5CKHA

E. coli mazf e24a form iib
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
103
Chain Sequence
VSRYVPDMGDLIWVDFQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
molecule keywords Endoribonuclease MazF
total genus 25
structure length 103
sequence length 110
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ckhA00
5CKBA 2MF2A 4ELYC 1M1FA 4ELZC 5CKFA 4OF1A 3G7ZA 1VUBA 5CQXA 3NFCA 4VUBA 1X75C 3VUBA 5CKHA 3TCJA 5DLOA 5CO7A 2KMTA 2VUBA 4MZPA 4MZTA 5CK9A 5HK3A 3HPWA 4MZMA 1UB4A 5HKCA 5CQYA 4HKEA 5CKEA 3JSCA 4MDXA 4ME7A 2C06A 5CCAA 5CKDA 5CR2A 1NE8A 5HK0A 3JRZA
chains in the Genus database with same CATH superfamily
2RNAA 3OYLA 5C6SA 1TOVA 4M75E 2FRWA 1CSKA 3OB9A 1K8AC 2CP7A 4L59A 4R56A 4XTYA 3CD6Q 3JCMc 3JCMg 1AWWA 4LD9K 2IG0A 2ECZA 4JRPA 1OV3A 1N6AA 1U8RA 4M75G 1R77A 5L23A 1FMVA 1O9SA 2NUPB 2FZGB 1AEYA 2QQSA 2HQEA 1VQOA 4F7UG 1YIJQ 1UFFA 2DVEA 3OW2P 1UJ0A 4F17A 2XIDA 1WHLA 2EIFA 1B34A 5DLQE 2MI6A 5GAMe 1U1TA 1AHJB 3QPHA 1BBZA 1YITA 3JCMb 1PC0A 4JS5A 5GAN8 4PJOD 2QDLA 4KRTA 1G2BA 3QUIA 2K3BA 2NUPA 2J6OA 3WXMB 2D6FA 3JCMd 3RIRA 1ZA2B 1ZSZB 1SF9A 3OYBA 2JW4A 5KYWA 5IAYA 1V29B 1V1CA 2EGCA 3C94A 2E64A 2GQVA 4A54A 1EIFA 4F7UB 3EGXA 3AHUA 3G4SA 1KK7A 1PNJA 2XK0A 2PU9B 1W4SA 2P0KA 3CC2A 4ZN1A 4PJOF 2MWOA 4C92A 1K8AR 4PJOG 1SRMA 4BDZA 2YUOA 3BDUA 1M30A 1OEBA 1VQMA 3OYNA 4M78G 4HA8A 3SFMA 3OYEA 1BCOA 4YTLA 2DPPB 2E3HA 5CR2A 2KBTA 5LJ5j 2PVOB 3N5BB 1XTDA 1E6HA 4C5GA 1GBRA 1PRLC 4AFSC 4M78E 3NHNA 3M0PA 3CCQQ 2L3QA 5GAN2 1N9RA 3HKSA 4J9DA 2AHJB 1M1KR 3A8HB 2YWWA 4ZGJB 1GRIA 3CCUT 4GLMA 2FPDA 1Q82R 4ELZC 4F7UF 2ESWA 3JCMJ 2GGRA 1G3YA 1NZ9A 3OYKA 2NYSA 4AT1B 1YCYA 1VQ6Q 3DLLA 1LPLA 1NPPA 5GAN5 1RAFB 2KEAA 2CGHA 1T3LA 1WJSA 2I2LA 1SRLA 5KH6A 1X6BA 3I5RA 3OS5A 1NE8A 3OBYA 4FU6A 5CAIA 1RAHB 2DD5A 1B3QA 2J6FA 4IUVA 3JCMW 1CKBA 4OMNA 2BKDN 2HNIA 3EHRA 4CC4B 3DLMA 1OX9A 3MP8A 5GAN3 2QGGA 3UA6A 5M9OA 2V1RA 3L2RA 2FEIA 1WDXA 2EJFA 4HVWA 5GANf 1Z9ZA 1K73U 3OMCA 2DYIA 2Y90A 2ZAEA 2YLBA 1QQJA 2BZXA 3MEVA 3CXCA 1KQ2A 1NBEB 1VQ9Q 2COZA 2CSQA 2OTLA 1EX4A 2CP2A 4ANJA 1PHTA 3I55T 1H8KA 1G3WA 3UT1A 1UHCA 1J3TA 3VS6A 2ZZDA 2E70A 1VQNA 3ZL7C 3EG9B 5D6WA 2KXDA 1Q86U 3G71A 2GCXA 1KIKA 1AVZC 5GAMh 1M1GA 1Y96A 1WNLA 3AT1B 2RHIA 1PCXA 1JXMA 3MCAB 3CCRQ 1M3AA 2K5FA 1JB0E 3SWNB 4A4HA 1MV0B 2O9VA 4DA4A 2QASA 2ROLA 5GMKl 4LDXA 5FRNA 5LJ5g 4C92G 3CMAQ 4FCYA 1VIEA 3QWYA 2EYZA 4QVZA 2QA4T 2EYYA 4LD6A 1C0MA 5LJ3j 1TG0A 2EQIA 4FYVB 3HPWA 4XU2A 2KRSA 2LDMA 5GANj 2KSSA 2A0FB 2RB6A 2LJ3A 1ZQ1A 3JAME 3JRZA 2MCNA 4OMMA 4LDWA 4ZNXA 2M51A 4C92D 2RQUA 5GAOm 1M3BA 2E12A 2P84A 2VKNA 2J06A 1VQ9A 2KR3A 2HQHA 2CDTA 1TU0B 2DE0X 3HP9A 4C8QF 3M53A 3VS4A 1WYXA 2DIQA 2DBMA 3L2QA 2SRCA 4MZPA 3I55Q 2F2XA 2QDYB 2O4XB 2O88A 2BE9B 3QG1A 4PLIA 2FHDA 1YWOA 4E6RA 4J9EA 4AFUC 4Q5WA 1SG5A 3CCVT 2JXBA 2OX7A 1R0CB 4C8QA 4M7DD 3ASKA 5FWCA 3H0IA 1EZZB 3GP8A 2XMFA 1T0JA 1BI3A 4QW2A 2XKOC 4J6YA 1KD1R 1IRXA 1UE9A 4A4FA 3REAB 3LWHA 1IGUA 3NTKA 1QVGP 2RJDA 3NTIA 4J9GA 1Q86C 2EYXA 4C8QB 2QQ9A 2YSQA 2ZPIB 3V7CA 2H3JA 2K2MA 5AYFA 2DKGA 1GL5A 1JO8A 4XU3A 2CH4W 5DM7R 1QVFA 1K0SA 3EFOA 3M0UA 3H9NA 1AZEA 3HRTA 1ZLMA 7AT1B 5IN1A 3OYJA 3E2UA 2WSCE 1S1NA 5IHKA 3NGPA 4OGCA 2ATCB 1W2BA 1RABB 2P0QA 1RI0A 2LVMA 4OMPA 4QQDA 4Z89A 3GIBA 2DZ9A 3CCEQ 2H3EB 3VKIA 2DEQA 2HSPA 3M59A 2EQKA 4XU0A 2RM4A 3OYCA 1MGQA 1H3ZA 1RADB 2E6ZA 2F2VA 2L89A 2FZCB 2O01E 1KSWA 1MMDA 3JB9J 5CIUA 3S3MA 2DJQA 1VQKQ 1M8VA 1AOJA 1ZUYA 3A5ZB 2LJ1A 4PJNA 3G1JA 1KJWA 2ABLA 1KD1C 2NUTA 1I0CA 5GAN6 5KYWB 3HFNA 2JMAA 1H3HA 4BI8B 5GMKh 3RUXA 4FYWB 2COWA 2D1XA 4B9WA 3RKYA 4IURA 5I22A 4A4KA 3OS0A 2HQXA 1KQ1A 1B07A 1IXDA 1ZHIA 3A8OB 2CZ7B 2OJ2A 1JBMA 3CMET 3CPFA 3SD4A 3LH0A 2YLCA 2JVVA 1Z9QA 4J9FA 2DFUA 3CMAT 4JLGA 2HDAA 4CC7A 3LX7A 1UG1A 4KGZB 2DNUA 3CMEQ 3RMQA 1ZA1B 3PE0A 1AZGB 3CCQT 4MZMA 4AG2C 2E65A 1VQ8Q 4EPCA 1FXXA 4BY6B 3M5AA 1X69A 1VQLT 2LMJA 2E4HA 4B6MA 1G3SA 1LOJA 1Q81C 4ZGDB 1K73R 1OU9A 1VQ7Q 3PFSA 1AWOA 3NFCA 3FB9A 3ZEHA 3P8HA 3OQ5A 3BFMA 1G3TA 1QVGS 2FRYA 2QTXA 3M57A 5GAMd 1QVPA 3KUFA 5LJ3e 2NUTB 2RPNA 4C5EA 2PUKB 1VOMA 1SSFA 4CC2A 1DJ7B 3V8JA 2B8AA 3CCEA 1NJIR 3I56A 2YUQA 3CCSQ 2AIRB 4E7IA 3VYGA 2RO0A 4OMOA 2LCLA 2DA9A 2CS7A 4L6V5 3GNGA 4M7AD 2GTOA 1TTHB 3QIIA 2GNCA 2K2VA 3CD6A 1QKWA 3IQLA 3EH1A 1BB9A 2F5TX 2HBPA 1W2BP 5EG2A 3EGUA 3FC3A 4RTVA 2RF0A 4HCZA 5KYYA 3CC7T 2PVDB 1QWFA 1HK9A 1YWPA 4RKUE 3JB9G 3SDZA 4E7ZA 2JMCA 1OX8A 2X9HA 2LRQA 1RAEB 1KC8R 1QVGA 4C92B 4OP0A 4O5VA 5J3BA 3S6WA 5GMKm 3OS2A 2D0QB 5KYYB 5I2MA 2EVRA 1LVKA 2VV5A 4J9HA 1M2VB 3V8KA 2ENMA 3TQ7P 4C0DC 3OA6A 2D8JA 2V1QA 1T3SA 5HCKA 1ZUKA 3CCMT 3X20B 4F14A 4LNPA 1M1KC 5CKEA 4MDWA 4ME7A 4DBRA 1YJNA 3G4SQ 1RLQC 2MF2A 3BY7A 1TS9A 3LGLA 4JS4A 1M27C 2MYSA 2PNIA 3QDRB 2L3SA 1VA7A 2JNGA 2KMTA 2K9GA 5LJ3f 4RTZA 1OQKA 1QVFS 4DOVA 1PD0A 1SSHA 1FX7A 8AT1B 1U5SA 3CC2T 4M75C 3TREA 4DBHA 3VS2A 2D9TA 1AT1B 2FVUA 2OI3A 2OAUA 2P4TA 2A36A 1YJWQ 3V8LA 2XICA 1A0NB 4PL6A 1YITQ 2Z0WA 3EFRA 1BI1A 4M7DC 4BDYA 5LJ3d 1MMAA 2MIOA 1KG1A 5FU7B 1IHVA 2F1LA 2L5QA 1WFWA 3JB9I 2A3LA 2ROTA 3UDCA 2KY9A 4XK8E 1WIEA 3RBBB 4M77A 3REBB 3CCSA 4B9XA 4JJCA 5KYNA 5AT1B 3J80E 4J9BA 2W10A 4FW1A 2YUPA 1W1FA 4DEYA 4E7JA 1BI2A 4Y92A 5GMKj 2HMAA 2YRDA 3EH2A 1VQ6A 1WHGA 1VQNT 1SHGA 4C5IA 2KI7A 4KULA 4XTVA 4C0FA 4DQ2A 2VUBA 4ESRA 3M58A 1W6XA 4ZN3A 2G6FX 4C92C 1I07A 2LNHB 1VYUA 4EIKA 1O75A 9ATCB 2RK1A 1ZSZA 2K79A 3PGGA 3X25B 3EG3A 4LUEA 5LJ5f 1YJWT 1I81A 1WQWA 2HZYA 2R5AA 3R6NA 4M78B 4HCKA 2L3PA 5KYXA 3EGXB 1M9SA 4N0AA 4JLIA 2E1HA 1WLPB 4MZTA 2IIMA 2ZPHB 4E7HA 1JJ2S 2EQJA 1S72Q 5KYUB 2B86A 2CH4A 5D6XA 1IZ6A 5IHNA 2CZ0B 1YHQT 2MOXA 4M77B 3THKA 1YJNQ 1M4ZA 4PJMA 5EC7A 4GLKA 2KYMA 2QQRA 4P5NA 3C0CA 4M77D 4KUIA 3MHXA 5GAMf 2MWPA 3FRNA 3M0RA 2OTLT 2DTOA 1N8RU 2O9SA 4C8QG 5CKDA 1UECA 3TSZA 3GBQA 1C1AA 3X28B 3NMZC 5GANg 1JJ2A 2XG8D 2E3IA 3KXTA 2C0TA 3I56Q 2P0PA 1HSQA 2O2OA 4JUVA 1NYFA 2GQIA 4CI0C 1BIBA 1K9AA 1HJDA 1WA7A 2FL7A 2QA4A 3H0HA 4N4GA 4AFZC 4R55A 3INZA 4CRIA 2OTJT 5KCHA 5CKBA 3OW2S 4E2FB 1YIJT 4IUQA 2FO0A 3QZ5B 1YP5A 4A53A 4XTUA 2QEXT 2VASA 4A4EA 1IREB 4ZGEB 1UDLA 2VGMA 3A1PA 1RLPC 4A4GA 1Q95G 2YRVA 1UUEA 3GF5A 3HHTB 1RI9A 1M8MA 2JM8A 1BYMA 3CCQA 1FWZA 2CREA 