5CLLA

Truncated ran wild type in complex with gdp-bef and ranbd1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
179
structure length
179
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 54
structure length 179
sequence length 179
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cllA00
1E2EA 5EXXA 4C0JA 1GZSA 2A5GA 1OH5A 2QMHA 2WICA 5IRCD 1CBUA 4Q19A 4DCNA 1S8FA 2ZIAA 3R7WB 3CPHA 4R71A 5JS8A 2FNAA 1E9FA 3VU9A 2AXPA 3Q85A 2G0NA 4B3BA 1D2EA 2ZI5A 1Z8FA 3MCAA 3CR8A 4G01B 1T91A 1A4RA 3IEUA 2F1JA 2OUKA 3C7KA 2I1QA 1DADA 3K9HA 2ZR9A 4DVGA 1G20E 4XTCS 5D3QA 1NIPA 2ZETA 2B92A 3RLFA 1II9A 2O0HA 1SZPA 1E79A 5LBIA 4C0LA 3GJ7A 1PLLA 3VR3A 4AYWA 1KHTA 1L7VC 3SQWA 4CEHA 2IUSA 1UBEA 4P4UA 4NYJR 1NNEA 4XSGA 1YZQA 3VR1A 4BEJA 4W5JA 2H18A 3GP8A 4RFVA 1CP2A 3K0CA 4E5UA 1PJRA 3ECCA 4ESVA 2FEMA 4KYUA 1A2KC 3UWKA 3ZDQA 5CITA 5CDFE 1AGPA 2WMNB 1T5IA 3VR4A 2J7PD 2FE4A 4OI4A 4TLCA 4W5HA 4QXAA 5K8TA 3T1QA 4A2QA 1E9RA 4U5XA 3RVBA 2V8OA 4JL8A 5BW8A 2YC2C 4B76A 2GK6A 4HYYA 4NDZA 1YR6A 1Q1EA 1NVVR 4TSFA 3LX5A 3P27A 4YXWA 5E7MA 4ZDJA 3QKUA 3GLGE 3C41J 1GM5A 3W8NA 2FPMA 2JLYA 2MSCB 5AUQA 3DOFA 1T3SA 1OIXA 3U7FB 2A2ZA 4TMKA 4Y0AA 3VHLB 4E03A 4Q1CA 3U6KA 4PZYA 1KI8A 1O3YA 4JMPA 1G7TA 3I62A 2AN9A 2GZDA 3UMFA 5KPDA 1P2UA 4BQSA 1COWD 3IIJA 1FPMA 2VO1A 2C96A 1UBFA 2ZVQX 5CYOA 2Z83A 1YR9A 4LC1A 1MT0A 2YOFA 3S1AA 1FMLA 5EZ5A 3B5JA 5SZHB 3EASA 4IDNA 1KO5A 1XD2A 3LBIA 3BWDD 5G3YA 1QF9A 1D8TA 5FOXA 2B8TA 3U3JA 2P5TB 4UJ5A 5EZ6B 2ZJYA 1VIYA 1T4GA 3AF0A 2Q9BA 3AP3A 4KBGA 5AJWA 4DCVA 1Z06A 4OL0A 3K0SA 1GNPA 2C9OA 3TR5A 3GLGB 2VP9A 1E4YA 5CM9C 3RRMA 4A0FA 2J46A 1RVDA 4DLSA 3N70A 2WWHA 2REOA 3CRQA 4GT1A 2CHGA 4OK6A 2YWEA 4BZXA 3EZFA 2ZRKA 2IYRA 2BEKA 1RZ3A 2IS4A 5EUQB 4RZ2A 1KY2A 3H2YA 1C9KA 4YC7A 1JR3A 5BN4A 2YWGA 3CUEF 1ZC4A 5JEDA 1YZKA 2VHJA 3MLEA 1OXVA 3IKJA 2W58A 5HTKA 4M0LA 1XB2A 2OCBA 1ZM9A 2Y8EA 2REBA 3P32A 4ZIRA 5KDDA 1YE8A 2R9VA 2HT1A 4GP7A 4Q1FA 2NZ8A 3THWA 1WP9A 3GQBA 3QBTA 3R20A 4PPGA 4QBGB 1YKSA 4AK9A 1PLKA 1US8A 3KUCA 1CR0A 5CJ2A 5BXQC 5GVSA 1E2FA 2O8BB 4GBMA 4D25A 1G5TA 4JLBA 2FN4A 2RH5A 2ZSFA 4CEHB 4GRAA 1HY3A 5A4JA 5SZKB 1EWQA 2WSSA 3UK6A 4C2UA 1M8PA 1GL7A 3QJYA 4LYAA 4A9AA 1IOZA 1S9DA 4RSGA 1G64A 1K5DA 5EP2A 3C5CA 2Z0MA 1OH6A 3A4NA 1KNXA 5CB8A 1TUIA 4KYIB 3A37A 3VMFA 1ODFA 2ANCA 5H70A 4D0GA 3LBNA 2PL3A 4JLKA 1E3MA 4DKXA 4BFVA 1ZU5A 1G8HA 4HLUA 5HCIA 1OKKD 3CF2A 1CJUC 2EYQA 3ZVRA 1T0HB 3O8CA 1K6MA 4JVLA 4Y0VA 2AK3A 4XD7A 5HE8A 1P2VA 2LWIA 1JXOA 4JLVA 5GJCA 4B74A 4ZCIA 4G3XA 5CLLA 2HYDA 3BAFA 4LHZA 2NO0A 1ZUHA 4P4SA 2XJ9A 4Q4JA 4X8HA 3KQKA 2OBMA 4Q7KA 4FCWA 4DSUA 1WE2A 2V1XA 2AFHE 4TQ9A 5CB6A 5TMPA 3A1VA 4KO8A 4JLDA 4QC2A 1RYFA 1ONBA 2CVFA 3MAAC 4DHEA 1XD2B 2J0VA 3LV8A 4ASUD 2D62A 2FPKA 1TQ6A 1KIMA 1SULA 3CWZA 4PR0A 2HDNB 3B1ZA 1TX4B 1KO1A 5KNDA 2XITA 2QORA 2VLIA 3UXMA 3ASYA 2L0XA 5G53C 3RABA 1W0JA 2ZPTX 2N1BA 1E79D 4I1VA 3TE6A 4R98A 2V54A 4KFSA 4DLZA 2CCKA 1U94A 4II7A 4M1WA 1Z6XA 1FOEB 3KKMA 1T8TA 2QSYA 3D8BA 3BGWA 4AURA 1CEEA 5SZJA 1CJKC 2GF9A 1DPFA 2PZEA 4IDQA 3PV0A 4A15A 4MRVA 3NEJA 2YWFA 5TY0A 1PVOA 1IY1A 1ZUNB 1LB1B 2ZQ5A 1W4BA 4I1OA 4L9SA 4B44A 3KQLA 3PJRA 3I3SR 3IUYA 2HCJB 4MKIA 1ZRHA 4JT2A 3WP0A 4V0MA 1QVAA 1E2KA 4LI0A 3QKRA 4TSFD 4PAMA 3RS4A 1Z2AA 1BMFA 1D6JA 5KSOA 1NG1A 4A6XA 1G6OA 1HYQA 1OXSC 4UXHA 2QBYB 1HUQA 2P6NA 4B2IA 1W36C 4LHXA 2CNWD 2G9NA 4B32A 1W36B 2BC9A 1FMJA 4MGYR 2QP4A 1WA5A 2YOHA 2GVZC 2FSIA 2IW3A 4GOJA 2RB4A 1Y3AA 2Q3MA 2H8KA 1LFDB 1Q21A 1YZGA 3RHFA 2WPDA 4PHTA 3RS2A 1E2IA 4DC9A 5JEEA 2GXSA 3CW2A 4JKYA 3BS4A 3KTAA 4WZBE 4D4JA 2PLRA 1F2TA 4TT3D 2OESA 4V0OA 8OHMA 1P4SA 1DOAA 2EFDB 1KO8A 4ZI3A 3LLMA 2GJ9A 1VCMA 4ZV4A 1QVRA 1NMZA 1GNQA 5FTKA 1AM4D 1P2TA 2ZSBA 3LFUA 3NBFA 1FQJA 3U7HB 3ZQ6A 4RD4A 1OFHA 3TVTA 1E32A 2W83A 3SEAA 2HUPA 3IO5A 4TMVA 1S1MA 4EPVA 2B7CA 4HDCA 5FBLB 1E0KA 1U9IA 2QTHA 1HQYE 4TL6A 3AB3A 4C7OB 1SXJA 3WRYC 1ZM2A 3R9XA 1CF4A 2XXAA 4IVPA 4RD3A 4Q4JB 4ZKDA 2W6ID 3BIFA 3TBKA 3C8UA 4LV8B 1E0AA 1FQKA 1UADA 1JR3D 1MO3A 1XTRA 4PO9A 1KJYA 3O8RA 4DUGA 2PMKA 2CL7X 3BB1A 3FB4A 4MKFA 4NYMQ 2C77A 4PQFA 1XU4A 2R6AA 4LC0A 2EVWX 4IVQA 3KQUA 3CKLA 4LJ6A 5E7JA 1DAKA 3F0TA 3X1YA 4EAQA 1KI7A 2EFGA 3JVVA 4XWOA 3QXJA 3AM1A 1JB1A 2MSEB 2NZJA 2ZRBA 1XEFA 4CGZA 1R8SA 3PITA 1KMHB 4H1VA 2FDCA 5LDDC 1RKBA 1OXXK 521PA 2GWHA 3TK1A 1F3OA 2GK7A 1Z6TA 3IQXA 3WNBA 3BK7A 1E69A 4AYTA 2WSSD 2ZRMA 4NHOA 3KXLA 4CT4B 1F2UA 2FOLA 5BYKA 2PLFA 4RD2A 2ZRIA 4US2R 2BHRA 3LH5A 4KFUA 1HQCA 1OHHA 1I2MA 3PIRA 2BM0A 4DCTA 5B57C 4CVNA 2NPIA 2RGCA 4Q03A 3O47A 2IYTA 5JMTA 3IILA 2BJWA 2V3CC 1E2LA 3RWOA 3V4FA 1E4VA 1X8JA 2A9KA 1U2RA 2REXB 2R44A 4PHHA 3MWLA 2ONJA 5F98A 5JJIA 3NWJA 4D4KA 1ZNWA 1SXJE 1R0XA 4BZPA 3A58B 3HU3A 4XD7D 5FL7A 2ZXUA 3OZXA 2H1LA 3K0EA 4Q9IA 3VR5A 5HPYB 2ZI9A 4DLWA 1FNNA 3EXAA 3X2SA 2W0SA 3K09A 4PAQA 4G5OA 1ZD1A 2WBLC 4OHZA 2VP5A 4DJTA 3SQXA 2KB0A 3BBPA 3ICEA 3KTAB 2ZRCA 2J0QA 1GSIA 2GCOB 2QP3A 4IFEA 5KO2A 1BOFA 4HEJA 2RMKA 1G8YA 3KB2A 2ODEA 4HI0E 3LW7A 4IKEA 4PC1A 5FH9A 1VYVA 4QHYA 3ICQB 2V6JA 2ZAMA 4EPXA 1L4YA 