5CLLA

Truncated ran wild type in complex with gdp-bef and ranbd1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
179
structure length
179
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
molecule tags Hydrolase
source organism Homo sapiens
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
total genus 54
structure length 179
sequence length 179
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cllA00
2VHUA 2W6JD 1CF4A 5FOSA 4B2IA 4LHZA 1PZNA 2DWOA 4TT3A 1T3LA 4FN5A 3V9PA 3ZS9A 1I2DA 2GXSA 1G7TA 1W48A 1ZRHA 2AN9A 3CX8A 4G5QA 1YZTA 2JLWA 4PO9A 3JVVA 4PZZA 4HUTA 5IHPA 1AKYA 2H92A 2QPAA 3QY0A 1VG9B 3FDIA 5KU1A 2C8VA 4BLOA 4G0NA 4CRWB 1SGWA 2W6IA 3LXXA 1WDTA 4HLCA 2J59A 4JLBA 1SVOA 4Q02A 2AFHE 3K9LA 2G6BA 2YV5A 4NP6A 3BC1A 4TMKA 1I2MA 2F1JA 1NMZA 1Q1EA 1CR1A 2O8EA 1R5OA 2O8EB 2Z4RA 2ZSDA 1KJWA 2YWGA 3BH6A 4PPQA 4CEHA 1D6JA 1FFHA 1P4SA 2E87A 1HEIA 1QF9A 2FMXA 1NBMD 3WHLA 3WNDA 2GHIA 2QROA 1ZCBA 4OHVA 1QBKC 3OEEA 4JSYA 1YVDA 2AK3A 1LV7A 3U44A 4JLPA 5DH9A 4U00A 1XTRA 3AUXA 4NONA 1DOAA 3K09C 3AF3A 2RMKA 2FSHA 1KI8A 2CE2X 4NL4H 5L3QA 2ONKA 1N0UA 2RGNC 4NYJR 1NJFA 3QEOA 3LXRA 2FSIA 2OM2A 1XJCA 1J90A 5E7JA 4B6EA 2A5FA 2R44A 2GJSA 4TN1A 1BYIA 4RZXA 3C14C 4RD3A 4E5UA 2B21A 3GLHA 2ZUDA 4QBFA 2QAJA 2GETA 3VFDA 1Q12A 4D81A 4KFRA 2J45A 4M9QA 3WHKA 4MGZR 4X8LA 2D06A 4DLTA 1S8FA 3A58B 1G291 1NN1A 3K0CA 4Y0AA 2FGKA 3UXMA 4P4SA 4TSFA 1N6KA 1X1RA 3CF6R 4TYNA 1V43A 1G19A 3ZVNA 4Q1DA 1G16A 4BASA 4Q7JB 2Z4SA 5DNYB 4I1SA 3B78A 1GNQA 4U02A 2B92A 2QY9A 3RS5A 3F0TA 2ZREA 1J2JA 4AY2A 4RZ3A 2NTYC 1XTJA 3FHTA 4URZR 4P3YA 3UIEA 2AHOA 5EUQB 4II7A 1KOFA 2TMKA 1D9XA 2FOLA 3FMFA 3OFND 5GJBA 1LF0A 3TQFA 5F9FA 5FBWB 1P73A 1GDDA 5GJCA 1HE8B 1JR6A 4M1TA 2D4HA 4JLAA 5EE3A 5TDHA 2EVWX 3B5JA 3VR2A 1NMYA 2XJ9A 1OF1A 4PHGA 3BH7A 1HTWA 1L7VC 3SJCA 2AK2A 3FMIA 1XMIA 3FHOA 4R2IA 3T34A 1E2LA 1XTKA 1T3HA 1ZYUA 2WICA 4QC2A 3K0FA 1S3GA 2KWIA 2ZSEA 4DLXA 4MYHA 1W36B 2JDID 1OXTA 2DPXA 2CNWD 1OFIA 2ZTSA 5FL3A 4LPSA 4P32A 5G3YA 1R10A 1G5PA 3W6PA 4BLTA 3C16C 4RFSB 1YR6A 3M6AA 3CNNA 1AA9A 1E1QA 2FE4A 1IN7A 1K6MA 3NDPA 1JBKA 3CZQA 2FPLA 4DUGA 2YHSA 3V4RA 5HKKA 2L0XA 1SVMA 3N5CA 1SXJB 2FZLA 1DS6A 3W90A 1I4LD 1VTKA 3PIRA 4JLKA 1GRNA 4BFVA 4CDGA 3HPRA 3B9QA 1ESNA 3MFYA 5CB8A 3EASA 3KDSE 2ZAOA 2ZI7A 1TF5A 2G0NA 4ASUA 3D6TB 2XITA 2WV9A 3PFIA 3X1DA 1CKEA 2C99A 2UKDA 5L3QB 3RRZA 1HYQA 2CMKA 1N2CE 1XZPA 1YZQA 1CJKC 3EZ2A 3BFKA 3FB4A 3IHWA 4L9SA 3TSOA 4O3MA 3ZZ0A 2RGXA 4TSFD 2BM0A 3FFAA 1ZNZA 4Q1EA 4YXWD 1EWQA 2O8CB 4EAQA 1A4RA 4BECA 4FCWA 3E70C 2ATXA 1YR8A 4DDUA 3VKWA 5FFMA 4CYMA 1CTQA 2WJGA 2Y8EA 1L4YA 1CIPA 1N6OA 4QFMA 4LX0A 4IDPA 1A1VA 5C4GB 3Q5DA 1TF7A 2GF9A 1SVSA 5FR1A 3BH0A 3M1IA 1OHHD 1JNYA 3HR8A 3KKOA 1LNZA 2GESA 2R9VA 4TLCA 2HDNB 3O8DA 4DDVA 2Q6TA 1TQ2A 2QE7A 3SFZA 2BKUA 4FMCB 4LDJA 3MGCA 1N5JA 4TL8A 5L3SA 1XWIA 3QXCA 2KE5A 3H86A 4LHYA 2ZJBA 3BS4A 2ZRDA 2WIBA 3EAQA 3TAHA 3VNUA 2G1KA 1F5NA 2DFNA 3PUWA 1ELOA 2ZEJA 4Z8XA 4HDQB 2WAXA 5C46F 4DB4A 1AS3A 3RVBA 3SJBA 4DSTA 1TUEA 3WNCA 1E79D 3WMEA 1KK3A 5J40A 1YZLA 1CXZA 4M1YA 4Q7KA 3FFBA 4F7WA 2ZE5A 5DYGA 3KKMA 1QHGA 3NC0C 4Q00A 2A5YB 2ZROA 3SS8A 4XD7A 1ZM9A 3SQXA 1DARA 4US0R 4V0MA 5TARA 2R6DA 1XTQA 2ZAMA 3CPEA 4NCHA 4ZKEA 1N0VC 3ADCA 4L15A 4ZI2A 2AD1A 