5CLLA

Truncated ran wild type in complex with gdp-bef and ranbd1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
179
structure length
179
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 54
structure length 179
sequence length 179
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cllA00
2BM0A 1LW7A 1D2NA 3CNNA 2YKGA 4CDGA 1IY1A 4EPTA 3P26A 5D3MB 2CCGA 3QF4A 2ZRCA 4G5RA 2ATVA 2JJ1D 3TGPA 2ZTSA 5ELXA 1N6HA 3X2SA 5J4YA 4V0OA 3WHKA 4CYMA 2PX3A 5H8WA 1M7BA 4G5SA 2F9LA 4YC7A 1TPZA 1KSGA 3WXMA 3U5ZB 1AZSC 2XNDA 3BGWA 3U3JA 3BD9A 1DO0A 3T1OA 3TJZA 1OIVA 5FTJA 3TW8B 1VPLA 2Q9BA 1OHHA 3VR4A 1SVMA 1G3RA 2GJAA 4MRPA 3B82A 2R6DA 4Y0AA 5EP3A 2EFEB 2G83A 1E69A 2ZRPA 1FUKA 3LO5A 3I92A 1EWQA 3R7WA 3THWA 2F43A 2AD5A 1KMHB 3PR1A 3LRPA 3C41J 4I4LA 1W46A 1W4RA 4KLNA 1YQTA 3A8TA 5KSPA 1DARA 1NBMA 1SHZA 4ITRC 2GAOA 4TTQA 4IOMA 5DNYB 1W2GA 4CVNA 1ZC3A 3VR3A 2O8CB 3QKSA 2CJWA 4QJ5A 2P67A 4DC9A 5CITA 2VYFA 2RGNA 4FCVA 1Z0DA 2NPFA 1BIFA 3ZJYA 1E3MA 2Z43A 2ZXUA 1QHGA 1XPUA 1N3BA 1W2HA 1R0XA 2IX3A 1T6NA 4PAQA 5KTYA 3QKUA 2VF8A 1GRNA 4JSYA 1R2QA 2CHVA 3IPXA 4WA7A 1A7JA 2XB4A 4QNRA 5CM9C 4FXPA 5F98A 2J9RA 3ZD7A 1KO5A 1XP8A 4URYR 1P6XA 2OSBA 2ZE7A 3KQHA 3I8SA 1KSHA 5CDFA 5EJEA 4PQRA 4AKGA 4H1VA 3KZ1E 1XTSA 1TQ6A 3T61A 4OBEA 5J4KA 1A5TA 1GRRA 2IEYA 2H5EA 1E2GA 1NBME 2WWYA 1N0WA 2V1XA 1XF9A 1G18A 1VTKA 1Z0JA 3LXRA 1R5BA 5BW8A 4HAUA 3QXSA 2ZJ5A 1ZUHA 2OG2A 5AJXA 4MRNA 2VIIA 1JR3A 1D9ZA 2CE2X 5JJLA 1II9A 2GXAA 4TT3D 3ZVRA 1H65A 4M4SA 3QIAA 2IYQA 4XVUA 1G19A 2CVHA 3FFBA 2YOFA 2RHDA 1UKVY 3VR1A 1BYUA 2IS2A 2ZJOA 4MYHA 3MUFA 1MABB 2ZRJA 1JI0A 5BWMA 3U7GA 1OFIA 1KK1A 1KO4A 2BM1A 3MAAC 3IEUA 4D0GA 2DWQA 4TWZA 4LJ9A 3IHWA 1HY3A 3ZIAA 2ZM5A 2RB4A 4ZI3A 2BBWA 2JA1A 2VSXA 2ZETA 1YZNA 3F0TA 3QG5A 4TMVA 3EA0A 3A1VA 2IUUA 4D0LB 4A8JC 2IYRA 3S1AB 4MRRA 3CO5A 3GJ0A 2F55A 5G3YA 1KOFA 2B21A 2QQEA 4D4KA 4V0LA 4BEBA 1G8GA 2GJ8A 1K5DA 2ZROA 5H1YA 5TXGA 2ZSEA 3EPJA 3R9XA 1KYIA 3CX7A 1OKKA 1GAJA 5JJIA 4QBGB 3T34A 1FL9A 3HU1A 1TUIA 4KODA 3GLHA 1W0JD 2ZJBA 4UJ3A 3NH9A 2P6NA 3EWAA 2I4IA 3R20A 2QI9C 4RD0A 2GDJA 4GL2A 2J59A 2ZE5A 1G4AE 1ZC4A 3DO6A 2OBMA 3IBYA 1XTKA 2A5JA 1A1VA 4ESHA 1YR7A 5KPDA 5DE3A 3QKTA 1XTIA 2GJSA 3AVVA 3OHMA 4CGZA 1QHIA 2CNWD 1GWNA 5TV2A 2MMCA 2V8OA 2F1HA 2ONJA 4WXRA 4E07A 4KU4A 1VYVA 3K09C 2BDTA 5FPKA 1VCNA 3NVAA 1GP2A 4TYPA 2OCAA 3A37A 1Q3TA 2WAXA 3LY5A 1P75A 5E7IA 4HI0E 3AEZA 1G64A 4FINA 3KKNA 5IDVA 2BMDA 4GI7A 2NO9A 4WZ6A 2J0VA 1XB2A 4HB3A 1UEIA 3ZS9A 4M9SA 3K8YA 2FX3A 3SE0A 4JLJA 3O8DA 4ABYA 2JDIA 4GDFA 2QNRA 2QGNA 2VF7A 1U9IA 1WRBA 2WHXA 1OFHA 1KI8A 3LDAA 5F9HA 3HPRA 1ZINA 5KSOA 4O3MA 4KI0A 1WA5A 4LBWA 1GNQA 4JLPA 3M4YA 3BAFA 3IPYA 4AIIA 4B75A 2FV8A 3FHOA 4RZ3A 4XVQA 3REGA 4BLTA 1F3OA 4MGIR 2IYUA 1QBKC 3FGNA 2IYWA 2JIZD 3Q7QA 1PZNA 3DZDA 2QORA 2YNMA 3B6EA 2F1IA 3PUWA 4BZQA 5JWRA 3CKLA 4RFSB 4AG6A 1NIJA 3OEED 2O8FB 3RS7A 5FOXA 1SULA 2XITA 2AK2A 2BMJA 3BFXA 4JL8A 4NCIA 5EE0A 5AR1A 1NKTA 3IHLA 2FPLA 1X8KA 4JLMA 2DFTA 4FI3C 4CEJB 3U7FB 4MGKR 1V5WA 4LJ4A 1P2UA 2PBRA 3TVDA 3IQWA 4LC0A 3DOFA 4Q03A 2FEMA 3AKDA 2D4HA 4O0MA 4TLCA 4UKDA 4PC1A 2RGAA 5CK5A 4TQAA 2XNSA 3TUJC 3ZQJA 4FWIB 1MRSA 1OH7A 3KKMA 3FDIA 5TMPA 3UMRA 2HLDD 1Q1BA 1ZM3A 1E0AA 1VHTA 4P4TA 4C4PA 5FR2A 1SVWA 5L3SB 2WPDD 4IDPA 4F38A 3HYRA 1DE0A 1R0ZA 3FKSD 2QP9X 5SZKB 3CRMA 4HZUA 1Z0IA 2WKRA 4B3XA 4C0QC 3EXAA 3QE0A 2H16A 1COWA 2NG1A 2WJYA 2AX4A 5C18A 2ZI4A 4LWZA 3U7HB 1QHXA 1ZP6A 2QAGC 4LHYA 3ZGXA 2EFCB 1E96A 1ANKA 5LDDC 1DELA 2ZUDA 5J4VA 1OF1A 1UBCA 3RRMA 4R2IA 1XDBA 2ANCA 2W00A 1CR2A 3ZVLA 4RD1A 1VKJA 3NBZC 3LW7A 3NTUA 3THXB 1TEVA 3PV0A 1OIWA 3CX8A 5HE9A 4IFEA 3Q3JB 3OFND 2WTUA 1JR6A 1WP9A 2E9SA 2ZRLA 1S1CA 1S9DA 3GFTA 5KYKA 1NJFA 5E7JA 2DYKA 5CLQA 1WBDA 3N5CA 1CKEA 3W6NA 2J5XA 4BQSA 1W4AA 2FFAA 2R6CA 2Q9AA 2AXNA 1MV5A 3UG6A 4YMTA 1IBRA 2ZRMA 2Q9CA 4EAQA 2XZOA 5KUTA 4URVR 5AUQA 4LHVA 4GMDA 1RKBA 1TF5A 1YZKA 3A4NA 5TVKA 3AF0A 4OHVA 1NY6A 4U02A 1FMJA 3MSXA 5FPTA 3RS2A 5JWHA 3K9LA 1Z22A 1I4TD 2A5GA 3IDQA 2F1RA 4Q1EA 2IW3A 5JSZA 1R0YA 3AGQA 1XXHB 3A36A 3R9IA 4Q19A 3K0AA 1US8A 2ZIAA 4DWJA 3P27A 4JLKA 3QG1A 3CX6A 4QGGA 4FIDA 4OJQA 5CJ2A 1IN6A 3TKLA 2FF7A 3QQ5A 5JECA 1EX6A 1ZAKA 3AKCA 4IEIA 3QPVA 2XTNA 3N2IA 5EXTA 3WY9A 1KI2A 5F9FA 2WM9B 2FE4A 5C1BA 1GUAA 1FPMA 2FOLA 2O8EA 4GBMA 2YOHA 4RSGA 1Z07A 2FSIA 3RRZA 5DHAA 4HAXA 2JJ1A 2NPIA 2QMHA 4Q9IA 1L4UA 4MKGA 4KYIB 1T91A 3U4QB 2W0SA 1NKSA 1Z3IX 1WCV1 3G5UA 1A2KC 2ZS7A 1NN1A 1ZCBA 2GBLC 4DLRA 1DTSA 1D9XA 1BYIA 1SXJE 2AN9A 3LX8A 3EZ7A 1G7RA 2J87A 1HTWA 1Z0KA 2VBCA 4MRSA 4TL8A 2J46A 4QNMA 5KOYA 4D4MA 1N6IA 1P9NA 2GXUA 3SOPA 5EP2A 4B48A 4HLUC 4Q1DA 2OLJA 2RGBA 2REBA 2QTVB 4URXR 2CHGA 4Q9LA 5BXQC 3GLFE 1CR1A 1Z06A 1SXJC 4LX0A 1P61B 1M2OB 5DYGA 3NBXX 2GF0A 4HZIA 4LZZA 4KJZA 3SNHA 1TADA 3GP8A 3DKPA 1TAGA 4AG5A 1AK2A 4DLXA 3L2OB 3A1UA 1LY1A 1ZIOA 3DM5A 3AF1A 5D3QA 5EE1A 2IF2A 3NIBA 3AVWA 3L0OA 2W0MA 3DEFA 3GLGB 1II8A 2ZJZA 2ASEA 2WJIA 5AJVB 3WMGA 1VMAA 3SC3A 3X1DA 5CIWA 3GLIE 3RRYA 1M7GA 5FI1B 1S1MA 4XJXA 2ZUBA 5HE8A 1E9SA 2ECKA 3TUIC 