5JWOA 4LV5B 1UKYA 3ND8A 1RIFA 4FI3C 2KWIA 4BFXA 3THXA 3VX4A 2ZROA 4ZI2A 2B7BA 1W0JD 3ADDA 3SFZA 1U9IC 2QMOA 2ZRGA 1SXJC 3BXZA 2OAP1 1SXJB 2PX3A 3P4YA 4FXPA 4C0BA 1KO4A 3HP1A 2XXAB 2XOKA 3MSXA 4HAWA 4TL8A 4RVCA 2FFHA 2UZIR 4QG7A 1CKEA 3RC3A 1W0KA 1XMSA 1PLJA 3KJHA 3SBDA 4K81B 4Q9LA 2F7SA 3T61A 3OE7D 2A5DA 2J87A 3BOSA 3X1WA 1EFCA 1A5TA 5C4MA 1EX6A 2GXQA 2VP6A 2WVJA 4BLTA 2OFOA 4A8JA 4C3ZA 5CYPA 5AJZA 3WMFA 4G5QA 1BMFD 4QHTA 4MYTA 4D6PA 1Z29A 1TQDA 4ZO4A 2FPLA 1UDWA 1E0SA 1AN0A 4IXMA 4WZAE 2AHOA 3BB4A 3EA0A 4JZKA 1AQUA 4PAOA 3GJXC 3CONA 1R5BA 2HF9A 1BH2A 1ZNZA 3HU2A 3JZMA 3T5GA 4L16A 2LCFA 5JWHA 2GRJA 2JJ2A 3I8SA 1JQLB 1TF7A 4KODA 5DE3A 4BLSA 3QOFA 1J8MF 4YONB 5K8LA 4B3GA 2RGBA 5BN3A 2WPDD 2ZE8A 2VTKA 2WWYA 4P4TA 3AUYA 2VP0A 4OBEA 1SGWA 4DSOA 4LOAA 4B75A 3GFPA 1UM8A 4BPBA 3U4QA 3WXMA 2R6CA 2VYFA 4C0QC 1WB9A 2QAGA 4I4LA 3BH6A 3AEZA 1GP2A 2VP2A 3CNOA 4Q1BA 1OJLA 4OK5A 3UKDA 2VQSA 1I2DA 4EUNA 3IBYA 3G0HA 1KNQA 1N6RA 5DHFA 2X77A 2JEOA 4B3DA 5E4FA 4HLQB 2GBLC 4IRUB 2FJUA 3MUFA 4F92B 1P73A 1SXJD 5FTJA 221PA 2D2EA 4KSBA 1I4TD 2H5EA 4OK3A 4DDVA 3CWQA 3D31A 4OYHA 3K09C 3OF5A 1VHLA 2F6RA 3U61B 5G40A 1KJWA 2ZREA 3EWAA 3BE4A 3K70C 2CE7A 3SJCA 3N2EA 4FMDB 4ARZB 3K70B 5EE5B 1N6LA 4M1KA 4HATA 1KMQA 2VSXA 4MYUA 3I73A 3VKHA 3QKSA 2GHIA 4Q4LA 4D26A 1EK0A 4DUGD 3DHWC 3TVDA 4UNQA 3WYAA 2IHBA 3ZS8A 1VTKA 4ABYA 3PG5A 4QBFA 2W2TA 3VAAA 1N3BA 4RY2A 4HUQA 1UBCA 2ZS8A 3L0PA 4OQLA 3VKWA 2IS6A 5FR2A 4PSKA 4E22A 4Q1AA 2ATXA 3WY9A 4O2RA 1DAGA 4PC3A 4PZLA 5JSZA 1QHSA 3FDIA 2JLUA 3Q5EA 4FN5A 4UNNA 4B3CA 1KJZA 3UMSA 1DO0A 4OKSA 1OB2A 4Q21A 3FVQA 5HZHA 1OHHD 1YQTA 2WHXA 721PA 4NMMA 1QHIA 1NG9A 4DWJA 5FPYA 3HDTA 4MDEA 4BLOA 5EXSA 3QPVA 3TH5A 4BASA 1E0JA 4A8JC 3I92A 1P72A 5JRJA 2GJ8A 2QN6A 4A8JB 1N2CE 1SQ5A 4I99A 1DO2A 3NG1A 1FX0A 2XTNA 3GJ6A 2W2XA 3EWSA 3KKNA 1KSHA 1OFUX 4MGKR 4XWKA 2XZLA 3AVOA 1EXMA 4BECA 4URWR 4HSEA 4B2PA 1XCGB 5FL7D 1P9WA 2RHDA 4WZ6A 2NGRA 1A7JA 2PEZA 4CF7A 4JLOA 2D2FA 3H4MA 3SBEA 3NIBA 2OFWA 4PX9A 3U3RA 3CNNA 5FOWA 4B3FX 2J7KA 2XZPA 2IA5A 3IIMA 3K0AB 4YDSA 1M1YE 4ZKEA 3L43A 2WAYA 1RJ9B 5CLQA 2BCJQ 3BJIC 3KL4A 1KK2A 4XOIA 1T5LA 1DBSA 4V0KA 1KZ7B 3TUIC 3K70D 4R7ZA 5JFGA 1GDDA 3CH4B 1BO6A 3QEOA 2AD1A 2ZYTX 2CJWB 2H16A 5GVRA 2ZUBA 2XGJA 3SE0A 1XEWX 2FGJA 3NH6A 4OHWA 2ERXA 2XSZA 5FUXA 1G3UA 3OHMA 4TYNA 1N0UA 5FPHA 3MWYW 4JLJA 4DCUA 4A4DA 2OEPA 5FTMA 3GLFA 4JVNA 2ZE5A 4M2LA 3VNUA 2VBCA 3THYB 4FINA 5K8UA 4MDFA 2N42A 1XCPA 2XOKD 3TAUA 3A8TA 3WP1B 4FWTA 1S96A 2EYUA 2VPPA 5H68A 2FFBA 3MWJA 1NN5A 4M9XA 2IUTA 4F4JA 1E96A 2JA1A 3C4JA 3AGQA 1W0KD 2JLSA 1SVWA 2O8DB 5FR1A 1TEXA 2KJQA 1HTWA 3QKSB 3VTKA 3QEJA 1EFTA 2IHYA 2H7VA 2R65A 1G21E 2DYKA 4NZYA 4B47A 2VA8A 1NLYA 4L9WA 2QROA 1KDTA 3KKPA 4DLVA 1OH8A 2ZRHA 4O3MA 3B78A 3KXIA 2OFXA 2ZRAA 4HUQB 4C9BA 1G291 1UKVY 2WJVA 4GFDA 2JLZA 1KY3A 3KQHA 1XPOA 1UBGA 1EFHA 2X2FA 4JSYA 4Q9KA 2JJ2D 3NC0C 5GJVC 1XMIA 3CX7A 2OILA 2PZFA 2WSMA 1Q44A 5EXPA 1ESNA 1T6NA 2ODNA 1ZNYA 5F9FA 3T15A 1YHNA 5BWMA 5FOVA 5F9HA 1BKDR 2G1JA 1FNMA 4P32A 4TTPA 1G41A 2FH5B 2ZI7A 1NBMA 1GILA 1A82A 1NJGA 3C14C 2CL0X 2C04A 5B30A 4M53A 4IEEA 4TL7A 3HYRA 1XJCA 3GLFE 5FTNA 2BJVA 1FX0B 1N6PA 3PXGA 3PEYA 2F43B 4XVUA 1OIVA 1ZC3A 2VIIA 3IDQA 4KLNA 2YZ2A 2HJVA 4K46A 5KSZA 2ZITA 4LPSA 2OO7A 1DARA 5CK5A 2Q0HA 2JATA 3GJ5A 4BLPA 2OCPA 1GKIA 1GVNB 3CLVA 4C2TA 1G7SA 3ND9A 1VIAA 1XRJA 5DSZA 2FFQA 1AZTA 2C98A 4NE2A 3T06B 2IYVA 4LYJA 1E98A 2O5VA 2JLQA 2ZE7A 5J47A 3ZGXA 2I3BA 3MRSA 4IHQA 2O8EA 2BBSA 3VNVA 3T1VA 1WDTA 3GMTA 4Q01A 3SN6A 1A1VA 1HE8B 2Q21A 1KGDA 2ZU6A 2J5XA 4NCHA 5AUNB 1WRBA 1ZJ6A 2O0KA 3CZPA 3W3ZB 4PHGA 2B8WA 4TTRA 5E3HA 3R8CA 3DM5A 3WYFA 4XSHA 4URYR 3TUZC 1HE1C 2E87A 2WJJA 4AY2A 3I72A 4YQFA 2OT3B 5IHPA 1Z6GA 4TZ6A 4A92A 2JAQA 4IW3B 2GEDA 2AK2A 3GLFB 1G18A 2N46A 3VU9B 4OJQA 3F8TA 4CRWB 2WKQA 5DLQC 4AC9A 3QPWA 1J7KA 2YV5A 1M7HA 1N0VC 4AKEA 3TSOA 2VL7A 1JAHA 4NKRA 4PPQA 1JEEA 2V4ZA 1NSFA 2H17A 2I1VB 4GI7A 1OB5A 3AKEA 4KJZA 4HB0A 4TLDA 1NY5A 1GRNA 1TU3A 2X1VA 1LS1A 1Z0FA 3NC1C 2KBEA 4QGHA 1MRNA 4D0LB 1W46A 2TMKA 3QBVA 3QF7A 4JVMA 3A36A 1TF5A 4OI2A 2IYLD 2OBNA 4TLBA 2IX3A 2AD5A 2CK3A 2W0MA 4RKEA 4MYHA 3K0CC 4V0LA 4KV9A 1Q3HA 1SHZA 1UEIA 3B2EA 1W4RA 3OIYA 2PT7A 3CPJB 4GSYA 3OIWA 4O0MA 1AKYA 2VHUA 1TUEA 3AH8A 5HZKA 2ZJZA 2ZSAA 3CZQA 4B35A 2HEIA 4TYWA 1E1RA 2IC5A 1AS0A 5TARA 2PCLA 2V6IA 4QKQA 4QJ5A 5D3MA 1WXQA 1WMSA 1KZGB 2WZQA 1U8AA 2ZTSA 3CRVA 2FWRA 2IYYA 4RCZA 2EW1A 1NIJA 1IAQA 2OCYC 5KDLA 1R0ZA 2JLVA 2FV8A 5FBVB 1G16A 1PUJA 2V9PA 1LS6A 4TN1A 1MR3F 3UANA 1IN7A 3ETLA 1JR3E 3LNCA 2ZRPA 3FMPB 2XSZD 3M6AA 1XFAA 3KQNA 1TAGA 2QM7A 4D2IA 4B34A 4EQ6A 3SC3A 5KNBA 5K8IA 2X8AA 4DB2A 1XJQA 1YZTA 2VHTA 4LJ8A 2VEDA 3GPLA 2OSBA 3REGA 3S1AB 2R6DA 5J4KA 2V55B 1KI2A 2QQEA 1JJVA 3AVUA 2WWXA 3U60B 1IY0A 2DPXA 1X8LA 3OIVA 4P3YA 4S2EA 2XB4A 4PHFA 3B1YA 1BYIA 4WXRA 1HT2E 2Q9CA 1DVRA 2O8EB 3L0OA 4LJ9A 1VCOA 3NVAA 4MRNA 3PCRB 4NCNA 1P61B 2C03A 1UPTA 1DS6A 2WWFA 1CJMA 1X3SA 2C5LA 3PQCA 5FUYA 5FOTA 1YR8A 1E9BA 3TKLA 1J2JA 2DR3A 4HZUA 4Z8XA 1WF3A 4QFMA 2EU8A 