  4OP0 A;  4M78 C;  5FU7 B;  4RMO A;  4E7L A;  2P4T A;  4FT2 A;  2DEQ A;  2E6N A;  3L1A A;  3MP8 A;  2CZ1 B;  4BI3 A;  4B9W A;  5CQX A;  4C8Q A;  3LW5 E;  3GLX A;  1N8R U;  3LWI A;  1N9S A;  5CCA A;  3RMQ A;  4JJN K;  3QII A;  4Y91 A;  4HKE A;  3V7R A;  1XQH A;  4KUD K;  2HD0 A;  2Y90 A;  5KE3 A;  2EQK A;  3CMA T;  3NFC A;  3CCJ A;  2R5M A;  3G4S T;  3M4G A;  3GOX A;  3CCM T;  3KBG A;  2QTX A;  4P5N A;  1Y96 B;  3LX7 A;  5HK0 A;  4ZTJ A;  3QYG B;  1VIF A;  1M1G A;  3CXC A;  1QVP A;  4M78 D;  5GMK m;  4QQG A;  3BW1 A;  4BD3 A;  4XTY A;  2O4X A;  4BB7 A;  3PIO A;  2K3X A;  1Y07 A;  2DZC A;  1BIA A;  2DK3 A;  3JB9 I;  2VYT A;  3AHU A;  1KHC A;  2X4Y A;  3Q1J A;  3JCM e;  5A0D A;  1MGQ A;  2DO3 A;  5D6X A;  5A2Q E;  2LRQ A;  4YTL A;  4EMK C;  1UGR B;  1WJQ A;  4C5I A;  1VQL T;  2EQJ A;  3OYJ A;  4M7A A;  3CCR T;  1TH7 A;  2DTI A;  4HCB A;  5A0G A;  5LJ3 f;  5DLQ E;  1KC8 C;  4C8Q C;  4RG8 A;  3QJ6 A;  4PKC C;  3OYH A;  4OB1 B;  3G4S A;  3MEV A;  1KQS A;  2K4Y A;  1M9S A;  3GP8 A;  2E70 A;  2LT1 A;  2RHZ A;  3G6E T;  2PU9 B;  5CKF A;  2PUK B;  2LQ8 A;  2PQW A;  2V8K A;  4J8O A;  2KDS A;  4OMF B;  5GAN 3;  3OYE A;  3I55 A;  1VQ4 T;  4OVA A;  3VUB A;  2DXC A;  1N6A A;  1VQN A;  3MEU A;  2M9U A;  2ZPB B;  5FU6 B;  5CAI A;  4QVZ A;  1SSF A;  4QVC A;  5AYF A;  3OBW A;  2E65 A;  4PNO A;  4B9X A;  4XU1 A;  3CPW S;  1VQ7 A;  4F7U A;  2EKO A;  3PMT A;  1D3B A;  2VGM A;  4RKU E;  1G3Y A;  3WVD B;  3JB9 J;  4HT8 A;  1QVF S;  1XNI A;  3DLM A;  2XDB A;  2XDP A;  2JNG A;  3JCM h;  5LJ3 g;  2QQR A;  3CCL T;  2RD1 A;  4BE1 A;  5GAM d;  3F70 A;  3FIF A;  3MO8 A;  3J80 E;  2RJE A;  3DB4 A;  3LLR A;  3OS2 A;  1D3B B;  1OYX A;  3I55 T;  2CZ7 B;  1K73 U;  3SWN B;  3G7Z A;  2FYK A;  2EJG A;  3FRN A;  4JLI A;  1I5L A;  3QSU A;  2EIF A;  2F5T X;  2MWP A;  3M4Y A;  2RH2 A;  3MCA B;  4GLK A;  3QG1 A;  2JVV A;  3OS0 A;  5GMK i;  3PIP A;  1WPY A;  2R5A A;  2YLC A;  5EG2 A;  5GAO n;  3V7C A;  2ZZD A;  3HFN A;  4M75 E;  5IN1 A;  4Y28 E;  4C8Q D;  5LJ5 f;  3OYM A;  4C92 B;  3JB9 H;  3HL8 A;  3UT1 A;  1W4S A;  2ZPG B;  2XD0 A;  5GAM e;  3CMA A;  2QI2 A;  2P0Q A;  2XG8 D;  3A8H B;  3QZ9 B;  4M75 G;  4N4I A;  3OS1 A;  3A8L B;  2MAM A;  4EMK A;  4IKF A;  4E7J A;  1GXI E;  2XID A;  3CCE A;  4OB2 B;  4RG2 A;  3J81 E;  3CBP A;  4O6J A;  4J6Y A;  5LJ5 j;  4A4F A;  1K73 C;  3X26 B;  2B8A