3GNFB 4M7AB 1SHFA 4LDUA 2RQTA 1OPLA 2E6NA 2CT3A 3TU4K 3OS1A 2JUFA 4IIOA 1NLPC 3FIFA 2KK4A 4D8DA 2CSIA 4OVAA 3RMSA 2L0AA 2RHYA 3CPWS 1VQ5T 2QQBA 3JB9H 3CCVQ 1V76A 2QG9B 1WHMA 2DXBA 4FT4A 4D6WA 2M16A 2VB6A 2M02A 3JCMX 5C0MA 1I4K1 5LL6S 3FJ5A 2LQ8A 5I11A 4BY6C 4HXJA 2FZKB 4IUTA 1Y07A 2XDPA 1RL2A 3RKXA 1WHKA 2RH2A 4GY5A 2Y4YA 2PZ1A 2Y4XA 4C8QE 3CCJA 2DMOA 1MMGA 2C06A 5A0LA 5LJ5e 3F70A 1U1SA 3HL8A 5J26A 1VQ8A 3SEMA 2MPXC 3L2WA 4X1VA 5A0GA 1VQLA 4J7IA 2DEUA 4JJDA 5CQYA 1X6OA 2ED1A 2L3RA 2K5LA 4KGVB 2CT4A 4BUGA 3MEUA 4F7UA 4PJJA 3RR6A 1K8AU 3OSSC 3J7AF 3FDRA 2M0YA 2J05A 1HD3A 5GMKe 4AG1C 1OI1A 4QQGA 3CCET 3OYDA 2E5KA 3S3OA 4FSXA 4MMKA 2C0IA 4C0GA 4RTWA 4X9DA 4LDYA 3CEYA 1YN8A 1NEGA 2HEQA 1RUWA 1M2OA 3CCRA 3MJXA 1ARKA 1H641 4HT8A 2DD4A 1VQPT 1WQ7A 5CQXA 4DEXA 1NYGA 3E1SA 5CKHA 2K57A 3TVTA 1BCMA 3O5ZA 1BK2A 4C0ZA 5LJ5d 2GF7A 3CMAA 3VRYA 4NOYA 4PJOA 2VC8A 1VQKA 3A8GB 4A63B 2DIGA 3L1AA 1MNDA 1D09B 3PNWC 2CZ6B 2IPOB 2F69A 1PRMC 1WJQA 1AWXA 4EMHA 4XAXB 1PSFA 3OW2A 2LP5A 3VV0A 3I35A 5KYUA 2BZ8A 1WXBA 1NJIC 4JRQA 3JB9F 1NG2A 4RG8A 2MK5A 4RCBA 2EBPA 1LJOA 1BKBA 4FSSA 3QYHB 1KC8C 1YFNA 4N4IA 1OZ2A 5FRMA 2RD1A 4C8QD 4M7DA 2X4WA 1QP3A 4OB3B 4RTUA 1N8RC 2QYZA 3CPWA 2BIVA 1H92A 3M0QA 5GAMj 2RQWA 1IB8A 5HKCA 4Z8AA 2KRMA 4BI4A 1M2VA 3LH5A 1Q7YR 1VQLQ 3MEAA 2OTJQ 2X4XA 4PFPA 3LW5E 3CD6T 2NUZA 1SPKA 1PM3A 1M1FA 1JEGA 4PJLA 3G6EA 4F04B 4HVVA 3R6OA 1WXUA 3GLXA 2ED0A 1CKAA 3TCJA 5GANe 2DL8A 2BUDA 1TSFA 3CCLQ 2HKNA 1YJWA 4KT0E 3LYIA 1X27A 4F7UE 2JOYA 2LCCA 3TSWA 1OYXA 2BZYA 2J7IA 2MMPA 4RTXA 2AZSA 4E7KA 2X3XD 1Y71A 2RK2A 3G6EQ 5IH2A 2CYZB 3NPFA 2DL3A 4M7DG 1QKXA 2LQKA 4M78F 2CP3A 1NPRA 1X75C 5GAOp 1TWBA 2J6KA 4LE9A 1VQMQ 3T9NA 3SWNA 1KFZA 4WTOB 3OYYA 1D3BB 1VQ7A 4RCCA 5D6YA 1HXDA 2KNBB 2JS2A 1SKUB 5GJWB 1T0HA 5I21A 4D8KA 1GCQA 1Q81R 1RAAB 3OYMA 1RAGB 2CP5A 3SHWA 1K76A 4FW2A 5CO7A 3X24B 4PJOE 4M78C 4C8QC 3JCMV 2JN0A 4BE2A 1QP2A 3OYAA 1M5Q1 2YHTA 3JSCA 4AFQC 1VQOQ 2LNVA 2DXCA 3EFOB 4KH0B 1Y96B 1FYNA 5ECAA 2HCKA 4LUDA 1RAIB 3QWXX 4MMLA 2E41A 1MNEA 2HSEB 2DTIA 2GBQA 1IO6A 3SWNC 3VUBA 4EDUA 2LTOA 2OTJA 4QKUA 4L5GA 2PUOB 2GFUA 3H6ZA 4EMKC 1YIJA 4EMGA 1M90C 2R58A 5IHIA 4MDXA 1GCQC 3J81E 2FG0A 3D7SB 2K3XA 2FPFA 3QYGB 3CPWP 3CBMA 2O31A 1QLYA 4LDVA 1X01A 2VXEA 4UC4A 4OMQA 3QHSA 1UGRB 1YHQA 3CXCP 1K9MR 1WZOA 1D3BA 3I9QA 1JU5C 3EG9A 3CC2Q 4LN2A 3H41A 3EHQA 2V26A 2DLPA 5GAN4 5CCAA 1S72A 2H8HA 3JCMh 2V8KA 3CCMA 5A2QE 2L2PA 4M77G 4WF2A 2E10A 2D8HA 3CXCS 1VYTA 4OF1A 4OB2B 3CMEA 1YJ9T 2HKQB 1K9MU 1YHQQ 1UGVA 3ZFJA 3C4SA 4EMKA 3QDFA 4M75F 4X9CA 1KD1U 4PNOA 4RTTA 1K4US 1NM7A 4PFZA 2ZPFB 4RG2A 1G8XA 5FWBA 1M3CA 3L42A 4OB0B 2EGEA 4IUPA 5GAOn 1D0ZA 1KQSA 3EG1A 1X2KA 1VUBA 3UA7A 2AKLA 4GBQA 3C95A 4Y28E 2R5MA 4KBMB 3VJPA 1IGQA 2F5KA 3CCUA 3URGA 1LNXA 5FLXE 2O4XA 5KYXB 3MP6A 1EFNA 4J8OA 3VUZA 2EYQA 2QEXA 1RACB 1MHNA 1AWJA 2CZ1B 3P8DA 2F2WA 5CKFA 3RNJA 4OMFB 1N9SA 3FJPA 1K9MC 2EQMA 2QXFA 4HCCA 1X2QA 3MP1A 4QVCA 4BE1A 1D1AA 4F16A 3OY9A 2QQAA 4PK4A 1OU8A 4M75A 2WSFE 1PG5B 2EQUA 3VU3C 3JV3A 3CCLT 4IKFA 2LJ0A 5GAOl 5D7UA 4KGXB 4RMOA 1ABQA 1G5VA 2K4YA 3CCMQ 1TXQA 1WX6A 5FW9A 2JZ2A 3SB2A 2RHZA 2X3WD 2WACA 5KE2A 1TUDA 1UGSB 1ZBJA 2FYKA 2KRNA 4J5YA 4M77C 4Y91A 4ZTJA 1JQQA 1PKTA 1JXOA 3CC4Q 3ER0A 3GPLA 4XU1A 3P8BB 1ZBXA 2KDSA 1YI2A 4C92E 4IUUA 2YXYA 3PTAA 4E7SA 3M9QA 1G83A 1WHJA 4KH1B 5I2SA 1LCKA 3L2UA 5IXFA 3Q1JA 2EW3A 2HL5C 3M56A 3TEEA 3E9GA 4CC3A 5GAOr 2RMOA 3VRZA 1YJNT 3H0FA 1K73C 4Z02A 3H8ZA 2V8IA 2COYA 2L8DA 4PJOC 2I0NA 2RJEA 1UJYA 2JM9A 2YDLA 4QQ6A 2QGFB 4E7LA 4J9CA 2OTLQ 2AK5A 2VGNA 2PVGB 3HRUA 2WSEE 4NS5A 4BB7A 2A7YA 2K6DA 2A37A 1Y57A 1NLOC 2QEXQ 3QJ6A 3OSVA 4OGEA 2QK0A 4J7FA 1W70A 2CKKA 1XOVA 1KQSS 1MUZA 3DB3A 1BIAA 3META 4FT2A 1YJ9A 3CCUQ 4M7DE 1QCNA 2DAQA 2DRMA 3OYHA 4PKCC 3CCJT 2DERA 2W0ZA 4HCBA 2EKOA 2QA4Q 1P92A 4M7AE 4J6XA 1E6GA 3LWIA 2LQWA 1M90R 1GFCA 4PLLA 4HT9A 1ABOA 2XHCA 3VS3A 1VQPQ 1QCOA 5FU6B 4M7AA 4C5HA 3G6ET 1NEBA 3JCMf 5L8RE 2PTKA 2EPDA 1D1BA 1PD1A 2DYBA 3VYHB 4V2SA 1ACMB 2RI3A 4JDSA 2EYWA 1MMNA 2ZCFB 4M7AG 1YBYA 1VQMT 2ZPEB 1IHWA 3M0SA 1VQ6T 1VQ4T 2CP6A 4XTZA 1D0XA 2DO3A 2JJ9A 2R57A 2E5QA 3E9FA 4IIMA 2XDBA 4RUGA 4NL2A 4XTXA 2DL7A 2LX9A 2LZ6B 3HFOA 4FYYB 1UEBA 1QCFA 2HBWA 2HAXA 2QI2A 3M4YA 5HK0A 1W2BS 1YI2Q 1M1KU 1AD5A 4EMKB 2EKHA 3UATA 1JRIA 2VYTA 3EGDB 1Q82U 1VQ5A 5IT9E 3MPUB 2KE9A 2VXFA 5HY6A 1Y7XA 3PIPA 3NTHA 1XNIA 5GMKi 1KHIA 2QAZA 3CQTA 2AT1B 1XQHA 3EAEA 2LQNA 1UHFA 3I5SA 4HVUA 3VS7A 2RA2A 1YCSB 4Z88A 3G7ZA 4M78A 3A8LB 4PJOB 2JTFA 1B34B 1GCPA 5KCOA 1Q82C 2KT8A 2DK3A 8ATCB 3EGDA 3PVLA 3L2VA 3ME9A 3VS0A 2MAMA 1VQ8T 2DL5A 4M77E 2KYBA 3CBPA 3EFSA 1VIFA 1VQNQ 1K0XA 1VQOT 1QMCA 3QKJA 1ZSZC 5KE3A 1NJIU 5FROA 1C6VX 4DOWA 3PT9A 4BI3A 3CCRT 1D0YA 6AT1B 4OB1B 4N0AC 3WVDB 2IVWA 3OMGA 1BU1A 3RESA 2DZCA 4QVDA 4FM4B 4AMCA 4JRIA 1YJ9Q 1N5ZA 3PIOA 1FMWA 4M77F 1Q86R 3PVQA 1OULA 2FPEA 3O8VA 1QWEA 3CC4T 1ZUUA 1S72T 4M75B 3G4ST 1YITT 1Q7YU 3FEOA 3DB4A 1I1JA 2K5IA 3RKWA 3QXEB 1VQPA 1HYOA 3M54A 3BDLA 1I8FA 3BE3A 3EG0A 1VQ5Q 3C12A 5GAMg 4ELYC 2YT6A 3UWNA 1KC8U 2DX1A 1GBQA 2K3YA 2DBKA 1QVFP 1JJ2P 4ORZA 4K11A 3GOXA 2LT1A 2HD0A 1OZ3A 3KFVA 4PFOA 4M7DB 2LT4A 2FB7A 3UPUA 1B7TA 3MEWA 4BD3A 1MV3A 3S3NA 2EJGA 2M1HA 3QJYA 3JCMe 1SEMA 2XD0A 1U3OA 4FL6A 1X6GA 2A28A 3ZBDA 2DTHA 1UGQB 4VUBA 3WVEB 3V7RA 2LC4A 5CK9A 2RJCA 3CBOA 1TUGB 5J39A 3CCVA 2YRCA 1WGSA 2EAYA 3I55A 1OPKA 4XQ3A 1YNZA 3OYFA 2RQVA 4X34A 4JRKA 2X51A 4JPBW 4ATOA 2AZVA 2GFAA 1Q81U 1VQ4A 4BACA 4M4ZA 3CCJQ 2DXUA 3JCMP 2JTMA 3VS5A 3EG2A 2HL3A 4M7AF 5FU6C 3G71Q 1BI0A 4JZ3A 1N8RR 2DVJA 2KVQG 3HTRA 3MO8A 2YUNA 5DY9A 3VS1A 1D1CA 2DETA 4WCIA 3CCLA 4M7DF 1KQSP 1Q7YC 1R8OB 1PSEA 4ZTFA 1VQ7T 3HSBA 1Y0MA 2JT4A 4J9IA 3DKMA 2CP0A 1TUCA 3QO3A 4TVRA 5GANh 4DBQA 2RQRA 2DRKA 1ZX6A 1VQ4Q 4O6JA 1WPYA 4FIBA 1GFDA 5LJ5h 3E19A 2X4YA 1WJRA 2JTEA 4M75D 4JJNK 1XJWB 2K7AA 4JJBA 1WI7A 4N4HA 3JB9D 4C0DB 1YI2T 3LLRA 4J83A 2DJZA 3A8MB 3BW1A 2P4RA 5A0DA 2PQWA 4FYXB 5GJVB 2LCSA 2DILA 3JCMQ 5GANd 1KHCA 2CUBA 2LX7A 5LJ3h 1UGPB 3V7SA 2NWMA 2EGAA 3CC7Q 4C92F 3OYIA 2M9UA 3RERA 2KGTA 3L2ZA 2V8JA 2EFIA 3UF4A 2EJ9A 4M78D 2OAWA 1VQKT 3G71T 2RN8A 1UTIA 2JS0A 2M0OA 3OBWA 2AKKA 3MKDA 1E7OA 1M90U 2KAFA 3PMTA 2ZPBB 1F1BB 1I5OB 1OOTA 3QZ9B 3CC4A 3QSUA 1I5LA 2RJFA 2KXCA 1QW1A 1N27A 2VWFA 2XU8A 1PWTA 5FU7C 2ZPGB 2BTTA 3M55A 2VVKA 5CVIA 2D0NA 3OYGA 2NLUA 4RTYA 1U06A 2X4JA 2BE7D 1X43A 4OMLA 1ZSGA 1K1ZA 5GAOq 2DL4A 5GAN7 2KROA 2RI2A 4R0KA 4BE0A 2CUDA 1WHHA 1TH7A 1WXTA 2EWNA 2ZGWA 4M7AC 1PKSA 3M0TA 1VYVA 2DXTA 5HK3A 3QBYA 4J6WA 3CCST 2GTJA 4HKEA 3ULRB 2RHUA 5IXBA 2DM1A 2QTVA 4QT7A 4II1A 2C0OA 4KUDK 5LJ3g 1UB4A 4LXCA 2KT1A 4NL3A 3M4GA 3RDVA 3FLGA 2XI9A 1VQ9T 2A08A 2X35A 2XDDA 3A98A 2DF6A 2RHXA 5DLOA 3I56T 1R0BG 4XTWA 3CC7A 3KBGA 3HRSA 3LGFA 4E47A 1FMKA 2KQWA 4DBFA 3U23A 2G3RA 3X26B 4JZ4A 1GXIE 3PMIA 2RI5A 2SEMA