5KU1A 2BV3A 2EQBA 2OHFA 2GAAA 2RGXA 1T3LA 4CIDA 4ZDKA 1ZMXA 3AP1A 1DAIA 1EFRA 1Q22A 3AF3A 5KUTA 3LAWA 4HB3A 1P3JA 4R2IA 2ZI6A 1U90A 1OT3A 1JAIA 2J0UA 1G4UR 3NDBB 1BS1A 3LXRA 3ZLJA 3X1DA 5JBQA 4W7SA 1S3SA 4YMWA 3OEEA 4ZIRB 1YZNA 2QSZA 3U3KA 4N1AA 4YXWD 5BYJA 5KNCA 4IFBA 1XBTA 4XJXA 2BEJA 5KPJA 1RRCA 4OHYA 2CHVA 4OQFA 3KDSE 3AVXA 4YMVA 3THWB 3ZQJA 4RD1A 2HLDA 1US8B 3AF2A 4M1MA 3A1TA 1NBMD 3FMFA 1XX6A 4PPFA 1CRQA 3CM0A 2G6BA 2GEUA 4BFZA 2GJSA 1KAOA 1G9XA 1SVIA 3PUXA 1X1RA 1LVGA 4GOKA 4PANA 1IONA 1N6OA 3AVTA 1D9XA 2ZE6A 1ZYUA 3VFDA 4CZ2A 4MGIR 2GZAA 6Q21A 5IF9A 1XTJA 1OFTA 2E1RA 2Z4SA 1HV8A 1ZU4A 2WJHA 1R7RA 4NYIR 4IDHA 4KI0A 1XEWY 1Z22A 3GLHA 2IWRA 2HXYA 4WVFA 1J8YF 1XTQA 3K8YA 1OYWA 5TV2A 2GVDC 4A36A 4KFRA 1AJEA 4HLUC 4LJYA 4Z51A 5KOYA 3LLUA 4JL5A 5D3MB 2FF7A 4C0KA 1ZIOA 2FGKA 1JJ7A 4L15A 4G5RA 2YVUA 4ESHA 5L3QA 2VF8A 2BKEA 4PZZA 1SVMA 2HYIC 2QPTA 1XMJA 5EE1A 2PCJA 5IT5A 4L5BA 1E2NA 2CHQA 1N6IA 1NLZA 2O8FA 4A2WA 4LBZA 1E2JA 1SHKA 2NO6A 4IDPA 4O25A 4WOPA 3VR6A 2WIAA 1DAHA 4P4SB 3GJ4A 1V43A 4MKGA 4UJ3A 1G8FA 3IO3A 2QAJA 5A0FA 1MV5A 1F48A 2BMEA 4V0ME 1X8KA 3QUSA 1ZAKA 3CNLA 5DI3A 3E70C 4C4PA 3RANA 2IYZA 1AS2A 4FMCB 4NYJQ 1W2GA 1NP6A 2KBFA 4G5GA 2CVHA 3BFKA 3AKYA 2C78A 4M1YA 3NXSA 1GL6A 2Q3FA 4U00A 5BQ5A 2AWOA 3FOZA 2ZJ2A 3EZ9A 4AKIA 3HPRA 4ZDWA 1SVOA 5SZIA 4LSGA 4AI6A 5M04A 1XPRA 1AQYA 2ZUDA 1IBRA 4PFSA 5AWFC 4DLYA 5LD2C 2RHMA 3AKCA 2YNMA 4HAUA 1Z83A 5LD2B 4KXFB 4TWZA 1G1MA 1NVVQ 1IXSB 1BYUA 2ZS9A 3TQCA 1L2TA 1F60A 1W1WA 3GLHE 3X1XA 1QZXA 2KE5A 1MRSA 2CEAA 4XTRA 5UKDA 3B13B 1BIFA 4L4UA 3GEIA 2I4IA 1SVKA 1ZD8A 3QF4A 1QHHA 3KJGA 2OG2A 2ZJAA 1X6VA 1Z0IA 2AWNA 3QY0A 4US0R 1J90A 2BWJA 1G5PA 3LA6A 5B64A 3RRNA 821PA 2ZAOA 2HV8A 1E1RD 2MMCA 3QKRB 4IVRA 1NMYA 2IYQA 2PMDA 2GCNA 3P26A 2BKUA 2JJ1A 4X8LA 3DPUA 2R6FA 1XTIA 3T5DA 4G0NA 3WRXC 1L4UA 3A1SA 3ZIAA 1H8HA 2FA9A 2ORWA 4QNRA 3WNDA 4LRWA 1W5SA 3QKTA 4M21A 5JI2E 1J70A 5L8VA 4JSTA 3C16C 1WBBA 4XVRA 1P2SA 1XD8A 2WWGA 4EIWA 5L3RA 5A5GA 4CEJA 4JBYA 2NO7A 1F2TB 3GLHB 4IOMA 1KSGA 1AK2A 1GOTA 3QVVA 5DHAA 2WAXA 3JZAA 3PUYA 3GEEA 4JLAA 1QBKC 1JXMA 4CYMA 2IXFA 2QU8A 4FMDF 2P5SA 3QXCA 3GLIA 3P1JA 4I1UA 5JJKA 4V0NA 1G19A 1NMXA 1ZM4A 3IGFA 1GWNA 5L3QB 2ZRFA 5JS7A 5TXGA 1M6NA 5FPSA 3L8ZA 4Q66C 1E9CA 4DT1A 2DCUA 2Q6TA 1Z6AA 3IIKA 3A4MA 1CJTC 1H65A 1TU4A 2VP4A 1G3QA 4KBFA 3B1WA 3O8DA 2B6HA 4DDTA 4FCTA 1HA3A 1DG3A 4CEIA 3RNLA 2OLKA 4B71A 3ADKA 1U0JA 3BFXA 4YMUA 4AWXA 3FHTA 1GKYA 2ZUCA 1P6XA 1EFRD 3ZS9A 3PUZA 1ZNXA 1LV7A 4QBHA 1ELOA 2R2AA 4GMDA 3DMNA 3REFA 3SHWA 5AJYA 5DI3B 3LW8A 2Z5FA 3SS8A 4BLQA 3KFXA 3H0KA 4FW9A 5J4VA 2GA8A 2WOOA 3ZD7A 1X1SA 3GEHA 3CBQA 1D9ZA 2J1LA 3OEED 4YMTA 1S9HA 3T35A 3PEWA 1JR6A 3EAQA 2XJ4A 2HLDD 1U0HC 4PXAA 4NONA 1ETUA 4BFTA 3BORA 3QQ5A 1E2QA 1KKMA 2SHKA 4Z8YA 3NDPA 2ASEA 1CR4A 4D80A 4LK2A 3Q9LA 4R2HA 5JCPA 1F2UB 4W9MC 3A1WA 4JYBA 4TMXA 1NN0A 3W3AA 4JLNA 3U7EB 5LPNA 1N5LA 2YJTD 3AP2A 1RPZA 4F91B 4W5WA 3QF4B 3CX6A 3Q5DA 3TR0A 5HKKA 3GLIE 1TTTA 2ZYUX 5TVKA 5F3WB 3TSWA 3K9GA 1GTVA 5JI3E 4Q7JB 1KDRA 1JQJC 1GNRA 1M7BA 1ZUIA 3TW4A 3CF6R 4FCVA 1ZCAA 4JT4A 5FBRB 1XPUA 2IS2A 2F1RA 4I81A 4HAZA 5GJWC 2ONKA 1N0WA 1CTQA 4LDJA 1PZNA 2ZS7A 3HPQA 3HYTA 1N5IA 3IHLA 3KKQA 5EP4A 4PSAA 1B0UA 3OESA 3TAHA 1Y63A 1YZUA 2PBRA 3ZVLA 1Q0UA 1TL7C 1XD9A 5KTYA 1K5GA 2RGDA 3Q7PA 3M4YA 3BH7A 1QDEA 3B9PA 2ZI4A 4XVQA 4LHYA 3AVVA 3SZRA 3BERA 1RFLA 4CEJB 4Q4AA 4F4CA 4UNSA 1FW6A 3KFVA 1G3RA 1KI4A 1U0LA 4QM6A 1YVDA 4HZIA 4N3NA 4ILEA 3U2QA 4LHVA 5DN6A 2A3RA 3ZZ0A 5AK0A 3R7WA 2X2EA 1RRGA 2RGGA 2HJGA 2JDIA 3TIFA 4EPYA 2PX0A 2WV9A 3LY5A 4OQXA 4IOJA 4ACBA 2DWPA 3I32A 3VX3A 3W8RA 2IBMA 3GLIB 1NVWQ 2FZLA 2RGAA 3CO5A 2CLSA 1XXHA 4Q4HA 1TEVA 1EG7A 1TPZA 1UF9A 2ZJ8A 3T12A 3THXB 2CL6X 1Z63A 3ONWA 2QP9X 4U02A 3DEFA 1CR1A 2JJ8A 1E9AA 1RW4A 2P3SA 1TNDA 3L8YA 3Q7QA 4MRSA 2CE2X 2H92A 3G82C 1G5RA 2F3RA 2WWWA 2OXRA 1RRFA 1U8ZA 3PUWA 1KDPA 2FEOA 2QPOA 4CEIB 2GJKA 1N25A 4RFSA 2VH5R 2RKOA 4EFNA 2MMGA 3TUJC 4ZCMA 2F3TA 5DH9A 3RRYA 2D06A 4PO8A 3PR1A 1EGAA 2ZR0A 4HB4A 4KVGA 1NKTA 1NRJB 1G3IA 3AVQA 1NF3A 4LYFA 4OQMA 4P33A 1NI3A 1W2HA 1R4AA 4M8NE 3AF4A 1IJFA 4KHZA 1G17A 3SDZA 2A7QA 3EC2A 3L0SA 4Q9HA 4ZCLA 2OXCA 2QTVB 5KHOC 3RS7A 3LQRA 5TB5A 3RDPA 1MKYA 2BBOA 5AUPB 3QPUA 2DHRA 2JJ1D 3D7MA 3FTQA 2WKPA 4TLAA 5L3VA 5GADl 5JHGB 1LF0A 2WOJA 3GJ3A 1E2DA 3N2IA 4CW7A 2P6UA 3Q72A 3TMKA 2RAPA 4DEYA 3ZIAD 1KI9A 1H8HD 3I5XA 2BMJA 3W5IA 5J4HA 1ZM3A 3EZ2A 2WMOB 1LTQA 2NIPA 1NL3A 4C0AC 2OCAA 2J0SA 3TRFA 2BBWA 2XTMA 3DVLA 3FKSA 3SJBA 3ZJYA 3CRMA 5JRZA 3LXXA 1Z08A 3P20A 4JLPA 1N6HA 4HDOB 5BN5A 3KJEA 4NH0A 4WAUA 3KJIA 4XH9B 2JIZA 4Q9JA 5EJEA 1DE0A 4DEXA 1XXHE 3U4QB 2A5JA 1Z0DA 2VHQA 2XX3A 4Q48A 4YDHB 3SHFA 2QAGC 1FTNA 2QAGB 1UAAA 1N5KA 2EFCB 3QG1A 3PENA 2PEYA 3BC1A 3RSLA 3CX8A 3V9PA 1S2MA 3FHOA 2ZR7A 5F2EA 1RE0A 2X19A 5CDFA 3TJZA 2RGNA 1OIWA 2G77B 4KITB 4DLRA 1HEIA 3GD7A 2IL1A 1VPLA 1R10A 4LBWA 4A0HA 2P67A 1GRRA 4LJ4A 1W4CA 2OE2A 3ASZA 3GLGA 4GL2A 4DZZA 5CK4A 2G88A 4C30A 1XEXA 1C4OA 4TL9A 2CBZA 4FIDA 5EE3A 3EPLA 2EWVA 3F3YA 2GZHA 