A;  2XIC A;  2KQW A;  3HP9 A;  2E6Z A;  4Z02 A;  4LD9 K;  1VUB A;  3ER0 A;  4M77 A;  3VKI A;  1FXX A;  4M75 D;  2K57 A;  4ZN3 A;  2I2L A;  4UC4 A;  1UGP B;  3OYF A;  4C92 C;  4PJO B;  1NJI C;  3A5Z B;  5CKH A;  3OA6 A;  2MWO A;  2EQU A;  5FRO A;  1YIT A;  1WQW A;  4PJO F;  2X35 A;  3OYK A;  3LWH A;  1VQP T;  4N4G A;  4J83 A;  2E64 A;  2CYZ B;  2QA4 A;  1Q86 C;  4ZGE B;  3VV0 A;  1IZ6 A;  2KK4 A;  4O5V A;  5GMK e;  2RK2 A;  4JLG A;  4BAC A;  3CCJ T;  3L2Z A;  2DVE A;  4ATO A;  4F7U G;  3LGF A;  1H64 1;  4JS5 A;  4M7D A;  2CZ6 B;  4MDW A;  4PL6 A;  3PNW C;  2OTJ A;  4M78 A;  2PVD B;  2V8J A;  2LT4 A;  4C5E A;  1Y71 A;  2K5L A;  4JS4 A;  4A4K A;  1XTD A;  2ZPI B;  1ZBX A;  2OTL A;  3CCQ T;  4PJO C;  1PSF A;  4R56 A;  4MZT A;  3HSB A;  5GMK h;  1BYM A;  2MF2 A;  4M7D B;  5GAM h;  4C0G A;  3QHS A;  4PJO A;  4C92 F;  1K9M U;  3O8V A;  2RJF A;  3JCM d;  1S72 T;  4IUQ A;  2OTL T;  2WSE E;  4NOY A;  2DIG A;  2VUB A;  3RKY A;  1VQO T;  1KD1 U;  1B34 A;  3CC7 T;  1Q86 U;  1M1K C;  3PGG A;  3V8J A;  2GF7 A;  4MMK A;  2P0K A;  1NZ9 A;  4RCB A;  2JOY A;  1ZQ1 A;  2LCL A;  3CBM A;  2K5I A;  1NJI U;  3X28 B;  5CVI A;  1VQP A;  1Q81 C;  1YJW A;  2DPP B;  4DOW A;  2BUD A;  3L42 A;  4C5G A;  5LJ5 h;  2DTH A;  5IAY A;  3OY9 A;  1Q7Y C;  1G3S A;  2DXU A;  2RHU A;  5GAN 4;  2QQB A;  1DJ7 B;  4DA4 A;  3X24 B;  3CCM A;  1JBM A;  5GAN e;  4A4E A;  3PTA A;  5HK3 A;  3G71 T;  4F7U B;  1BI2 A;  1I4K 1;  3C4S A;  5J39 A;  3BDU A;  1VQ8 T;  1U1S A;  3M57 A;  4M7A B;  3ZFJ A;  4XTV A;  1M8V A;  1LJO A;  4VUB A;  1UEB A;  2IVW A;  4BI4 A;  4J5Y A;  1PSE A;  3RKX A;  3JCM V;  3LGL A;  4OGE A;  5GAN d;  3P8H A;  4KT0 E;  4NS5 A;  1YHQ T;  1QP3 A;  3EFS A;  2PVO B;  3CCQ A;  3CCE T;  2H3J A;  2M16 A;  5GAN 7;  4L59 A;  5KE2 A;  4KUI A;  2QDY B;  3TEE A;  1YJN T;  4XQ3 A;  3LYI A;  1BI0 A;  2FVU A;  3TCJ A;  4FM4 B;  1MHN A;  2L3R A;  1YCY A;  3HFO A;  2JTM A;  3KXT A;  4TVR A;  5CKE A;  1G3W A;  1N27 A;  3MP1 A;  3OBY A;  3OYI A;  3MEW A;  2DTO A;  2LDM A;  2RI5 A;  1WNL A;  2DIQ A;  3JCM W;  4L6V 5;  5LJ3 d;  1YIJ T;  3OSV A;  2DJZ A;  2XKO C;  4C8Q G;  4LDV A;  1JJ2 A;  3SFM A;  4FL6 A;  3L2U A;  2RM4 A;  3N5B B;  1EIF A;  4J7F A;  4BDZ A;  1K9M C;  2O01 E;  4M77 C;  1M4Z A;  3X20 B;  2EYQ A;  4JRP A;  1XOV A;  4LD6 A;  1VQ6 T;  1VQ5 T;  3OMC A;  1KQS S;  3HRU A;  3NTK A;  