1G3UA 1U8AA 3BWDD 1Q44A 2I3BA 4BUJA 4XVRA 4F4JA 3SNHA 3TE6A 1R2QA 1OW3B 2HT6A 1E96A 1SZPA 3CW2A 4N3NA 2WJVA 1G21E 5FOUA 5IT5A 4TZ6A 1BOFA 4PHFA 2PT7A 2J9RA 4XTCS 3WXMA 3RRNA 2A78A 4YC7A 2F9MA 3CH4B 4MKGA 5F98A 1W2HA 3AF2A 2YZ2A 1T8TA 5CM8B 1O3YA 4OK6A 1U90A 1VG8A 3GFOA 4GP7A 1E9AA 1DAKA 2IYRA 3R9IA 2RKOA 3UATA 1E2KA 1RFLA 4B74A 4D4KA 2W0MA 1OXXK 1LB1B 1KSFX 1E9RA 4I81A 5L3SB 4P33A 1OYWA 2RAPA 4B2LA 3LLUA 2F1IA 3TQCA 1S3SA 1GITA 3TK1A 5A4JA 3AVWA 1NIJA 3UWOA 1MT0A 3IO3A 2NGRA 4A8JA 4HATA 5KYKA 4QM6A 1J8MF 4NDZA 4EUNA 1NRJB 2WWXA 1QDEA 2NO6A 1RJ9B 1KNXA 4C2TA 3NBXX 4IRUB 2GBLC 1ZMXA 3FMPB 4Z51A 2NG1A 1Q22A 1VYUA 2RGNA 4TWZA 2GJ9A 4GZMA 3KXKA 4K8OA 1W0KA 4NTZA 4M9SA 2HF8A 1CJVC 2CCJA 2CCKA 1QHHB 2P6NA 3AB3A 1IY0A 1JQLB 1XEFA 1N25A 5KDLA 4B73A 1WMSA 2A2ZA 5BWMA 4KU4A 2J7PA 1XD2B 4GOXA 2QRNA 1QVRA 3NBZC 3PG5A 1SKQA 1KNQA 2D3WA 2IYYA 4PAMA 4LHVA 3T06B 3BB3A 4LJ4A 1VMAA 2QT1A 1EWRA 1Z0KA 5JJKA 1JB1A 2ZJOA 1ZD1A 2CLSA 2F3TA 3UK6A 2OZEA 4HAZA 4Q7LA 1TQ6A 3WMFA 2NZJA 5KHOC 2OFWA 2RHMA 1VKJA 2AXPA 4LZZA 4KI0A 4FMDB 5EXTA 1G20E 4LCBA 1IY1A 1DAGA 3W9YA 5AJXA 3P32A 3KQNA 4MYTA 5KPDA 3PEYA 1II9A 3AUYA 5JRJA 1FP6A 1OH5A 2BKEA 3BFVA 4GT1A 4HAVA 2QZ4A 2G77B 1EX6A 4GFDA 3BK7A 4MKHA 5HCNA 1R0XA 2CBZA 2CHVA 1D9ZA 3KFXA 4Z8YA 3IIKA 2BHRA 5B2ZA 5IF9A 3PR1A 4UKDA 3AVTA 1MO6A 1S2MA 2EYUA 1J70A 1RKBA 3ICEA 3CRVA 1NNEA 3IIJA 3PV0A 4BZPA 3THYB 2A7QA 1AQYA 2OESA 2QRZA 1CBUA 1EGAA 2ZJZA 4BLSA 2R6AA 2ERYA 2ZI3A 1NN3A 5FH9A 2J1LA 3T5DA 2KB0A 3UG6A 1LF5A 1KK0A 3ADKA 2NQ2C 1OB5A 4EKDA 3GLGA 4I4LA 2PZFA 4BFYA 4PC7A 4DIEA 3KUCA 2OE2A 1TEVA 2GA8A 3LRPA 3HWSA 2J0UA 1XFAA 1U9IA 3DO6A 1L2TA 1TU3A 2EWVA 4MRRA 3TBKA 4D0GA 3SI7A 4EJSB 1NP6A 3QKUA 2BMJA 3CRMA 1G3QA 4YQFA 4HLUC 4BLQA 2Q9BA 4A2QA 4JKYA 1TMKA 1FUUA 1MABA 1E9DA 3K8YA 4JJZA 5FTMA 3B1ZA 4B2PA 3CR7A 4WBSA 4L16A 721PA 2IC5A 2HT1A 2ZE8A 3TUZC 2BCJQ 1BS1A 2PH1A 3QVVA 1OE0A 1GAJA 1TADA 2PCLA 3IHLA 4DWJA 4TYYA 1EX7A 2J0VA 4UJ3A 3CKLA 3EZ6A 4ZDJA 4PO1A 1CJUC 1JR3E 4MRSA 4NYMQ 2YWFA 3CRQA 2IWRA 4MKFA 3THXB 4QM7A 1ZC4A 3O8BA 1K5DA 4NPHA 3T1TA 5G53C 1R0ZA 4JLMA 4US1R 1BIFA 3EIHA 4TYWA 3QKSB 1W5TA 3CWZA 2E9SA 4M1OA 4ZCLA 1IJFA 3ADDA 1OXVA 1XMVA 2B8TA 3HYTA 1XXHB 3I8XA 5CITA 4XSGA 1IN8A 621PA 3KZ1E 3LAWA 2V1UA 4IVQA 4ACBA 2F1RA 5KTYA 4TZ0A 1TPZA 4US2R 1QG2A 1RYFA 4BZQA 2F1HA 2O0KA 3BRWD 1E0AA 2XB2A 5BW8A 2EFEB 3WNBA 4LBVA 2YYZA 1DTSA 2O0HA 2VH5R 1PLJA 4MH0R 4UXIA 3QUSA 3J81k 1TL7C 1Q21A 3F8TA 5CDFE 1PV4A 2C04A 2ZRHA 1EXMA 4OBEA 3R7WB 3RRMA 2GEVA 3DKPA 3KJEA 4YLGA 4GDFA 1RPZA 2V54A 3T15A 2IYZA 1HH4A 4TYQA 1KJYA 2PLRA 2ZI6A 1G7RA 2P65A 4A4DA 2ZE6A 5DN6A 2GEUA 1P60A 1W0KD 4KCGA 3QG5A 3HJNA 1TU4A 1T9HA 2HCJB 5KSPA 4PAQA 2CE7A 4DB2A 2GJAA 1E9EA 4DCUA 2ZI5A 1FNMA 1BMFA 3S1AA 5TY0A 1GRRA 3OZXA 4LJ9A 5FOTA 1H8EA 5JSZB 2HJGA 1W36C 1J7KA 3EWSA 2CL0X 4JLDA 1G8GA 1MOZA 2C5LA 3AVPA 2GXAA 3AP2A 5FBRB 3WRYC 4BEBA 2AWNA 3KXIA 5H68A 4N0DA 3THWA 2HLDD 2X2FA 2GAOA 3FE2A 3AEZA 4C2UA 2IEZA 5DHAA 3CF2A 4S35A 1WB9A 2IHBA 2ZSAA 4QXAA 5E7IA 4JT4A 1Z47A 1FL9A 3OHMA 1S9HA 4WZ6A 3U6KA 4F4CA 3AVYA 4HB0A 2VQSA 5JECA 4PHTA 4R71A 4RD1A 4U7DA 5B30A 3OIYA 2IXEA 1UKZA 1Z0DA 1US8A 1FP7A 3ADBA 4U5XA 3R9WA 4WAUA 3QXSA 1I4DD 2WJIA 1GFIA 1XMJA 4PSAA 2REXB 2OAQ1 1G64A 3Q7PA 4DEYA 2QORA 4A2WA 