chains in the Genus database with same CATH topology
4BI8B 2VGNA 2PVGB 3HRUA 2WSEE 4NS5A 4BB7A 5GMKh 1VQ8A 3OYLA 5C6SA 3RUXA 2A7YA 3L2WA 4M75E 4B9WA 3RKYA 5A0GA 1VQLA 3OB9A 3OSVA 3QJ6A 4IURA 4J7FA 4OGEA 4A4KA 3OS0A 4J7IA 2HQXA 3HSBA 1KQ1A 1K8AC 2CKKA 1ZHIA 1XOVA 4L59A 3A8OB 1KQSS 4R56A 4XTYA 2CZ7B 5CQYA 3DB3A 1BIAA 1X6OA 3META 1JBMA 4FT2A 3JCMg 3JCMc 3CMET 1YJ9A 2L3RA 4M7DE 4LD9K 2K5LA 3CPFA 4BUGA 2IG0A 3MEUA 3SD4A 2DAQA 4F7UA 3LH0A 2YLCA 4JRPA 3OYHA 2JVVA 4PKCC 1K8AU 1N6AA 3OSSC 1U8RA 3CMAT 3FDRA 4M75G 3CCJT 3J7AF 1O9SA 4JLGA 5GMKe 4HCBA 2EKOA 1OI1A 3LX7A 1P92A 2QQSA 2HQEA 1VQOA 4QQGA 4M7AE 3CCET 3OYDA 4J6XA 3RMQA 4F7UG 3LWIA 4PLLA 4HT9A 2DVEA 2XHCA 3S3OA 4FSXA 3CCQT 2XIDA 5FU6B 4MZMA 4MMKA 4M7AA 4C5HA 2EIFA 3G6ET 2E65A 4C0GA 3JCMf 1FXXA 4BY6B 4EPCA 4X9DA 1B34A 5L8RE 5DLQE 2MI6A 3M5AA 4LDYA 5GAMe 3CEYA 1VQLT 1U1TA 1AHJB 3QPHA 3VYHB 1YITA 4V2SA 3JCMb 2RI3A 4JDSA 3CCRA 1G3SA 4JS5A 1H641 4HT8A 2DD4A 1LOJA 5GAN8 1Q81C 2ZCFB 4ZGDB 4PJOD 4M7AG 1YBYA 3QUIA 1VQMT 1VQPT 1WQ7A 5CQXA 3PFSA 3NFCA 3WXMB 3FB9A 3ZEHA 2D6FA 3E1SA 3P8HA 3JCMd 3RIRA 2ZPEB 5CKHA 2K57A 1VQ6T 3OYBA 3OQ5A 4C0ZA 3BFMA 5LJ5d 1G3TA 1QVGS 2GF7A 1VQ4T 3CMAA 2QTXA 3M57A 5IAYA 5GAMd 1QVPA 4XTZA 1V29B 3KUFA 5LJ3e 2DO3A 2R57A 3E9FA 2E5QA 4NOYA 2XDBA 4C5EA 2PUKB 4NL2A 1SSFA 4XTXA 1DJ7B 3C94A 2LX9A 2B8AA 2E64A 2VC8A 1UEBA 2GQVA 3A8GB 3HFOA 3V8JA 1EIFA 4A54A 4F7UB 3I56A 1VQKA 2HAXA 2QI2A 3M4YA 5HK0A 2DIGA 3AHUA 3G4SA 3L1AA 4E7IA 1W2BS 3PNWC 2XK0A 2PU9B 1W4SA 2CZ6B 2RO0A 3VYGA 1M1KU 2LCLA 2P0KA 2F69A 2CS7A 4L6V5 1WJQA 4ZN1A 3CC2A 4PJOF 3GNGA 4EMKB 2MWOA 4C92A 4M7AD 4PJOG 4EMHA 1JRIA 4XAXB 2VYTA 1PSFA 1Q82U 1VQ5A 4BDZA 3QIIA 3BDUA 5IT9E 3OW2A 3VV0A 2K2VA 3CD6A 2F5TX 2VXFA 1VQMA 1NJIC 5HY6A 1Y7XA 4M78G 3PIPA 4HA8A 3SFMA 3NTHA 1XNIA 2HBPA 3OYNA 3OYEA 4JRQA 4YTLA 2DPPB 1KHIA 5GMKi 3JB9F 3PMIA 1XQHA 4RG8A 5EG2A 5CR2A 3EAEA 4RCBA 3FC3A 1LJOA 1BKBA 1KC8C 3QYHB 2RA2A 4HCZA 4N4IA 1OZ2A 5FRMA 3CC7T 5LJ5j 2PVOB 2RD1A 4C8QD 4M7DA 2PVDB 3G7ZA 4M78A 2X4WA 3A8LB 2JTFA 1B34B 1HK9A 1QP3A 3N5BB 4OB3B 1XTDA 5KCOA 4RKUE 3JB9G 1Q82C 1N8RC 2DK3A 4C5GA 3SDZA 3CPWA 2BIVA 4M78E 3ME9A 3L2VA 5GAMj 2MAMA 5GAN2 2LRQA 5HKCA 1N9RA 1VQ8T 3HKSA 4M77E 3CBPA 3EFSA 4BI4A 1VIFA 1VQOT 4PJOB 2AHJB 3MEAA 1QVGA 4C92B 3A8HB 2X4XA 4OP0A 3LW5E 4O5VA 5J3BA 4ZGJB 3S6WA 3CD6T 5GMKm 3QKJA 3CCUT 3OS2A 1M1FA 5KE3A 2D0QB 3G6EA 1NJIU 5FROA 4ELZC 4F7UF 5I2MA 4DOWA 2VV5A 3R6OA 3V8KA 3GLXA 3JCMJ 1G3YA 1NZ9A 3OYKA 3TCJA 1YCYA 3PT9A 5GANe 4BI3A 2BUDA 4C0DC 3OA6A 3CCRT 3DLLA 3CCMT 1YJWA 4KT0E 3LYIA 1NPPA 3X20B 4F7UE 5GAN5 2JOYA 4OB1B 2CGHA 2LCCA 4N0AC 1M1KC 1OYXA 3WVDB 5CKEA 1WJSA 2IVWA 4MDWA 3OMGA 2I2LA 4ME7A 3RESA 1GXIE 2MMPA 2DZCA 4QVDA 4E7KA 4FM4B 5KH6A 1YJNA 4JRIA 3OS5A 1Y71A 2RK2A 1NE8A 3OBYA 3PIOA 4FU6A 5CAIA 4M77F 2MF2A 2CYZB 3BY7A 2DD5A 3LGLA 4IUVA 4JS4A 3JCMW 4M7DG 2BKDN 2LQKA 3O8VA 4M78F 2HNIA 3QDRB 1NPRA 1X75C 3CC4T 3DLMA 5GAOp 3MP8A 2JNGA 2KMTA 1S72T 3T9NA 5GAN3 4M75B 5M9OA 3G4ST 1YITT 1Q7YU 3FEOA 5LJ3f 3DB4A 3SWNA 1QVFS 4DOVA 3OYYA 3L2RA 1D3BB 1FX7A 2K5IA 1VQ7A 3CC2T 4RCCA 3RKWA 4M75C 5D6YA 3CCEA 1HXDA 3QXEB 3TREA 1VQPA 2EJFA 5GANf 3M54A 1K73U 3BDLA 1I8FA 2D9TA 3OMCA 2FVUA 2Y90A 2OAUA 2YLBA 2P4TA 3MEVA 3C12A 5GAMg 3CXCA 5I21A 4ELYC 3UWNA 3V8LA 1KQ2A 2XICA 4PL6A 1KC8U 2OTLA 2K3YA 3I55T 1G3WA 3EFRA 3UT1A 3OYMA 1BI1A 2ZZDA 4M7DC 5CO7A 4BDYA 3X24B 3GOXA 2E70A 4M78C 5LJ3d 4PJOE 1KG1A 2LT1A 2HD0A 1OZ3A 5FU7B 4C8QC 1VQNA 3JCMV 2JN0A 2L5QA 5D6WA 4M7DB 2LT4A 2FB7A 4BE2A 3UPUA 1QP2A 3OYAA 1M5Q1 2YHTA 3JSCA 3MEWA 3JB9I 1Q86U 2A3LA 2LNVA 2DXCA 3UDCA 4BD3A 3G71A 2GCXA 1Y96B 2KY9A 4XK8E 3S3NA 5GAMh 1M1GA 1Y96A 1WNLA 2EJGA 2M1HA 4MMLA 2E41A 2RHIA 3QJYA 4M77A 2DTIA 3JCMe 3CCSA 2XD0A 4B9XA 4FL6A 3ZBDA 2DTHA 3SWNC 1UGQB 4VUBA 3VUBA 3J80E 4EDUA 2LTOA 3WVEB 3MCAB 2OTJA 3V7RA 2K5FA 1JB0E 2LC4A 5CK9A 3SWNB 4A4HA 2RJCA 2PUOB 2GFUA 3CBOA 3H6ZA 4L5GA 4EMKC 5J39A 3CCVA 4EMGA 4E7JA 1YIJA 1WGSA 2EAYA 2R58A 1M90C 3I55A 4XQ3A 4MDXA 4DA4A 1BI2A 3OYFA 4X34A 5GMKl 4JRKA 3J81E 4LDXA 5FRNA 5GMKj 2K3XA 4C92G 5LJ5g 1VQ6A 4ATOA 2GFAA 1Q81U 1VQNT 1VIEA 3QYGB 1VQ4A 4BACA 3CBMA 4C5IA 4PJOA 4KULA 4LDVA 2DXUA 3JCMP 1X01A 2VXEA 4XTVA 4C0FA 4UC4A 2JTMA 4QVZA 4M7AF 3QHSA 4LD6A 4DQ2A 2QA4T 5FU6C 1UGRB 5LJ3j 2VUBA 1YHQA 1BI0A 3M58A 2KVQG 3MO8A 4ZN3A 1D3BA 4C92C 3HPWA 4XU2A 5DY9A 2LDMA 5GANj 1O75A 2KSSA 2RB6A 2RK1A 1ZQ1A 5GAN4 3JAME 5CCAA 3PGGA 1S72A 3CCLA 3X25B 4M7DF 3JRZA 1Q7YC 1R8OB 3JCMh 2V8KA 5LJ5f 1I81A 1WQWA 5A2QE 3CCMA 1YJWT 4LDWA 4M77G 1PSEA 2E10A 4WF2A 4ZTFA 2R5AA 4M78B 4C92D 3CXCS 1VQ7T 4OF1A 1YJ9T 4OB2B 3CMEA 1K9MU 5GAOm 3DKMA 3ZFJA 3C4SA 3QO3A 4TVRA 1M9SA 4EMKA 5GANh 4N0AA 4M75F 4JLIA 2E1HA 4X9CA 4MZTA 2E12A 2ZPHB 4E7HA 1JJ2S 2EQJA 1KD1U 4PNOA 1VQ9A 4O6JA 1WPYA 4FIBA 5D6XA 1IZ6A 5LJ5h 2ZPFB 3E19A 4RG2A 3L42A 2CZ0B 1YHQT 2X4YA 3HP9A 1WJRA 4IUPA 4OB0B 5GAOn 4M77B 1KQSA 4M75D 4JJNK 4C8QF 3M53A 1M4ZA 4N4HA 3JB9D 4GLKA 4C0DB 1YI2T 1VUBA 3LLRA 2DIQA 4J83A 2QQRA 2DJZA 3A8MB 3BW1A 4P5NA 3C95A 3L2QA 4M77D 4KUIA 3MHXA 2PQWA 4Y28E 2R5MA 5GAMf 5A0DA 4MZPA 4KBMB 2MWPA 3FRNA 3VJPA 3CCUA 2F5KA 3URGA 1LNXA 5FLXE 2QDYB 3JCMQ 5GANd 1KHCA 2O4XA 2OTLT 2DTOA 2O4XB 3MP6A 4C8QG 1N8RU 5LJ3h 3QG1A 1UGPB 4J8OA 3V7SA 4PLIA 3VUZA 2FHDA 5CKDA 2EYQA 2QEXA 1MHNA 3X28B 4Q5WA 4C92F 3CCVT 3OYIA 2M9UA 3RERA 3L2ZA 2CZ1B 3P8DA 5GANg 2V8JA 2EFIA 5CKFA 1JJ2A 2XG8D 2EJ9A 4M78D 4OMFB 1N9SA 3FJPA 1K9MC 3KXTA 4C8QA 2EQMA 2QXFA 1VQKT 4M7DD 3ASKA 4HCCA 3G71T 2P0PA 3MP1A 4JUVA 3GP8A 4QVCA 4BE1A 2M0OA 3OBWA 4CI0C 1BIBA 3OY9A 2QQAA 1BI3A 4QW2A 2XKOC 1M90U 