4A4G A;  2RHI A;  1RI0 A;  1Y7X A;  4XTZ A;  3HKS A;  2RK1 A;  2JN0 A;  2LNV A;  2F69 A;  1UB4 A;  3CCS T;  2M0O A;  5CK9 A;  3WVE B;  3FJP A;  5LJ5 d;  4XU3 A;  4MDX A;  4M77 G;  3UPU A;  3H8Z A;  3JCM g;  3G71 A;  2NLU A;  3P8B B;  3RER A;  2KAF A;  1QP2 A;  1VQ9 A;  3OYL A;  2DD5 A;  2PUO B;  3FB9 A;  4M7D C;  2DXB A;  3VUZ A;  3A8O B;  3E19 A;  5LL6 S;  2QXF A;  4JRQ A;  1KQ1 A;  3G6E A;  4M7A C;  3NTI A;  2LC4 A;  5GAN 8;  4IUU A;  3OW2 S;  2WSC E;  4XTW A;  3RES A;  1WJR A;  4C0D B;  3DLL A;  1Q7Y U;  3M9Q A;  5KH6 A;  1YBY A;  5GAN h;  2HBP A;  4EMH A;  3CME A;  5D6W A;  5GMK l;  1I8F A;  3M58 A;  4M78 G;  2E10 A;  2BKD N;  1VQ6 A;  1K8A U;  2EJF A;  2JUF A;  4C0Z A;  3CCU T;  3CC4 T;  3M5A A;  4C8Q B;  1X01 A;  3VU3 C;  1KD1 C;  5HKC A;  1LNX A;  2PVG B;  5C0M A;  4BE2 A;  1VQ7 T;  1H3Z A;  2D0Q B;  2FHD A;  2R58 A;  3QUI A;  5KCO A;  1M5Q 1;  3MET A;  4MML A;  4PJO G;  1ZHI A;  2KVQ G;  3R6O A;  4Q5W A;  4CI0 C;  2YHT A;  3OQ5 A;  4MZM A;  4BY6 C;  3CCV T;  3RKW A;  4EDU A;  3C95 A;  4M75 C;  2LCC A;  5DM7 R;  5FRN A;  4C92 D;  3X25 B;  4MZP A;  3RUX A;  3I56 T;  3EAE A;  3BDL A;  2QEX T;  1OZ3 A;  1N8R C;  3GIB A;  2RJC A;  3KUF A;  2L8D A;  3V7S A;  1O75 A;  4IUP A;  3JCM c;  4R55 A;  1YJW T;  4FU6 A;  3GPL A;  3I56 A;  2XI9 A;  1FX7 A;  2EQM A;  5GAO r;  2EAY A;  1UGS B;  3NTH A;  4NL3 A;  3L2Q A;  3L2R A;  4C92 G;  3JB9 F;  2KMT A;  3UWN A;  1BIB A;  1KHI A;  2ZGW A;  5IT9 E;  2L5Q A;  1M1F A;  2XK0 A;  3OMG A;  3WXM B;  3BFM A;  2XDD A;  5GAM f;  1VQL A;  4ZGJ B;  1IRE B;  4XU0 A;  3CCS A;  2LX9 A;  1R8O B;  3H6Z A;  3JCM P;  5M9O A;  3CPF A;  1S72 A;  4PJO D;  2DKG A;  3A8G B;  1NPP A;  3QKJ A;  5CKD A;  2RO0 A;  5CKB A;  4BUG A;  4L5G A;  1WGS A;  4HCZ A;  5DLO A;  2QQA A;  4PLL A;  3MP6 A;  1P92 A;  4FSX A;  3RMS A;  2EJ9 A;  1QW1 A;  2XU8 A;  4M7A D;  1YIJ A;  4HA8 A;  4OB3 B;  5GAO q;  4PLI A;  4OB0 B;  1AHJ B;  2L89 A;  3RIR A;  3S3N A;  2VV5 A;  4DQ2 A;  1U8R A;  1KC8 U;  4FIB A;  1JB0 E;  4LDX A;  2X4W A;  3VYG A;  1X75 C;  5FRM A;  3HRT A;  4BI8 B;  4X9D A;  3URG A;  1QVG S;  1V29 B;  4JRI A;  2BIV A;  4XTX A;  3QYH B;  1O9S A;  4J6X A;  2RJD A;  3PMI A;  2RA2 A;  3SWN C;  1YI2 T;  3E9F A;  1W2B S;  1VIE A;  5HY6 A;  2IG0 A;  3S3O A;  2GCX A;  3OYG A;  1VQ5 A;  3JB9 G;  3JAM E;  3CXC S;  2CS7 A;  1JJ2 S;  4ME7 A;  3T9N A;  