2ZRAA 3C41J 2V7QA 3EX7C 1OH7A 2VP0A 2O8CA 4JT2A 5FI0B 3QSYA 5J4VA 2ZRIA 1UM8A 3QKSA 2C9OA 1W44A 4EPWA 3SHFA 1L4UA 4HB3A 1F2UB 1N6HA 1QHYA 2OV2A 3IDQA 4CF7A 4Q66C 2LKCA 2IYQA 5IK2D 3K9HA 1P2UA 1XNJA 3TIFA 2ORWA 4YMWA 4TL9A 2X1VA 3TVDA 2EFCB 1K8RA 3DVLA 3EW9A 1US8B 1YRBA 4ZPXA 4HLDA 3AF0A 4AG6A 3KL4A 3MG9A 4Q1AA 2ERXA 4OQLA 2QSYA 5A0FA 3GFTA 4IEEA 2HV8A 1TX4B 2XB4A 4IOKA 4W7SA 2OEPA 1OIXA 2RGBA 4RFSA 3RYTC 4YMTA 2PX3A 1AK2A 2WJHA 5P21A 4DCVA 2OXCA 4Q1CA 2VO1A 1EFTA 4YONB 1FTNA 1JECA 4DSUA 1E9SA 1DG3A 3H0KA 1WP9A 1ZVQA 4JYBA 5EP4A 1VECA 5HE9A 1KGDA 4UNNA 1NN0A 2EW1A 3E5HA 4MITA 3DMNA 5J5CA 3IO5A 1EESA 2IYUA 2G0TA 3UMFA 1Z6TA 3SEAA 3PUVA 1NI3A 3MLEA 2HYIC 1N6NA 2C03A 1KIMA 2ANBA 2GXUA 2ZPTX 3M0EA 1VCNA 4GOKA 4D82A 3Q9LA 4LRWA 2J7PD 2CVFA 2G88A 2PX0A 1YHNA 3B8HA 4M9ZA 2LCFA 4ZDKA 1U0LA 2O52A 2NMVA 3R8CA 3C15C 4CW7A 1WF3A 1YKSA 1DBSA 1EFRA 1P9RA 4GP6A 5DYIA 1XF9A 3NTUA 1IY2A 4RD4A 3SJAA 3T1VA 2IF2A 3BBPA 2ZYUX 1CRQA 3GLHB 3GJXC 3K9GA 3LO5A 4JL8A 4A82A 4NH0A 3NXSA 2ZS8A 2QTFA 2P2LA 5HTKA 4GPTA 4CEIB 4IKEA 3MWKA 2XTZA 2QU8A 4Q4HA 5KNCA 4B3FX 2GVZC 4ZDIA 3GJ7A 1KI3A 1KI4A 1XTIA 2ZSBA 3Q72A 3KKQA 1W7AA 1AM4D 1IJEA 5HR5A 5FTNA 3U2QA 3BB4A 4B34A 3RS0A 4F93B 1FPMA 4LUCA 4E22A 2I4IA 3BGWA 2WWIA 1ZJ6A 1R6BX 2ANCA 3OE7D 2ZRGA 3PXGA 4KFSA 4LJ6A 1U0JA 2ODWA 4ARZA 2R2AA 1N5KA 2JJ2D 1XX6A 4IXMA 4ZCMA 2P6RA 3GJ3A 3W5IA 5KOYA 2DB3A 1TEXA 2FFHA 1GVNB 3QG1A 3L8ZA 4DVGA 4FD2A 4B47A 1E2NA 4LBWA 2XOKD 1PLLA 4Q48A 1W0JD 3NKVA 4GMDA 5LPNA 4JL6A 3X1ZA 3LVQE 3C8UA 1E79A 2CEAA 3B9PA 2GCOA 1KAOA 3VR3A 1XTSA 1KSJA 3QBTA 4KAXA 3MUFA 1KI6A 4OL0A 3CWQA 1IN5A 4TYPA 3ZYCA 3VKHA 3SC3A 2V6IA 3LA6A 4HYYA 3AQ4A 4YDHB 4QNMA 4IDHA 3WP0A 4H1UA 3WMGA 4A1FA 1E0JA 1PUJA 2QPOA 2BEKA 2VHJA 1HT2E 3U7GA 1E2HA 4Q01A 4RSGA 4Q4AA 2IYTA 2QP3A 4EPYA 2D62A 2QBYA 5F3WB 4FMDF 4DLSA 1E4VA 3HR7A 2J0UB 5FR2A 4ESHA 4PTLA 4KBFA 1BYUA 1IXZA 3KKPA 1DG1G 2PMKA 1FX0A 2DFLA 1FX0B 2V8OA 4ZV4A 4DZZA 4LV6A 1G8PA 3K9NA 4LC1A 3GJ8A 3OE7A 2HF9A 4LHWA 5L3RA 4LJ8A 2OHFA 4ZI3A 3GLGE 2GXQA 3CNOA 1GKUB 3LW8A 4G3XA 4LYFA 5M04A 2O8BA 2WWYA 2FF7A 1OT3A 2B7BA 1JXOA 3B13B 2WM9B 4KHZA 2XSZA 4NCJA 5FUXA 3NBFA 2G83A 3B60A 1KI1A 1E2PA 2JLYA 5EUMA 1OIWA 3QVUA 4UXJA 4XJXA 2ZRJA 2X8AA 1T5LA 1VHLA 1IM2A 2ORVA 3AF1A 4QGAA 2XEXA 1P7CA 4B71A 3DZ8A 4A2PA 3SDZA 4C30A 2BBTA 1XEXB 4PANA 1DAIA 2C96A 4Q9JA 1OKKD 4KITB 1E2QA 1PJRA 1W47A 2ZRCA 1V5WA 4EIWA 3AKEA 3VU9A 4DKXA 3ZIAA 3K0CC 2G9NA 5JWOA 4UNQA 1GTVA 2OAP1 4EPRA 3VR4A 3U7EB 1X8JA 1W4AA 2JLRA 2XSZD 4AKEA 5AUPB 5LBIA 3U3KA 2WWWA 5AUQA 4OI2A 2DHRA 4WZAE 1RZ3A 5FOVA 3A6PC 2O5VA 2IS1A 3IBGA 4A0FA 4N0EA 4TQAA 4GZLA 2VF7A 1ONBA 4Q47A 4DUGD 3IEVA 2G1JA 1F2TA 3KKNA 5HPYB 1M34E 2V6JA 1Z63A 1P2TA 2XX3A 3U3JA 3CH5A 1W5SA 4BPBA 2JDIA 1XD8A 4EPTA 5JMTA 2FDCA 1E4YA 1FQJA 4URWR 2WWFA 4WOPA 5EP3A 3PEWA 2W6JA 1UEIA 3R9XA 2GRJA 1AS2A 3I1FA 3KJIA 1GZSA 1NVUQ 3P20A 4DCSA 1HA3A 4TQ9A 3C4JA 2WMOB 4MDFA 1E94E 4Z1MA 1B0UA 2IS2A 4XTRA 2IHYA 2ODBA 2HXYA 2YKGA 3H4MA 2UZIR 1G8YA 1WCV1 3D7MA 1BKDR 1T0JB 2ZRNA 1JALA 1AGPA 3QQ5A 1H8HA 2IF0A 1MO4A 4DLRA 2K5UA 3PEVA 5FPKA 4Q9IA 4XH9B 1CP2A 3I62A 4LOAA 2ZVPX 4Q4AB 2IUUA 2XZOA 3VNVA 1X6VA 2QT0A 5LD2B 1OH8A 1D8TA 3GLGB 1DO0A 4FWIB 4EFNA 5FBQB 1GUAA 4GNKA 1OHHA 2MMCA 4HUQA 1K5GA 3AH8A 