3SYLA 2VHCA 4HDQB 4PQRA 3I5YA 1NSTA 2ZSDA 1HT1E 3ZH9B 3TNFA 2WJGA 3NH9A 1YRAA 1D2MA 4BUJA 4HAYA 1G7CA 1AIPA 4LUCA 2GEVA 5LB4A 3MGCA 1T3HA 3SJAA 4ASUA 1XXHB 1KK1A 2HF8A 4Q4HB 4OJKA 1E99A 3WNCA 4QM7A 1R8QA 1KOFA 4KLZA 3B82A 3BD9A 5L3SA 2P0EA 3QXSA 3GFTA 3PVSA 2HXSA 2GILA 3HWSA 2IEZA 1KAGA 1Q1QA 4FWIB 3JVUA 1T8UA 4BLRA 2O8BA 5JSZB 4LGMA 3DL0A 2EWWA 1RYHA 1QHNA 1DAFA 2QY9A 4RFSB 3UG6A 1SKQA 3K9NA 2NPFA 1E2GA 4NYMR 1VKJA 5JJLA 1JALA 4DCSA 5HKKD 5FOUA 3BFVA 3EPHA 4FD2A 1M7GA 2QMUA 3MJRA 1H8EA 4LV6A 3CRW1 1IJEA 2IYXA 3QE0A 2ZEJA 1PUIA 1FUKA 5DNYB 1QHYA 2QNRA 1DAEA 4GZLA 2ODWA 5KYKA 4QJ3A 1UKZA 3WMGA 2DWQA 1M74A 4EPTA 4H9GA 2XNSA 4MGZR 1Z47A 2JGNA 3B1XA 1TQ4A 1N6KA 2QENA 3D6TB 4F38A 5IDVA 2QEQA 3OFNA 3EZ7A 3C15C 4G5SA 2ZYWX 4H1UA 2CNWA 3RRZA 4E07A 4EPRA 4HB2A 1AZSC 4AYXA 1OFIA 1VCNA 2KSQA 3FMOB 5AR1A 4BFWA 5FPTA 1C1YA 2YHSA 1MO4A 1Q57A 1GRQA 5G41A 5EQTA 3M0EA 5C4GB 3MFYA 2WTUA 3DDCA 4X8OA 1JNYA 1FL9A 1P7CA 1T0JB 1NJFA 1YR7A 3LVRE 5C46F 5DN6D 4EKDA 1VCIA 3IPXA 4UXIA 3EX7C 1DELA 1P60A 3T1OA 2JDID 421PA 4TT3A 2GETA 1MOZA 2PT5A 4PO1A 4BWYA 2IYUA 5FUVA 5E7IA 4JLMA 3U44A 3W90A 3A1UA 2IT1A 1AA9A 4D4LA 5FPKA 2AFIE 2RGNC 4JBWA 4UKDA 4MUBA 3FKQA 1W5TA 3DKPA 1VDZA 3TGPA 3T1TA 1NVXQ 4Z1MA 1CU1A 2GAOA 3KKOA 3MD0A 3GJ0A 2AKAB 3RAPR 3DM9B 4D81A 4TZ0A 1IN6A 3WMEA 1CRPA 1N6NA 3EW9A 1R0WA 4Q00A 4AG5A 3QXHA 2XEXA 1IHUA 2CMKA 1NBME 1FUUA 4M9SA 4Q5IA 1XF9A 4UNRA 3X1ZA 1XEXB 4TMTA 4MYCA 2ZSEA 2C99A 3EPKA 4ITRC 2MSDB 2W6IA 2IWHA 2FSGA 2WIBA 3V00A 4DDUA 4R9UC 3D3QA 1XTSA 2WM9B 3IQWA 2V1UA 2BIFA 4V02A 3TLXA 1E9SA 4HAXA 5C1BA 1LF5A 3ADBA 2IYSA 5DGXA 1OYYA 3EA5A 4TLEA 3BH0A 3W5JA 1UKEA 5L3SB 3KXKA 2VF7A 2QZ4A 2QBYA 2ECKA 3U6BA 5G3ZA 1YRBA 4POAA 3E2IA 4Q7LA 3CR7A 4MQBA 1ZINA 2ODBA 2YC4C 2IEYA 3Q8XB 4KFTA 3OEHA 3UPUA 2GTPA 4AG6A 3DMDA 2GESA 4MUAA 1IN8A 3FKSD 2J41A 4S35A 1E1QA 1XZPA 2IXEA 4DDWA 3B1VA 2DWOA 2JIZD 2AR7A 2AXNA 3RS5A 2QQ0A 1OXUA 1U8YA 2ZJBA 5J4YA 3THOA 4YMSA 2F55A 2FG5A 1SKYE 1SVLA 3AGPA 1XJ0A 2NG1A 2XTZA 3PEUA 2QUZA 1ZW6A 2FSFA 4EPWA 3U5ZB 4M22A 1HH4A 4IDOA 5AUOB 4URZR 2V7QA 1ZCBA 3A6PC 3RYTC 1WBDA 3MWKA 3RWMB 1FP7A 4QJ4A 2OBLA 1EESA 3A4LA 2IUUA 4C0SA 2IS1A 4RD6A 1FP6A 4NCKA 4JVSB 4F93B 4DBLC 4HLDA 4C7OA 2QE7A 3TQFA 4WA7A 4DSTA 2DBYA 4KCGA 4ZDIA 2OM2A 1KDOA 1Z6YA 3FHCB 5DYIA 1GUAA 2QI9C 4OQNA 4IOLA 2A5FA 5HR5A 5AJVB 4FMCF 3UATA 4PC6A 1KSJA 3QIAA 1VG1A 3IPYA 1R5OA 2CXXA 1JEDA 4DLXA 3L82B 1Z0KA 1LW7A 4NPHA 4BGDA 2ZU0C 3QENA 3CH5A 4IEIA 2CCGA 4JYCA 3U44B 3WHLA 5ELXA 2FZ4A 4JL6A 2FU5C 1YU9A 1SKYB 1P9NA 4TTQA 1QRAA 3KUDA 5FL3A 4B6FA 1U98A 1M2OB 1TF2A 1OH7A 1Z5ZA 2BVNA 1OV4A 2F1HA 4JBXA 1KTVA 1P5ZB 4M9QA 1W4AA 5JLJA 3R8FA 1KMHA 2F1IA 3EG5A 3NEYA 4FMBB 5KSPA 2YKGA 1ZVQA 3R9IA 3WBJA 5FTLA 2ZJ5A 3FYHA 5H8WA 3HR8A 2C8VA 2PJZA 3BRWD 2AKYA 2GCPA 1W48A 4RKFA 5GJBA 5J5CA 2LKDA 1UFQA 1AGRA 1H8ED 2ZRDA 4CDGA 5KSYA 4URVR 2OV2A 2XNDA 3SYKA 3IEVA 1P62B 4D82A 4GZMA 4KVAA 2ZVPX 3OE7A 1KO7A 5B2ZA 1JPNA 4JJZA 3ZYCA 4BFUA 1OE0A 1NN1A 4G1UC 1VMAA 3K0FA 4RZ3A 5EE0A 1G8PA 1TQ2A 1VYUA 2GXUA 2QPAA 2Z43A 3NBYC 4LJ5A 3ZD6A 1W7AA 1L8QA 2D4HA 3U3OA 1X86B 4IOKA 3TSZA 4PC2A 4LX0A 3AQ4A 3EIQA 3OFND 3KZ1E 2A30A 1CLUA 2IXGA 3K1JA 5CJPA 4Z54A 5C2JB 4TYPA 1S3GA 1OF1A 4GMXA 4F7WA 4TMZA 2QG6A 3PUVA 4TYYA 5ANRB 4GPTA 3RS0A 3RS3A 4BE7B 4EDHA 5JECA 3AUXA 1FFHA 4UQOA 1JI0A 2BCGY 4JIMA 2FX3A 3VHXA 3J81k 3I8XA 4Q1DA 4ON9A 1Z0AA 2ZM5A 1NN3A 5TDHA 4TMWA 3E1SA 1Q1ZA 1U81A 3CIOA 1XTKA 3N5CA 5JHHB 4B43A 2GCOA 2Z6VA 3UMRA 4QNMA 1KK3A 1CULC 2ZI3A 3H84A 3B8HA 4A82A 2YOGA 1Q3TA 1V5WA 4LWZA 4KAXA 1CJVC 5HCNA 3SJZA 4GDFA 4EQ6B 1MO6A 1F5NA 1ZM7A 4MITA 5JZVA 4O2LA 3LDAA 5HE9A 2LKCA 3ZZUA 4Z1MD 3QG5A 2G1KA 1II8A 5EP3A 2OZEA 3SFVA 2DFLA 4IJMA 5CIWA 3KX2A 3QNUA 1E9EA 5DIFA 1G8GA 1PV4A 3DOEA 2WWIA 3AF1A 4GOXA 5EXTA 3B85A 2F9MA 3O8BA 4WIAA 1W47A 3U3MA 4CT5A 1CR2A 2A5YB 4PTLA 1KI6A 2KI5A 3AVWA 2A78A 2C2HA 1S0UA 4E09A 2NO1A 1O87A 3GFOA 3MG9A 4KU4A 1GL9B 4C0HA 2ORIA 4TYQA 2FMXA 3IBGA 1KI1A 4OHVA 3W6OA 1GIAA 2ANBA 1QG4A 2J3EA 4XIGS 4K8OA 3UIEA 2CK3D 2NQ2C 2QM8A 4HZUB 1IXRC 4Q47A 3DZDA 1Q20A 3BB3A 4DLUA 4B6EA 3CPEA 4DB4A 4NTZA 4LBYA 3V4RA 1D5CA 2DFTA 4PSVA 1R0YA 3HU1A 3IHWA 5J4LA 2VSOA 3EIEA 4PQYA 3FFBA 5FOSA 2BM1A 2J0UB 2P2LA 4UNPA 4Q02A 1W36D 3B6EA 4OHXA 1E94E 5FI0B 1XCMA 2YINC 3OIUA 3OEHD 1EWRA 3L2OB 1AS3A 4B73A 3LBHA 3QSYA 4TQAA 3FE2A 4PPNA 2G0TA 1E1QD 1YZLA 4A6PA 2JLWA 4M1TA 5P21A 4JS0A 2NTYC 1R2QA 3OAAA 2RCNA 2G3YA 2UVQA 3PEVA 5DISB 5JCZA 3ZVNA 5H1YA 4NBSA 2ZYVX 1JPJA 3NTUA 2YYZA 3K0FB 4EJSA 4TQUS 2GXAA 1GG2A 2BDTA 2J45A 1ZD9A 2V7QD 3G5UA 4XWAA 4P31A 4F4IA 2WKRA 4NU0A 2DY1A 2ORVA 3B7GA 1RC8A 1KI3A 4QRHA 5JWRA 1IY2A 1ANKA 3W34A 2XZOA 2IK8A 2GBLA 3FFAA 1CXZA 2QT0A 2QE7D 4JJKA 4A1FA 3E5HA 5IK2A 3Q3JB 1OXTA 2Q9AA 2QGZA 4V03A 4I1SA 4B48A 1KKLA 2WJYA 1WCV1 1D2NA 1JECA 1MABA 1Z07A 5EUMA 5E95A 4KSCA 1EFUA 2ZRLA 4ERNA 3HR7A 4NP6A 4ARZA 2W6JA 3FGNA 4Q18A 2W2VA 4BEBA 2O8FB 2JLRA 3WYGA 3LVQE 1Z2CA 121PA 4BRUA 4ACAA 3EC1A 4GP6A 4URUR 2QGNA 3M1IA 2BMDA 1KYIA 1LY1A 4ZPXA 3RC8A 4MH0R 3GJ8A 2G83A 4LY6A 