5FTLA 5GJWC 1ZNXA 1PLJA 4E03A 4JS0A 5D3MA 1BO6A 3QKRB 1D5CA 4B3GA 4OHWA 5M04A 4X8LA 2HCBA 2OXCA 1KAOA 3IUYA 2C98A 1JQJC 1KK3A 4OI1A 1E2PA 4MUBA 5JWOA 3C16C 4CEIB 2ZVPX 4G5QA 4C0LA 4LYAA 2R2AA 4IDQA 2WJJA 4UXHA 4LV6A 4ZO4A 1E2HA 1F48A 4A82A 5DHFA 4PXAA 3QSYA 2H1LA 3LNCA 3W5IA 1YZTA 4PPGA 4BLRA 4CW7A 4TT3A 1KMHA 3KJIA 2W2TA 3M6AA 4JBXA 4GT1A 2DHRA 1NVVQ 1TF7A 4QBFA 2HEIA 1B23P 5L3QB 1OH8A 1W44A 4HEJA 2VHUA 1KI6B 2ZE8A 2QE7D 4NCHA 3W8RA 1TQ2A 2XXAB 3KJHA 1XCPA 2IT1A 2WWWA 2QAJA 2O8CA 1T9HA 4I1OA 4LV5B 2BKUA 2VHQA 1FTSA 2P3SA 2WZQA 3HR8A 4KVGA 4OHXA 2YWEA 4NCJA 4EPVA 4DDUA 4G1UC 2BMFA 1N6KA 1DAHA 4G0NA 4JJKA 5BN3A 3K0FA 1J7KA 2FFHA 3WNCA 4D81A 3ZYCA 1VG1A 5CB6A 3VAAA 4ZCIA 2MSDB 3GPLA 1CRPA 5FOUA 3MJHA 1X6VA 3IIMA 4LJ8A 2YC4C 3MLEA 1LF5A 2GAAA 4C0KA 3F3YA 3SFZA 5FOVA 2IYXA 3UMFA 1E1QD 2Y8EA 4L16A 3IQXA 4UXJA 2X19A 3Q8XB 3ONWA 1DG3A 4B6EA 3JVUA 5UKDA 3BB3A 4DLZA 2BC9A 3K9GA 1IM2A 3BXZA 1LF0A 2RMKA 2F7SA 2QN6A 4IVRA 1NIPA 5C4MA 1U8AA 3OZXA 2CK3D 3KFVA 1G3MA 4R2HA 2VP4A 3VR2A 3U6KA 2R44A 5EXXA 3TQCA 1Z83A 2FWRA 3KXKA 1E2FA 4DLYA 1W0JA 3TVTA 1FP7A 2ZI9A 1U99A 3BORA 1W4CA 1JNYA 2R9VA 1B0UA 5IT5A 4M1WA 4LYHA 2K5UA 1UFQA 2PLRA 4US0R 4KBGA 2J0SA 3WBKA 1L8QA 1E2LA 5FPYA 5L3RA 2A3RA 4Q7KA 2MSCB 3CB4A 5DO9A 3EC2A 1RC8A 1R10A 3G82C 4RKEA 5KSZA 5FTMA 4Q4HB 2HF8A 1MABA 3TBKA 1NMYA 1X8JA 1NLFA 2CNWA 5CM8B 2GHIA 3LVQE 4JVLA 1VIYA 4IVQA 3RS3A 1QHYA 4B2LA 4KBFA 3TAHA 5E3HA 5JEDA 1ZNWA 1ZCAA 2YWFA 4HSEA 2JLSA 3IKJA 4R9UC 1R5NA 2ZJYA 4B71A 4Q1AA 1JPJA 5LD2B 2IF0A 4WAUA 5ANRB 5DN6D 3FOZA 3W34A 5GVRA 3S1AA 1GL6A 2R65A 4KXFB 4LK2A 1A2BA 3TR5A 1LV7A 1FMLA 1AQYA 4RD4A 5B57C 4HB2A 1RRPA 2IC5A 2P6UA 1HQCA 2HJGA 4PHGA 2AKAB 4XOIA 5KNCA 1ZUIA 1IN5A 4JLBA 2NTYC 2UZ3A 1HH4A 2PCLA 3QVUA 1YHNA 3LV8A 5JBQA 3KTAB 5IK2D 1RPZA 2G0TA 2EWWA 1T5LA 3CIOA 3H2YA 1ZU5A 2JIZA 3I5YA 3AVXA 1RYFA 1OV4A 1N2CE 1U81A 2ZYTX 1DAIA 1G3IA 4D26A 2OCBA 3FTQA 4JT2A 1XCMA 4B33A 3OEEA 3RSOA 2PZEA 4Q02A 4HB0A 2PJRA 1DG1G 4BLSA 3AVYA 4EPXA 3I73A 1IN4A 4QRHA 4EIWA 4JT4A 2JLYA 5K8IA 2NQ2C 4MRVA 4Q4AB 5LBIA 1Q1EA 1QHHB 2RGGA 1XU4A 2AFIE 2WICA 3I3SR 1KK2A 2WSMA 1N0VC 1NVUQ 2VQSA 1OLOA 1NN5A 2YYZA 4KHZA 3I8XA 2HLDA 4GFDA 4JBYA 5FR1A 1XX6A 4OHZA 3NWJA 2WPDA 3CONA 4HUQB 3KQNA 4FMBB 2XSZD 3M0EA 1NSTA 1OIXA 4U7DA 3D8BA 4ZCLA 1SZPA 3KX2A 4JLNA 1TTTA 1KSFX 1Q22A 3SJZA 5KHOC 1NSFA 2OZEA 2Z4RA 2WIAA 3RVBA 1S4QA 2QM8A 3BRWD 3I62A 4PANA 4QGHA 3WMEA 3TUZC 2J7KA 1N6PA 2CEAA 2XEXA 1DPFA 3K70D 1SKYE 1EX7A 3K0CA 5DISB 3CM0A 4QFMA 2HXYA 1AS0A 4Z1MD 2ZR0A 3ZQ6A 4QKQA 4GRAA 4Q18A 4PFSA 2O52A 1UBGA 4LJAA 1PV4A 4RFSA 1M6NA 3AVQA 1L4YA 3B1XA 2N42A 2WWHA 1E9BA 4BFUA 4HDOB 5JCZA 2O8FA 5L3VA 221PA 3RWOA 4DSUA 4A2QA 3QOFA 5G53C 4CEJA 3L0IB 2ERYA 2GA8A 2D06A 2DFKB 4M22A 4Q21A 1WF3A 2XJ4A 4E5UA 3U6BA 4LJ5A 4MDEA 2RGXA 1E99A 4G01B 2EYQA 3OIUA 4V0KA 2ZRKA 1CR0A 3IIJA 1UJ2A 3SQWA 1GRQA 2ZUCA 2VO1A 3BH7A 4BFZA 1JEEA 1G4UR 4CEHB 3C4JA 5KSYA 3G0HA 3QF7A 5EQTA 5L3SA 1NRJB 5EE9A 2ZITA 1OXTA 4FMCF 1IHUA 4PSAA 1N6LA 3NHBA 4BPBA 2R6FA 4NCKA 2XZPA 4X8MA 2REOA 4JSTA 1CBUA 3DPUA 2I3BA 2ZE6A 3U61B 5CIQA 2OO7A 1EK0A 2QSZA 2QTHA 1GG2A 4Q00A 2ZPTX 1VYTA 2QT1A 3GJ8A 4NYIR 1VDZA 2ZJ8A 3D3QA 3FFAA 4URZR 3RS0A 3E5HA 2WKPA 1BOFA 1XRJA 4ZIRB 5G3ZA 3TW4A 1GITA 4D80A 5KNDA 1WB9A 1E6CA 5A5GA 2ZSFA 5DI3B 1DS6A 3THXA 4DEXA 1G8PA 2OEPA 1RW4A 1OXXK 4JLVA 2IYSA 3RNLA 2BIFA 2JLRA 1LS6A 1WE2A 2CXXA 2RH5A 4QHSA 3SJAA 2Z83A 4NH0A 1XPRA 4BUJA 4Q47A 5AJYA 3K53A 3B9QA 1E79D 1NL3A 2J0UB 4C30A 4EJSB 4QJ3A 4NCNA 3KDSE 3OIWA 2HJVA 3EG5A 4K8OA 1KJWA 3A1SA 2J41A 3SHFA 1GNPA 2QM7A 2JLVA 4URWR 4M21A 2BJVA 4LGMA 2E1RA 4LYJA 5FBWB 1G3QA 4DB4A 1RYHA 2GZHA 1CR4A 2Z0MA 2VP6A 1K5GA 4W5HA 2H7VA 2UKDA 5AJWA 5FOWA 3UK6A 1AN0A 3C14C 3CRVA 1XXHA 4DLVA 2A30A 4JYBA 2X77A 3FHTA 2JASA 3I72A 4FCTA 3T1TA 4AY2A 2PZFA 1Q0UA 2QT0A 2ZS9A 3B85A 2OHFA 3ADKA 1XEFA 2BVNA 2ERXA 3KXIA 1FUUA 4D6PA 5JI3E 3PJRA 4AKEA 1JAIA 2BBSA 1ZD1A 2FJUA 3RANA 2NIPA 1VG0B 1VG8A 4A6PA 2XGJA 3VKGA 5FPSA 1UDXA 2CCJA 1UBEA 3VR6A 4M1YA 1MRNA 1G1MA 1NY5A 2V1UA 2C03A 2WJGA 3OF5A 2RGNC 1ZUNB 1XMJA 2IUSA 5KO2A 3U4QA 4AWXA 1X86B 2QPTA 2B8TA 1R7RA 5B58C 5CDFE 1W36C 1XCGB 1HUQA 1NNEA 5EE3A 2P5TB 3UATA 4BASA 3IO3A 1I2DA 3CUEF 1Z6XA 2V6JA 2QG6A 2FDCA 1TQ4A 2X2FA 2PJZA 2RAPA 1R5OA 2WWFA 1ZNZA 3DOEA 2H8KA 1XEXB 1XXHE 4DBLC 3ICQB 4KFTA 1OPXA 4ZKDA 2R6AA 4FD2A 5BN4A 1JR3E 4A0FA 3X1XA 2VPPA 3TSWA 1MO5A 2WAYA 5J40A 3RDPA 2GXQA 3CH5A 1NLZA 1YZGA 3CPHA 4JYCA 1S2MA 5GADl 5J4HA 3JVVA 4V0MA 3IBGA 5H68A 4JKIA 4FWTA 4A15A 3AM1A 2QE7A 1E9FA 1SVLA 3AVPA 1SVSA 3QUSA 4P32A 4Q4JB 2QPAA 2A5YB 1SQ5A 3DDCA 3QENA 1QVAA 4C0AC 2UZIR 3GLGA 1QDEA 2Q3MA 3AF4A 4JVMA 4XWOA 2OXRA 3MRSA 4QL3A 3EA5A 4GOKA 4MUAA 4MA4A 5JCPA 1KDOA 3D7MA 1ZNYA 4LV8B 1IONA 2Z5FA 1YR9A 2GJ9A 4F91B 2H57A 3TH5A 3B13B 4XD7D 2A7QA 4M8NE 1EFHA 3QKRA 3AP1A 4NYMR 2D2EA 4CT4B 1S3GA 2OAQ1 2A5FA 2GZAA 1E1QA 2RHMA 5EP1A 4Z51A 1XTJA 1XEWX 1U94A 4GOXA 2IWRA 4C7OB 3SS8A 4LI0A 4CEIA 3TMKA 4YQFA 4P0TA 1ZYUA 3QVVA 4PZZA 1TUEA 1W1WA 2CL6X 4JLAA 3U3MA 2CK3A 4LBVA 4R71A 