1VCIA 3AVXA 2OLKA 3RC3A 1G5TA 1QZXA 4CGZA 4PFSA 1MH1A 3CF0A 4AYXA 1NKSA 2VP6A 1VG0B 1MRSA 2AD5A 2EU8A 2D2EA 1Z22A 2EWWA 5SZJA 4C7OA 5H70A 5IRCD 4G5GA 2V7QD 2DWQA 2F3RA 4PX9A 3ASYA 2BIFA 4V0OA 4BFWA 2JCSA 3FPAA 1D5CA 5ANRB 5GADl 4EFMA 1SVWA 4PSKA 2QAGC 4I1OA 4FXPA 4B48A 4MYUA 3RWMB 5LB4A 5K8LA 4QJ4A 1Z6XA 2XAUA 1P2SA 4CZ2A 5HE8A 2GEDA 5JHHB 1GNPA 1RJ9A 4TL7A 1O87A 4YMUA 5EP1A 4DXAA 3EZ9A 2BBSA 5E4FA 1YQTA 4ZDWA 1WBDA 3CUEF 2Q9CA 2YWEA 4D25A 2PMDA 2XGJA 2IBMA 2E1RA 3AVOA 1SKYB 3IILA 2XZPA 4Q4LA 1F60A 3SZRA 5BXQC 4OI4A 3FYHA 5DLQC 5CJPA 4A6PA 3EPHA 5CIWA 4V0ME 3OAAD 4KFTA 5CLLA 1OPXA 5FBVB 2W58A 4GL2A 4LYHA 3ZVMA 1UBCA 2LKDA 3H1TA 1WBBA 1S9DA 1XDBA 1JAHA 3AGPA 4NE2A 2FFBA 2FU5C 1N5IA 2O8DB 2XJ4A 4AG5A 3GLIE 1OJLA 3TNFA 3CPJB 2ZRPA 5HZKA 4URXR 4G1UC 1VYTA 3MD0A 3CONA 3PQCA 1VHTA 4B6FA 1FMJA 2RB4A 4B43A 2J0QA 4FINA 3KQKA 5BYKA 4EPXA 1SVLA 1QHSA 2G3YA 3AV0B 3KB2A 3PUXA 3I3SR 1KMHB 3TLXA 3P26A 1ZM3A 4GI7A 4C0HA 1U81A 5JRZA 3KUDA 1II0A 3FOZA 3B2EA 5FI1B 3QNUA 2W83A 5DISB 1F3OA 4EFLA 3GLIA 2GZHA 4Q4JB 3LBNA 2O8FA 5EXSA 4R2HA 4D26A 2R65A 2JLVA 3I32A 1KAGA 3FTQA 2QG6A 2FA9A 2AL7A 4TLBA 3VHLB 2BM1A 1KZ7B 4IHQA 1ZP6A 3WBJA 2QEQA 3NBYC 3BJIC 1XPOA 2XNDA 1NG9A 1UKVY 1Z0AA 2XTMA 4KYUA 1CS4C 1Z6AA 1GKIA 4B44A 1JR3A 1U8YA 5HKKD 3B6EA 5AR1A 1MO3A 3B85A 4BLRA 4LYJA 4QNRA 1E2FA 4OK5A 3MWJA 2R62A 1XPRA 2JJ1A 2JASA 4UNSA 1OFTA 4IXNA 3JZAA 3Q7QA 2VHTA 1YZUA 4GRAA 3VMFA 3RS4A 5C4MA 4PZLA 4XOIA 1Z6GA 4JS0A 4OK3A 3ZVLA 1X3SA 4W5HA 4IVRA 1COWA 2HLDA 1OFHA 3GLIB 3ZD7A 4QHSA 1IXSB 3NH9A 4KXFB 1N6LA 2QNRA 4AYWA 2CVHA 2YOHA 4RFVA 4W9MC 2ZS9A 1W2GA 3W5JA 1HQYE 4F4IA 2H5EA 5JI2E 3ZZUA 2C95A 3AKYA 3L82B 3NEJA 4FCVA 4LJYA 1SQ5A 1ZCAA 3UWKA 4DT1A 3P4XA 3BB1A 1G1MA 5HCIA 5FPTA 3I5YA 3DOFA 1II8B 4JVMA 421PA 2EFHB 5CDFA 4YMVA 2XNSA 4Q9KA 2P5TB 2CHGA 2FEOA 1UBEA 1RIFA 1F2UA 3U5ZB 4TLDA 4DSOA 1SXJD 1Q3HA 4AC9A 5E3HA 3I4LA 1WXQA 2ZANA 2XNDD 5DI9A 3IGFA 1XZQA 5BN5A 4IEIA 4HEJA 1VPLA 4E09A 4F91B 3N70A 3BORA 2FG5A 4C0QC 1SHKA 1GL6A 3EA0A 3UMRA 2J3EA 1W46A 5AK0A 2DCUA 2DY1A 3X2SA 3CM0A 4LBZA 1P3JA 1OB2A 2BOVA 1OYYA 2B8WA 2GK7A 3RLFA 4KSCA 1NMXA 4DBLC 2B7CA 2H17A 2QN6A 3LWNA 4NYIQ 1G4AE 3B1YA 3DKVA 1KSHA 4LI0A 4QHTA 4UQOA 3FKQA 4X8MA 1GG2A 4XWKA 4DLVA 1MV5A 3TMKA 4KYIB 4IFEA 3KXLA 3LBHA 1HE1C 3OEED 4JKIA 4M2LA 4RKFA 4BEJA 1PVOA 2GWHA 2ZQ5A 3HPQA 1ZM2A 4HAXA 4NHOA 2NPIA 5CK5A 1HURA 2YINC 3QXJA 1QHNA 1S0UA 2X19A 3KTAB 1KO4A 2R6CA 5DI3B 5E7MA 4BLPA 5AJVB 5FTKA 2WOJA 1ZNWA 2VEDA 2QP4A 4NYMR 1N6IA 1XRJA 1I4TD 3ECCA 4LV8B 3SR0A 2RGGA 2YVUA 1KY3A 4MGKR 3AP3A 4OJKA 2VP2A 1M6NA 4IDNA 4BFZA 821PA 3PITA 3GJ0A 4FCTA 2Q3HA 3KB1A 1ODFA 2ZU0C 4P4TA 1RE0A 2QP9X 3QPWA 2AKYA 4O2RA 1XCGB 4Q4HB 3A8TA 4O25A 4HLUA 1RYHA 4TL6A 3RS2A 3KQHA 3HU3A 4L5BA 4OQNA 2ZUCA 1CR0A 1G6OA 3QF7A 1U9IC 5SZIA 2IUTA 1JI0A 3X1XA 1KMQA 2OFOA 2JJ2A 1W4CA 4PHHA 2HJVA 2WZQA 3EPKA 1CLUA 1Q1QA 1R4AA 4M9XA 2ZYTX 4NCIA 4KFUA 2DFTA 3EC2A 4Q9LA 5AJZA 2O0JA 4BQSA 1X8LA 1YR9A 2QSZA 3MCAA 3TKLA 2NO9A 2J87A 4B3CA 1II8A 2JLSA 1N6PA 3MJHA 1DAMA 4NCNA 5KSZA 1RRCA 1P62B 3RRYA 1JPJA 1RW4A 2IEYA 3IUYA 5D3QA 3EPJA 2OUKA 3IQXA 4A36A 1ZBDA 1NVXQ 3Q3JB 2JJ1D 1Q1ZA 4IOLA 2CL6X 4ABYA 2FX3A 4QJ3A 4HAUA 1CR4A 1BMFD 2QMOA 4QG7A 1JXMA 2ZU6A 2ZYWX 4QJ5A 2BBOA 4WA7A 3ZVRA 2VF8A 