3MJHA 1II8B 4A0RA 2D7CA 1XMVA 3R9WA 2HCBA 2UKDA 1UEJA 4MKHA 4HUTA 1LNZA 5FUWA 1J99A 1ZBDA 1I4DD 1XDBA 4EFMA 5DO9A 2RGEA 2DFKB 3CF0A 2J59A 4J0QA 3AV0B 1K8RA 1KI6B 1NY6A 1S1CA 2CCJA 4M1OA 4EFLA 1E2MA 2QRNA 2IYWA 3W6NA 1JBKA 4QOSA 3SYNA 1E2PA 1T9HA 1AKEA 2XNDD 3GCGA 1OLOA 3LD9A 2W00A 3L0IB 3T34A 3DO6A 2QT1A 3LO5A 1MH1A 2AX4A 1QG2A 4YLGA 3QVUA 3I4LA 1A2BA 3ZZTA 4AIIA 1W44A 4RCYA 3DZ8A 1G4AE 4BFSA 4LPKA 1DEKA 2JASA 4N0DA 4DLTA 4DRZA 1QHHB 3LX8A 2CDNA 5C18A 1TADA 4URXR 4LCBA 4NL4H 2GNOA 3SU8A 4US1R 1XP8A 2O8CA 2GF0A 2J7PA 3EZ6A 4RD0A 2O52A 3TW8B 2C9CA 2P65A 2VRWA 2QA5A 4DIDA 4NCJA 5B58C 3K0AA 3UWOA 3LWNA 2C9YA 1DAMA 1RJ9A 4QL3A 1Q1BA 1KK0A 3VQTA 4P0TA 1P75A 2ATVA 3HJNA 3PFIA 2YWHA 4UXJA 4A2PA 1ZIPA 1E9DA 3WBKA 2QL6A 3H86A 2E9SA 1XZQA 2B21A 1OW3B 4WBSA 1Z28A 1VG8A 2CJWA 3NKVA 4WW0A 4DIEA 4EJSC 1VG0B 4EJSB 4D0NA 2XAUA 3I1FA 1IQPA 1EX7A 4HLCA 1MO5A 4LYHA 1TMKA 2ERYA 1G7RA 3LRPA 1II0A 1COWA 1VECA 4QHSA 4BRWA 5AJXA 3NBXX 1IN4A 5EE9A 1R5NA 4OI0A 1FTSA 3K9LA 3CRRA 3SNHA 2EFHB 1Q12A 4L8GA 4MA4A 2CLDX 3THYA 5FBQB 2BMFA 3RSOA 4M4SA 5J40A 1XWIA 3VR2A 2D74A 2R8RA 3NHAA 2BOVA 3DKVA 4QBIA 1KSFX 1GITA 1MABB 2Q3HA 3ZVMA 1GFIA 4M1SA 2R6GA 1ZP6A 4BZQA 4DT1B 1B23P 1YJ5A 2O8DA 4DSNA 1VG9B 5DI9A 2F9LA 4LJ7A 3C5HA 1ESMA 2OAQ1 1XNJA 3K53A 4RJLA 4DXAA 3SR0A 3CB4A 3AVPA 1S4QA 4RZXA 4OI1A 1NLFA 3W6PA 3LQQA 1M34E 2ZJOA 2GKSA 4MRRA 1VHTA 4HAVA 1WQ1R 2XB2A 4NCIA 3B9QA 4AKGA 2AL7A 3EARA 1DTSA 3VKGA 1IM2A 2C95A 4B33A 1F6BA 1VYTA 4BFYA 2IF0A 1GAJA 2JCSA 5CM8B 2K5UA 1OPXA 2OLJA 2ZANA 4X8MA 1P9RA 1NKSA 4PC7A 2CLCX 5CIQA 2J9RA 2PZGA 4NYIQ 2IF2A 621PA 2BBTA 1I4LD 3OAAD 2DB3A 1FZQA 1HURA 5FI1B 3SI7A 1OSNA 2ZRNA 3FMIA 1CS4C 3AVYA 4LBVA 4WXPA 4B2LA 2QRZA 4LZZA 3WHKA 3AKDA 4U7DA 1IXZA 4M9ZA 3U7GA 2P6RA 5FFMA 2JLXA 5KDOA 3I61A 2F43A 2FSHA 3FWYA 1W49A 2QTFA 3F5FA 1UDXA 5FBWB 1QHGA 3NHBA 2D3WA 3P4XA 2DFNA 2FFAA 4Q7MB 3UG7A 3KB1A 2O8CB 4D4MA 3QXXA 1E2HA 1NVUQ 4RZUA 2NOAA 1E6CA 2QMEA 3MMPA 4LHWA 2Z4RA 2O0JA 4QGAA 2VSFA 2HT6A 2D7DA 5IK2D 3H1TA 2GJAA 3QI2A 1IN5A 4MRPA 4QGGA 2GDJA 2ZRJA 2H57A 2PJRA 3W9YA 4Q1EA 5LB2A 4IXNA 1DG1G 1OKKA 2WJIA 3SOPA 4A0GA 5DYGA 3ADCA 2W6JD 4JKIA 4QGFA 1GKUB 1Z3IX 4GNKA 4AD8A 1SVSA 2NO9A 4N0EA 1Z0JA 1N5JA 5EP1A 1G6HA 3NBZC 1RRPA 1R6BX 1UJ2A 4B3XA 1QHXA 2EFEB 3EPJA 4AKHA 2UZ3A 1CIPA 4LJAA 3B60A 3FPAA 2R62A 2NMVA 1U99A 3EIHA 4Q4AB 2PH1A 1G3MA
chains in the Genus database with same CATH superfamily
3K3PA 4D97A 5EXXA 1V35A 3BXEA 2QMHA 2CLKB 2IXDA 4L5YA 5IRCD 5IWAB 3ORRA 4FHGA 1V95A 2DTEA 4QICA 3R7WB 1LNQA 2J3HA 2J85A 3K9BA 4OM8A 1ZUD1 3QWAA 5JS8A 1G55A 2ICAA 3OF3A 3R7BA 4M0DA 5TT0A 1D2EA 1NQAO 2BT4A 1Z8FA 1JH8A 2QJRA 2ZI5A 1RHMA 1USKA 3PL5A 4G01B 3CQ9A 2MIIA 2WJZB 3EXFB 3ZHRA 1M2VB 1RQPA 4M86A 3KQTA 3RIEA 4WFKA 1DADA 1J0EA 2W6QA 3KUUA 4X94A 3WSTA 1DRKA 3UHJA 2QNBA 2GFQA 2ZT8A 4HUJA 4XTCS 1NIPA 4POOA 1IZ8A 3HDHA 3G23A 3R3WA 1E79A 4RH3A 3GJ7A 3TMAA 3AHEA 3DHYA 4L95C 4DR2B 1KHTA 4ITUA 4CEHA 2G17A 1VGVA 5T8KC 4OO3A 4NOKA 3H1BA 3GDFA 1Z4MA 1YDWA 4XSGA 1YZQA 3OQVA 1NNEA 4W5JA 2H18A 2ZIZA 1V5EA 4NJEA 1UL1X 1KJIA 4RFVA 3WGNA 2O2GA 3SMVA 3GO4A 5F35A 4E5UA 2I2FA 1GQOA 1Y8ZA 4YJ3A 1A2KC 1JFFB 1P44A 1WMEA 1AGPA 1N1GA 2WMNB 4R1NA 2PSSA 2J7PD 2RSLA 4QXAA 3UOWA 1CY0A 3IV6A 2Z04A 3A2KA 1B43A 2DSNA 2WJAA 4N3CA 3U7QA 3ED1A 3V8PA 2GK6A 2ZUUA 4CKCA 1Q1EA 3IP3A 4MP8A 1P8AA 3LX5A 4BTLA 1JE0A 5E7MA 4YPFA 1NDHA 1YVRA 1RYDA 1C8VB 4MCHA 1KMNA 5T4HA 3ZHUA 5J5AA 4AZ3B 1OWPA 5ALRA 3R7LA 2PD3A 1WTAA 2V5UA 3LL7A 2JLYA 3JXEA 2YYYA 3FPGA 2MSCB 3BREA 3UXHA 1QH8B 3DV9A 5K8CA 4C4XA 2YFQA 1Q92A 3EIUA 3SGLA 4IVNA 3GT7A 3TKYA 1G20B 3UUWA 2Y3IA 3D0RA 1QVVA 4JMPA 3PQEA 5E6RB 3VRHA 3VSEA 2VCEA 3H6HA 4LOIA 1G7TA 1OZ0A 5FBZA 1QTNA 2C8LA 2AN9A 5KPDA 2YYAA 3KLBA 4TM7A 1K6IA 3A6EA 3SNKA 5LP6C 1NXPA 3STUA 3VYSB 4MCIA 1HTTA 4LC1A 5F9MA 1MT0A 1XA0A 4CNBA 1AB5A 3B5JA 4W5OA 3FPLA 3D3KA 4ZOBA 2VNHA 1P33A 3LBIA 3H9JA 4RTLA 5GQSA 5JYEA 1QF9A 1D8TA 4TXLA 5FOXA 1SB9A 5A6VA 4UZSA 1QS0B 1AQNA 2HSZA 3DXXA 3NM4A 5EZ6B 1YBHA 4RVHA 1O8BA 1LKZA 3FTDA 3L7YA 2AC7A 2WKSA 2OO5C 2K4MA 2GHQA 4NJMB 3H7IA 3WGKA 3L6RA 5M7EA 1S01A 1T4MA 3TLKA 3H11B 3K0SA 1I1HA 5ILOA 3TR5A 3TX2A 3H2SA 4ZAYA 2R68A 4G85A 3ZN2A 3EQ9A 5BNFA 1D4OA 2Q4DA 2V7BA 1RVDA 2FMHA 4OMUA 2Q2NA 4DSAA 4QECA 4NFYA 4QU0A 4OK6A 2YWEA 4X41A 2JAWA 3RIXA 5KWIA 2QVBA 1EUQA 3ZKWA 1L7BA 2BEKA 2AYZA 5AVZA 2FUNB 4H31A 4RZ2A 1KY2A 1N7JA 1NMEA 2B1QA 1C9KA 4RIGA 4CXMA 3SK0A 4YUYA 2YWGA 3MCUA 3DHVA 3C48A 3CUEF 4JXXA 2CMGA 3PF8A 2ACWA 4EJ2A 2BI7A 2Y05A 3MLEA 5ICEA 3IKJA 1IIBA 3ZY6A 1JT2A 3SDBA 1I0IA 1TI7A 2W93A 3PNOA 2OCBA 5KDDA 2MSLA 2REBA 5P8WA 3H3XA 2PLWA 4G2TA 2HT1A 3I2IA 2O07A 2NZ8A 3GX1A 1WP9A 3OT4A 4R9SA 3ZE2B 4Z6KA 4AK9A 5GVSA 5DRYA 2QN2A 3GZNA 2O8BB 1R1DA 5BXYA 4NF2A 2BGWA 1ODSA 1ZGCA 1MC8A 4L08A 2WD8A 2GB4A 2FN4A 1YZHA 2NYVA 2RH5A 1TE2A 2D4AA 2QVXX 4XE5A 5BYAA 1HY3A 4O3FA 3R5SA 4LGYA 3T0IA 4X3CA 1NQTA 1RXYA 2PH7A 5DW3A 1EWQA 2EFYA 4HTFA 5IUJC 4FDMA 4LYAA 4ZYUA 2ZBGA 1PNVA 2C5BA 3HCEA 1IOZA 5CDSA 5J2TB 2XIJA 4RSGA 5DGHA 3W5VA 1ULUA 1TA9A 2M6SA 