4A36A 1UF9A 1IOZA 3KKQA 4DLTA 4DCVA 3AB3A 1LFDB 4LHWA 1IXSB 1E2JA 1E9DA 1KNXA 1LTQA 3GLHE 1ZVQA 4N0EA 2GCNA 4LPSA 3VU9B 3ADBA 2CHQA 4DLSA 4L4UA 1HEIA 5JEEA 3U44B 2FFQA 4I99A 4BFYA 5AUOB 5K8TA 3I32A 3A1TA 4NYIQ 2AKYA 1D2EA 4BLQA 1V43A 4CF7A 2EU8A 1NMXA 2NO0A 3GLGE 1N6OA 1OT3A 4C2TA 1FP6A 2ZI5A 2CLCX 2W83A 1YE8A 3QY0A 5L3QA 1ZRHA 4QGAA 2QMUA 1AA9A 1KI6A 3AVOA 5FBQB 1T8UA 2QEQA 1ESMA 1F2TB 1FW6A 3KFXA 2DPXA 1GDDA 4FN5A 4AYTA 1VCMA 4H1UA 1XTQA 4O2RA 1EGAA 1U8YA 2J3EA 3OESA 3THOA 4E22A 4F7WA 3LVRE 2D62A 2ZYVX 4ON9A 4Q7JB 4QM6A 1FZQA 3FYHA 4PO9A 3MFYA 4FCWA 2C9OA 2GK6A 3BK7A 3HR7A 4MKHA 2D74A 2ZSAA 1SGWA 4B3BA 4IKEA 2SHKA 2ZVQX 3Q9LA 1ZU4A 1RJ9B 4WBSA 2FGKA 1W0KD 5DN6A 3ZZ0A 4BZPA 4H9GA 1BKDR 3L82B 1KI7A 4DCNA 1KHTA 1IJEA 3ADDA 2GESA 2IHYA 2GK7A 1WMSA 1OFUX 1ZMXA 4M9QA 3UXMA 2H92A 3B1VA 621PA 2ZRFA 1YR8A 1A82A 3OIVA 2B8WA 2VEDA 4XTRA 3Q72A 2HCJB 5HKKD 4M9ZA 3WP0A 1RVDA 4AC9A 3BH0A 3EZFA 2O8DB 2L0XA 3NC1C 5IK2A 3MCAA 4URUR 4KFRA 1ZM9A 1C1YA 3CLVA 3MGCA 4Z8XA 2XOKD 4B74A 1TL7C 3P4YA 3PIRA 2QUZA 5JHGB 3OE7D 4OQXA 4M1SA 4UXIA 4B3CA 1RFLA 3HYTA 2P5SA 1U9IC 4W9MC 2GF9A 1GKIA 4UNSA 1KDTA 2CMKA 5HCNA 2EYUA 1UKYA 4Q9HA 4OK5A 2KWIA 3KB1A 3AH8A 4TLDA 4P4SB 4YLGA 3RYTC 1F60A 3NEYA 1W49A 3ND9A 2YWGA 4QM7A 1P62B 4PC3A 4BE7B 1AGRA 4QHTA 3B8HA 4Q4HA 1W7AA 2ZRNA 2VP0A 2OE2A 3EIQA 1DAKA 4OHYA 1VHLA 1E32A 4ZPXA 2N46A 1OE0A 2PL3A 2FEOA 2ZSDA 1KK0A 4YMSA 2XSZA 4Q66C 2WSSD 1SKQA 4RKFA 3TSOA 4V0NA 4G3XA 3SZRA 3SBEA 2CJWB 4DVGA 3PG5A 3UMSA 1NJGA 3SU8A 4HUTA 4P4UA 3JZAA 1EESA 4DEYA 3LLUA 2AWNA 4GMXA 2B7BA 3DKVA 4RD6A 4RVCA 3MMPA 3GJ4A 4LPKA 4UNPA 4TMKA 1EFRD 3THYB 1G9XA 1E2IA 3SEAA 2ODNA 2V55B 3H0KA 4BLPA 4A8JB 2KSQA 3KTAA 3LQRA 3EWSA 4Z1MA 3RSLA 3QEJA 4TL6A 4BEJA 2WJHA 4A2WA 2GKSA 3VKWA 1WXQA 1X3SA 4B6FA 5SZHB 2TMKA 5EUMA 2RGDA 4BFSA 2V54A 4FW9A 4QBHA 3UANA 4D25A 2O0HA 4I1VA 1J8MF 4BFWA 1NN3A 5HTKA 2JATA 3FE2A 4NYMQ 2ZRIA 4PPQA 821PA 1QRAA 4PO1A 2QBYB 4KV9A 1QHHA 4PX9A 4B44A 3FMIA 5FPHA 5JRZA 2DFNA 4NL4H 2VLIA 5G41A 3WNBA 3CZPA 3DL0A 3U7EB 2J1LA 3A1WA 3EIHA 1UKEA 1YJ5A 4PZYA 4I1UA 4ZKEA 1Q1QA 3OIYA 4KYUA 2AWOA 2FSFA 1FQJA 3BOSA 2GEVA 4PC7A 3KB2A 4M53A 3RABA 4HUQA 2W6ID 1AIPA 3EC1A 3LA6A 4QXAA 4AYXA 3RS5A 2XZLA 3HU2A 1XWIA 3BC1A 121PA 2PT7A 4MITA 1GNRA 1U90A 1J2JA 4YXWD 3O8CA 1KI1A 5KDDA 4M2LA 2ZAOA 4US1R 5EZ6B 1K8RA 5BYKA 1Z08A 2BCGY 4JKYA 1E9CA 3T35A 3K70C 4TYWA 4OI0A 3OEHD 4A0RA 3EPLA 5DIFA 3WRYC 1XPOA 3LH5A 2D7CA 1R6BX 3K1JA 4KSBA 2C2HA 4D4JA 1UEJA 2ZRDA 1G7SA 2LKDA 3RS4A 2ZJAA 2IUTA 2VHTA 2EWVA 2FU5C 4AI6A 1CJTC 2AR7A 1Q21A 2ZRAA 5EUQB 1KY3A 3EIEA 1E79A 1K6MA 4R98A 3PEYA 5TDHA 1BMFD 2R62A 4ACBA 4JL6A 1T8TA 4LRWA 3I4LA 3GCGA 3GEHA 2PMKA 3GEEA 3UIEA 3EZ2A 4EFMA 2NZ8A 3T1VA 1KO7A 2D7DA 4B35A 2IEZA 1HE1C 2A5DA 1Q12A 4TMTA 4ASUD 4E09A 3PUZA 4HAVA 1MKYA 1WQ1R 4II7A 2GRJA 4PQFA 1EFTA 1KGDA 2VL7A 4WIAA 2PX0A 2QP3A 1SVKA 2XTMA 1P3JA 1NG1A 1IXZA 3D6TB 1ZD8A 4L5BA 4PAOA 2AL7A 1IY0A 2J45A 3LWNA 4PZLA 4L9WA 2AK3A 2BBTA 5FUYA 3B2EA 4FMCB 5GVSA 1HQYE 4G5OA 2ZI7A 1G7TA 2B92A 721PA 2DFLA 1TQDA 3W90A 2C95A 4B2IA 1RZ3A 4KFUA 5B2ZA 3GJXC 4ZIRA 2C8VA 3IEVA 1E1RD 4GPTA 5DI3A 2BCJQ 2OBNA 2KBFA 4NYJR 3DVLA 3NDBB 1QF9A 3PEUA 2QAGB 421PA 1JJ7A 3EARA 4DCTA 1YRBA 3CF6R 4DCUA 1EG7A 2Q3FA 3NBYC 4F92B 1CRQA 2OILA 4DLUA 1BH2A 5JLJA 2J0UA 2PEYA 3CWZA 3ZH9B 2C78A 2G1JA 4EJSA 1MO4A 3IIKA 1ZD9A 2RCNA 1GVNB 2FZLA 4JL5A 3DMDA 3V9PA 2JJ8A 1UPTA 3CBQA 2ZAMA 2Z4SA 4UNRA 1XBTA 3SFVA 4I81A 3RAPR 4Q1BA 2FPKA 2WWIA 3SN6A 1KY2A 2JEOA 4DHEA 4B32A 2JLQA 2X1VA 4NU0A 1DO2A 3FKQA 4LC1A 3VX3A 3QXJA 1KAGA 3QEOA 4TQ9A 1J99A 3CF2A 4XH9B 3QBVA 3REFA 3CZQA 1CJVC 2GNOA 3PFIA 2IA5A 2EFDB 4XD7A 2AXPA 1X1SA 1TX4B 1YR6A 2O5VA 3H4MA 4V02A 3PQCA 3Q5EA 2ZYUX 2HT6A 3K9HA 1LB1B 3X1WA 2P65A 4JLOA 1HYQA 4IOKA 4IDHA 1GKUB 2ORWA 3OAAD 2OBLA 4DT1B 3W9YA 1E2QA 1E4YA 5BN5A 2YWHA 2W6JD 4JIMA 4NMMA 1JBKA 4TMZA 2PCJA 2ONKA 2PMDA 2FG5A 1KO1A 2QU8A 2DR3A 1SVIA 2HDNB 3CR7A 2J7PD 4W5JA 4KLZA 4IHQA 3BWDD 4X8OA 5LB2A 1JALA 3HWSA 2HYIC 3WBJA 4LUCA 4NONA 1OXVA 1XEWY 1JQLB 1VCIA 1YZLA 3BIFA 4QBIA 4LJ7A 5SZIA 5LPNA 3MWJA 3AGPA 4RZ2A 1QZXA 1A4RA 4LYFA 4AKIA 3VQTA 4C9BA 3SBDA 4IVPA 2BKEA 4RY2A 1P9RA 2OCYC 4Q4JA 2OFXA 2CLSA 3WMFA 1S3SA 5GJVC 3AUYA 3C5CA 4B47A 4Q9JA 1CXZA 3L0PA 1SXJB 2QP4A 4OI4A 1G8HA 2MSEB 1M1YE 4CT5A 4POAA 4PC6A 4Q4LA 5JRJA 1JECA 1P2VA 2IXGA 1ELOA 1HE8B 2Z6VA 4L8GA 3W5JA 1UAAA 2FN4A 2GILA 2ZRBA 4P3YA 1W0KA 4U5XA 2WOOA 1EFUA 1ZM2A 4TL7A 5EE5B 3GLFB 4TL9A 4A0GA 1RRCA 4C7OA 1I4DD 5DI9A 1E2NA 4ARZB 1E9RA 3SDZA 1G16A 4TLAA 4MDFA 3TSZA 5FTNA 5HKKA 2WV9A 4DXAA 4YMVA 1Q1ZA 1YU9A 1XMSA 5A4JA 2VA8A 3O8RA 4QG7A 4KCGA 2XOKA 4MQBA 3QI2A 4RZXA 3AP3A 3P1JA 3OE7A 1TMKA 1U8ZA 5FBRB 3FMFA 2ZYWX 3GLIB 3U44A 4EPYA 4HAYA 4TYYA 2E87A 1AKEA 5FL7D 4IXNA 4JBWA 5HCIA 2CLDX 2XTZA 3CW2A 1P9WA 2F1JA 3U3RA 2FSGA 1G3UA 4PHTA 3TIFA 3V00A 1KKMA 4NYJQ 1YKSA 1JB1A 1GIAA 1PVOA 4WXPA 1EFCA 1FNMA 1F2TA 2YHSA 4GOJA 5CYPA 3W6OA 4AYWA 2ZU0C 4TZ6A 5JMTA 3UWOA 1CJUC 5P21A 1ZIPA 4RFVA 1SXJD 1UBFA 4HATA 4ERNA 5GJBA 1U98A 5F3WB 2BV3A 