2ZETA 4BFTA 4LPKA 3NVAA 4H9GA 4JBYA 1J99A 1M8PA 1NY5A 1CJTC 4ESVA 4B3XA 4ON9A 5DN6D 5TXGA 1E9FA 1P6XA 2QMHA 3M4YA 4MRPA 3A4LA 3GLFE 2A5GA 5FPSA 5G40A 1OV4A 1JAIA 4FI3C 1EFCA 4AWXA 2Q9AA 4HUQB 3ZLJA 1L8QA 2BJVA 4RZ2A 5GVRA 2CL7X 4F92B 1H8ED 1NSFA 1XB2A 4S2EA 1KTVA 1OXSC 2IYVA 3EIEA 1NG1A 1W1WA 4J0QA 1E6CA 3NWJA 5EQTA 1YJ5A 1KK1A 1P2VA 1FOEB 2WIAA 2ZUBA 3F5FA 3OF5A 1SULA 4HDOB 1F6BA 2ZM5A 3V00A 3UKDA 3BE4A 1XBTA 3TRFA 5C1BA 2PLFA 1UEJA 2SHKA 1XJQA 4C0JA 3B1VA 4PQFA 4URUR 2CCGA 4PC2A 3OESA 2VTKA 3OEHA 3KTAA 3H2YA 1SXJA 4ZCIA 4TT3D 1UFQA 3EG5A 2IS6A 2ZRFA 1T5IA 1P72A 4Q5IA 5FOWA 3ZH9B 2P5SA 5B64A 1T4GA 5DO9A 4X8OA 1YZNA 3QXHA 4A15A 2D74A 1OLOA 1P5ZB 1S1MA 4YMSA 1WRBA 3CX6A 3U3MA 3A1UA 2RH5A 3W8RA 1HUQA 2GDJA 3KX2A 1KHTA 3ND9A 4JVNA 2VP5A 1KO5A 1ZU4A 2DWPA 2MSDB 3W6OA 4A0RA 5CB6A 3BAFA 5C2JB 1E2GA 2VP4A 3VKGA 2VSFA 3IPYA 4E07A 1QHHA 4V0LA 2IWHA 4KO8A 4DIDA 2GCOB 3WYGA 2D2FA 3ZS8A 4ITRC 4EQ6A 2BMDA 1G6HA 4G01B 1C9KA 4IJMA 1GL9B 3WYAA 1R8QA 3CX7A 1TTTA 1C1YA 2WWHA 2KSQA 3VR5A 5KNDA 2AWOA 3DHWC 4OHWA 3UPUA 1VG1A 2BC9A 3PCRB 4I99A 1U0HC 4BFXA 1E3MA 5KDDA 1IOZA 1DAHA 5EZ5A 5GJWC 2N1BA 1AIPA 2GZDA 2OFXA 4MUAA 2BMEA 1ZUIA 4HSEA 2PEYA 2F7SA 4D4LA 2ZRLA 3FKSD 1E99A 4RD6A 1U99A 3UMSA 5J47A 1Q3TA 2D7DA 3GEIA 521PA 1D2MA 3NH6A 2R6GA 2QAGB 3WP1B 1F2TB 2W00A 2Z43A 1W4RA 3GCGA 4POAA 1CEEA 5IK2A 2OT3B 2WPDD 3BFXA 2FPKA 2Z5FA 4HB2A 4BFSA 1OXUA 2ZR0A 4HB4A 1LS1A 4FMCF 4LV5B 4C4PA 2V3CC 3K0EA 3SBEA 2QGZA 5AJWA 1E1RA 1G3IA 1CR2A 3D3QA 1Z2AA 4NCKA 5CJ2A 1ZD9A 1KI9A 3KJHA 5EXPA 2QENA 3MAAC 2OCYC 2VSXA 3RAPR 2WSSA 3TGPA 5J4KA 3AVVA 4LC0A 1GKYA 2QM7A 2NZ8A 5JWRA 4AKGA 2CJWA 2QTVB 4M1SA 3LH5A 2VPPA 2HUPA 4XVQA 4OJQA 4JBXA 3QKRA 5TV2A 4D80A 1ZAKA 2CLCX 4JBWA 5KPJA 1Z2CA 3DDCA 5FUVA 1UF9A 1OSNA 1E2DA 3TSWA 2GZAA 4HAYA 4D2IA 5EE5B 1NLFA 2WTUA 5JEDA 5JLJA 1G41A 3SOPA 2P67A 1JR3D 1T0HB 1G7CA 2RGCA 3CR8A 4BRUA 4JIMA 4Q9HA 1ZNYA 4X8HA 5H8WA 4V03A 4IVPA 1QHIA 2BWJA 1FNNA 2IK8A 2IYXA 1XU4A 4UXHA 1AN0A 1FQKA 5J4YA 2OILA 5BYJA 3ZZTA 3NC1C 5JI3E 4DLWA 2ODEA 4V0KA 3L8YA 2ZYVX 1A82A 2EYQA 1JQJC 1AQUA 4JLJA 2FGJA 2ZSFA 4LHXA 1Q1BA 3GLFA 1A2BA 2ZJ8A 1E2IA 5JHGB 4XD7D 3O8RA 2CNWA 2CJWB 4WW0A 1XXHE 1GNRA 3QF4A 1SHZA 3DL0A 1U8ZA 2C9CA 2ZRBA 4MA4A 1D2EA 1Z83A 3P4YA 3Q8XB 3ZIAD 2Q3FA 2QM8A 1UAAA 2GJKA 3K1JA 1AZSC 4XVUA 4OI1A 2V4ZA 3NDBB 3PUYA 2DYKA 3C5HA 4Q1BA 4RY2A 1LY1A 5K8IA 1Z5ZA 3QPUA 4V02A 2QPTA 4DHEA 5FL7D 4HZIA 5SZKB 4DEXA 5LB2A 5JJLA 2EQBA 2PJRA 1IAQA 2WVJA 3NHBA 4DCNA 5CIQA 1E1QD 4PO8A 2WPDA 5FUYA 1M1YE 3RHFA 3QKTA 2JATA 4PC6A 1DAFA 1MABB 4ZO4A 1G8FA 2H1LA 3OIVA 4A6XA 1R5NA 3L0OA 4NBSA 3P27A 3RS3A 4M53A 5G3ZA 2FN4A 1FUKA 3VHXA 3ICQB 1OKKA 3LDAA 1RRGA 2ZI4A 4DLUA 3A4MA 2FSFA 1SVIA 2WSSD 3D31A 3LX8A 5DSZA 1XEWY 2C77A 3NEYA 1GP2A 4PQRA 4Q19A 3AM1A 4B3GA 4E03A 2YOGA 1G3RA 1KSGA 4DC9A 1OFUX 1KI2A 4QKQA 3I5XA 1ZIOA 1KMHA 2QAGA 5AUNB 2EFGA 1R5BA 4P4UA 5SZHB 2JEOA 3DM9B 1PLKA 4NKRA 2ATVA 3SYLA 1NY6A 4NYJQ 1UJ2A 4A9AA 3KQLA 2FPMA 1SXJC 3ZQJA 2W2TA 2VLIA 5J4HA 3CPHA 3OIWA 5BQ5A 2ZIAA 3VR1A 3JZMA 3WRXC 4QGHA 1E0KA 4OQXA 3U7FB 4URYR 4LSGA 2OBMA 2IUSA 2GKSA 4LBYA 3QF4B 3IEUA 3UG7A 1E2JA 1SKYE 4Q21A 5BN4A 5JSZA 4WVFA 4AI6A 4M0LA 1VYVA 4PR0A 1NIPA 4QBHA 4QBGB 1ZD8A 4RCYA 2VP9A 4ZIRA 3DM5A 3ETLA 2OCPA 1UADA 