3CFYA 4UU8A 2H2HA 4HQ6A 2R2GA 4HDMA 3WNZA 5CB8A 2V0GA 1X1TA 3P97A 1ZD2P 1LI4A 2QQFA 2WWRA 4LF7B 5COBA 2ECPA 4WADA 4H1WA 2F1KA 1IRXA 1CJSA 1FU8A 1QIEA 4AUMA 3ANLA 4BNDA 1GN9A 3P4UA 1OKKD 3ZVRA 1F6DA 3FFTA 1IU9A 4KAAA 1SUCA 1T0HB 2O6HA 1K6MA 3HKEB 5CA0F 4R2MA 1N7GA 1HR0B 5HIMA 3AHHA 1LDEA 1IN1A 4JQOA 4MUKA 1P1FA 2IP2A 4B74A 3I53A 3JATA 4G3XA 1Z8NA 2MDTA 2R00A 3NETA 1BXKA 4IO1A 3RYIB 5DNVA 1YRYE 2G4LA 1Z4LA 5IS2A 3WRYA 2XJ9A 3PDHA 5JYCA 4Q4JA 1GGEA 3D4PA 4X8HA 3U3XA 3WQRA 3OD1A 3KQKA 2LUOA 2OBMA 4HJXA 1IBLB 3TZQA 2VUSA 6REQA 4D56A 2I87A 5LUAA 2V1XA 4TQ9A 1G60A 5TMPA 2DQKA 1GNTA 2ZQZA 4I9UA 3IHTA 1DX6A 4CL3A 3NTVA 1I13A 2JGLA 5CB4A 4JLDA 5KYXB 1IRIA 1QCZA 1RRVA 3AJRA 3EFOA 3FGOA 2RE8A 2J0VA 3IMCA 4R9RA 3LV8A 3GDGA 4X9XA 1TQ6A 3EEIA 2DJ5A 3B1ZA 1TX4B 1SIBE 1P1BA 4HF7A 3DKIA 3WLIA 3FTCA 3ISVA 4AX8A 1W96A 3VZQA 1CNMA 2VLIA 3NM6B 3ROMA 4CV1A 4S3MA 4X60A 5A5DA 3RABA 5CBPA 1W0JA 2BGMA 2VDWB 2ZPTX 3PR3A 1FJHA 4LF8B 3E7XA 4Q3KA 3U80A 4NCXA 1O89A 2HJHA 1TYCA 4U9UA 3QMWA 2OWDA 3ZV6A 5KTNA 4LQ4A 4HVTA 5IP5A 4DLZA 3ZDDA 1WZ2A 4FN4A 4II7A 1PK7A 5AK5A 1EK6A 1SEVA 2X1LA 2Y1EA 4LAFA 5EKTA 3TPFA 1ZAYA 1RLIA 3S1SA 3KKMA 5FAXA 1ORRA 3LKZA 3HEAA 4DTCA 3KCQA 2BAGA 2PZLA 1KTIA 4RTSA 3PV0A 3VR4D 5BV1A 1PV2A 3FFWA 2G80A 2CC2A 4DYVA 1LB1B 5EGSA 4A1OA 1PVOA 1M3SA 2HCJB 3IUYA 1GZ5A 4MKIA 3I1JA 4UUPA 1P80A 1B14A 2BE7A 3QKRA 4LI0A 4TSFD 1K8XB 4UZEA 3LHKA 1UOQA 2H8GA 5D01A 2V03A 3BE8A 2CDCA 5KOIA 5CCBA 3A27A 3I45A 1HYQA 3EFBA 3FOCA 2WK1A 1GGFA 2EEZA 5LXTA 4RQBA 4DR1B 2CNWD 4WXHA 4ENSA 4UDXX 5DBHX 4B32A 4M87A 4CDRA 3F6YA 4BBZA 4XUGB 5TQVA 1Y1LA 3BEOA 4MR9A 5A7FA 3VTZA 1QRDA 4DFDA 5L6LB 1WA5A 2AZTA 5CVTA 2F8SA 5I3CA 3LOPA 1ENZA 2RB4A 1FYFA 4BBAA 5A9SB 1AHNA 1Y9JA 3EVNA 4BUCA 3OZVA 1Q21A 2RHBA 3CX3A 3UPTA 3ZDEA 3OBBA 1FU4A 1P1KA 2WPDA 2X7HA 3RS2A 2XBMA 1E2IA 4OVKA 4DC9A 5JEEA 1XZBA 4M37A 2I6TA 3T8YA 3CW2A 4E1AA 2HHCA 2BKAA 2XVZA 4WZBE 1HE2A 1LPBB 4EGJA 3MCTA 2XKKA 1G8SA 1UJBA 3OLCX 3PQ5A 3A06A 3LLMA 5AM3A 2CMHA 3DBHB 3DB2A 1VCMA 3K0HA 4LOHA 1QVRA 3KJQA 5IVDA 1GNQA 5EJ9A 3DNMA 4RCVA 3LSYA 2VJDA 2POCA 3I9LA 3LGXA 3LFUA 1DTWB 3NBFA 5IJAA 1U3GA 1NBOA 1FQJA 3BDAA 4DA4A 4KXVA 5JCJA 1O0BA 3RTCA 3UW3A 1OFHA 2B78A 1E32A 3TTSA 3WYCA 3RSSA 3TXXA 5GINE 5FV4A 3NTQA 2G09A 4HDCA 2R00C 4CQJA 5WRFA 3QJGA 4XM1A 1SXJA 3VH4A 3WRYC 3KYDA 3NGLA 2XXAA 1LZLA 2DKNA 4PRKA 2EF0A 5KQLA 3DHNA 4RD3A 1Z4QA 2D1QA 1QORA 2HA4A 2W6ID 3C8DA 3K1YA 1WSDA 4S1NA 2YIVX 3B1FA 1YULA 1UADA 2WG2A 5EI5A 3IUJA 3CNBA 1D7OA 1ICEA 2GAJA 4HQLA 2WJ4A 5LBUA 3QA9A 1KR2A 1XTRA 1ZQ1A 5G0UA 1RWMA 3HFGA 3DAFA 2W98A 7GPBA 1C9YA 1DCFA 3LE8A 4QGBA 1DKLA 1AUPA 2G9UA 4JJAA 2C77A 3MOGA 4PQFA 1XU4A 3VPAA 4AIRA 4AKSA 1XTPA 4R6WA 1JH9A 3UH0A 1X9IA 5EIFA 3CLUD 2EVWX 1RPTA 4FXOA 5LKAA 1G63A 3IJPA 3IPAA 5E7JA 1R9JA 1DAKA 3F0TA 2IU3A 5JV5A 2XKAA 3DXZA 1NVFA 1V11A 3I9KA 2NZJA 1T29A 4ZP1A 1TEHA 1ZK0A 5C32A 3W9SA 1JG7A 2FDCA 5LDDC 3IT3A 3BGIA 2Q3JA 4MVXA 2QMYA 5FULA 521PA 3TK1A 1HG1A 4BCDA 5SICE 4ZT3A 2NZVG 1FC0A 1U0RA 2WT4A 2WMDA 4LJLA 3NGXA 1D2CA 1G0NA 2I6XA 2P2NA 2WSSD 4FNOA 4AYTA 4E7PA 3E84A 2VR1A 4CQMD 5L7YA 5JMOA 2EBFX 4OGLA 2P68A 3AWDA 4ZHQB 3F7NA 1HQCA 1OHHA 1YRHA 3PIRA 2BM0A 4DCTA 4QVIA 4FJ2A 3X1KA 1GQYA 4Q03A 4TTTS 4R7GA 5H9WA 3DW3X 4QXQA 4DHWA 1XOIA 3QSGA 2YYSA 5IDYA 1LVUA 2QMZA 4YRCA 4YFVA 1KVQA 1JHXA 1EWVA 4LXIA 1E2LA 2XZOA 2FN8A 1X8JA 2A9KA 2REXB 1NULA 4XOUA 5FNVF 5IVPA 3O26A 4D4KA 1ZNWA 1SXJE 4PINA 5CW1A 3G5MA 4NBLA 2E21A 5D6OA 4BZPA 1NBEA 1GZ4A 1ZA1A 5KYTA 3PTZA 4BX2A 7REQA 4IX1A 4UHDA 5ECGC 4UOEA 4Y1FA 3OZXA 1YIOA 2H1LA 3K0EA 3LVBA 3PDIB 4KR2A 2EHDA 1O2DA 5CTAA 3ETGA 4LZPA 3VH3A 4EB6A 2V96A 4DLWA 3ZWPA 4EL5A 1U2TA 1VRVA 3HBJA 4JITA 5E4JA 4U9HS 1A71A 1PJCA 2BSAA 5DHSA 2C3UA 5DBFA 5CCXA 1RQ2A 3K5HA 4OV6B 2W0SA 3K09A 3LP5A 3SQOA 4YNBA 4XX1A 1RI2A 3A10A 4EZIA 4A0QA 2QRVB 4RJTA 1ZD1A 1O4VA 2O2YA 3SQXA 3RVLA 1JYSA 3QVLA 2GLTA 3KTAB 3PDJA 3QUQA 3NIDB 1X87A 2QP3A 5LLTA 1QX3A 4IFEA 3UMMA 2AYXA 3HN6A 2GSWA 4KWHA 1G8YA 2FG6C 1C8LA 3KB2A 1PFWA 1SUFA 2HX1A 2ZBFA 3L6BA 3N0XA 4IDBA 5ALFA 4BNUA 4LG1A 1ZVMA 4HI0E 4IKEA 1YDHA 2XUJA 4RPKA 1C9NA 1GGJA 1VYVA 2BFAA 3FOAA 1L7RA 3A14A 3FUXA 3IMKA 3LCUA 2BFFB 3GVHA 4LV5B 2ORED 3TLBA 3VOBA 3WLRA 2O3QA 4FNAA 1RIFA 3HB7A 1M8GA 1T4CA 3HBLA 4FS8A 5HKBA 3THXA 2ZROA 4N82A 4FKBA 1GLVA 2A1IA 3KELA 3ADDA 4EGAA 3SFZA 4ZU1X 1QIHA 2E4AA 4R0VA 1SXJC 3BXZA 5CCEA 4C0BA 4GGMX 1EQUA 3R75A 1KO4A 2LW7A 3HP1A 4QAQA 4WNCA 2OGTA 1RAEA 1U1FA 4RTQA 1Z15A 3MSXA 1N4AA 4J3JA 2PRIA 2EIXA 2HU7A 2P4EA 4IGFA 1TJYA 2GCIA 3NVMB 4QG7A 1EIZA 4Q3OA 5TNXA 3KOOA 3AFHA 3TW6A 1RE1A 1O5IA 4I55B 5K6RA 3KJHA 1J09A 4JODA 3ZLTA 4KH1A 3OE7D 4AROA 3H97A 5C9ZA 5A6SB 4WCDA 1EFCA 4MULA 3BCHA 2GYYA 3R3HA 4DTIA 3C39A 1MC1A 2GXQA 2VP6A 4OXIA 4XFJA 5CYPA 4DV5B 2RHHA 1BE8A 1E66A 1FNCA 1TTQB 4DYDA 2EDAA 2W90A 3V97A 1YS4A 2Q28A 3I30X 3MSCA 4ZO4A 1XKTA 4G5YA 4NXMB 1UDWA 4RLHA 5G1OA 5J63A 5TQ0B 4WZAE 2QKYA 2X14A 5CT8A 5K2OA 1PN3A 2YWCA 1GTMA 4PAOA 2OCLA 4E5PA 1QP0A 1HNWB 2WUEA 1R5BA 3SHOA 2QJWA 2HF9A 2X0KA 4O4JF 1BHQ1 2VPZA 