2KAFA 3PMTA 2ZPBB 2FL7A 2QA4A 4N4GA 4J6YA 4R55A 3QZ9B 5J26A 3CC4A 3INZA 4CRIA 3QSUA 1I5LA 4M75A 2RJFA 2OTJT 4A4FA 2WSFE 5KCHA 5CKBA 2EQUA 3LWHA 3OW2S 1QW1A 1N27A 3NTKA 2RJDA 3NTIA 1YIJT 2XU8A 3VU3C 1Q86C 4IUQA 5FU7C 4C8QB 2QQ9A 2ZPGB 3M55A 3QZ5B 4A53A 3CCLT 4XTUA 2ZPIB 5CVIA 5GAOl 2QEXT 4IKFA 3V7CA 2H3JA 4A4EA 1IREB 5AYFA 2DKGA 4RMOA 4ZGEB 4XU3A 3OYGA 1G5VA 2K4YA 2NLUA 2VGMA 5DM7R 1QVFA 2X4JA 4A4GA 2JZ2A 2YRVA 3SB2A 2RHZA 2WACA 5KE2A 3HHTB 3HRTA 5GAOq 5IN1A 5GAN7 1UGSB 3OYJA 2WSCE 2RI2A 1BYMA 3CCQA 1FWZA 3GNFB 4OGCA 4M7AB 4BE0A 4LDUA 1W2BA 1TH7A 2FYKA 2EWNA 2E6NA 2P0QA 4J5YA 1RI0A 2LVMA 2ZGWA 4M77C 4QQDA 2JUFA 4Y91A 3OS1A 3TU4K 4ZTJA 3GIBA 2DZ9A 4M7AC 3VKIA 2DEQA 3FIFA 2KK4A 3ER0A 3GPLA 2DXTA 4XU1A 3M59A 3P8BB 1ZBXA 2EQKA 3QBYA 4OVAA 4XU0A 2KDSA 3RMSA 5HK3A 1YI2A 2RM4A 4J6WA 4HKEA 4IUUA 4C92E 2RHUA 2RHYA 3OYCA 3CCST 1MGQA 3PTAA 3CPWS 3M9QA 1H3ZA 1VQ5T 4II1A 4KUDK 5LJ3g 2QQBA 5I2SA 1UB4A 2E6ZA 2L89A 3L2UA 4NL3A 3JB9H 2O01E 3M4GA 3FLGA 3Q1JA 3M56A 3TEEA 3JB9J 3E9GA 2DXBA 5GAOr 5CIUA 3S3MA 2XI9A 4FT4A 4D6WA 2M16A 1VQ9T 2X35A 2XDDA 1YJNT 1K73C 3JCMX 1M8VA 4Z02A 5C0MA 1I4K1 2RHXA 3H8ZA 5LL6S 5DLOA 3I56T 2LQ8A 3A5ZB 4BY6C 2V8IA 4IUTA 2L8DA 1Y07A 2XDPA 4XTWA 3CC7A 3KBGA 4PJOC 1RL2A 2RJEA 3HRSA 2RH2A 2Y4YA 4GY5A 3RKXA 2Y4XA 4C8QE 3CCJA 3LGFA 4E47A 1KD1C 4QQ6A 2C06A 2KQWA 4E7LA 5A0LA 5LJ5e 2G3RA 5GAN6 3X26B 3F70A 1U1SA 3HFNA 3HL8A 3GF5A 2RI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKB A;  2MF2 A;  4ELY C;  1M1F A;  4ELZ C;  5CKF A;  4OF1 A;  3G7Z A;  1VUB A;  5CQX A;  3NFC A;  4VUB A;  1X75 C;  3VUB A;  5CKH A;  3TCJ A;  5DLO A;  5CO7 A;  2KMT A;  2VUB A;  4MZP A;  4MZT A;  5CK9 A;  5HK3 A;  3HPW A;  4MZM A;  1UB4 A;  5HKC A;  5CQY A;  4HKE A;  5CKE A;  3JSC A;  4MDX A;  4ME7 A;  2C06 A;  5CCA A;  5CKD A;  5CR2 A;  1NE8 A;  5HK0 A;  3JRZ A; 
#chains in the Genus database with same CATH topology
 2RNA A;  3OYL A;  5C6S A;  1TOV A;  4M75 E;  2FRW A;  1CSK A;  3OB9 A;  1K8A C;  2CP7 A;  4L59 A;  4R56 A;  4XTY A;  3CD6 Q;  3JCM c;  3JCM g;  1AWW A;  4LD9 K;  2IG0 A;  2ECZ A;  4JRP A;  1OV3 A;  1N6A A;  1U8R A;  4M75 G;  1R77 A;  5L23 A;  1FMV A;  1O9S A;  2NUP B;  2FZG B;  1AEY A;  2QQS A;  2HQE A;  1VQO A;  4F7U G;  1YIJ Q;  1UFF A;  2DVE A;  3OW2 P;  1UJ0 A;  4F17 A;  2XID A;  1WHL A;  2EIF A;  1B34 A;  5DLQ E;  2MI6 A;  5GAM e;  1U1T A;  1AHJ B;  3QPH A;  1BBZ A;  1YIT A;  3JCM b;  1PC0 A;  4JS5 A;  5GAN 8;  4PJO D;  2QDL A;  4KRT A;  1G2B A;  3QUI A;  2K3B A;  2NUP A;  2J6O A;  3WXM B;  2D6F A;  3JCM d;  3RIR A;  1ZA2 B;  1ZSZ B;  1SF9 A;  3OYB A;  2JW4 A;  5KYW A;  5IAY A;  1V29 B;  1V1C A;  2EGC A;  3C94 A;  2E64 A;  2GQV A;  4A54 A;  1EIF A;  4F7U B;  3EGX A;  3AHU A;  3G4S A;  1KK7 A;  1PNJ A;  2XK0 A;  2PU9 B;  1W4S A;  2P0K A;  3CC2 A;  4ZN1 A;  4PJO F;  2MWO A;  4C92 A;  1K8A R;  4PJO G;  1SRM A;  4BDZ A;  2YUO A;  3BDU A;  1M30 A;  1OEB A;  1VQM A;  3OYN A;  4M78 G;  4HA8 A;  3SFM A;  3OYE A;  1BCO A;  4YTL A;  2DPP B;  2E3H A;  5CR2 A;  2KBT A;  5LJ5 j;  2PVO B;  3N5B B;  1XTD A;  1E6H A;  4C5G A;  1GBR A;  1PRL C;  4AFS C;  4M78 E;  3NHN A;  3M0P A;  3CCQ Q;  2L3Q A;  5GAN 2;  1N9R A;  3HKS A;  4J9D A;  2AHJ B;  1M1K R;  3A8H B;  2YWW A;  4ZGJ B;  1GRI A;  3CCU T;  4GLM A;  2FPD A;  1Q82 R;  4ELZ C;  4F7U F;  2ESW A;  3JCM J;  2GGR A;  1G3Y A;  1NZ9 A;  3OYK A;  2NYS A;  4AT1 B;  1YCY A;  1VQ6 Q;  3DLL A;  1LPL A;  1NPP A;  5GAN 5;  1RAF B;  2KEA A;  2CGH A;  1T3L A;  1WJS A;  2I2L A;  1SRL A;  5KH6 A;  1X6B A;  3I5R A;  3OS5 A;  1NE8 A;  3OBY A;  4FU6 A;  5CAI A;  1RAH B;  2DD5 A;  1B3Q A;  2J6F A;  4IUV A;  3JCM W;  1CKB A;  4OMN A;  2BKD N;  2HNI A;  3EHR A;  4CC4 B;  3DLM A;  1OX9 A;  3MP8 A;  5GAN 3;  2QGG A;  3UA6 A;  5M9O A;  2V1R A;  3L2R A;  2FEI A;  1WDX A;  2EJF A;  4HVW A;  5GAN f;  1Z9Z A;  1K73 U;  3OMC A;  2DYI A;  2Y90 A;  2ZAE A;  2YLB A;  1QQJ A;  2BZX A;  3MEV A;  3CXC A;  1KQ2 A;  1NBE B;  1VQ9 Q;  2COZ A;  2CSQ A;  2OTL A;  1EX4 A;  2CP2 A;  4ANJ A;  1PHT A;  3I55 T;  1H8K A;  1G3W A;  3UT1 A;  1UHC A;  1J3T A;  3VS6 A;  2ZZD A;  2E70 A;  1VQN A;  3ZL7 C;  3EG9 B;  5D6W A;  2KXD A;  1Q86 U;  3G71 A;  2GCX A;  1KIK A;  1AVZ C;  5GAM h;  1M1G A;  1Y96 A;  1WNL A;  3AT1 B;  2RHI A;  1PCX A;  1JXM A;  3MCA B;  3CCR Q;  1M3A A;  2K5F A;  1JB0 E;  3SWN B;  4A4H A;  1MV0 B;  2O9V A;  4DA4 A;  2QAS A;  2ROL A;  5GMK l;  4LDX A;  5FRN A;  5LJ5 g;  4C92 G;  3CMA Q;  4FCY A;  1VIE A;  3QWY A;  2EYZ A;  4QVZ A;  2QA4 T;  2EYY A;  4LD6 A;  1C0M A;  5LJ3 j;  1TG0 A;  2EQI A;  4FYV B;  3HPW A;  4XU2 A;  2KRS A;  2LDM A;  5GAN j;  2KSS A;  2A0F B;  2RB6 A;  2LJ3 A;  1ZQ1 A;  3JAM E;  3JRZ A;  2MCN A;  4OMM A;  4LDW A;  4ZNX A;  2M51 A;  4C92 D;  2RQU A;  5GAO m;  1M3B A;  2E12 A;  2P84 A;  2VKN A;  2J06 A;  1VQ9 A;  2KR3 A;  2HQH A;  2CDT A;  1TU0 B;  2DE0 X;  3HP9 A;  4C8Q F;  3M53 A;  3VS4 A;  1WYX A;  2DIQ A;  2DBM A;  3L2Q A;  2SRC A;  4MZP A;  3I55 Q;  2F2X A;  2QDY B;  2O4X B;  2O88 A;  2BE9 B;  3QG1 A;  4PLI A;  2FHD A;  1YWO A;  4E6R A;  4J9E A;  4AFU C;  4Q5W A;  1SG5 A;  3CCV T;  2JXB A;  2OX7 A;  1R0C B;  4C8Q A;  4M7D D;  3ASK A;  5FWC A;  3H0I A;  1EZZ B;  3GP8 A;  2XMF A;  1T0J A;  1BI3 A;  4QW2 A;  2XKO C;  4J6Y A;  1KD1 R;  1IRX A;  1UE9 A;  4A4F A;  3REA B;  3LWH A;  1IGU A;  3NTK A;  1QVG P;  2RJD A;  3NTI A;  4J9G A;  1Q86 C;  2EYX A;  4C8Q B;  2QQ9 A;  2YSQ A;  2ZPI B;  3V7C A;  2H3J A;  2K2M A;  5AYF A;  2DKG A;  1GL5 A;  1JO8 A;  4XU3 A;  2CH4 W;  5DM7 R;  1QVF A;  1K0S A;  3EFO A;  3M0U A;  3H9N A;  1AZE A;  3HRT A;  1ZLM A;  7AT1 B;  5IN1 A;  3OYJ A;  3E2U A;  2WSC E;  1S1N A;  5IHK A;  3NGP A;  4OGC A;  2ATC B;  1W2B A;  1RAB B;  2P0Q A;  1RI0 A;  2LVM A;  4OMP A;  4QQD A;  4Z89 A;  3GIB A;  2DZ9 A;  3CCE Q;  2H3E B;  3VKI A;  2DEQ A;  2HSP A;  3M59 A;  2EQK A;  4XU0 A;  2RM4 A;  3OYC A;  1MGQ A;  1H3Z A;  1RAD B;  2E6Z A;  2F2V A;  2L89 A;  2FZC B;  2O01 E;  1KSW A;  1MMD A;  3JB9 J;  5CIU A;  3S3M A;  2DJQ A;  1VQK Q;  1M8V A;  1AOJ A;  1ZUY A;  3A5Z B;  2LJ1 A;  4PJN A;  3G1J A;  1KJW A;  2ABL A;  1KD1 C;  2NUT A;  1I0C