2OSBA 3GLHE 4KODA 1A2KC 3OEHD 3ASZA 3GEEA 2X2EA 1FZQA 4PSVA 1NJGA 3PJRA 4RZUA 1IN6A 4DDTA 1GL7A 3R8FA 3CBQA 4O2LA 5ELXA 2QI9C 2PZGA 3V4FA 3EZFA 3REGA 2GCPA 2V9PA 2VL7A 4W5WA 3QE0A 4IFBA 3R7WA 3RABA 4EJSA 4IDOA 4B32A 1PUIA 5B58C 1ANKA 3B7GA 4KJZA 5CYPA 8OHMA 3SHWA 1RRFA 2RGAA 5CM9C 1BH2A 4XWOA 1J8YF 2W2VA 3RANA 4D4JA 3GPLA 4H1VA 5DGXA 1AZTA 1Y3AA 3REFA 2KBFA 2WJJA 4GOJA 1OIVA 1ZW6A 1WA5A 1G9XA 1KZGB 4JMPA 1UKEA 4RJLA 4OQMA 4TMXA 2YC2C 1QG4A 3LD9A 3K0AB 5E95A 2W2XA 2P6UA 2FH5B 3QJYA 1EFUA 4DT1B 4LYAA 5H1YA 3D8BA 1H65A 4AIIA 2N46A 4TTQA 3BD9A 4XSHA 4C0SA 2QQ0A 4A92A 4GSYA 2AXNA 4OI0A 4FWTA 1A5TA 1AGRA 2H8KA 3C5CA 1FTSA 5JS7A 1F48A 1NBME 4OYHA 2P0EA 2QA5A 3SE0A 2WHXA 1U98A 1UKYA 4ZKDA 3RDPA 1EFHA 1XXHA 3W3AA 3U6BA 3K70D 4KVAA 2R6FA 1KDTA 1RRPA 1GRQA 3A1TA 3BOSA 4JYCA 2A9KA 2ZRMA 3QENA 4QL3A 1Z29A 3HP1A 3SU8A 5FTJA 1W4BA 2X77A 3A1WA 1G8HA 1T6NA 4TMTA 2QE7D 1VCMA 2W0SA 3VAAA 4MGYR 1ZINA 4LJ5A 2MSEB 3P1JA 2RHDA 3FHCB 2YWHA 1TUIA 2MSCB 3T1QA 1YZKA 2JLQA 1IN4A 1DPFA 2OBNA 1CJMA 2FJUA 2ZJAA 1DELA 1NF3A 3N2EA 4AD8A 4C9BA 2BVNA 2REOA 2RGEA 3MWYW 2JLXA 4W5JA 4KSBA 2Z83A 2GILA 2GAAA 1XMSA 3LY5A 2FSGA 4G5OA 1GILA 2F6RA 3TUJC 4FIDA 4DLYA 3GJ4A 3A1VA 3L43A 2BMFA 1RC8A 2XZLA 1H8HD 3L0IB 3TW4A 2WKPA 2F55A 4QBIA 5LD2C 3A37A 1E98A 3LX5A 3G0HA 1EG7A 4B35A 1DAEA 2JGNA 4Q4JA 3GEHA 4WZBE 2QL6A 3BXZA 3W8NA 2IXGA 3H84A 2GTPA 4NMMA 1ZU5A 1ETUA 4PAOA 1VDZA 3S1AB 5DI3A 3A1SA 2YNMA 3CNLA 4RD2A 4BZXA 3RSOA 4PC3A 1DE0A 2OLJA 2FNAA 1W0JA 1Q20A 2HYDA 2VRWA 4Q03A 3ONWA 3SFVA 1U2RA 1NSTA 3K70B 4M4SA 2A30A 1W49A 2BBWA 3U44B 3TAUA 4PQYA 2UVQA 3A4NA 4I1VA 3VTKA 2CK3A 2IX3A 1ESMA 4PC1A 2JAQA 4ACAA 2QGNA 221PA 1EFRD 5DE3A 1KJZA 3I8SA 3QOFA 4HI0E 1A7JA 1R0YA 5AWFC 1E9CA 1IQPA 4DJTA 1GWNA 5AUOB 1E2EA 1UDWA 3ZD6A 2ZITA 4OHYA 4MGIR 1ZNXA 2D7CA 3U61B 1R7RA 1AS0A 3BERA 5G41A 2XXAB 1IXRC 3OAAA 1KO1A 4C0BA 1Z07A 4JLVA 3RNLA 1XD9A 4MRVA 4CEHB 5J4LA 1M7HA 1NVWQ 4K46A 4P4SB 5AJYA 5JS8A 3VX4A 2NO0A 3LV8A 2VYFA 2HEIA 4KV9A 1X8KA 1ZC3A 3AKCA 2VIIA 3DPUA 2N42A 3X1YA 3EPLA 5JEEA 5K8TA 3PVSA 2Z6VA 2WJYA 2DR3A 4RVCA 2AX4A 1MRNA 2C2HA 1CRPA 4LGMA 3U3RA 1C4OA 3GFPA 1T3SA 4QHYA 1LTQA 2WMNB 2QMUA 2ODNA 4M1KA 2ECKA 4UNPA 3LW7A 3I73A 3LVRE 3TJZA 3MWLA 2PZEA 4P0TA 1TAGA 1R8SA 1YR7A 1CULC 1UBGA 1VIYA 4BFUA 3VQTA 4ILEA 4AK9A 3E1SA 3L0SA 2CHQA 2WOOA 2GNOA 2VA8A 1M2OB 3K70C 1WQ1R 1NBMA 3HDTA 3IKJA 2ONJA 5EJEA 3AGQA 1E9BA 4BE7B 3PENA 3KFVA 4M1MA 5FBLB 3O47A 4JL5A 5KSOA 3GD7A 2DBYA 1S4QA 4TMZA 3HU2A 4YXWA 5B57C 1QVAA 4M8NE 4D0LB 1N6RA 4ARZB 4ERNA 3T12A 2PT5A 3ND8A 4C0AC 3W34A 1HY3A 2GCNA 4Q18A 3B82A 4L9WA 1Z6YA 4JVSB 1YE8A 1XCPA 2A5DA 1EK0A 2AR7A 3HYRA 1B23P 4MRNA 5BN3A 3KQUA 4PXAA 4QGFA 2XXAA 2NO1A 2VBCA 2MMGA 3B1XA 3NIBA 1UDXA 4IW3B 2F43A 1LW7A 2GK6A 2V1XA 1Z3IX 3EARA 3IIMA 3IQWA 2NIPA 2PEZA 4IOMA 4LJ7A 1SVKA 3VX3A 5KSYA 4CIDA 1S96A 2FFQA 3TR0A 3CIOA 3MMPA 2J46A 3L0PA 2XOKA 1E69A 4V0NA 5HZHA 1OH6A 2Z0MA 4QGGA 4TLEA 2KI5A 5TVKA 4A0HA 3K53A 2XTNA 4EJSC 2QMEA 2ZE7A 3OFNA 3IBYA 2HXSA 3DMDA 2JIZD 2RGDA 2OCBA 4MUBA 3HU1A 2ZVQX 4GBMA 3QEJA 4Z1MD 2ZI9A 6Q21A 4CEJA 1KI7A 4FMBB 4JLNA 2QTHA 3GJ6A 5CYOA 1RVDA 4B3BA 3K0FB 2WKQA 4CEIA 3VU9B 4BRWA 1Z28A 2PL3A 5F2EA 4LY6A 3THWB 4AURA 3TH5A 4M21A 3QBVA 4A8JC 5FOXA 2GVDC 3B1WA 3U60B 1JEDA 3T1OA 