4YRIA 4XR4A 5JWHA 2GRJA 4GOLD 5BR8B 1W88B 3GQVA 3DMFA 4OGKA 4KZPA 4UMFA 1J8MF 2R6ZA 4B46A 2C7OA 4B3GA 2QWXA 2UYYA 4BNWA 1D6MA 1U2PA 3RT9A 2WU1A 3KR2A 4EY3A 4P4TA 1S5PA 2XTAA 4OBEA 2IUEA 3H04A 5BMVB 5E1OA 5A3QA 1DUIA 2QY6A 4AZSA 4BNMA 3GFPA 1NYLA 3JAMA 5DSTA 3WXMA 5FAKA 2XYQA 3TEMA 4W5NA 3MS7A 3LPDA 1I0ZA 4YCNA 2VCYA 1VSQA 1RADA 2VC2B 3VU0A 4Z0PA 1QQBA 3K30A 3B9BA 3BH6A 4XGIA 4KRXA 1T2NA 4MNTA 3GMDA 3AEXA 1KHHA 4RV5A 4OK5A 3UKDA 1I2DA 4EUNA 1D4AA 3QE9Y 3G0HA 1NGSA 5I9LA 2X77A 3AHDA 1U0FA 5EZSA 4B3DA 3AJDA 3DF9A 1Q0TA 1EFVB 4HLQB 1LPSA 5F23A 2Q2WA 3MOSA 3FRJA 1VJ0A 4IIFA 3K9FC 3E9CA 2CFIA 3OZSA 4ZI7F 4N6GA 2IH4A 1P73A 3CMMA 2FMFA 3PU6A 5FTJA 3LHDA 4KSBA 3WQBA 3W5BA 5PNTA 1ZXLA 3OX3A 2DOKA 2H4XA 3CWQA 3D31A 5E6SB 4C3UA 3K09C 5AW5A 4ER3A 4JP2A 1EVQA 3EWAA 4JC4A 1EA5A 3BE4A 3SJCA 2WB2A 2X22A 3K70B 4BC1A 2O7NA 4CDMA 2X7JA 3HKDA 4M1KA 5CAEA 4MYUA 2DRIA 3VKHA 3QKSA 4G5HA 2R6HA 4P3OA 4UU1A 5DM4A 1QO0D 3FDFA 4C4RA 3I3OA 2Z9BA 1EK0A 3TDMA 3DHWC 2XTJA 4JC0A 2EP8A 2ZTMA 3SF0A 2AMJA 5CVJA 4H7PA 2ZBPA 1VXOA 2WF9A 3AV3A 3GPBA 3LHIA 3KQMA 5KIAA 1XRRA 2UUAB 1CUYA 1I6MA 4LQDA 4OQLA 3OLYA 3HRIA 5JAOA 4UHCA 3JYNA 4C20A 4E22A 1V8BA 4YAEA 3OOJA 4IQ8A 1DV1A 4BO5A 3WY9A 4TVSA 2JAPA 3I1YA 1DAGA 5JSZA 3FDIA 1DQPA 4FIZA 4FN5A 4UEQA 4QASA 4OTZA 2VDOB 5G4KB 3EXEB 1MU0A 4ZA2A 4RF3A 4UHKA 4X62B 1JEQB 3BMQA 3FVQA 4KXYA 5TPZA 2BKLA 2HDOA 5AOVA 4GOMD 5CDGA 1GU0A 4KC0A 4DWJA 5FPYA 3HDTA 4Q6BA 1PS8A 3KETA 3QPVA 2H0RA 4M1ZA 3TH5A 1CS0A 4ZOCA 3ZCUA 1TGVA 2JGFA 1P72A 1K3FA 4PRLA 2E48A 4C76A 5L95A 1N2CE 1RWBA 2AOTA 1DO2A 1IH8A 3MYRA 3O75A 4FOLA 1FX0A 5F2KA 3SVTA 3GG2A 2XTNA 3GJ6A 1NNUA 2W2XA 3EWSA 3KKNA 4DPMA 1JGTA 1HWYA 4HJRA 4WLUA 2XZLA 2JHCA 1EXMA 2CD7A 2GQ0A 2FTKE 1PGPA 1XCGB 1R5JA 1PJ2A 2C5HA 1ZNQO 3NB0A 3HZHA 4JEMA 5FRDA 4RBNA 4Y9SA 3VR5D 4ETWA 5I7HA 1L7PA 1JAXA 2EJCA 3FYUA 4PX9A 1AQJA 4XCQA 3D59A 2X9NA 4XDYA 1Q0ZA 3CG0A 4ENTA 2EGHA 5ALZA 5EYPB 1A0OA 1E1LA 1FDWA 3B20A 5AW8A 1HBJA 5I7SA 3DDOA 5CLQA 3KL4A 4MZXA 3ACCA 1DBSA 2Q6VA 5EVJA 3K70D 4KQHA 1XWFA 2GA9A 1DXHA 2J48A 5FA5A 2ZAGA 4C04A 4KKXB 4IMPA 3RFXA 3HA2A 1NJ2A 5ILQA 1OWOA 4A5OA 2XGJA 3W9UA 2ZTLA 3RU2A 1LBTA 1ZA2A 2Q2OA 3EJ6A 4AS2A 3EYAA 3KKLA 3R76A 4X6LA 1G3UA 4BFLA 1KBZA 1X2BA 2VZEA 3AF5A 3MGGA 3OHMA 4U7WA 5EWJA 3TPCA 1EZ4A 1TTPB 5TLSA 3F90A 1T24A 4OHMA 3MWYW 4MPDA 4CKYA 4H4CA 2XMCA 4DCUA 4A4DA 2QZJA 3CEAA 2ID9A 4DJDC 5JJBA 3L1IA 2QXUA 5KKCA 2ZE5A 4M2LA 1SQGA 4FR2A 2LXNA 2IOQA 2ONZA 2N42A 4HX5A 5LKRA 2XOKD 4RK6A 3A8TA 4F9TA 1I5EA 2EYUA 2FFBA 3BD8A 4IGEA 3SC2B 3WIOA 4X1YA 4F4JA 4KE7A 4DNOA 3PFKA 5D1HA 4HBGA 1SVWA 2O8DB 5SY4A 3S2EA 3HJHA 1M1YB 1SCDA 2WP0A 3U1VA 1SXHA 3VTKA 3OOYA 3QEJA 5KVAA 4ZZ1A 3QY9A 5A4KA 2R65A 1YS2X 2QN9A 4J7CA 1G21E 1UFRA 3MTEA 4B47A 2Q1UA 4DADA 4B3MB 4YJ2A 4L9WA 3PPXA 4M7WA 3TM5A 1VPVA 2ZRHA 1NVTA 2I0FA 5HZGA 4F45A 3F73A 3R0ZA 3QBJA 4R1UA 3QM1A 4FYPA 1BS2A 3BIXA 5K1ZA 3LPAA 1PX2A 5EIHA 2OV3A 3DOUA 4G86A 4TT8A 4E2ZA 3BQMB 3I23A 3V4LA 3O4JA 4CMEA 4TLLB 1MP0A 4GW3A 3KQHA 1XPOA 2Q46A 3HCPA 4Q9KA 4RO0A 1LDGA 4YTEA 5GJVC 1XMIA 2OILA 2AFIA 1DG9A 1SNYA 2Y27A 4PAGA 1NZJA 4X6UA 4UC0A 1BFKA 3E9MA 3WYBA 4P6VF 3SBOA 1OBFO 3PLAE 2DECA 3GN2A 4ZQHA 2I6QA 2VPYA 2RK4A 3CV3A 4DNFA 2NXWA 5FOVA 2WDZA 3AEYA 2CUZA 5C5CA 3QVJA 4KK4A 5DYTA 1G41A 5CT9A 1NBMA 2OD7A 4EK9A 1NJGA 2CL0X 5I4BA 3ZU3A 1F7VA 1XRLA 2QMQA 1GUYA 3JWHA 4NEGA 2F3QA 5CNMA 5LBTA 4M53A 1M6VA 3BWMA 2YN4A 2IDMA 3C3WA 3MTBA 2HBYA 3N2YA 5FTNA 1XCOA 4YRJA 4OFBA 3WA7A 5FPQA 1ZH2A 3B3FA 3PUHA 3AKZA 2HIHA 3IDQA 3I6IA 4KLNA 1WCIA 2QDXA 4FFDA 1V1MA 3LCMA 4O4IA 4EMBA 1JHYA 1T0BA 3FYUC 1PDWA 5EY5B 3T7EA 5EL0A 2JATA 2G5TA 4PYKA 4UHBA 2BKVA 2W2KA 1MHPA 2WIDA 3DL4A 4ME6A 3NBUA 3KD3A 3GLUA 3ND9A 3KWLA 2FFQA 2C98A 2J6HA 5F78A 3VC2A 3VUFA 4FD3A 1MMFB 1XQXA 1E98A 5IKPA 2ZWIA 2JLQA 1RYNA 4S0ZA 2YZKA 5T4BA 3ZGXA 2I3BA 3MRSA 4Q9AA 3DQPA 5DB4A 1K7XB 5K4AA 4MV8A 1G8JA 1A1VA 3RAJA 1HE8B 2WWTA 1DBIA 2AJDA 2Q21A 2HPVA 1ZONA 3CW8X 3GPIA 3IAUA 4X93A 1SOUA 2AJBA 2OC4A 2ZU6A 2QJTA 3RVSA 4WERA 1M66A 3KAJA 4QYWA 5I4IA 3CZPA 4YJGB 3T9EA 3T3DA 4BGIA 3DE4X 2VRNA 1TA0A 4XYEA 4TTRA 3T7CA 2PAAA 3TOZA 5E3HA 3DMHA 1PR2A 4XSHA 2FOXA 4F2PA 2IHTA 2PSFA 2AZ4A 4AY2A 3SMQA 1G2PA 3I72A 4YQFA 1RXVA 3LC1O 2NO4A 1Z6GA 2P62A 3OCXA 2OBYA 3JYPA 3JASA 1JYEA 3UW1A 4A92A 3MBIA 3BF8A 4OXXA 3VU9B 4CRWB 4OJQA 2WKQA 1EUCA 3GZ4A 1ZGAA 1JDVA 3AR7A 1CUIA 1IVNA 3G0BA 1UXGA 1O5OA 2HK9A 5L7TA 2DPGA 1DDIA 1JAHA 1QV7A 1ZX1A 2I3GA 2VL7A 2X5JO 3O5AA 4M60A 4P3PA 3COSA 5IVKA 4Q3LA 1LSJA 4XPIA 3UK0A 5CYFA 4HPWA 2B4RO 2QRUA 5FBHA 4O4LF 1HRDA 4EX7A 2GERA 5HJ2A 2ZM6B 1UP7A 4P38A 4QOIA 4GI7A 4U0KA 1JLSA 4KXLA 1JWAB 1ST2A 3EVAA 3ML1A 3AKEA 3O0TA 2JVIA 3OZEA 5ALUA 4B6SA 2B99A 4BTEA 4TLDA 3DTVA 1C4XA 2Q41A 4EKIA 5HKAA 1LS1A 3KTFA 3V7UA 2G06A 4Y6OA 1U2EA 3NZEA 4JVMA 4OI2A 2IX3A 3HUDA 4QUKA 2OBNA 3K2IA 3OZIA 2AD5A 2CK3A 4RKEA 4CMAA 2C57A 1L4NA 1Q3HA 3I64A 5IJ9A 1VB3A 5B3AA 5HIKA 5JZMA 4JZYA 1RC1A 3DKRA 3H2IA 4EKYA 4O0MA 1RHKA 1EUZA 2P9YA 2VHUA 4CMEC 2W8ZA 1V41E 1FSFA 1R9NA 4NMHA 1E3WB 1TUEA 1NUTA 