1Q81 U;  2ZPH B;  4ELY C;  3CC7 A;  5I21 A;  3GNF B;  4M78 F;  3OYN A;  3L2V A;  5GAN j;  1VQO A;  4M7D E;  3P8D A;  4M7D F;  4WF2 A;  3CCU A;  1Q82 C;  4IUV A;  4E7I A;  1BI3 A;  3OYY A;  3FLG A;  3VJP A;  5LJ3 e;  2KSS A;  2D6F A;  3QJY A;  2R57 A;  3S6W A;  1VQN T;  2XHC A;  3M59 A;  4EPC A;  3CME T;  1X6O A;  3E1S A;  4GY5 A;  3V8K A;  3CEY A;  5GAO p;  2E1H A;  3UDC A;  2MI6 A;  1BI1 A;  4RCC A;  3OYA A;  2VC8 A;  4IUR A;  1VQK T;  2WAC A;  4E47 A;  2O4X B;  4V2S A;  2RHX A;  4M77 D;  3J7A F;  3HPW A;  3JCM f;  4C5H A;  3M54 A;  1LOJ A;  5LJ3 j;  3LH0 A;  4BDY A;  1NE8 A;  2QA4 T;  4N4H A;  4ZTF A;  4OGC A;  2Y4Y A;  4D6W A;  4C0F A;  2GQV A;  2M1H A;  4J7I A;  5GAO l;  2YLB A;  4N0A C;  4ELZ C;  4F7U F;  2AHJ B;  2HAX A;  3JCM Q;  3QXE B;  1QVG A;  3V8L A;  5I2S A;  5CO7 A;  1KQ2 A;  3CC4 A;  3OYC A;  4A54 A;  3CC2 A;  2F5K A;  5L8R E;  1VQM T;  4LDU A;  2JZ2 A;  2QQS A;  3ZBD A;  1N9R A;  2LQK A;  3OSS C;  5GAN 5;  1VQ4 A;  2OTJ T;  1M90 C;  3VYH B;  3OYB A;  3CPW A;  2G3R A;  4M7D G;  3GF5 A;  2ZPE B;  4M78 B;  3BY7 A;  2YRV A;  4FT4 A;  2QQ9 A;  4EMG A;  5LJ5 g;  4XU2 A;  4HCC A;  3SDZ A;  2LVM A;  2CGH A;  4ZGD B;  3C94 A;  4BY6 B;  5DY9 A;  2EFI A;  4A4H A;  1NPR A;  2FL7 A;  2WSF E;  5J26 A;  1I81 A;  1VQ9 T;  5GAN g;  4KUL A;  3CCV A;  3ASK A;  5GAN f;  4F7U E;  3CCR A;  5FLX E;  4QVD A;  1Y96 A;  2LTO A;  2RHY A;  1OZ2 A;  1HK9 A;  2A3L A;  2X4X A;  5CIU A;  3ME9 A;  3DKM A;  2DD4 A;  4C92 A;  1B34 B;  3JCM X;  3OW2 A;  1YJ9 A;  2CZ0 B;  3OYD A;  2ZPF B;  3E9G A;  5GAM g;  4C8Q F;  3TU4 K;  2HQX A;  2Y4X A;  1JRI A;  2K5F A;  2ZCF B;  3HHT B;  5KCH A;  3CC2 T;  2C06 A;  3INZ A;  1YJ9 T;  2K2V A;  1OI1 A;  2FB7 A;  4X9C A;  4OF1 A;  4BE0 A;  1K8A C;  3M53 A;  3MEA A;  5J3B A;  3JSC A;  1FWZ A;  3CBO A;  1VQK A;  3ZEH A;  5A0L A;  4M77 B;  3CD6 T;  1Q82 U;  2EWN A;  2MMP A;  3L2W A;  4QW2 A;  5FU6 C;  3TRE A;  4ZN1 A;  2DXT A;  3OB9 A;  2JTF A;  4JDS A;  3M56 A;  4KBM B;  5GAN 6;  1U1T A;  3HRS A;  4M78 E;  1W2B A;  1QVF A;  3CD6 A;  4M75 F;  1KG1 A;  1YIT T;  3M55 A;  2RB6 A;  2A7Y A;  4EMK B;  3FDR A;  2QEX A;  3QDR B;  1RL2 A;  3A8M B;  3FEO A;  3QBY A;  2DAQ A;  2E12 A;  3GNG A;  4LDY A;  3CCL A;  4QQ6 A;  1YHQ A;  2GFA A;  2VGN A;  2VXF A;  3FC3 A;  4X34 A;  1HXD A;  3OS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...