A;  5GAN 6;  5KYW B;  3HFN A;  2JMA A;  1H3H A;  4BI8 B;  5GMK h;  3RUX A;  4FYW B;  2COW A;  2D1X A;  4B9W A;  3RKY A;  4IUR A;  5I22 A;  4A4K A;  3OS0 A;  2HQX A;  1KQ1 A;  1B07 A;  1IXD A;  1ZHI A;  3A8O B;  2CZ7 B;  2OJ2 A;  1JBM A;  3CME T;  3CPF A;  3SD4 A;  3LH0 A;  2YLC A;  2JVV A;  1Z9Q A;  4J9F A;  2DFU A;  3CMA T;  4JLG A;  2HDA A;  4CC7 A;  3LX7 A;  1UG1 A;  4KGZ B;  2DNU A;  3CME Q;  3RMQ A;  1ZA1 B;  3PE0 A;  1AZG B;  3CCQ T;  4MZM A;  4AG2 C;  2E65 A;  1VQ8 Q;  4EPC A;  1FXX A;  4BY6 B;  3M5A A;  1X69 A;  1VQL T;  2LMJ A;  2E4H A;  4B6M A;  1G3S A;  1LOJ A;  1Q81 C;  4ZGD B;  1K73 R;  1OU9 A;  1VQ7 Q;  3PFS A;  1AWO A;  3NFC A;  3FB9 A;  3ZEH A;  3P8H A;  3OQ5 A;  3BFM A;  1G3T A;  1QVG S;  2FRY A;  2QTX A;  3M57 A;  5GAM d;  1QVP A;  3KUF A;  5LJ3 e;  2NUT B;  2RPN A;  4C5E A;  2PUK B;  1VOM A;  1SSF A;  4CC2 A;  1DJ7 B;  3V8J A;  2B8A A;  3CCE A;  1NJI R;  3I56 A;  2YUQ A;  3CCS Q;  2AIR B;  4E7I A;  3VYG A;  2RO0 A;  4OMO A;  2LCL A;  2DA9 A;  2CS7 A;  4L6V 5;  3GNG A;  4M7A D;  2GTO A;  1TTH B;  3QII A;  2GNC A;  2K2V A;  3CD6 A;  1QKW A;  3IQL A;  3EH1 A;  1BB9 A;  2F5T X;  2HBP A;  1W2B P;  5EG2 A;  3EGU A;  3FC3 A;  4RTV A;  2RF0 A;  4HCZ A;  5KYY A;  3CC7 T;  2PVD B;  1QWF A;  1HK9 A;  1YWP A;  4RKU E;  3JB9 G;  3SDZ A;  4E7Z A;  2JMC A;  1OX8 A;  2X9H A;  2LRQ A;  1RAE B;  1KC8 R;  1QVG A;  4C92 B;  4OP0 A;  4O5V A;  5J3B A;  3S6W A;  5GMK m;  3OS2 A;  2D0Q B;  5KYY B;  5I2M A;  2EVR A;  1LVK A;  2VV5 A;  4J9H A;  1M2V B;  3V8K A;  2ENM A;  3TQ7 P;  4C0D C;  3OA6 A;  2D8J A;  2V1Q A;  1T3S A;  5HCK A;  1ZUK A;  3CCM T;  3X20 B;  4F14 A;  4LNP A;  1M1K C;  5CKE A;  4MDW A;  4ME7 A;  4DBR A;  1YJN A;  3G4S Q;  1RLQ C;  2MF2 A;  3BY7 A;  1TS9 A;  3LGL A;  4JS4 A;  1M27 C;  2MYS A;  2PNI A;  3QDR B;  2L3S A;  1VA7 A;  2JNG A;  2KMT A;  2K9G A;  5LJ3 f;  4RTZ A;  1OQK A;  1QVF S;  4DOV A;  1PD0 A;  1SSH A;  1FX7 A;  8AT1 B;  1U5S A;  3CC2 T;  4M75 C;  3TRE A;  4DBH A;  3VS2 A;  2D9T A;  1AT1 B;  2FVU A;  2OI3 A;  2OAU A;  2P4T A;  2A36 A;  1YJW Q;  3V8L A;  2XIC A;  1A0N B;  4PL6 A;  1YIT Q;  2Z0W A;  3EFR A;  1BI1 A;  4M7D C;  4BDY A;  5LJ3 d;  1MMA A;  2MIO A;  1KG1 A;  5FU7 B;  1IHV A;  2F1L A;  2L5Q A;  1WFW A;  3JB9 I;  2A3L A;  2ROT A;  3UDC A;  2KY9 A;  4XK8 E;  1WIE A;  3RBB B;  4M77 A;  3REB B;  3CCS A;  4B9X A;  4JJC A;  5KYN A;  5AT1 B;  3J80 E;  4J9B A;  2W10 A;  4FW1 A;  2YUP A;  1W1F A;  4DEY A;  4E7J A;  1BI2 A;  4Y92 A;  5GMK j;  2HMA A;  2YRD A;  3EH2 A;  1VQ6 A;  1WHG A;  1VQN T;  1SHG A;  4C5I A;  2KI7 A;  4KUL A;  4XTV A;  4C0F A;  4DQ2 A;  2VUB A;  4ESR A;  3M58 A;  1W6X A;  4ZN3 A;  2G6F X;  4C92 C;  1I07 A;  2LNH B;  1VYU A;  4EIK A;  1O75 A;  9ATC B;  2RK1 A;  1ZSZ A;  2K79 A;  3PGG A;  3X25 B;  3EG3 A;  4LUE A;  5LJ5 f;  1YJW T;  1I81 A;  1WQW A;  2HZY A;  2R5A A;  3R6N A;  4M78 B;  4HCK A;  2L3P A;  5KYX A;  3EGX B;  1M9S A;  4N0A A;  4JLI A;  2E1H A;  1WLP B;  4MZT A;  2IIM A;  2ZPH B;  4E7H A;  1JJ2 S;  2EQJ A;  1S72 Q;  5KYU B;  2B86 A;  2CH4 A;  5D6X A;  1IZ6 A;  5IHN A;  2CZ0 B;  1YHQ T;  2MOX A;  4M77 B;  3THK A;  1YJN Q;  1M4Z A;  4PJM A;  5EC7 A;  4GLK A;  2KYM A;  2QQR A;  4P5N A;  3C0C A;  4M77 D;  4KUI A;  3MHX A;  5GAM f;  2MWP A;  3FRN A;  3M0R A;  2OTL T;  2DTO A;  1N8R U;  2O9S A;  4C8Q G;  5CKD A;  1UEC A;  3TSZ A;  3GBQ A;  1C1A A;  3X28 B;  3NMZ C;  5GAN g;  1JJ2 A;  2XG8 D;  2E3I A;  3KXT A;  2C0T A;  3I56 Q;  2P0P A;  1HSQ A;  2O2O A;  4JUV A;  1NYF A;  2GQI A;  4CI0 C;  1BIB A;  1K9A A;  1HJD A;  1WA7 A;  2FL7 A;  2QA4 A;  3H0H A;  4N4G A;  4AFZ C;  4R55 A;  3INZ A;  4CRI A;  2OTJ T;  5KCH A;  5CKB A;  3OW2 S;  4E2F B;  1YIJ T;  4IUQ A;  2FO0 A;  3QZ5 B;  1YP5 A;  4A53 A;  4XTU A;  2QEX T;  2VAS A;  4A4E A;  1IRE B;  4ZGE B;  1UDL A;  2VGM A;  3A1P A;  1RLP C;  4A4G A;  1Q95 G;  2YRV A;  1UUE A;  3GF5 A;  3HHT B;  1RI9 A;  1M8M A;  2JM8 A;  1BYM A;  3CCQ A;  1FWZ A;  2CRE A;  3GNF B;  4M7A B;  1SHF A;  4LDU A;  2RQT A;  1OPL A;  2E6N A;  2CT3 A;  3TU4 K;  3OS1 A;  2JUF A;  4IIO A;  1NLP C;  3FIF A;  2KK4 A;  4D8D A;  2CSI A;  4OVA A;  3RMS A;  2L0A A;  2RHY A;  3CPW S;  1VQ5 T;  2QQB A;  3JB9 H;  3CCV Q;  1V76 A;  2QG9 B;  1WHM A;  2DXB A;  4FT4 A;  4D6W A;  2M16 A;  2VB6 A;  2M02 A;  3JCM X;  5C0M A;  1I4K 1;  5LL6 S;  3FJ5 A;  2LQ8 A;  5I11 A;  4BY6 C;  4HXJ A;  2FZK B;  4IUT A;  1Y07 A;  2XDP A;  1RL2 A;  3RKX A;  1WHK A;  2RH2 A;  4GY5 A;  2Y4Y A;  2PZ1 A;  2Y4X A;  4C8Q E;  3CCJ A;  2DMO A;  1MMG A;  2C06 A;  5A0L A;  5LJ5 e;  3F70 A;  1U1S A;  3HL8 A;  5J26 A;  1VQ8 A;  3SEM A;  2MPX C;  3L2W A;  4X1V A;  5A0G A;  1VQL A;  4J7I A;  2DEU A;  4JJD A;  5CQY A;  1X6O A;  2ED1 A;  2L3R A;  2K5L A;  4KGV B;  2CT4 A;  4BUG A;  3MEU A;  4F7U A;  4PJJ A;  3RR6 A;  1K8A U;  3OSS C;  3J7A F;  3FDR A;  2M0Y A;  2J05 A;  1HD3 A;  5GMK e;  4AG1 C;  1OI1 A;  4QQG A;  3CCE T;  3OYD A;  2E5K A;  3S3O A;  4FSX A;  4MMK A;  2C0I A;  4C0G A;  4RTW A;  4X9D A;  4LDY A;  3CEY A;  1YN8 A;  1NEG A;  2HEQ A;  1RUW A;  1M2O A;  3CCR A;  3MJX A;  1ARK A;  1H64 1;  4HT8 A;  2DD4 A;  1VQP T;  1WQ7 A;  5CQX A;  4DEX A;  1NYG A;  3E1S A;  5CKH A;  2K57 A;  3TVT A;  1BCM A;  3O5Z A;  1BK2 A;  4C0Z A;  5LJ5 d;  2GF7 A;  3CMA A;  3VRY A;  4NOY A;  4PJO A;  2VC8 A;  1VQK A;  3A8G B;  4A63 B;  2DIG A;  3L1A A;  1MND A;  1D09 B;  3PNW C;  2CZ6 B;  2IPO B;  2F69 A;  1PRM C;  1WJQ A;  1AWX A;  4EMH A;  4XAX B;  1PSF A;  3OW2 A;  2LP5 A;  3VV0 A;  3I35 A;  5KYU A;  2BZ8 A;  1WXB A;  1NJI C;  4JRQ A;  3JB9 F;  1NG2 A;  4RG8 A;  2MK5 A;  4RCB A;  2EBP A;  1LJO A;  1BKB A;  4FSS A;  3QYH B;  1KC8 C;  1YFN A;  4N4I A;  1OZ2 A;  5FRM A;  2RD1 A;  4C8Q D;  4M7D A;  2X4W A;  1QP3 A;  4OB3 B;  4RTU A;  1N8R C;  2QYZ A;  3CPW A;  2BIV A;  1H92 A;  3M0Q A;  5GAM j;  2RQW A;  1IB8 A;  5HKC A;  4Z8A A;  2KRM A;  4BI4 A;  1M2V A;  3LH5 A;  1Q7Y R;  1VQL Q;  3MEA A;  2OTJ Q;  2X4X A;  4PFP A;  3LW5 E;  3CD6 T;  2NUZ A;  1SPK A;  1PM3 A;  1M1F A;  1JEG A;  4PJL A;  3G6E A;  4F04 B;  4HVV A;  3R6O A;  1WXU A;  3GLX A;  2ED0 A;  1CKA A;  3TCJ A;  5GAN