3WB1A 5IXSA 3K1AB 2ZSAA 3MB8A 3WQQA 1DINA 1BGVA 3A31A 2CXOA 4H0FA 4H1TA 3TL3A 1QQ6A 4QTXA 3ZD8A 3GDOA 4TYWA 3WGIA 2EZTA 3RSHA 3RV3A 4BL5A 1VA5A 2WILA 2X13A 4AP6A 5GM2A 1KAMA 2AEJA 3RGGA 3RE1A 3ST7A 5D3MA 3W5CA 1WX1A 4C1NA 4ILKA 3AO0B 5IBQA 1WMSA 1KZGB 1U0SY 2ZTSA 2G1PA 4LOLA 1HX7A 3CRVA 1KPHA 3BJMA 2FWRA 1Z17A 2IYYA 2P2DA 4JX8A 3KQPA 2EW1A 4MUIA 5BR7A 5DGIA 3HCBA 2FV8A 2YV4A 1A9XB 2O20A 4IHKA 4OHPA 1PUJA 4D9JA 1LS6A 4S0XA 3RSQA 4CF5A 1MR3F 3COJA 3CNEA 3ETLA 1JR3E 3M6AA 3MT9A 4XSVA 4NOLA 1PQYA 1X7WB 3OE5A 5TSDA 3ND5A 4P2BA 4B34A 4B9AA 2CNBA 3UO8B 4D2IA 4EQ6A 2FUCA 1PJ3A 1TYAE 2I3AA 2C7PA 4OHCA 2JFZA 3T7JA 5LQDA 1OC2A 3ZLBA 3GPLA 4JC5A 1SUBA 2NT3A 1N2SA 1JTFA 2HAEA 3L8GA 4PW0A 1BXZA 5J4KA 1N0IA 1Q7GA 5SY9A 5JMPA 3TRKA 2DUWA 1IBKB 1JLKA 1HQKA 1WZIA 4QJBA 3TOCA 3PKJA 2B30A 4X90A 5HF9A 1X8LA 1OXMA 2NTEA 3GBVA 3PFHA 5C1IA 3OIVA 6PFKA 1TCVA 3A4VA 4U2DA 1HFKA 1BYIA 1Z0ZA 4CKZA 1KP2A 1HT2E 1FF9A 3L8FA 1LQUA 1V1RA 5ISMA 3L4EA 3DZKA 4LJ9A 2TYSB 3TM4A 5DEOA 2PUDA 3OFJA 3PCRB 1A9PA 1IQ0A 4FPXA 1Q95A 4II2A 4NCNA 4DCJA 2NSLA 3EQ8A 5B1YA 1YZFA 1OU0A 1DS6A 1SBQA 3GC6A 2WWFA 4Y2XA 2V3WA 2AVNA 2JAXA 4J0IA 5FOTA 1YR8A 1YTUA 2WTMA 1FLAA 4HZUA 2W4QA 3AI7A 1WF3A 1U80A 3BMCB 4QFMA 2OHFA 4RZSA 2GAAA 2YHAA 5TR9A 2IIPA 3TXAA 4ETMA 2RKBA 1UCFA 3KYJB 1Q22A 5IJZA 4HVLA 2FWJA 2BMWA 1PV1A 5J23A 3ROEA 4UQPA 2HGZA 2MR6A 4HK4A 2ZI6A 3EPPA 4AM8A 1OT3A 3ENNA 3FPEA 1MZVA 1BS1A 1RJEA 1CD5A 1K6XA 3KLNA 2D0OB 4W7SA 5IZCC 1F1JA 1S3SA 4TKVA 3D43A 4YMWA 2QSZA 4I08A 4U6NA 8ADHA 5BYJA 4CUJA 2I2CA 3OUTA 4HN9A 2BEJA 3NONA 4OHYA 1ZJ5A 3NAQA 3NVDA 4HG2A 5DHTA 4G8BA 3T4XA 3ROQA 2CBXA 5BSGA 2IH5A 2Q5QA 2GM9A 1LA2A 1TCUA 2BN4A 1US8B 2QOEA 2VOEA 3AF2A 1Q0RA 3WKBA 1ADBA 2XBLA 3FMFA 1K3UB 3H75A 2WEKA 1AGXA 3C7DB 5KS2A 2MCFA 3CM0A 2GEUA 2AX3A 3UYLA 2GJSA 4BFZA 2H85A 3OX4A 2H4WA 4BY9E 5MGNA 3ZV3A 1NDQA 4FYYA 4PANA 2NNWB 3AVTA 1RBMA 3O8OA 1L7QA 4MGIR 2GZAA 4MJ7A 3IAEA 4RQAA 3E4DA 1ORDA 2ETVA 4MR7A 4JFAA 3KBBA 3CZ9A 4IDHA 4MK4A 4XIFA 2PKQP 3EVGA 5J5VA 1GQSA 2R8YA 1NNLA 1DQRA 4GPBA 2WW8A 2HW8A 2NWQA 2PX4A 3C7AA 4WT7A 1DC4A 3ZEAA 2CXHA 1PG2A 4KFRA 1JJBA 1A8UA 1C2YA 2EL9A 1AJEA 4HLUC 5KOYA 4GH5A 5HILA 1VI6A 3HJCA 4LNUB 4JL5A 3G2HA 3TB6A 4AKTA 3DZBA 4N8EA 4C0KA 3O1LA 1UZUA 4G5RA 5L3QA 4M0FA 4ZRMA 1J9ZA 1W5AA 2HJ9A 4PZZA 1XMJA 3KIPA 3OPYA 1YI8A 1Y7IA 2HQSA 1OREA 1Q15A 2PKQO 3LWDA 4J6EA 4YT8A 5IT5A 3N75A 4A2WA 1X94A 4LBZA 5FO0A 4IDPA 3I39X 4CMIB 1EFAA 1Y8CA 2AMVA 1QQ5A 4RS3A 5AVVA 4WN9B 2CDBA 1N0HA 1M2NA 1W85A 1G8FA 4YCLA 1Q2UA 1U04A 1F48A 4F84A 2O2EA 2R79A 2CXRA 4R54A 3S27A 5FB3A 2Y1LA 1LX6A 4OAOA 1RQGA 4OOEA 3AEKB 3PHJA 3GUCA 4NMWA 3MINB 4JXKA 1Z2EA 3C5WP 4C4PA 2OZKA 4EOGA 2JI7A 4IWNA 3VGJA 4FMCB 3T3EA 4WNYA 4AP5A 3DAPA 5GONA 1L1FA 4BTVA 3BFKA 3AKYA 3AY6A 3PK0A 3QH4A 3B6KA 5F4ZA 3QV1A 1K75A 1GL6A 1DJQA 5JXJA 4JEUA 3USCS 4DOMA 5BQ5A 1EHCA 3DULA 2G5GX 4AKIA 3CT6A 1Z35A 2YZMA 3DD1A 2CLMB 1AQYA 1IOLA 4BUJA 1IBRA 4DLYA 4MTLA 4H7IA 1JFLA 4UVIA 5LD2B 4TWZA 1G1MA 4LOJA 2H9AA 3BUSA 3HKCB 5JLAA 3EXG2 1BYUA 4RANA 3HLTA 4IGAA 3X1XA 1QZXA 2UAGA 2ISQA 4XRGA 4XTRA 3TCXB 4G0WA 1EFPA 1OD6A 3T94A 1LLCA 1Z5OA 2ODQA 5D87A 4FYVA 2I4IA 4OKIA 3ILVA 3TZHA 4Q9NA 1FNDA 4Z9FA 4L0QA 3JRNA 3N2KA 1DKRA 3PZBA 1MTOA 2AWNA 2GZ2A 4PTYA 4R83A 4B7ZA 3WDLA 2HMAA 1G5PA 4R9VA 5DJ5A 3C97A 5B64A 2XCTB 2QDKA 3EK2A 4G89A 4RELA 1E1RD 2JFPA 4IVRA 1JP7A 1NMYA 3GU3A 4DJEC 4LRYA 4OGGA 2V58A 1KEEA 1GAQA 4D8TA 3LZDA 1KQPA 1TYBE 3LUJA 4ZQEA 1GQQA 1XTIA 3T5DA 3TLZA 3A1SA 1EVZA 1YRLA 3EDYA 2JD1A 5CRIA 3S7ZA 3VU3A 3TSYA 2GCGA 4EITA 1H8HA 1I6LA 1PEDA 2GPAA 3CY6A 3N7AA 4QNRA 4YWHA 3RAEC 4RGVA 2JEZA 4LRWA 5C8YF 4ZGWA 1V8DA 4M21A 3TNDA 1KZ1A 4J90A 3K71B 4JSTA 3OPVA 1RI5A 1KOJA 2BELA 2ZSUA 1YKFA 1WBBA 1GPAA 1OASA 3UUFA 1YCFA 5L3RA 4DMCA 5A5GA 2W8BA 1Z38A 3IOYA 3IAXA 2NO7A 3GLHB 4IOMA 1KSGA 5REQB 1GOTA 3QVVA 4EVQA 1WQ3A 3JZAA 1W1UA 2NTJA 3PUYA 5LZ4A 3HJTA 3IDFA 1HG0A 2O8FA 1QBKC 1JXMA 1WS6A 4FMDF 3T1YB 3P1JA 3M5CA 4TGLA 3WQSB 4ZCRA 4MHTA 2JF0A 2XWBF 3IGFA 4BIIA 2MINA 3F2IA 5JS7A 3NYWA 3HXKA 3NDJA 4D8YA 4Q66C 1E9CA 4QYIA 3O4HA 4G24A 1Z6AA 1E3LA 4KDCA 3UXYA 4RJIA 3OKPA 3E27A 1W35A 3I0MA 1YJBA 3N8DA 1ZDMA 1PL7A 4CEIA 3ZGYA 3LIIA 5LLSA 1U0JA 2Q3EA 5A9RA 2JB9A 5HJEA 4UCXA 2ZUCA 3FHTA 3IMGA 4A27A 2CYBA 1UXHA 3E9ZA 3KWFA 3ZE1B 4V2UA 4BV8A 1SCAA 2R2AA 3EDQA 4TTSA 5F1PA 1V5GA 3REFA 2OXEA 5AJYA 5ALLA 3SHWA 5IJ0A 2H48A 4ENVA 5JISA 2AI3A 3KFXA 4MIYA 4XB1A 3E15A 2MJLA 2WOOA 2C83A 4ARCA 3SAJA 4Y7DA 1D3AA 1X1SA 3CBQA 1D9ZA 3M5WA 2Z98A 4H7EA 1RZRA 4QEDA 1JZTA 2A1TS 4YMTA 3ZJTA 2I91A 1FYVA 4LTDA 2EBHX 1AO3A 2I4NA 4INZA 5EHZA 2BGRA 2XAAA 4DBVO 2XJ4A 4HRVA 4J2HA 3EISA 3R7DA 5K09A 1QH0A 2FF5A 2PR7A 1IHOA 4PYJA 2CLIB 5K0ZA 1ETUA 3MTDA 1ZPDA 1TKAA 3BORA 4P98A 3J81A 2Q4OA 2SHKA 2HEGA 3FYDA 1CNFA 3NDPA 4Z8YA 1BTOA 1NVAA 3E9DA 2H51A 4J1NA 3DJFA 3O1JC 4ETNA 1WCWA 2VZ8A 4R2HA 4JI0B 5JCPA 4W9MC 1JIUA 3A1WA 4AY3A 3VNSA 3UMBA 4BP3A 1P0IA 1JHAA 1Z5GA 3W3AA 2PXXA 3DG9A 4QT0A 2NVOA 3LBAA 4IY1A 1TCBA 4F91B 1Q7EA 1I7DA 5ER6A 3TR0A 5M5BA 1B26A 2VP3A 4U8GA