5JWHA 1DEKA 4JZKA 1MO5A 4DSNA 4A8JB 1JEEA 3T5GA 1GOTA 2ZXUA 1NVVQ 1XP8A 2ASEA 3EC1A 4MQBA 2GF0A 3K09A 2IS4A 5F9HA 1QRAA 4L4UA 4PZYA 4LWZA 4TMWA 3FGNA 1DO2A 3DOEA 3BIFA 2IL1A 2I1QA 1FMLA 2IYLD 2JIZA 4PPFA 1Z0JA 4XWAA 2ZJ5A 5EZ6B 3X1WA 1N0WA 4BWYA 4KBGA 3FMOB 3ZGXA 2QQEA 1T91A 4IOJA 1UBFA 2VHCA 4TTRA 2KBEA 1KDOA 1NL3A 2BDTA 2J7KA 4OHXA 4OHZA 2B6HA 3EXAA 1NN5A 2OBLA 4G5RA 4M22A 1KO8A 2H18A 1G7SA 2V55B 4BGDA 1Q57A 1R0WA 2CXXA 2QUZA 3N2IA 4EDHA 3MSXA 1TQDA 3GQBA 2OO7A 4B33A 1KK2A 4JJKA 5C18A 3TUIC 2J0SA 2OCAA 4TQUS 3K0SA 1SXJE 1HQCA 4Z54A 3WYFA 5TB5A 3LFUA 3C7KA 5JJIA 3CRRA 3EA5A 5JCPA 3EWAA 2FZ4A 3GP8A 3EIQA 4EPVA 1KI6B 5GJVC 3NHAA 5KO2A 3QI2A 1XD2A 5CK4A 4CEJB 1KO7A 3MRSA 1Q0UA 3U4QB 2BJWA 4MKIA 1W36D 2JLZA 2LWIA 1X1SA 5FL7A 1YU9A 2WSMA 3G82C 2KJQA 3LBIA 4YDSA 5EXXA 2F9LA 4LK2A 2QBYB 1Z0FA 5KDOA 3LQRA 1KDPA 1ZIPA 1TF2A 2BEJA 1M74A 1NLYA 2PBRA 4I1UA 3PEUA 2F43B 1GIAA 4NZYA 1XEWX 4PPNA 3QKRB 4AKHA 3TVTA 4GMXA 4RCZA 4CVNA 1VIAA 3Q5EA 2UZ3A 2PCJA 3FVQA 3LLMA 1KKLA 4ZIRB 3I72A 4HZUA 4HZUB 1HV8A 3I92A 2NO7A 3SYNA 4B3DA 5JFGA 3MJRA 1G3MA 4KLNA 2FV8A 2R8RA 4G5SA 2ZJYA 2A3RA 4XIGS 4Y0VA 4AYTA 2I1VB 4DCTA 1S1CA 4WIAA 1Z8FA 1AJEA 1UPTA 4FW9A 4B75A 1E32A 4C0LA 5D3MA 2O8DA 2NOAA 1JJ7A 1MKYA 4C0KA 1XPUA 1NVVR 4UJ5A 2FEMA 1HT1E 2JLUA 2Q0HA 1G4UR 2NPFA 2C9YA 1KDRA 1XEXA 3VR6A 4A0GA 4KVGA 1COWD 1VCOA 3RS7A 4EQ6B 3FKSA 4HLQB 1XJ0A 2J41A 3CO5A 4RD0A 4HDCA 5JBQA 3SQWA 4C7OB 1CU1A 4JSTA 2CK3D 2W6ID 2Q3MA 3LQQA 3T61A 5DHFA 5KUTA 1T8UA 2C78A 1ZUNB 2IXFA 4Q7MB 2J5XA 1ZM7A 4K81B 3SJZA 3U4QA 2CLDX 3RSLA 3ZQ6A 4P31A 5TMPA 1KKMA 4B76A 3I61A 5KNBA 2O8BB 1G18A 1LVGA 2IA5A 3QIAA 3DZDA 1WE2A 3GMTA 2A5JA 1TQ4A 2WWGA 5K8UA 3THYA 4DRZA 3AVUA 3Q85A 1AKEA 4L8GA 4TLAA 4UNRA 1E0SA 3THOA 4DDWA 3RC8A 1U94A 2H16A 5LDDC 3AP1A 1NLZA 2FWRA 1DVRA 4M1WA 1LFDB 4R9UC 4MDEA 4DLZA 1GSIA 2VSOA 1YRAA 2CDNA 5L8VA 1IONA 5GVSA 4WXRA 1IHUA 3CZPA 1MR3F 2IYWA 2AFIE 3TW8B 4URVR 3U3OA 5JCZA 3TSZA 5FPHA 1P75A 2IT1A 1DADA 4PPGA 4QRHA 4RKEA 4NU0A 3R20A 3AKDA 2OG2A 1TNDA 2WBLC 2P3SA 2IW3A 4OQFA 3E2IA 4IDQA 5EE0A 3ZJYA 2C98A 1FW6A 4O0MA 2VHQA 1GM5A 1KY2A 1E2MA 5FTLA 3QPVA 3TR5A 2ZRKA 2ZR9A 121PA 4TTPA 3T35A 1M7GA 5EP2A 4D0NA 3W6NA 3G5UA 3UANA 3AVQA 5FPYA 4R7ZA 4LJAA 1P9WA 1Z06A 2HCBA 2BV3A 4JVLA 4MYCA 2OXRA 5IDVA 4R98A 3CLVA 1Z08A 3L2OB 2YOFA 3JVUA 3ZDQA 1ZUHA 3O8CA 2JA1A 2RCNA 5UKDA 4NYIR 2WAYA 1G17A 3GLFB 3GJ5A 4WXPA 1JPNA 1QHXA 2H57A 2ORIA 2REBA 2JJ8A 1P61B 2AKAB 3A36A 3QXXA 4TMVA 5L3VA 1IBRA 3EZ7A 5A5GA 3WY9A 1KYIA 2WKRA 1Z0IA 3CB4A 3NG1A 1XCMA 3AF4A 1ZM4A 5D3MB 2YC4C 4OKSA 2ZS7A 3SBDA 1Y63A 1D2NA 1LS6A 3W3ZB 1YZGA 3SYKA 3KJGA 3FWYA 3U7HB 2IYSA 4ASUD 4HAWA 4CT4B 4QOSA 2EFDB 2GBLA 2H7VA 3CRW1 3RWOA 3WBKA 4C3ZA 2BCGY 2PJZA 2DFKB 4Q1FA 1NKTA 4D6PA 3SN6A 1E1RD 2YJTD 2GJ8A 1P9NA 2FFAA 3F3YA 2ZR7A 1JJVA 4AKIA 1X86B 4F38A 4JLOA 4D4MA 2Q21A 3OIUA 1M7BA 5JZVA 4KLZA 1N3BA 3LNCA 3DEFA 4N1AA 4CT5A 1N5LA 3PUZA 2O8FB 3THXA 1G5RA 5DIFA 5EE9A 3IPXA 5FUWA 1BO6A 5EE1A 3K0AA 2ZJ2A 5CLQA
chains in the Genus database with same CATH superfamily