e;  2DL8 A;  2BUD A;  1TSF A;  3CCL Q;  2HKN A;  1YJW A;  4KT0 E;  3LYI A;  1X27 A;  4F7U E;  2JOY A;  2LCC A;  3TSW A;  1OYX A;  2BZY A;  2J7I A;  2MMP A;  4RTX A;  2AZS A;  4E7K A;  2X3X D;  1Y71 A;  2RK2 A;  3G6E Q;  5IH2 A;  2CYZ B;  3NPF A;  2DL3 A;  4M7D G;  1QKX A;  2LQK A;  4M78 F;  2CP3 A;  1NPR A;  1X75 C;  5GAO p;  1TWB A;  2J6K A;  4LE9 A;  1VQM Q;  3T9N A;  3SWN A;  1KFZ A;  4WTO B;  3OYY A;  1D3B B;  1VQ7 A;  4RCC A;  5D6Y A;  1HXD A;  2KNB B;  2JS2 A;  1SKU B;  5GJW B;  1T0H A;  5I21 A;  4D8K A;  1GCQ A;  1Q81 R;  1RAA B;  3OYM A;  1RAG B;  2CP5 A;  3SHW A;  1K76 A;  4FW2 A;  5CO7 A;  3X24 B;  4PJO E;  4M78 C;  4C8Q C;  3JCM V;  2JN0 A;  4BE2 A;  1QP2 A;  3OYA A;  1M5Q 1;  2YHT A;  3JSC A;  4AFQ C;  1VQO Q;  2LNV A;  2DXC A;  3EFO B;  4KH0 B;  1Y96 B;  1FYN A;  5ECA A;  2HCK A;  4LUD A;  1RAI B;  3QWX X;  4MML A;  2E41 A;  1MNE A;  2HSE B;  2DTI A;  2GBQ A;  1IO6 A;  3SWN C;  3VUB A;  4EDU A;  2LTO A;  2OTJ A;  4QKU A;  4L5G A;  2PUO B;  2GFU A;  3H6Z A;  4EMK C;  1YIJ A;  4EMG A;  1M90 C;  2R58 A;  5IHI A;  4MDX A;  1GCQ C;  3J81 E;  2FG0 A;  3D7S B;  2K3X A;  2FPF A;  3QYG B;  3CPW P;  3CBM A;  2O31 A;  1QLY A;  4LDV A;  1X01 A;  2VXE A;  4UC4 A;  4OMQ A;  3QHS A;  1UGR B;  1YHQ A;  3CXC P;  1K9M R;  1WZO A;  1D3B A;  3I9Q A;  1JU5 C;  3EG9 A;  3CC2 Q;  4LN2 A;  3H41 A;  3EHQ A;  2V26 A;  2DLP A;  5GAN 4;  5CCA A;  1S72 A;  2H8H A;  3JCM h;  2V8K A;  3CCM A;  5A2Q E;  2L2P A;  4M77 G;  4WF2 A;  2E10 A;  2D8H A;  3CXC S;  1VYT A;  4OF1 A;  4OB2 B;  3CME A;  1YJ9 T;  2HKQ B;  1K9M U;  1YHQ Q;  1UGV A;  3ZFJ A;  3C4S A;  4EMK A;  3QDF A;  4M75 F;  4X9C A;  1KD1 U;  4PNO A;  4RTT A;  1K4U S;  1NM7 A;  4PFZ A;  2ZPF B;  4RG2 A;  1G8X A;  5FWB A;  1M3C A;  3L42 A;  4OB0 B;  2EGE A;  4IUP A;  5GAO n;  1D0Z A;  1KQS A;  3EG1 A;  1X2K A;  1VUB A;  3UA7 A;  2AKL A;  4GBQ A;  3C95 A;  4Y28 E;  2R5M A;  4KBM B;  3VJP A;  1IGQ A;  2F5K A;  3CCU A;  3URG A;  1LNX A;  5FLX E;  2O4X A;  5KYX B;  3MP6 A;  1EFN A;  4J8O A;  3VUZ A;  2EYQ A;  2QEX A;  1RAC B;  1MHN A;  1AWJ A;  2CZ1 B;  3P8D A;  2F2W A;  5CKF A;  3RNJ A;  4OMF B;  1N9S A;  3FJP A;  1K9M C;  2EQM A;  2QXF A;  4HCC A;  1X2Q A;  3MP1 A;  4QVC A;  4BE1 A;  1D1A A;  4F16 A;  3OY9 A;  2QQA A;  4PK4 A;  1OU8 A;  4M75 A;  2WSF E;  1PG5 B;  2EQU A;  3VU3 C;  3JV3 A;  3CCL T;  4IKF A;  2LJ0 A;  5GAO l;  5D7U A;  4KGX B;  4RMO A;  1ABQ A;  1G5V A;  2K4Y A;  3CCM Q;  1TXQ A;  1WX6 A;  5FW9 A;  2JZ2 A;  3SB2 A;  2RHZ A;  2X3W D;  2WAC A;  5KE2 A;  1TUD A;  1UGS B;  1ZBJ A;  2FYK A;  2KRN A;  4J5Y A;  4M77 C;  4Y91 A;  4ZTJ A;  1JQQ A;  1PKT A;  1JXO A;  3CC4 Q;  3ER0 A;  3GPL A;  4XU1 A;  3P8B B;  1ZBX A;  2KDS A;  1YI2 A;  4C92 E;  4IUU A;  2YXY A;  3PTA A;  4E7S A;  3M9Q A;  1G83 A;  1WHJ A;  4KH1 B;  5I2S A;  1LCK A;  3L2U A;  5IXF A;  3Q1J A;  2EW3 A;  2HL5 C;  3M56 A;  3TEE A;  3E9G A;  4CC3 A;  5GAO r;  2RMO A;  3VRZ A;  1YJN T;  3H0F A;  1K73 C;  4Z02 A;  3H8Z A;  2V8I A;  2COY A;  2L8D A;  4PJO C;  2I0N A;  2RJE A;  1UJY A;  2JM9 A;  2YDL A;  4QQ6 A;  2QGF B;  4E7L A;  4J9C A;  2OTL Q;  2AK5 A;  2VGN A;  2PVG B;  3HRU A;  2WSE E;  4NS5 A;  4BB7 A;  2A7Y A;  2K6D A;  2A37 A;  1Y57 A;  1NLO C;  2QEX Q;  3QJ6 A;  3OSV A;  4OGE A;  2QK0 A;  4J7F A;  1W70 A;  2CKK A;  1XOV A;  1KQS S;  1MUZ A;  3DB3 A;  1BIA A;  3MET A;  4FT2 A;  1YJ9 A;  3CCU Q;  4M7D E;  1QCN A;  2DAQ A;  2DRM A;  3OYH A;  4PKC C;  3CCJ T;  2DER A;  2W0Z A;  4HCB A;  2EKO A;  2QA4 Q;  1P92 A;  4M7A E;  4J6X A;  1E6G A;  3LWI A;  2LQW A;  1M90 R;  1GFC A;  4PLL A;  4HT9 A;  1ABO A;  2XHC A;  3VS3 A;  1VQP Q;  1QCO A;  5FU6 B;  4M7A A;  4C5H A;  3G6E T;  1NEB A;  3JCM f;  5L8R E;  2PTK A;  2EPD A;  1D1B A;  1PD1 A;  2DYB A;  3VYH B;  4V2S A;  1ACM B;  2RI3 A;  4JDS A;  2EYW A;  1MMN A;  2ZCF B;  4M7A G;  1YBY A;  1VQM T;  2ZPE B;  1IHW A;  3M0S A;  1VQ6 T;  1VQ4 T;  2CP6 A;  4XTZ A;  1D0X A;  2DO3 A;  2JJ9 A;  2R57 A;  2E5Q A;  3E9F A;  4IIM A;  2XDB A;  4RUG A;  4NL2 A;  4XTX A;  2DL7 A;  2LX9 A;  2LZ6 B;  3HFO A;  4FYY B;  1UEB A;  1QCF A;  2HBW A;  2HAX A;  2QI2 A;  3M4Y A;  5HK0 A;  1W2B S;  1YI2 Q;  1M1K U;  1AD5 A;  4EMK B;  2EKH A;  3UAT A;  1JRI A;  2VYT A;  3EGD B;  1Q82 U;  1VQ5 A;  5IT9 E;  3MPU B;  2KE9 A;  2VXF A;  5HY6 A;  1Y7X A;  3PIP A;  3NTH A;  1XNI A;  5GMK i;  1KHI A;  2QAZ A;  3CQT A;  2AT1 B;  1XQH A;  3EAE A;  2LQN A;  1UHF A;  3I5S A;  4HVU A;  3VS7 A;  2RA2 A;  1YCS B;  4Z88 A;  3G7Z A;  4M78 A;  3A8L B;  4PJO B;  2JTF A;  1B34 B;  1GCP A;  5KCO A;  1Q82 C;  2KT8 A;  2DK3 A;  8ATC B;  3EGD A;  3PVL A;  3L2V A;  3ME9 A;  3VS0 A;  2MAM A;  1VQ8 T;  2DL5 A;  4M77 E;  2KYB A;  3CBP A;  3EFS A;  1VIF A;  1VQN Q;  1K0X A;  1VQO T;  1QMC A;  3QKJ A;  1ZSZ C;  5KE3 A;  1NJI U;  5FRO A;  1C6V X;  4DOW A;  3PT9 A;  4BI3 A;  3CCR T;  1D0Y A;  6AT1 B;  4OB1 B;  4N0A C;  3WVD B;  2IVW A;  3OMG A;  1BU1 A;  3RES A;  2DZC A;  4QVD A;  4FM4 B;  4AMC A;  4JRI A;  1YJ9 Q;  1N5Z A;  3PIO A;  1FMW A;  4M77 F;  1Q86 R;  3PVQ A;  1OUL A;  2FPE A;  3O8V A;  1QWE A;  3CC4 T;  1ZUU A;  1S72 T;  4M75 B;  3G4S T;  1YIT T;  1Q7Y U;  3FEO A;  3DB4 A;  1I1J A;  2K5I A;  3RKW A;  3QXE B;  1VQP A;  1HYO A;  3M54 A;  3BDL A;  1I8F A;  3BE3 A;  3EG0 A;  1VQ5 Q;  3C12 A;  5GAM g;  4ELY C;  2YT6 A;  3UWN A;  1KC8 U;  2DX1 A;  1GBQ A;  2K3Y A;  2DBK A;  1QVF P;  1JJ2 P;  4ORZ A;  4K11 A;  3GOX A;  2LT1 A;  2HD0 A;  1OZ3 A;  3KFV A;  4PFO A;  4M7D B;  2LT4 A;  2FB7 A;  3UPU A;  1B7T A;  3MEW A;  4BD3 A;  1MV3 A;  3S3N A;  2EJG A;  2M1H A;  3QJY A;  3JCM e;  1SEM A;  2XD0 A;  1U3O A;  4FL6 A;  1X6G A;  2A28 A;  3ZBD A;  2DTH A;  1UGQ B;  4VUB A;  3WVE B;  3V7R A;  2LC4 A;  5CK9 A;  2RJC A;  3CBO A;  1TUG B;  5J39 A;  3CCV A;  2YRC A;  1WGS A;  2EAY A;  3I55 A;  1OPK A;  4XQ3 A;  1YNZ A;  3OYF A;  2RQV A;  4X34 A;  4JRK A;  2X51 A;  4JPB W;  4ATO A;  2AZV A;  2GFA A;  1Q81 U;  1VQ4 A;  4BAC A;  4M4Z A;  3CCJ Q;  2DXU A;  3JCM P;  2JTM A;  3VS5 A;  3EG2 A;  2HL3 A;  4M7A F;  5FU6 C;  3G71 Q;  1BI0 A;  4JZ3 A;  1N8R R;  2DVJ A;  2KVQ G;  3HTR A;  3MO8 A;  