1J8YF 1P73A 2KE5A 2QQ0A 4BZXA 2WSSA 5KPJA 2NO7A 3V4RA 1RJ9A 2CBZA 3QJYA 2AFHE 3SYNA 1GFIA 2PT5A 3UWKA 1ZW6A 2BBOA 2YZ2A 2D3WA 1AM4D 4DDVA 1E9AA 1L7VC 2VHCA 4Z8YA 2ZI6A 4M9XA 2DWPA 2PZGA 1KZGB 4M1OA 2IS4A 2HT1A 2GEDA 2QY9A 1XJQA 2VP9A 4W5WA 4I1SA 4QHYA 1EFRA 4DCSA 1G7CA 2EQBA 1N5KA 4JVSB 4UJ5A 3EW9A 5AWFC 3WRXC 1TU3A 2QROA 2O8DA 5G40A 3MWLA 5HPYB 3FB4A 1NF3A 2IYTA 1M34E 2A2ZA 5K8LA 3J81k 1QHNA 4A0HA 4EQ6B 5DH9A 3MG9A 1UM8A 3RC8A 2P0EA 1E2MA 4ZDIA 2B7CA 3AF3A 3LX5A 3ZZUA 3K0CC 1KTVA 4P4SA 4LHZA 4UNQA 4Z54A 3HJNA 4YMUA 4A9AA 1DEKA 4IFBA 3DM9B 2ANBA 4TSFD 4BFXA 1AZTA 2XX3A 3BFVA 3NXSA 3EZ9A 3LBIA 1T3SA 3T5DA 4B3FX 1H8EA 4KFSA 2CE7A 2ZQ5A 1X8LA 4TQUS 4DSTA 1BS1A 4Q01A 4LBYA 5FOSA 2FNAA 4N3NA 2NZJA 1GM5A 3DMNA 2W6IA 1JPNA 4C0BA 4K46A 4LSGA 1SVOA 3PVSA 2KJQA 5KDOA 1R8SA 1Z6GA 4YXWA 1YRAA 4NKRA 5FI0B 4DKXA 4D4LA 2FFBA 2JJ2D 3X1ZA 2C9CA 4OQLA 2V7QD 3FWYA 3T5GA 3K0FB 1PLKA 1J90A 1XD2B 5AK0A 2Q0HA 3T1QA 1MOZA 2HYDA 5CYOA 3VKHA 3THYA 3DHWC 3OEHA 3L0SA 4A8JA 4DDTA 1F2UB 3ZVNA 2ZANA 1CU1A 2REXB 3FMOB 3A4LA 4S2EA 5AJZA 3DZ8A 2F3TA 4A4DA 2LWIA 2BWJA 4OK3A 5JS7A 2H17A 4OL0A 2XB2A 3T06B 2BJWA 1DAFA 5JI2E 3GFPA 4PR0A 3VTKA 4C3ZA 4NE2A 1FX0B 1G8YA 3VNVA 2ZU6A 1CF4A 1GL9B 4IJMA 4XVRA 2QBYA 1BMFA 1P4SA 3KXLA 2VHJA 2IWHA 4BRWA 2O8BB 2DY1A 2V6IA 4OJKA 1Z6TA 4JLDA 1VYUA 2V9PA 4PPFA 2IK8A 2ZRGA 3VNUA 1X1RA 1KZ7B 1NI3A 4KAXA 4MYCA 4ASUA 2PEZA 2JAQA 1HURA 1RE0A 3H84A 4HLQB 3ZZTA 4BWYA 3W3ZB 4BRUA 2LCFA 4BGDA 3LLMA 1OH5A 3U2QA 4DUGD 3B60A 3C8UA 3VHLB 1FFHA 4LDJA 3PUXA 5E4FA 4Q9KA 1KDRA 4PSKA 3P4XA 4C0SA 1E2DA 4GSYA 4GP6A 3K09A 2F3RA 1NG9A 2PLFA 1TEXA 2H18A 1NLYA 1D6JA 1I4LD 4TMXA 3KKOA 1KJYA 1LNZA 1CEEA 3KJGA 2BMEA 5HZKA 1DVRA 1E1RA 2VP5A 4AK9A 1Z28A 3NH6A 1D8TA 1EXMA 5FUXA 4G5GA 3VHXA 3RLFA 1Z5ZA 1TNDA 1NVXQ 3VR5A 1AS3A 3FVQA 2NOAA 2IYVA 1KKLA 3Q5DA 5LB4A 1HT2E 4EUNA 3ND8A 5EZ5A 4P33A 2OT3B 1N0UA 5J5CA 3U60B 3UPUA 1CP2A 3SYLA 2GCOB 3NC0C 2CL0X 2FMXA 1GL7A 2G1KA 4L15A 2CL7X 1N25A 4YDSA 3EPHA 3ICEA 2VTKA 4DSNA 1OB5A 3PCRB 3ECCA 3NKVA 1II0A 1NN0A 521PA 1SKYB 1T4GA 1EWRA 2IYYA 3AV0B 4TLBA 1E2EA 2JLXA 3AQ4A 3GMTA 4V0ME 4D0NA 3B78A 1GKYA 4RCYA 1ESNA 1CJMA 3AP2A 4HDQB 2N1BA 2ODWA 3LBHA 2V3CC 1ZM7A 4Q1CA 1G21E 1W5TA 2CVFA 1U0LA 1VCOA 1QG2A 2IBMA 4YMWA 3ADCA 1VECA 3SJCA 4EFLA 4HB4A 1Z47A 2XJ9A 3K0EA 1UDWA 1OB2A 4TTPA 2GXSA 3C15C 4Q7MB 1QG4A 2ZR7A 4NTZA 2HXSA 1P60A 5J47A 2XXAA 5IRCD 1E94E 2HV8A 4B43A 4W7SA 2RGCA 2WWXA 1XJ0A 4WOPA 4V03A 3QXHA 3OAAA 2QAGA 3BS4A 4FMDF 2FH5B 2GVZC 2A9KA 4WW0A 3B1YA 2GWHA 3CH4B 2W6JA 3KJEA 1YZUA 3BE4A 5H70A 2OM2A 4HLCA 2BEJA 3E1SA 4XIGS 5JS8A 2WOJA 2J7PA 3BB1A 3GJ5A 3CNLA 3THWB 3GJ6A 3W6PA 3ETLA 2VP2A 1E2KA 2ZEJA 4TYQA 1IY2A 5AUNB 1FTNA 4DIEA 4KSCA 1GOTA 1Z2AA 3PITA 4GZMA 5EP4A 2FSHA 3GJ3A 4Q7LA 5JZVA 1G5RA 2IL1A 5FTKA 2EFHB 2ZREA 1I2MA 3QF4B 3WNDA 4RJLA 1MT0A 2O0JA 2BEKA 4GZLA 1R4AA 2G77B 2NGRA 2IXEA 4PHHA 2G0NA 1E0SA 4OK6A 3V4FA 1XJCA 2F6RA 2JCSA 5KU1A 1YZQA 1ETUA 3QPUA 2FGJA 4RD2A 1H8HD 3GQBA 1NP6A 3PXGA 1GTVA 2KI5A 3KQLA 4OQFA 1JJVA 3I61A 1KJZA 4B73A 1AJEA 3FMPB 2ODEA 3HU3A 3IGFA 1M8PA 4L9SA 1XMIA 1Z29A 1M74A 1G6OA 1OXUA 2VH5R 4A1FA 3VFDA 2I1VB 3KL4A 4PPNA 4Q1FA 2VSOA 4PSVA 2IYZA 4UQOA 2LKCA 3R7WB 1OYYA 2GJKA 1LS1A 2CCKA 2F43B 2IYLD 2MMGA 3LBNA 4LBZA 5FUWA 2VSFA 3NBFA 4IRUB 4MKIA 1S0UA 1Z0FA 3LXXA 5C4GB 1GILA 4DSOA 5SZJA 3QPWA 4IDNA 4DT1A 3CRQA 1C9KA 3CRRA 1IXRC 3KQKA 3N2EA 3AKEA 5BYJA 3TNFA 3RHFA 2OLKA 3R8FA 3QKSB 3FHCB 3CNOA 2JLZA 1NVVR 3TE6A 4OQNA 3EX7C 1JAHA 4ZI2A 1M7HA 1SHKA 4HAZA 1HT1E 4GP7A 1F5NA 3GJ7A 2EW1A 3A4MA 3E2IA 4WZBE 1OYWA 1G6HA 2ORIA 1IJFA 1MO3A 5FL7A 2GBLA 1R8QA 1W36B 3VX4A 2OAP1 2C04A 1Z2CA 4B3DA 2IS1A 4DB2A 3WP1B 1OH6A 5IHPA 5KNBA 1G291 1DAMA 1IAQA 1ZBDA 2BOVA 3ASZA 4HLUA 3HP1A 3F8TA 3T15A 4ACAA 4CIDA 4BFTA 5HZHA 1SXJA 1PUJA 4PO8A 3O47A 1U0HC 2XNDD 4B34A 4ILEA 3R8CA 1Z63A 2WBLC 1E9EA 2JLUA 1OHHD 2AD1A 2ZR9A 3CPJB 4Q4AA 2WMOB 1UADA 3CRW1 1ODFA 2IHBA 3MD0A 2C96A 1ZM4A 1Z8FA 2ZJ2A 4DLWA 4TYNA 3GLFA 1H8ED 3H1TA 4IEEA 5HR5A 2QRZA 4IXMA 3LFUA 4C0JA 3LD9A 4M1TA 3MWKA 3L43A 3B1ZA 4MH0R 4ARZA 3NHAA 2CDNA 3A6PC 2YJTD 1NBMD 3AUXA 1N5IA 1IN8A 4Q48A 2QGZA 2WWGA 2QTFA 5LD2C 2WJVA 4PAMA 1LVGA 1Q20A 3QXCA 3CR8A 1G5TA 4MGYR 3UKDA 3PEWA 6Q21A 4EDHA 1O3YA 1L2TA 4UNNA 1P7CA 1PUIA 3TQFA 3ZD6A 3IO5A 3TRFA 2WMNB 2FZ4A 4X8HA 4LY6A 3SI7A 3GLIA 1FNNA 1GSIA 2VRWA 2W2XA 3H86A 3PENA 3RWMB 5DGXA 4CZ2A 2YINC 3ZDQA 3HPQA 1QHSA 3BFKA 1P2TA 2QL6A 3RC3A 5IF9A 1W36D 1WDTA 1TF2A 2JLWA 3AVTA 2B6HA 2OUKA 1OSNA 4AD8A 1XFAA 3AF2A 4TSFA 1OXSC 3WYAA 4F93B 4F4IA 3M1IA 4JVNA 4Q5IA 1N5JA 1G20E 3E70C 4N1AA 4NBSA 3PEVA 3BBPA 3BERA 3N70A 3SYKA 5CB8A 3KUDA 1FQKA 2Q21A 1XNJA 4YDHB 2ZI3A 2QENA 5EXPA 5A0FA 3GLHB 1XTRA 1R0WA 3LQQA 3IILA 4D2IA 4WVFA 4BECA 2XAUA 1G17A 3ZVMA 2DB3A 3K9NA 1JR3D 3R9WA 1VIAA 2IS6A 2EVWX 4EPWA 2JJ2A 4OKSA 2V7QA 3UG7A 3KUCA 4NPHA 2P6RA 4CEHA 1YVDA 3WYFA 2NMVA 5EXSA 1XMVA 4PQYA 1CLUA 5KDLA 3KQUA 5BQ5A 3X1YA 1RRFA 2G3YA 3D31A 1U0JA 4OI2A 1T3HA 4QOSA 4DJTA 3GEIA 4HLDA 4EPRA 3BB4A 2D2FA 4HDCA 3EAQA 3GD7A 3C5HA 4Y0VA 