2YUN A;  5DY9 A;  3VS1 A;  1D1C A;  2DET A;  4WCI A;  3CCL A;  4M7D F;  1KQS P;  1Q7Y C;  1R8O B;  1PSE A;  4ZTF A;  1VQ7 T;  3HSB A;  1Y0M A;  2JT4 A;  4J9I A;  3DKM A;  2CP0 A;  1TUC A;  3QO3 A;  4TVR A;  5GAN h;  4DBQ A;  2RQR A;  2DRK A;  1ZX6 A;  1VQ4 Q;  4O6J A;  1WPY A;  4FIB A;  1GFD A;  5LJ5 h;  3E19 A;  2X4Y A;  1WJR A;  2JTE A;  4M75 D;  4JJN K;  1XJW B;  2K7A A;  4JJB A;  1WI7 A;  4N4H A;  3JB9 D;  4C0D B;  1YI2 T;  3LLR A;  4J83 A;  2DJZ A;  3A8M B;  3BW1 A;  2P4R A;  5A0D A;  2PQW A;  4FYX B;  5GJV B;  2LCS A;  2DIL A;  3JCM Q;  5GAN d;  1KHC A;  2CUB A;  2LX7 A;  5LJ3 h;  1UGP B;  3V7S A;  2NWM A;  2EGA A;  3CC7 Q;  4C92 F;  3OYI A;  2M9U A;  3RER A;  2KGT A;  3L2Z A;  2V8J A;  2EFI A;  3UF4 A;  2EJ9 A;  4M78 D;  2OAW A;  1VQK T;  3G71 T;  2RN8 A;  1UTI A;  2JS0 A;  2M0O A;  3OBW A;  2AKK A;  3MKD A;  1E7O A;  1M90 U;  2KAF A;  3PMT A;  2ZPB B;  1F1B B;  1I5O B;  1OOT A;  3QZ9 B;  3CC4 A;  3QSU A;  1I5L A;  2RJF A;  2KXC A;  1QW1 A;  1N27 A;  2VWF A;  2XU8 A;  1PWT A;  5FU7 C;  2ZPG B;  2BTT A;  3M55 A;  2VVK A;  5CVI A;  2D0N A;  3OYG A;  2NLU A;  4RTY A;  1U06 A;  2X4J A;  2BE7 D;  1X43 A;  4OML A;  1ZSG A;  1K1Z A;  5GAO q;  2DL4 A;  5GAN 7;  2KRO A;  2RI2 A;  4R0K A;  4BE0 A;  2CUD A;  1WHH A;  1TH7 A;  1WXT A;  2EWN A;  2ZGW A;  4M7A C;  1PKS A;  3M0T A;  1VYV A;  2DXT A;  5HK3 A;  3QBY A;  4J6W A;  3CCS T;  2GTJ A;  4HKE A;  3ULR B;  2RHU A;  5IXB A;  2DM1 A;  2QTV A;  4QT7 A;  4II1 A;  2C0O A;  4KUD K;  5LJ3 g;  1UB4 A;  4LXC A;  2KT1 A;  4NL3 A;  3M4G A;  3RDV A;  3FLG A;  2XI9 A;  1VQ9 T;  2A08 A;  2X35 A;  2XDD A;  3A98 A;  2DF6 A;  2RHX A;  5DLO A;  3I56 T;  1R0B G;  4XTW A;  3CC7 A;  3KBG A;  3HRS A;  3LGF A;  4E47 A;  1FMK A;  2KQW A;  4DBF A;  3U23 A;  2G3R A;  3X26 B;  4JZ4 A;  1GXI E;  3PMI A;  2RI5 A;  2SEM A; 
#chains in the Genus database with same CATH homology
 4BI8 B;  2VGN A;  2PVG B;  3HRU A;  2WSE E;  4NS5 A;  4BB7 A;  5GMK h;  1VQ8 A;  3OYL A;  5C6S A;  3RUX A;  2A7Y A;  3L2W A;  4M75 E;  4B9W A;  3RKY A;  5A0G A;  1VQL A;  3OB9 A;  3OSV A;  3QJ6 A;  4IUR A;  4J7F A;  4OGE A;  4A4K A;  3OS0 A;  4J7I A;  2HQX A;  3HSB A;  1KQ1 A;  1K8A C;  2CKK A;  1ZHI A;  1XOV A;  4L59 A;  3A8O B;  1KQS S;  4R56 A;  4XTY A;  2CZ7 B;  5CQY A;  3DB3 A;  1BIA A;  1X6O A;  3MET A;  1JBM A;  4FT2 A;  3JCM g;  3JCM c;  3CME T;  1YJ9 A;  2L3R A;  4M7D E;  4LD9 K;  2K5L A;  3CPF A;  4BUG A;  2IG0 A;  3MEU A;  3SD4 A;  2DAQ A;  4F7U A;  3LH0 A;  2YLC A;  4JRP A;  3OYH A;  2JVV A;  4PKC C;  1K8A U;  1N6A A;  3OSS C;  1U8R A;  3CMA T;  3FDR A;  4M75 G;  3CCJ T;  3J7A F;  1O9S A;  4JLG A;  5GMK e;  4HCB A;  2EKO A;  1OI1 A;  3LX7 A;  1P92 A;  2QQS A;  2HQE A;  1VQO A;  4QQG A;  4M7A E;  3CCE T;  3OYD A;  4J6X A;  3RMQ A;  4F7U G;  3LWI A;  4PLL A;  4HT9 A;  2DVE A;  2XHC A;  3S3O A;  4FSX A;  3CCQ T;  2XID A;  5FU6 B;  4MZM A;  4MMK A;  4M7A A;  4C5H A;  2EIF A;  3G6E T;  2E65 A;  4C0G A;  3JCM f;  1FXX A;  4BY6 B;  4EPC A;  4X9D A;  1B34 A;  5L8R E;  5DLQ E;  2MI6 A;  3M5A A;  4LDY A;  5GAM e;  3CEY A;  1VQL T;  1U1T A;  1AHJ B;  3QPH A;  3VYH B;  1YIT A;  4V2S A;  3JCM b;  2RI3 A;  4JDS A;  3CCR A;  1G3S A;  4JS5 A;  1H64 1;  4HT8 A;  2DD4 A;  1LOJ A;  5GAN 8;  1Q81 C;  2ZCF B;  4ZGD B;  4PJO D;  4M7A G;  1YBY A;  3QUI A;  1VQM T;  1VQP T;  1WQ7 A;  5CQX A;  3PFS A;  3NFC A;  3WXM B;  3FB9 A;  3ZEH A;  2D6F A;  3E1S A;  3P8H A;  3JCM d;  3RIR A;  2ZPE B;  5CKH A;  2K57 A;  1VQ6 T;  3OYB A;  3OQ5 A;  4C0Z A;  3BFM A;  5LJ5 d;  1G3T A;  1QVG S;  2GF7 A;  1VQ4 T;  3CMA A;  2QTX A;  3M57 A;  5IAY A;  5GAM d;  1QVP A;  4XTZ A;  1V29 B;  3KUF A;  5LJ3 e;  2DO3 A;  2R57 A;  3E9F A;  2E5Q A;  4NOY A;  2XDB A;  4C5E A;  2PUK B;  4NL2 A;  1SSF A;  4XTX A;  1DJ7 B;  3C94 A;  2LX9 A;  2B8A A;  2E64 A;  2VC8 A;  1UEB A;  2GQV A;  3A8G B;  3HFO A;  3V8J A;  1EIF A;  4A54 A;  4F7U B;  3I56 A;  1VQK A;  2HAX A;  2QI2 A;  3M4Y A;  5HK0 A;  2DIG A;  3AHU A;  3G4S A;  3L1A A;  4E7I A;  1W2B S;  3PNW C;  2XK0 A;  2PU9 B;  1W4S A;  2CZ6 B;  2RO0 A;  3VYG A;  1M1K U;  2LCL A;  2P0K A;  2F69 A;  2CS7 A;  4L6V 5;  1WJQ A;  4ZN1 A;  3CC2 A;  4PJO F;  3GNG A;  4EMK B;  2MWO A;  4C92 A;  4M7A D;  4PJO G;  4EMH A;  1JRI A;  4XAX B;  2VYT A;  1PSF A;  1Q82 U;  1VQ5 A;  4BDZ A;  3QII A;  3BDU A;  5IT9 E;  3OW2 A;  3VV0 A;  2K2V A;  3CD6 A;  2F5T X;  2VXF A;  1VQM A;  1NJI C;  5HY6 A;  1Y7X A;  4M78 G;  3PIP A;  4HA8 A;  3SFM A;  3NTH A;  1XNI A;  2HBP A;  3OYN A;  3OYE A;  4JRQ A;  4YTL A;  2DPP B;  1KHI A;  5GMK i;  3JB9 F;  3PMI A;  1XQH A;  4RG8 A;  5EG2 A;  5CR2 A;  3EAE A;  4RCB A;  3FC3 A;  1LJO A;  1BKB A;  1KC8 C;  3QYH B;  2RA2 A;  4HCZ A;  4N4I A;  1OZ2 A;  5FRM A;  3CC7 T;  5LJ5 j;  2PVO B;  2RD1 A;  4C8Q D;  4M7D A;  2PVD B;  3G7Z A;  4M78 A;  2X4W A;  3A8L B;  2JTF A;  1B34 B;  1HK9 A;  1QP3 A;  3N5B B;  4OB3 B;  1XTD A;  5KCO A;  4RKU E;  3JB9 G;  1Q82 C;  1N8R C;  2DK3 A;  4C5G A;  3SDZ A;  3CPW A;  2BIV A;  4M78 E;  3ME9 A;  3L2V A;  5GAM j;  2MAM A;  5GAN 2;  2LRQ A;  5HKC A;  1N9R A;  1VQ8 T;  3HKS A;  4M77 E;  3CBP A;  3EFS A;  4BI4 A;  1VIF A;  1VQO T;  4PJO B;  2AHJ B;  3MEA A;  1QVG A;  4C92 B;  3A8H B;  2X4X A;  4OP0 A;  3LW5 E;  4O5V A;  5J3B A;  4ZGJ B;  3S6W A;  3CD6 T;  5GMK m;  3QKJ A;  3CCU T;  3OS2 A;  1M1F A;  5KE3 A;  2D0Q B;  3G6E A;  1NJI U;  5FRO A;  4ELZ C;  4F7U F;  5I2M A;  4DOW A;  2VV5 A;  3R6O A;  3V8K A;  3GLX A;  3JCM J;  1G3Y A;  1NZ9 A;  3OYK A;  3TCJ A;  1YCY A;  3PT9 A;  5GAN e;  4BI3 A;  2BUD A;  4C0D C;  3OA6 A;  3CCR T;  3DLL A;  3CCM T;  1YJW A;  4KT0 E;  3LYI A;  1NPP A;  3X20 B;  4F7U E;  5GAN 5;  2JOY A;  4OB1 B;  2CGH A;  2LCC A;  4N0A C;  1M1K C;  1OYX A;  3WVD B;  5CKE A;  1WJS A;  2IVW A;  4MDW A;  3OMG A;  2I2L A;  4ME7 A;  3RES A;  1GXI E;  2MMP A;  2DZC A;  4QVD A;  4E7K A;  4FM4 B;  5KH6 A;  1YJN A;  4JRI A;  3OS5 A;  1Y71 A;  2RK2 A;  1NE8 A;  3OBY A;  3PIO A;  4FU6 A;  5CAI A;  4M77 F;  2MF2 A;  2CYZ B;  3BY7 A;  2DD5 A;  3LGL A;  4IUV A;  4JS4 A;  3JCM W;  4M7D G;  2BKD N;  2LQK A;  3O8V A;  4M78 F;  2HNI A;  3QDR B;  1NPR A;  1X75 C;  3CC4 T;  3DLM A;  5GAO p;  3MP8 A;  2JNG A;  2KMT A;  1S72 T;  3T9N A;  5GAN 3;  4M75 B;  5M9O A;  3G4S T;  1YIT T;  1Q7Y U;  3FEO A;  5LJ3 f;  3DB4 A;  3SWN A;  1QVF S;  4DOV A;  3OYY A;  3L2R A;  1D3B B;  1FX7 A;  2K5I A;  1VQ7 A;  3CC2 T;  4RCC A;  3RKW A;  4M75 C;  5D6Y A;  3CCE A;  1HXD A;  3QXE B;  3TRE A;  1VQP A;  2EJF A;  5GAN f;  3M54 A;  1K73 U;  3BDL A;  1I8F A;  2D9T A;  3OMC A;  2FVU A;  2Y90 A;  2OAU A;  2YLB A;  2P4T A;  3MEV A;  3C12 A;  5GAM g;  3CXC A;  5I21 A;  4ELY C;  3UWN A;  3V8L A;  1KQ2 A;  2XIC A;  4PL6 A;  1KC8 U;  2OTL A;  2K3Y A;  3I55 T;  1G3W A;  3EFR A;  3UT1 A;  3OYM A;  1BI1 A;  2ZZD A;  4M7D C;  5CO7 A;  4BDY A;  3X24 B;  3GOX A;  2E70 A;  4M78 C;  5LJ3 d;  4PJO E;  1KG1 A;  2LT1 A;  2HD0 A;  1OZ3 A;  5FU7 B;  4C8Q C;  1VQN A;  3JCM V;  2JN0 A;  2L5Q A;  5D6W A;  4M7D B;  2LT4 A;  2FB7 A;  4BE2 A;  3UPU A;  1QP2 A;  3OYA A;  1M5Q 1;  2YHT A;  3JSC A;  3MEW A;  3JB9 I;  1Q86 U;  2A3L A;  2LNV A;  2DXC A;  3UDC A;  4BD3 A;  3G71 A;  2GCX A;  1Y96 B;  2KY9 A;  4XK8 E;  3S3N A;  5GAM h;  1M1G A;  1Y96 A;  1WNL A;  2EJG A;  2M1H A;  4MML A;  2E41 A;  2RHI A;  3QJY A;  4M77 A;  2DTI A;  3JCM e;  3CCS A;  2XD0 A;  4B9X A;  4FL6 A;  3ZBD A;  2DTH A;  3SWN C;  1UGQ B;  4VUB A;  3VUB A;  3J80 E;  4EDU A;  2LTO A;  3WVE B;  3MCA B;  2OTJ A;  3V7R A;  2K5F A;  1JB0 E;  2LC4 A;  5CK9 A;  3SWN B;  4A4H A;  2RJC A;  2PUO B;  2GFU A;  3CBO A;  3H6Z A;  4L5G A;  4EMK C;  5J39 A;  3CCV A;  4EMG A;  4E7J A;  1YIJ A;  1WGS A;  2EAY A;  2R58 A;  1M90 C;  3I55 A;  4XQ3 A;  4MDX A;  4DA4 A;  1BI2 A;  3OYF A;  4X34 A;  5GMK l;  4JRK A;  3J81 E;  4LDX A;  5FRN A;  5GMK j;  2K3X A;  4C92 G;  5LJ5 g;  1VQ6 A;  4ATO A;  2GFA A;  1Q81 U;  1VQN T;  1VIE A;  3QYG B;  1VQ4 A;  4BAC A;  3CBM A;  4C5I A;  4PJO A;  4KUL A;  4LDV A;  2DXU A;  3JCM P;  1X01 A;  2VXE A;  4XTV A;  4C0F A;  4UC4 A;  2JTM A;  4QVZ A;  4M7A F;  3QHS A;  4LD6 A;  4DQ2 A;  2QA4 T;  5FU6 C;  1UGR B;  5LJ3 j;  2VUB A;  1YHQ A;  1BI0 A;  3M58 A;  2KVQ G;  3MO8 A;  4ZN3 A;  1D3B A;  4C92 C;  3HPW A;  4XU2 A;  5DY9 A;  2LDM A;  5GAN j;  1O75 A;  2KSS A;  2RB6 A;  2RK1 A;  1ZQ1 A;  5GAN 4;  3JAM E;  5CCA A;  3PGG A;  1S72 A;  3CCL A;  3X25 B;  4M7D F;  3JRZ A;  1Q7Y C;  1R8O B;  3JCM h;  2V8K A;  5LJ5 f;  1I81 A;  1WQW A;  5A2Q E;  3CCM A;  1YJW T;  4LDW A;  4M77 G;  1PSE A;  2E10 A;  4WF2 A;  4ZTF A;  2R5A A;  4M78 B;  4C92 D;  3CXC S;  1VQ7 T;  4OF1 A;  1YJ9 T;  4OB2 B;  3CME A;  1K9M U;  5GAO m;  3DKM A;  3ZFJ A;  3C4S A;  3QO3 A;  4TVR A;  1M9S A;  4EMK A;  5GAN h;  4N0A A;  4M75 F;  4JLI A;  2E1H A;  4X9C A;  4MZT A;  2E12 A;  2ZPH B;  4E7H A;  1JJ2 S;  2EQJ A;  1KD1 U;  4PNO A;  1VQ9 A;  4O6J A;  1WPY A;  4FIB A;  5D6X A;  1IZ6 A;  5LJ5 h;  2ZPF B;  3E19 A;  4RG2 A;  3L42 A;  2CZ0 B;  1YHQ T;  2X4Y A;  3HP9 A;  1WJR A;  4IUP A;  4OB0 B;  5GAO n;  4M77 B;  1KQS A;  4M75 D;  4JJN K;  4C8Q F;  3M53 A;  1M4Z A;  4N4H A;  3JB9 D;  4GLK A;  4C0D B;  1YI2 T;  1VUB A;  3LLR A;  2DIQ A;  4J83 A;  2QQR A;  2DJZ A;  3A8M B;  3BW1 A;  4P5N A;  3C95 A;  3L2Q A;  4M77 D;  4KUI A;  3MHX A;  2PQW A;  4Y28 E;  2R5M A;  5GAM f;  5A0D A;  4MZP A;  4KBM B;  2MWP A;  3FRN A;  3VJP A;  3CCU A;  2F5K A;  3URG A;  1LNX A;  5FLX E;  2QDY B;  3JCM Q;  5GAN d;  1KHC A;  2O4X A;  2OTL T;  2DTO A;  2O4X B;  3MP6 A;  4C8Q G;  1N8R U;  5LJ3 h;  3QG1 A;  1UGP B;  4J8O A;  3V7S A;  4PLI A;  3VUZ A;  2FHD A;  5CKD A;  2EYQ A;  2QEX A;  1MHN A;  3X28 B;  4Q5W A;  4C92 F;  3CCV T;  3OYI A;  2M9U A;  3RER A;  3L2Z A;  2CZ1 B;  3P8D A;  5GAN g;  2V8J A;  2EFI A;  5CKF A;  1JJ2 A;  2XG8 D;  2EJ9 A;  4M78 D;  4OMF B;  1N9S A;  3FJP A;  1K9M C;  3KXT A;  4C8Q A;  2EQM A;  2QXF A;  1VQK T;  4M7D D;  3ASK A;  4HCC A;  3G71 T;  2P0P A;  3MP1 A;  4JUV A;  3GP8 A;  4QVC A;  4BE1 A;  2M0O A;  3OBW A;  4CI0 C;  1BIB A;  3OY9 A;  2QQA A;  1BI3 A;  4QW2 A;  2XKO C;  1M90 U;  2KAF A;  3PMT A;  2ZPB B;  2FL7 A;  2QA4 A;  4N4G A;  4J6Y A;  4R55 A;  3QZ9 B;  5J26 A;  3CC4 A;  3INZ A;  4CRI A;  3QSU A;  1I5L A;  4M75 A;  2RJF A;  2OTJ T;  4A4F A;  2WSF E;  5KCH A;  5CKB A;  2EQU A;  3LWH A;  3OW2 S;  1QW1 A;  1N27 A;  3NTK A;  2RJD A;  3NTI A;  1YIJ T;  2XU8 A;  3VU3 C;  1Q86 C;  4IUQ A;  5FU7 C;  4C8Q B;  2QQ9 A;  2ZPG B;  3M55 A;  3QZ5 B;  4A53 A;  3CCL T;  4XTU A;  2ZPI B;  5CVI A;  5GAO l;  2QEX T;  4IKF A;  3V7C A;  2H3J A;  4A4E A;  1IRE B;  5AYF A;  2DKG A;  4RMO A;  4ZGE B;  4XU3 A;  3OYG A;  1G5V A;  2K4Y A;  2NLU A;  2VGM A;  5DM7 R;  1QVF A;  2X4J A;  4A4G A;  2JZ2 A;  2YRV A;  3SB2 A;  2RHZ A;  2WAC A;  5KE2 A;  3HHT B;  3HRT A;  5GAO q;  5IN1 A;  5GAN 7;  1UGS B;  3OYJ A;  2WSC E;  2RI2 A;  1BYM A;  3CCQ A;  1FWZ A;  3GNF B;  4OGC A;  4M7A B;  4BE0 A;  4LDU A;  1W2B A;  1TH7 A;  2FYK A;  2EWN A;  2E6N A;  2P0Q A;  4J5Y A;  1RI0 A;  2LVM A;  2ZGW A;  4M77 C;  4QQD A;  2JUF A;  4Y91 A;  3OS1 A;  3TU4 K;  4ZTJ A;  3GIB A;  2DZ9 A;  4M7A C;  3VKI A;  2DEQ A;  3FIF A;  2KK4 A;  3ER0 A;  3GPL A;  2DXT A;  4XU1 A;  3M59 A;  3P8B B;  1ZBX A;  2EQK A;  3QBY A;  4OVA A;  4XU0 A;  2KDS A;  3RMS A;  5HK3 A;  1YI2 A;  2RM4 A;  4J6W A;  4HKE A;  4IUU A;  4C92 E;  2RHU A;  2RHY A;  3OYC A;  3CCS T;  1MGQ A;  3PTA A;  3CPW S;  3M9Q A;  1H3Z A;  1VQ5 T;  4II1 A;  4KUD K;  5LJ3 g;  2QQB A;  5I2S A;  1UB4 A;  2E6Z A;  2L89 A;  3L2U A;  4NL3 A;  3JB9 H;  2O01 E;  3M4G A;  3FLG A;  3Q1J A;  3M56 A;  3TEE A;  3JB9 J;  3E9G A;  2DXB A;  5GAO r;  5CIU A;  3S3M A;  2XI9 A;  4FT4 A;  4D6W A;  2M16 A;  1VQ9 T;  2X35 A;  2XDD A;  1YJN T;  1K73 C;  3JCM X;  1M8V A;  4Z02 A;  5C0M A;  1I4K 1;  2RHX A;  3H8Z A;  5LL6 S;  5DLO A;  3I56 T;  2LQ8 A;  3A5Z B;  4BY6 C;  2V8I A;  4IUT A;  2L8D A;  1Y07 A;  2XDP A;  4XTW A;  3CC7 A;  3KBG A;  4PJO C;  1RL2 A;  2RJE A;  3HRS A;  2RH2 A;  2Y4Y A;  4GY5 A;  3RKX A;  2Y4X A;  4C8Q E;  3CCJ A;  3LGF A;  4E47 A;  1KD1 C;  4QQ6 A;  2C06 A;  2KQW A;  4E7L A;  5A0L A;  5LJ5 e;  2G3R A;  5GAN 6;  3X26 B;  3F70 A;  1U1S A;  3HFN A;  3HL8 A;  3GF5 A;  2RI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...