2GZDA 1OJLA 4J0QA 1U2RA 4EQ6A 3EASA 1E98A 2F9MA 1S96A 1JXOA 2G9NA 3ZIAD 4TN1A 2GTPA 3SQXA 4C0HA 5J4LA 2R6GA 2RGEA 2NO1A 1OFTA 2YOGA 2AHOA 3EPKA 2OV2A 1CS4C 3QXXA 4AKHA 4P31A 1PLLA 4IW3B 2GEUA 5K8UA 4EKDA 1UKZA 4LCBA 4PHFA 4JJZA 4NP6A 5JJKA 4B76A 1G5PA 3MWYW 1AQUA 2OCPA 3ZS8A 1KI9A 1OKKD 3W8NA 2QPOA 1CULC 3RRNA 4ESVA 2FA9A 1KNQA 1IQPA 1KI4A 4LJ6A 3Q7PA 4DDWA 3AKYA 4C2UA 3SJBA 4MGZR 4DUGA 4DIDA 1S8FA 3BJIC 1HV8A 3KKPA 2QMEA 1NMZA 3U3KA 1T0HB 1JEDA 2WVJA 4O25A 2J0QA 5JFGA 3I1FA 1G8FA 5TARA 2A78A 2Q6TA 4RZUA 1XD2A 2BHRA 4NZYA 3CPEA 1Q57A 2GVDC 3ASYA 4OYHA 4MKFA 3U3OA 3WHLA 3B1WA 3SR0A 1F6BA 3NG1A 3CWQA 1F2UA 1P2SA 1W47A 2R8RA 3B7GA 2OFWA 4XSHA 5GJCA 5TB5A 5B64A 1N6NA 3A58B 2OESA 4K81B 4MYTA 3GFOA 2ATXA 4JZKA 5TY0A 4QGFA 3Q85A 4U00A 5AUPB 4F4JA 1E0JA 1TU4A 3BH6A 4JMPA 2YVUA 2HUPA 5FUVA 4NDZA 1Q3HA 4IDOA 2X2EA 2X8AA 1FX0A 2QRNA 4B2PA 5F2EA 4OQMA 4HZUB 5JHHB 1XZQA 2WIBA 3LW8A 3TLXA 1MO6A 4TTRA 1Z0AA 4M1KA 4PTLA 3SHWA 2QMOA 1DOAA 2ZS8A 3EZ6A 2O8BA 2JDID 4ZCMA 1AGPA 4N0DA 4ZDWA 1DBSA 3P32A 3I5XA 1ONBA 5CLLA 3HDTA 2GETA 1J70A 1N5LA 2RKOA 1S9HA 1Y3AA 2ZRHA 3F5FA 4PC2A 2KBEA 3PUVA 4ZV4A 5DLQC 2ORVA 4EJSC 2O0KA 4XTCS 4RD3A 1XEXA 1G41A 5C46F 5CJPA 1D2MA 2C99A 1PJRA 2I1QA 4LJYA 1KO8A 2IXFA 4QJ4A 3B9PA 3QNUA 1CJKC 5DSZA 2HF9A 3JZMA 3ZLJA 2JGNA 4M0LA 4WZAE 4TZ0A 1CIPA 3L8ZA 2WKQA 3LAWA 4XWAA 1KIMA 5FL3A 5E7MA 5FBVB 2P2LA 4NHOA 5FBLB 2C77A 4HYYA 3O8BA 3MJRA 4IOJA 4DRZA 4AURA 1OW3B 1E0KA 1KDPA 4QC2A 1T5IA 2KB0A 3QBTA 2W2VA 1W48A 1JXMA 1T0JB 4BLOA 2QA5A 1HA3A 2G6BA 4BFVA 1CTQA 3B5JA 1O87A 1C4OA 5E95A 3K70B 5JSZB 3CF0A 4MYUA 1MR3F 1RRGA 2GCPA 3C7KA 1KI3A 3K0AB 1US8B 4TMWA 4LOAA 1COWD 2G88A 3TAUA 2GCOA 1N6RA 1ZJ6A 1AKYA 4HAWA 4IOLA 4XWKA 4A2PA 4KO8A 4ZDKA 4KITB 2V4ZA 2DWOA 2C5LA 3W3AA 2O8EB 4KVAA 2EFGA 5B30A 3T12A 3AVUA 1FOEB 4F4CA 4DZZA 2DBYA 1RIFA 3PUYA 1DAEA 5FOTA 4GNKA 4US2R 1GZSA 3VU9A 1Z6AA 4ZDJA 2ZSBA 3VMFA 4R7ZA 1Q44A 2PH1A 3P20A 1H8HA 2YV5A 4M1MA 2ODBA 1DAGA 3WYGA 2NO6A 1WBBA 4TLEA 4O2LA 5DYIA 4XSGA 1Y63A 2YC2C 4RCZA 1NVWQ 3FKSA 1QVRA 1E4VA 1AS2A 3L8YA 3K0SA 1T3LA 4YONB 2UVQA 1XD9A 3FPAA 1P5ZB 2QZ4A 3NDPA 4EFNA 1XD8A 2C9YA 2Q3HA 4A92A 4D82A 1W5SA 5L8VA 1VG9B 3TR0A 2OFOA 4S35A 2FPMA 5FH9A 3TK1A 1MH1A 1DADA 5C2JB 4LHXA 2DCUA 1IN7A 8OHMA 1KSJA 1P72A 1XZPA 4A6XA 1II8B 1Z6YA 5FFMA 1KMQA 1W4BA 3OFNA 4FMDB 5CK4A 2W58A 4CRWB 2QSYA 3NEJA
chains in the Genus database with same CATH superfamily
1L5ZA 3PNPA 3IUQA 1DC5A 3FYUA 4LN1A 4HX2A 3E35A 2EKZA 5KNCH 1QPGA 3VKVA 1KTIA 3P26A 5D3MB 4PG8A 4LG1A 5A6SB 3ZE7A 1ZA1A 3C85A 5AK4A 1G60A 3DCYA 4NFSA 3CUWA 1GRCA 1XVUA 3NVKI 4RW0A 3URMA 3EFBA 4HRXA 3TD9A 2W6OA 3AOEC 3RRFA 2C5AA 1T10A 3O4GA 3WHKA 5K8CA 1SOUA 5H80A 4JXXA 4D9HA 1M7BA 4JODA 4RQAA 2C7QA 2WSLA 4PGAA 1TPZA 1YA8A 1PKXA 1KSGA 3GYBA 2JB9A 1GN9A 2RKBA 3VU0A 2XNDA 3GGJA 3F7MA 3U3JA 1KRHA 3T1OA 3TJZA 1OIVA 1RD4A 1EJBA 1VPLA 2HXGA 2Q9BA 3ACCA 3DHVA 4FT2A 4NZ9A 5HA5A 5IMBA 2A14A 4RTJA 1OY1A 1TAQA 4GGPA 4MRPA 2R6DA 5AKXA 4BMZA 5EP3A 3QUBA 1E69A 1FUKA 3Q3GE 3LO5A 3OCYA 4GPZA 4J43A 2VDJA 2DOKA 4X44A 5DGCA 5EUBA 3TCNA 2F43A 1GQ2A 8ADHA 1ISSA 5U9CA 3HVJA 1CFJA 3G9ZA 4RNDB 2PL1A 4P98A 1RMTA 1GT91 2BFBB 1AO3A 2D5BA 5B1DA 2P8SA 4MLCA 4BO8A 5TPZD 4DMHA 4M0DA 5LL6P 2Y1CA 1OD6A 2EOAA 3I8OA 3JQ9A 1BXGB 5IAKA 1B1AA 1JH8A 3HBFA 4CVNA 1YIAA 2C2ZA 2H3HA 4G89A 3CKKA 4HO1X 2O8CB 3F78A 3ROXA 1BN7A 3GMDA 2P67A 2VYFA 3MTDA 4IZOA 3MGGA 1Z0DA 3TRKA 3AUSA 4PLCA 3ZJYA 2ZXUA 1Y7PA 1QHGA 3IMGA 1XPUA 1Q0SA 3ZU5A 2L69A 2A94A 4FYWA 4BN4A 1SUFA 1ZGZA 4EOGA 1HKHA 3VZQA 2IDJA 2YCBA 4MULA 4NFHA 4U0JA 2GYUA 1U0OC 3DXXA 3JQBC 1WUYA 2M32A 4UD2A 3ZHUA 5F98A 3L4JA 3ZD7A 1REQB 1FRVA 4FWBA 4OLJA 4URYR 1QX3A 3HN6A 5CDFA 2OHXA 4YWHA 4PQRA 3M4ZA 3H83A 4PRYA 1WXIA 1V4VA 1QYIA 2HC9A 2PZJA 3UB4A 3GLVA 2PUGA 4GZ5A 2Z30A 3ANMA 2GERA 4FX2A 3T41A 2FWBA 4POOA 1EUCA 2R4TA 1N2EA 3C7DB 1Y3CE 3FR7A 3MTEA 1Z0JA 2ZBPA 3JQPA 3LXRA 1R5BA 2WFLA 5E7QA 4BMCA 4RELA 5BPFA 6ADHA 3BX1A 1UOPA 2OG2A 1I36A 1FLVA 3MJFA 4YGYA 5D8DA 2VIIA 1JR3A 2GPJA 3D64A 3KWJA 3T7SA 1II9A 3ZWYA 4BWGA 4ZTZB 1ZITA 2HO5A 3N2KA 3KR9A 4N8EA 1G63A 4ESEA 1DG9A 2XUIA 1QRSA 1XVVA 3GB9A 5BSEA 3QIAA 1HL3A 5JALA 1P7WA 2V8BA 4G85A 1YGPA 3FFBA 5ICFA 3KE8A 1QNFA 2YOFA 2RHDA 4HDNA 3T3MB 1CQXA 4CIWA 1ID1A 4AL4A 1PJ2A 5C3UA 5JYEA 1D3AA 1FYEA 1Z75A 1EVLA 3U40A 5IXSA 5EJ7A 3U9SA 4QJBA 3UY4A 5BWMA 4NXMB 4J0CA 1OFIA 3NBMA 1KK1A 1T43A 4P5DA 5ENDA 2NM0A 3H19A 3MJVA 3OT1A 1CERA 2A0XA 2H52A 3QWHA 4O2AA 3T5CA 3WL4A 5FWYA 3VZRA 3IHWA 1HY3A 1CVRA 1JQ5A 5ALKA 5K3BA 2AG6A 2VPTA 5HOEA 2ZETA 3OZVA 4BX9A 1WV0A 3DWGA 2WE7A 3EA0A 4YAGA 4HF7A 5CU7A 5IEJA 5JDIC 3S1AB 3C3DA 3CRNA 3AG5A 3FSJX 4GXQA 4B81A 5G3YA 1O0CA 2EZ9A 3JWJA 2DPLA 1G9TA 3BIOA 2XUPA 3KSAC 4V0LA 3E0QA 3K96A 1G8GA 1DXHA 1PEDA 1KRXA 2GJ8A 3BDVA 2G9VA 3MMXA 3R9XA 3WDSA 1CY2A 1KYIA 2OFPA 3P4UA 1HRDA 4GEKA 1AGYA 1NNSA 3N0VA 5JJIA 2FQ1A 3HCFA 1E3IA 1FL9A 4MOWA 1WKVA 3T34A 4BAUA 1TUIA 4I4CA 4KODA 5DM1A 3IVRA 4MV9A 2EJUA 1DQNA 1IY8A 3K5IA 2X3FA 2OXTA 3FYCA 5EJ6A 5CDYA 4B5KA 4UJ3A 4UAVA 3NH9A 4DXDA 3R20A 1DAPA 2I4IA 3FPFA 4RD0A 1IBCA 1M66A 1G4AE 1OBFO 3IBYA 5CJJA 4ENWA 4HMOA 3KQTA 1CVLA 1A1VA 2OBFA 2N3ZA 3LRXA 3KYDA 4WA8A 2YFKA 4QO8A 3QOXA 2JAUA 1EIZA 4ESHA 3W2TA 5BR8B 3G17A 4XYLA 2ZBDA 3RRXA 3R5XA 2O1SA 4TTAA 1XN4A 4Q3NA 4QDUA 4EHAA 3OHMA 4CLDA 2FUNB 5A5VA 2GBIA 1HNXB 1QHIA 1MENA 1F20A 2GCIA 3N5KA 1B0AA 3HVKA 3O5AA 2MMCA 2V8OA 2F1HA 2NQ8A 4YECA 2LCQA 2ONJA 4E07A 4C3OB 3HDGA 3K09C 2LVBA 2BDTA 4Y2PA 3R7FA 2PLAA 1AT1A 2OCAA 3LY5A 3K35A 4N7JA 3O9VA 3TI7A 1SQSA 3AEZA 2GWRA 4NBUA 1K8ZB 2AUNA 3N0RA 2FP4A 2AFHB 3KKNA 1R64A 4TVBA 3OQVA 3C6BA 1MQ8B 2YJZA 1KJ8A 2VJLA 2ZYRA 4WZ6A 4ZFNA 1XMPA 1MIOA 5JXIA 2ONZA 4RPGA 5HKBA 4BB5A 2C82A 2X1MA 3CLSC 3O8DA 4JLJA 5AW2A 2JDIA 1QCYA 1F0KA 1NYLA 3HPRA 1PRYA 3PDIA 3EMDA 4LBWA 1I5RA 3IPYA 1ECCA 5DNAA 3SXPA 3RO7A 1HR0B 3J7AC 1EQUA 2FV8A 3GN2A 1U2GC 4O4HA 3FOBA 3HL0A 4XVQA 2ODPA 3LC0A 4BLTA 2X8LA 2IYUA 4JU9A 4RXTA 1GPLA 1TVKA 3T9EA 3X2FA 1PZNA 3PUWA 4ER0A 2F1IA 3LDGA 4E08A 4B83A 2H63A 4AG6A 2G07A 3JY6A 3ND6A 1OBCA 4TV8B 1JHAA 3ZYZA 2CLFB 3B3QA 2AK2A 3I83A 1O03A 4IO0A 1WX1A 4JL8A 5DNDA 5JSUA 1T8PA 4CEJB 4BPRA 1XDUA 2DFTA 3HI4A 1RP7A 5FB3A 4EB0A 3OWOA 2A9FA 4LJ4A 1P2UA 2PX8A 2VBIA 3ER8A 3VV2A 4U7GA 1XTUA 2WDPA 3UOWA 1WMFA 4PZPA 4QT4A 3KJXA 4PC1A 4KE7A 4XCVA 5CK5A 1KH2A 5ER6A 5CXUA 3EXG2 2OQ2A 2VK4A 3ZQJA 1D6SA 4KR9A 3RYFB 3V8NA 4HYEA 2Q5QA 3EY4A 3V55A 4P3XA 5TMPA 2ZB2A 3SG0A 1Q1BA 3V8EA 1VHTA 1SVWA 4QWWA 2YYAA 4DLLA 1H4QA 3K20A 1F2VA 4C22A 4F38A 4DR3B 1O54A 3ZNQA 4C6HA 3HYRA 1E1KA 1V47A 3I09A 4ZHQF 5H16A 5INTA 2QP9X 5CFZA 2F1OA 1J25A 1VKNA 2B0JA 2IU6A 3P9IA 5KHAA 5SZKB 3A3YA 3WGQA 4B3XA 1UJ5A 1VPDA 4JEHA 3TTXA 1M0EA 5DJ5A 4D8XA 2KS6A 4QLBA 5C18A 2GM9A 2JH3A 5DTRA 1KJQA 3LBYA 3M2TA 2HMTA 3ZZNA 2WD7B 1YUNA 2R8XA 3ROGA 1QIEA 1HXHA 1MX1A 1C0IA 2JZOA 2ZUDA 2BFDA 1OF1A 1JHXA 4LDAA 4LJRA 1WNFA 3L6DA 2XB6A 1XDBA 2ANCA 2EL7A 3D1VA 2G7MC 2GDZA 3A6LA 1X94A 2Z9CA 4MDYA 1CR2A 4CU2A 3ZVLA 2PKQP 4MP6A 3RBXA 2IU3A 4G0MA 3I6QA 1IC6A 1GGJA 1L4FA 3PV0A 4JUFA 2WC1A 5A1JA 1TYCA 4JI8B 4IFEA 3AUTA 1LNQA 3RYCB 4D8TA 1VJCA 2OV3A 3ETJA 5LOVA 2WEKA 4BBJA 3DLBA 5CLQA 1ECPA 3TPCA 2WG1A 3N5CA 5EJ2A 2C7PA 1LBEA 3BMCB 1ZW1A 2FFAA 3I1YA 2R6CA 4BQSA 1XMOB 4YMTA 1MEJA 2FSSA 2I76A 1CFZA 2PWAA 1SXHA 4PLGA 1SBIA 1N92A 3W7VA 2H2GA 2I55A 2J4DA 3Q7SA 4URVR 4EARA 2VUUA 4QXQA 4LHVA 1Y34E 4LDZA 4RESA 1JQDA 1DTEA 2UZAA 1CNMA 4RIIA 5D7NA 1FMTA 2X76A 4MPRA 2V5AA 4CI9A 1NY6A 4DMKA 1FMJA 5FPTA 2XI4A 4DC0A 4B6JA 3Q98A 3RUCA 3IDQA 1ZA2A 3AINA 3AV3A 4LZLA 4P82A 5JY1A 4Q1EA 1IZYA 1RE1A 4NAHA 3LT2A 4R05A 1M6EX 8ABPA 3AT1A 1J0CA 3AGQA 4NE9A 1Q6ZA 2Q2NA 3HY3A 3R9IA 4I36A 2XZTA 1ZN9A 1KPGA 4EKIA 5IS2A 3JWPA 5K3DA 3QG1A 3K5HA 3NTRA 3ON5A 4QGGA 1IN6A 3KTOA 2FF7A 3NALA 4HVAA 5CJ2A 3TKLA 1FK8A 2A9VA 2J3QA 4WUTA 1EWTA 1U28A 3AIIA 1KI2A 3L4EA 2FK7A 2WM9B 5DM0A 3WY9A 1I7SB 4NJEB 1LC3A 4F96A 3CW8X 1UXGA 2H9IA 4YV2A 1ULZA 4ARUA 4XR9A 3C97A 4GBMA 1GAXA 4J76A 3E9ZA 1RYYA 3RRZA 4KBYA 3OSUA 1NPTO 2NPIA 2QMHA 2EZ4A 3AHGA 4MKGA 5DHAA 9GPBA 1SUIA 5E3JA 1T91A 4P6VF 4WE3A 3U4QB 3WLJA 4DNOA 5I9BA 3IP5A 7AT1A 3E5NA 1U7ZA 4ZI7A 4DYHA 4BAZA 1GLGA 2NV2B 4G0VA 1AF7A 4BQFA 2GBLC 1YQGA 1FU4A 4YP1A 1LNSA 2OQVA 3LX8A 2ON6A 2A33A 4KWHA 1I2BA 1UDAA 2VBCA 4TL8A 5F1KA 2J46A 3PC3A 3G2QA 3OM9A 4QNMA 3BTSA 1IATA 1P9NA 1FRQA 4R8LA 1J8VA 4PONA 3ONDA 3P9SA 3W79A 1YVPA 1KA9H 1JWAB 1K75A 3DPIA 4LE1A 4Q9LA 5EKDA 2I3GA 4RY8A 1EZZA 1W85A 2I29A 1W88B 3RVKA 2E4AA 3NBXX 3BF7A 4LZZA 1SWWA 3C3MA 3H2SA 2K87A 3OZUA 2C3MA 2BTQA 3SNHA 2C20A 1NJ6A 4UVIA 5LLSA 3WZMA 3N6RA 3OTHA 8ATCA 3N9IA 5FX2A 3G2NA 4DLXA 5JANA 2I5PO 3NUZA 5IJ0B 3L2OB 1ZIOA 1WULS 1LRLA 3EB9A 3ICWA 4JXKA 2Q1YA 1FLDA 1VBKA 4K9MA 4M1ZA 3I2KA 1YTLA 5DOVA 3VNRA 2YX1A 1FFWA 1RPAA 2ZBGA 2BEWB 3TOZA 3F7OA 2ASEA 2WJIA 2ZIEA 5TGDA 4DJFC 5CIWA 1GV0A 1E8NA 2E1PA 5BPHA 2EARA 3ZE1B 5JADA 2F8MA 4XJXA 1K4KA 1WZEA 2ZUBA 3HGQA 5DV9A 2A58A 3OVMA 2EKBA 4H7EA 4M0CA 1ZNXA 5GJWC 2CY0A 1ZRMA 3NHPA 1AUOA 3D7NA 3S8YA 1D5CA 3B2NA 3DTYA 4B3GA 3TOVA 3VI4B 2PUJA 1J49A 3D5QA 3BRSA 3JZIA 1JQJC 3WIDA 2DT8A 2ZVDA 1E5VA 4OI1A 3TQSA 1E2PA 5JWOA 5K6AA 5C8VA 1MO2A 4CEIB 2C4KA 4DPLA 1KQPA 4IUBS 1EAYA 4MW2A 2ZT7A 3L7IA 5EFZA 1DT5A 3WK8A 1QONA 4LV6A 4DG8A 1PHRA 4A82A 5LQSA 4MP8A 2QV0A 3U7QB 5JSKA 3QSYA 1RCFA 5KYXB 1IXYA 2X9GA 4YRGA 4WECA 4PLVA 1D2AA 3T4XA 3QVSA 4ZJYA 3E8MA 4NS1A 3W7AA 2EJTA 6YASA 2PZ8A 2W2TA 3SVTA 3U7RA 3Q9NA 1DGQA 4B3HA 3G13A 2DHRA 1PR1A 1CIVA 3FSGA 4EA8A 5C35A 3A1NA 5CCEA 2P2GA 5L3QB 1H1DA 4REOA 4IY1A 3WK9A 4HEJA 5K0ZA 2C4TA 3FRIA 3IALA 4NCHA 3T7TA 1CNFA 1IHDA 4HAIA 1FNCA 1PNTA 2QAJA 3EHDA 3NTQA 3DE6X 1IHOA 4LV5B 1QYCA 3PK0A 5EJ9A 1FTSA 3HR8A 1PT9A 1C9JA 4C08A 3IV9A 4NCJA 3SKYA 3QWBA 4EPVA 3K4HA 4GLFA 2HADA 1M2NA 1V37A 2BMFA 4G1UC 5BN3A 1U7DA 1I14A 1M8GA 4JJKA 4ND8A 5FQOA 2RC5A 2IODA 4D81A 5HP4A 2V59A 4GI2A 3E7DA 2R5NA 4LSWA 1EKXA 4KWIA 1B8VA 3VAAA 3BG5A 3VJKA 2MSDB 4N6OA 1N7JA 4OYLA 3TBHA 2OHOA 1U8TA 1T1SA 3C3AA 3IIMA 3D9QX 3LMKA 4CG1A 3PNVA 1LF5A 4GD3Q 4L3WA 5BSKA 3OHSX 2IZ5A 5LR6A 2IYXA 4BQEA 1P1CA 1Z39A 3L1KA 1RAGA 4N9WA 4IQ4A 1EE9A 3KOWA 3WWDA 4MW5A 1YJQA 4G81A 4Z7QB 4I5FA 3LCUA 4MZXA 2XMZA 1IM2A 3BXZA 5SV2A 5BRNA 3O90A 1UBHS 5C8DA 1U8AA 4R2HA 4ZO6A 3TG8A 2ECFA 3UOAB 4U5QA 2R44A 1P8JA 1R00A 3BXGA 3HUFA 3NHRA 2JAPA 1Z83A 4HH4A 2FWRA 5CHEA 4ZAVA 2Q5JA 3DZJA 3OPYA 1P6UA 4UW9A 5JO9A 3S27A 2Z3ZA 3JATB 3MJDA 3TMAA 1Y80A 2YFHA 2HK6A 2ZI9A 4WZBB 3NTOA 1JNYA 3ASVA 3MILA 3GQBB 4MV1A 3GLUA 3KVOA 4CDRA 1KS9A 1AXEA 1HKUA 4M1WA 2JAOA 1KDVA 4PCVA 5DRYA 4JBNA 4IIJA 4QU9A 4BNKA 1WV1A 4PY2A 1C4KA 3ICPA 2A3RA 1T36B 3CB4A 4GE3A 4HNRA 2FK8A 5KQPA 5ARCA 3G82C 4EKYA 2PXXA 5HGXA 5KSZA 2HF8A 1W75A 2H59A 1NMYA 4R54A 2PQ6A 4UVGA 4X66B 3BJRA 3D8NA 4QTZA 1GAWA 3M9XA 2C92A 1R9NA 3C45A 4J1SA 2X0FA 4YX9A 5A04A 5KTSA 1ST2A 5ALGA 3DC7A 5LUAA 4B2LA 3PNKA 3TAHA 1UBUS 2OAGA 3MCUA 4EHFA 5E3HA 1DUVG 3A0UA 1XZ8A 3GXBA 2OORA 1VZ3A 4R9UC 1YJBA 2AFIA 5BW6B 3TWOA 3FOZA 4ALMA 3JVDA 2Z4TA 3W34A 3W9UA 1GL6A 3R40A 3H7IA 1SMKA 3EUWA 1KFBB 3JQEA 1R9JA 1A2BA 3D8RA 1LV7A 3TR5A 3AI1A 3K94A 4B79A 1AQYA 4K3VA 1A8IA 5ALEA 2HV9A 1I3CA 1QGED 4J3NA 4CMEA 3M6MD 2P6UA 1HQCA 2YV4A 1WU8A 1IN5A 5E3IA 4YAKA 3AEUA 1WCIA 1HH4A 4MUYA 2P3OA 2PCLA 2VJDA 3QVUA 1IZZA 4YRMA 1EVJA 3LV8A 4MV0A 1GZ3A 2IIBA 3KTAB 4BQQA 2XVXA 1E6EA 2WTEA 1LVHA 4J7CA 4XASA 4EVQA 1IPEA 3CIOA 3FCCA 3H2YA 3R7DA 4BYMA 3D8TA 5ADVA 1RYFA 3AM3A 4GPD1 3GX1A 1QIGA 2AUMA 3IVAA 4D26A 3NDJA 2CBXA 3FTQA 3WLEA 4B33A 4R3UC 4EH1A 2QSUA 3X1MA 3R3UA 4RIGA 5C32A 4IZHA 3RYHB 2PZEA 3GA5A 3ANTA 3FWKA 3OZ7A 1UMBB 1WSAA 2VDRB 2G25A 1T4BA 3AVYA 3I73A 4EIWA 4BLUA 3DNMA 1B1CA 2QXTA 3NWPA 4MRVA 4QUHA 5LBIA 1Q1EA 2MR6A 5I9SA 3R7LA 2WICA 3T5TA 1F1JA 1K97A 3VC7A 3LQ1A 1M3SA 2Z2ZA 3OPYI 1OLOA 3RD5A 3RVDA 1N2OA 3ICOA 1BCRA 2B1RA 1NN5A 3EODA 1IIBA 3D4PA 3QW4B 4KHZA 4O63O 3WL7A 3ZEIA 5FR1A 1XX6A 1GPJA 1BE6A 3DO8A 3HL4A 5DCUA 4FFNA 4KJXA 4R16A 2FI1A 1Y89A 2R96A 1NSTA 3VKFA 1ZJYA 3H18A 4I5IA 1WAMA 1QB7A 4HFRA 2BHTA 5TSDA 4C3UA 3D8BA 4W5QA 1KFEB 3R0VA 5HILA 1X1TA 5BQOA 5I48A 4L7QA 4WUVA 3LUAA 4LWQA 1HE4A 2B4RO 3DOJA 1KSFX 3QWIA 4LXGA 3SJZA 5AQ1A 9LDBA 5GONB 5KHOC 3FNIA 3WC4A 4KXLA 5E1DA 1KQGA 2RAUA 4ZT3A 4BV3A 5MGBA 5ELMA 4FU0A 3IQFA 4P4NA 1U31A 3BRWD 4RJTA 1RC0A 621PA 2DBVO 2QQ5A 3JD0A 4QGHA 3WMEA 2J7KA 2NUAB 1DPFA 2J6BA 4JCCA 1SKYE 5JSYA 4EHDA 1QTQA 5DISB 5CDHA 4RVGA 2QXYA 4Z1MD 2DEUA 4L0MA 2XCTB 4F86A 3GD5A 4HJRA 3T0IA 2X9LA 2QRVA 1K88A 2AH5A 2ZYIA 2ACWA 3ABRB 4FFWA 4PFSA 4Q18A 1PYOA 5FNZA 3BFPA 2IBTA 4OHBA 2X9NA 4TS9A 1L4YA 4BWFB 3B1XA 3V1KA 3X0DA 1E9BA 2P3QA 3O91A 4HDOB 5JCZA 4HXEB 2O8FA 4C7KA 2AA3A 1L4BA 3EG9A 3GCDA 4JC5A 4UU0A 2Q3EA 5CH3A 3QOFA 3PVZA 1RQPA 3ZX4A 2FHPA 2ERYA 3QYJA 2D06A 2R4UA 4S1TA 3AUUA 1UQUA 1UMCA 1OMOA 2O8VA 1AKUA 4OB7A 4ZOAA 1L7PA 3KR1A 3UK1A 4LJ5A 3H75A 2RGXA 2OCLA 5A4MS 1E99A 2FPGB 1ZIDA 2EYQA 4PIMA 1CS0A 1ZD2P 2ZRKA 4B3SB 5LJIA 2DBQA 1UJ2A 2NUBA 1Z5UA 3I5MA 3IIJA 4HDRB 3SQWA 1DKOA 2LNDA 2R8BA 2ZUCA 4BFZA 5DM70 3B20A 2QRGA 1RQGA 4TRRA 4RTLA 1PZXA 4ALKA 1SBCA 2RGUA 1J24A 3QF7A 4IIFA 4R3NA 3RU3A 3I9FA 2ZITA 2CMDA 4J16C 1JDZA 4EI9A 4JGBA 3VPSA 5M34A 1LDBA 4W7IA 2M98A 3N76A 4GL4A 5JQGA 1SN7A 2PWZA 1I80A 2R6FA 3G6KA 4UHEA 4C7VA 3IEXA 1J07A 2XPCA 3G8YA 4YRNA 4L76A 3ZWMA 4BXOA 2I33A 2CVOA 1JIXA 3B6KA 4JYZA 4QPPA 3HMKA 5C4IA 2QTHA 2FUKA 2OV4A 4GWLA 3U3ZA 1VYTA 2C97A 3TB4A 4EX7A 2QT1A 3QEMB 3QBDA 3DT6A 1MH9A 2A4MA 3QH4A 1XTBA 2WKPA 3AESB 4QLOA 4BTVA 4ZIRB 1ADBA 1C3XA 5G3ZA 1PI3A 1R4ZA 5K2OA 4NBWA 5B4UA 4LECA 2Q2VA 5DI3B 4A5SA 1CF9A 1Z2EA 2OEPA 3O1LA 2ZB8A 5TQVA 4GUDA 5ERYA 2MSLA 2V5VA 1VBMA 3UCXA 4AJLA 2GZMA 1RM4A 2JLRA 1Y3BE 2AG0A 3LPLA 1K3FA 1TMGE 1Z38A 2IELA 2P2DA 4H6XA 4QHSA 3WTCA 1JLSA 2VLBA 3PCXA 3VJRA 3K53A 5HJ7A 2RK6A 1E79D 2Y05A 2NSJA 3NP9A 1J5PA 1IMOA 4URHA 3V97A 1Q0LA 1UM9A 2PS3A 2J0UB 4NENB 3GCZA 2I6SA 4C30A 4TKVA 4QJ3A 2HJVA 1KJWA 3SEQA 2O3TA 5IZCC 2CYCA 2QM7A 4PX2A 3WMRA 5B55A 3CVUA 1G38A 4MLDA 5AKGA 1RZVA 4M21A 2JLVA 2JGLA 5E4TA 5T6BA 2E21A 3DZCA 2E1RA 3MQ4A 5AVJA 1G3QA 2UU9B 1GD1O 1RYHA 5FJJA 2GZHA 3D3NA 4LF4B 4W5HA 2J4CA 3P8ZA 5AJWA 3NHLA 1H0SA 5FOWA 3UK6A 3NDIA 4N8DA 3BWBA 3CVOA 3C39A 4UCXA 1P4GA 4PNPA 3CRVA 1XXHA 1P3Y1 3HNRA 2A30A 4P54A 5JZBA 3MHTA 5LWHA 3VA7A 2ZJ1A 3RKRA 4K9LA 2B98A 3DZGA 3KWFA 4AULA 1Z4PX 1NZFA 1Z68A 2PZFA 2QT0A 2ZS9A 3LF2A 4G65A 4K9DA 4D6PA 4XB6B 1IZ7A 1V2GA 1EWVA 2WWTA 4LQCA 1KQFA 2CUKA 2LBPA 1LGYA 2PTGA 2NIPA 5BSFA 4A6PA 4I9HA 1TJ3A 5FPSA 1UDXA 5CT4A 4Y30A 3UMGA 3VR6A 1EXDA 4E3ZA 4W8GA 4IWXA 1RQXA 3QX8A 2XKAA 1NGSA 2BDUA 2YIVX 1SD5A 4ZGWA 2V1UA 3VUFA 2WJGA 3E53A 2JGKA 2HK7A 2Z57A 2P9FA 3SZ3A 1ZUNB 2JW5A 1LU9A 4PU0A 3U49A 3VPHA 4CIBA 2R66A 4AWXA 4AIRA 1X86B 4KLRA 1VMIA 1R7RA 3GUUA 5AM1A 5HG0A 2OPBA 4CF6A 1L8AA 3RM3A 1NNEA 1D7AA 4ETWA 3DVQX 1FFDA 4M8SA 1HBJA 4F9GA 3EEIA 3FOAA 1QV9A 3PE3A 1I2DA 3HKBB 1TUGA 2QG6A 5NULA 1W19A 2E89A 4ID9A 1VDMA 5ABPA 3O2QB 1R5OA 2WWFA 3NU1A 2G4LA 2GI4A 2W5UA 1WW2A 3RJ5A 4BTEA 1DXQA 2OM6A 3NZEA 2R6AA 4JJ8A 5BN4A 3LUCA 4ZU1X 3RFVA 3X1XA 1U4OA 5LQMA 3C0KA 1MO5A 1M2OA 3B1KA 1P29A 1KF0A 1COZA 1C7ZA 3A3NA 3IODA 4QPCA 2WIKA 4I4TF 5ECGC 1S2MA 2K7FA 1ISPA 3VR2D 5J4HA 1P2BA 4Y2SA 2JFOA 5ALJA 4ND1A 5H68A 4JKIA 1YQXA 5DX8A 4RU1A 4MIEA 1R9MA 3CUKA 3AVPA 4XCXA 1SVSA 3RAGA 4J90A 3I9JA 1ZK3A 5JCOC 3ST7A 1NFRA 1VLMA 1NXSA 4IILA 4J1NA 2QPAA 1SQ5A 2B4KA 4G1BA 4EGAA 1QVAA 1T8SA 2P2CA 4MCJA 1UJ6A 3MUNA 4XWOA 1H5QA 3MRSA 4QL3A 3VPBA 1CEYA 5FWXA 3GOHA 1AC5A 4YLYA 4CLHA 5CB4B 2C8KA 5JCPA 3PD7A 4YV1A 1RAEA 3KB8A 4DMLA 2ORED 3DBHB 3Q10A 4Z3DA 4P7BA 3BRCA 2IQIA 2JL1A 2H57A 3QE9Y 3B13B 4O2BF 3ET5A 3DP7A 5AKJA 1STOA 3R7AA 2DUJA 3TOSA 5IM4F 2HTFA 2A5FA 1ABFA 4QRIA 5EPEA 1L5KA 3G0BA 2Q5FA 5HFJA 1X1AA 2VDLB 3IP7A 3HP7A 4UOEA 3SS8A 2ROQA 2P6MA 2PGIA 3UJ3X 2XRZA 2EAUA 3CO0S 1H0KA 2PKWA 1PJCA 2CL6X 4X7RA 5L4SA 3DLIA 4R71A 4Q3BA 1UF9A 4KV7A 4DLTA 3UC9A 3CLRC 4TXHA 3TLMA 4LHWA 2OC4A 3C98A 3O8NA 1FCJA 1E9DA 1JEAA 3GLHE 1A8SA 1BX3A 2GCNA 4LPSA 3U44B 4O29A 5AUOB 2P9JA 4O4IA 3W1VA 1TYDE 3H5OA 4PRKA 2FPXA 2QW1A 1V43A 5H3CA 1OT3A 2RI6A 3PUIA 5T3YA 3WOVA 4CKEB 1H1LB 2W6ZA 2V7EA 1JKXA 4QQFA 4PX5A 1JHQA 1YE8A 3QY0A 3RQIA 3TI9A 1E7MA 2I9PA 5KYUA 3UK2A 3C7CB 3EEYA 4INAA 3AVOA 3DYVA 2EF0A 3NWOA 3K6SA 2H2FA 1T8UA 3NUGA 2HRBA 4KRYA 3A4TA 5BOSB 5IBQA 4O2RA 1EM8B 4E22A 5I9NA 2O6HA 2Y67A 2QRHA 1FZQA 1TZJA 3UGKA 1VSVA 1A9RA 2VDWB 3MFYA 3MT8A 2C2XA 2I1LA 4FCWA 2GK6A 3N86A 3S2FA 4J7UA 1PS8A 1X70A 1A8HA 4IHKA 1NR5A 4N5NA 3Q9LA 2IHVA 3B89A 4WFKA 4H3HB 1RJ9B 3NPMA 3ROTA 2FGKA 4D9EA 1ZVKA 2VR1A 4R1OA 2GAJA 3ZZ0A 1RABA 3UAWA 4OREX 4RTSA 1KI7A 2Q7XA 2OBYA 2ZIGA 4GKVA 1IJEA 4BMOB 5CD9A 1CUFA 2GESA 4FB5A 2Y6VA 1OFUX 4GIBA 2WZBA 4M9QA 4B80A 4EW2A 2O19A 1JE1A 3UXMA 1NPYA 3B1VA 2AQIA 1XI2A 2Z3VA 2ZRFA 1PWYE 3ADOA 4PQGA 1NNI1 2R97A 3PEEA 4F3CA 1S4MA 5ALXA 2GKOA 4QUIA 1HORA 2HCRA 1IHXA 2YVAA 1QGZA 3BH0A 3EZFA 2AJBA 2V7PA 1GCGA 1ULHA 3L0DA 3THRA 4B45A 2QRKA 2DGDA 1ZM9A 3JSXA 3MGCA 3CLVA 3MOGA 4XX0A 5ALDA 1TL7C 1UQTA 5F5LA 3SM3A 2OQIA 3WRWA 5EKUA 4V0QA 1MB2A 2X0RA 4O4LB 4OQXA 3W5SA 3IEIA 1RFLA 3HYTA 2P5SA 1U9IC 1U9JA 2BGWA 4FEAA 1Z37A 1DHRA 1KDTA 2CMKA 1RU3A 3FI9A 3H0CA 3UMMA 3NCHA 1RSZA 4KZPA 1UKYA 4BE4A 3AH8A 3NOVA 3R5KA 4YLGA 4CLRB 3ND9A 3CCFA 1O9BA 2IOHA 1BHQ1 3HDYA 4PC3A 3T3DA 5BYAA 1QCCA 4RK0A 5IUKC 3WKDA 3VTFA 4B7CA 3B8HA 2YIJA 1GFZA 2IGTA 2ZRNA 2X1HA 4BNTA 3WKAA 3EIQA 4HVCA 1Y8CA 2XE8A 2CXOA 1K3UB 4ZPXA 3ELYA 2PGNA 4LOKA 3ZY5A 3WGUA 1OE0A 4PINA 4K1XA 1GPBA 1CUWA 2FEXA 2QHXA 3CISA 4KW7A 5IC5A 2O2EA 4DNQA 4F9FA 3N8HA 1NZJA 2XVZA 1SKQA 4W6ZA 1SKUA 4QELA 1ECBA 2B20A 4V0NA 4BNWA 3RSSA 4G3XA 2QTZA 1KVQA 3SBEA 2JVJA 1SBYA 2BP7A 2PX4A 3P2MA 3PG5A 4L4ZA 3DQPA 4EB6A 2QM3A 4QUGA 1I7DA 1CUZA 2ZTMA 1KP2A 3JZAA 3L8DA 5CVVA 3GNSA 3MTAA 1M75A 3LK6A 3I05A 4MI6A 2VF4X 1NNUA 2XDAA 3DKVA 3RFXA 4Z6KA 3MMPA 4LY0A 1WETA 4BNLA 1PJ3A 4UNPA 1G9XA 3RUDA 4YYZA 3KJNA 1ONPA 4GEGA 4NICA 1UBKS 3M6LA 4TRJA 1P5FA 4A8JB 1WU7A 3LQRA 2Q50A 4MB6A 3G5AA 3WRYA 3ZTYA 4ZI7F 1QAMA 1N9ZA 4E2FA 1LLCA 4YRFA 1YCHA 5CUQA 2QGFA 3ZV3A 3MIIA 5EUMA 4YLEA 5SZHB 2FOXA 1HDIA 3A11A 1J33A 3FAKA 1Y8ZA 4W5TA 1QK3A 3KUUA 1P4HA 1HI9A 1RHMA 2PUEA 1NN3A 3MXOA 4E94A 4KWCA 3O1HB 1JGTA 1Z13A 4C7MA 4ED9A 4PX3A 1ATZA 1UMKA 3UPUA 4YACA 1ONSA 2QYSA 3ZE2B 4E1AA 3JQRA 2UYCA 4G1EB 4INOA 1P5JA 1XGKA 1A9QA 5K3AA 5G41A 3BGSA 1XZKA 3TTSA 2I4NA 3A1WA 1UBLS 2GJ4A 1FYXA 3MJ4A 4ZKEA 1Q1QA 6NULA 3EXIA 3O4RA 4GXTA 3BOSA 3KB2A 3PC6A 3RABA 3OOWA 2W6ID 3S2SA 1X77A 3EC1A 5T3UA 1DC7A 1JIKA 2J33A 2QPLA 3BC1A 2RHGB 1C9NA 3CHYA 1YB1A 2YBEA 2TS1A 1N75A 1KI1A 2EX0A 5U4QA 4R83A 1JR4A 1QZTA 2PZKA 3NC4A 1FB5A 2I22A 1IZ0A 5BYKA 1JJFA 1PP4A 3ZV6A 4JKYA 3RJ9A 4K6KA 4Z7JA 4WCFB 1K92A 3T35A 2G70A 3L1VA 4DQKA 2V6BA 4JELA 3PL5A 1Y4UA 4MJ3A 3BICA 4R2XA 3UT5B 3OEHD 2QKYA 1XEAA 2NYAA 3DL2A 5DIFA 4LAFA 3FVVA 1KXJA 3KYBA 1PT6A 2ZKIA 3G23A 3GMSA 4KLCA 1R6BX 1L3CA 1W87A 2QK4A 4GAEA 4YRLA 2PV7A 3OD5A 4I3GA 3FB1A 2EEZA 3FYSA 4KIJA 3D6MA 1UEJA 1IB6A 3MN1A 2ZRDA 3QU5A 2LKDA 5E6UA 3RS4A 5KJFA 1ULBA 1MXHA 1W59A 2H1IA 4MJ7A 2BF7A 4KNYA 1VIVA 3G2IA 4WGGA 4AVYA 1N36B 4M0KA 3EWNA 5TRTA 2QM0A 3O38A 4Z4IA 4KRGA 1C3OB 1RQNA 1Q21A 2FTKE 2B1JA 5TQ2A 3ZJTA 4J03A 2Z6AA 1K66A 1YC5A 4LY9A 3A9UA 1S7GA 4ITUA 3GCGA 3GEHA 1NUHA 5KNBH 4C0XA 5IFKA 3RTAA 2D7DA 1F17A 4DMGA 2BD0A 4B35A 4OKNA 1HE1C 3SQLA 2JF0A 3MFQA 1NU8A 4FFOA 1NW5A 3EEFA 2IZZA 4EA6A 4HAVA 5DW3A 4OL9A 4YRPA 4ROTA 3K2BA 4CV2A 2DHDA 4ML3A 4PQFA 4X92A 4YP7A 3SLKA 5DNEA 3JQAB 4X3CA 2PKQO 2QS9A 4WIAA 4EATA 4LF8B 1SCIA 3G5LA 2I71A 3GV0A 4EMBA 3K0BA 5E6SA 2XTMA 4DOMA 2P4HX 2CKDA 1IXZA 4IHJA 5FWAA 2IYEA 3LUGA 5BV0A 1E7SA 5JZSA 4J49A 1GKLA 3FUTA 5FAXA 1EQAA 1ZD8A 4L5BA 4PAOA 2J45A 4PZLA 2NYUA 2AK3A 3F96A 5FUYA 5C81A 4FMCB 1M0SA 2BMWA 5GVSA 2GN1A 2HR1A 5LYJB 2NZYA 1TQDA 1FZTA 4B2IA 1QKKA 4TKMA 4UBLA 5GOTA 5BRAA 3GJXC 4II2A 1NVMB 4WQMA 4D9IA 1WXEA 3IEVA 2Y6UA 4GPTA 2QZPA 1TQ8A 4IJQA 3ZCQA 3V8PA 1E6WA 1T8YA 2OBNA 4NYJR 3DVLA 4IIHA 1GL3A 4TSRA 1O94D 1C9EA 3NDBB 5JPDA 3COWA 3M5DA 1QF9A 421PA 1XZNA 3EARA 5HIIA 4DCTA 3FLAA 4XZ3A 1YRBA 3M8KA 2PUTA 1S6YA 4GM4A 4AX8A 1V3UA 4W5OA 3AR2A 3WWPA 4F92B 4UZFA 5J1TB 1SOVA 5EWMA 1PDWA 1ZVMA 4F9TA 4JY7A 5JLJA 2H06A 3CWZA 4JEUA 2C78A 4N5LA 5IDQA 1MO4A 1GKKA 2EX1A 2H0AA