3INRA 3HZRA 3W2FA 2VHUA 1CF4A 1M2FA 2YRWA 4UFPA 5FOSA 2ZIFA 4IHJB 4AS2A 4BB5A 2YJGA 3F8WA 5DTEA 5A4AA 4JQSA 1G2OA 1PZNA 4LHZA 1MEEA 1XXLA 4FN5A 4TT3A 5C1DA 2CZGA 4MQMA 4C7JA 2PWPA 1ZRSA 3CX8A 2BHLA 4G5QA 2I03A 3O93A 4PO9A 1YWGO 5KKAA 4EJ2A 2JLWA 3R3SA 5JAQA 1P2FA 3QY0A 1VG9B 5CR9A 3QU7A 5KU1A 3EMKA 2C8VA 4PN3A 4G0NA 4TSKA 4CRWB 1E6MA 3GV0A 1WUIS 1TLFA 1ZI8A 4HLCA 2VQEB 4CTMA 4Q02A 4F1KA 4P0PB 3HJTA 5KWSA 2XDWA 1O5TA 4JR2A 2I2XB 3AX6A 1SCNE 2G6BA 4EKYA 2DWUA 3BC1A 1NU6A 3ZWBA 4TMKA 2XXJA 3AXSA 5DCYA 3UH0A 5FWNA 3N6XA 4UUNA 2ET6A 1TK3A 1O97D 2QW0X 2YUIA 4TWIA 1NVMB 1L4EA 2W6QA 4CIWA 1R5OA 4G37A 3WLAA 2O8EB 3M70A 4YACA 3H42B 2G63A 3BH6A 2YV4A 3RHTA 1I01A 5KYWA 4A5OA 5JS1A 2ZAGA 3PK0A 4B6GA 3AEQA 2E87A 4PZPA 1Q83A 1OBHA 4KO4S 3KTOA 3WYEA 2FMXA 3GRKA 4RQUA 2DBRA 2UYYA 3WHLA 2W2KA 1J24A 2PBZA 4NJEB 3EVCA 3EIUA 3OEEA 4RANA 5JLAA 3STHA 1YVDA 3T5TA 3WDKA 1GTL1 2BFPA 4AT1A 4EJMA 1DBVO 1SC9A 2DVMA 2YJ6A 3HNPA 2HTEA 2NXJA 4KN6A 1LSOA 4NONA 4XQ0A 1ZSYA 2QTBA 1DOAA 2W93A 3EF0A 3ICCA 2ZPUA 3K09C 2FSHA 1KI8A 4RETA 4WH0A 1E77A 2RGNC 1YSCA 3PTZA 3CJTA 1NJFA 1NVEA 4W7HA 1N78A 5CXSA 3ZNPA 2EKBA 2FSIA 4DQVA 5A6SA 3ZY2A 4QPPA 3BJEA 4FZ5A 5EC8A 2P1RA 3IMEA 4RVSA 2RHCA 2CNNA 1P81A 2QDXA 3TZ6A 1EUDB 4TN1A 2P3LA 1UK8A 3JD1A 1G66A 3C14C 3MTDA 1ULZA 4C7XA 2F62A 4D3ZA 4QBFA 5A9RA 1K68A 3KQMA 3ZNNA 1Q12A 1Q11A 1H1LB 2JFBA 5DM0A 1EE2A 2IW1A 2D06A 4ZEWA 2DGDA 2R6ZA 1G291 2DKOA 5FPPA 3JQGA 6NULA 4CL3A 4P4SA 4PQGA 2VAXA 3B9RA 2WUVA 1AQNA 4UC0A 1X1RA 4RTMA 1E89A 3V4OA 4Q1DA 5BSKA 1G16A 4FYJA 1HOXA 1TRKA 2XDQA 4U02A 4B80A 2Z1DA 2UYHA 3GF4A 1DWOA 3MCWA 2CLIB 3MOIA 5TPZA 4R8VA 3C85A 1L4GA 4AY2A 1JQAA 4M8SA 2NTYC 4NC9A 4JEUA 3FHTA 1GT6A 2BN4A 3FOBA 2TMKA 4K9KA 4B9AA 5A5FA 4UBMA 1LK0A 6ADHA 1EG2A 1LF0A 2QMYA 4HXYA 3QYFA 1TYCA 3HACA 5CBPB 4JV5B 3B52X 1Z8HA 4G2TA 4YAIA 3NP7A 1ZI9A 3Q7IA 4ZARA 4MVJF 2JBAB 2XQKA 5EE3A 4KW7A 2EVWX 2VRCD 3OOSA 1MAAA 2LCQA 3WL7A 5A9TA 4ATNA 1OF1A 3HXTA 4BN5A 1XTBA 4HQ0A 3C4QA 1JN0A 1NX9A 1EWTA 1ADBA 5AK3A 3VKFA 1M2KA 2PSJA 4P8RA 4QXQA 1I6KA 2PZAA 1ZH0A 4Z4FA 1TXGA 3FJOA 4FR2A 3G0DA 1OZ0A 3T34A 5BVHB 4U0JA 3JQFC 3KPYA 1NKVA 3JQPA 3RTBA 4MHTA 1IMOA 2C5GA 2WICA 3D2LA 4QC2A 2DHEA 5NLLA 3SS9X 4AN4A 3I6BA 3D0KA 1KJNA 1XDGA 2H7CA 3GQVA 4RHEA 2X9NA 5BSRA 2DPXA 4I08A 5FL3A 3FZEA 2B5VA 1L7BA 1O9BA 2VXOA 1R10A 2C4UA 3A6ZA 3CT4A 4LRUA 4X61A 4DVJA 2WFLA 3C16C 4OATA 2Y1EA 4RFSB 1ZGZA 3VI3B 2FE4A 3QPCA 4J6EA 3NDPA 3TYXA 3OU7A 5J59A 1C9EA 4LE2A 2IOFA 3UUEA 3BZUA 3PD1A 4Q82A 4IEFB 2L0XA 1PP4A 3C43A 5ITSA 4GEGA 2FZLA 2VJBA 5IC4A 5LQKA 4RDHA 4WHMA 1ORDA 1I4LD 4IZHA 4JLKA 1GRNA 1N75A 1X9GA 3B9QA 2JFPA 3KDSE 5I4BA 2G5TA 2QD2A 3EVTA 3ROTA 1CHDA 1XTZA 3FOWA 3A9TA 4WASA 3ZWDA 3QVXA 4KIJA 2XITA 1B8PA 1U7ZA 1BXKA 1ISGA 2WNIA 2GBIA 2WV9A 3NQ41 3PFIA 4OSEA 3HG7A 4PG7A 5KC8A 5L3QB 2WQ6A 1KYYA 1CYEA 1T8WA 3I2JA 3EZ2A 3PCXA 4FDLA 3S8EA 3SMQA 4RVHA 2H2AA 2BDEA 4ZCQA 1J2YA 5C52B 3CV3A 1ZNZA 2H51A 4HMQA 4Q1EA 1P6UA 1D2HA 4HC4A 4QX6A 5J23A 5IAAA 4BTLA 3E70C 4OGLA 4R0NA 2Q2QA 4M49A 2J3QA 4MCIA 3TG8A 1UPXA 4CYMA 3H1AA 2Y8EA 4XFDA 3ESCA 1L4YA 3RIGA 1CIPA 4LS3A 3K71B 4LX0A 4X62B 1Y6FA 2FCAA 4D3DA 1A1VA 1R18A 2QYOA 5DNWA 3HR8A 2H1FA 1WV0A 1LNZA 1K8ZB 1KJQA 3D5QA 3LBAA 5TVGA 3KWFA 3VUFA 4DMCA 4DDVA 2HHJA 2QE7A 2Y4OA 2XCUA 3SFZA 4LDJA 2VUSA 3LKBA 4N76A 3TB4A 1HDZA 3FR8A 1XWIA 3QXCA 1ODJA 3H86A 3P9PA 4LHYA 4W1PA 5JTTA 2ZWMA 1ZVMA 3VTFA 4ENPA 2ZRDA 2NU8B 1OWPA 3HDVA 1KU6A 2NZUG 2WIBA 4GI2A 2W6MA 4YAGA 3TAHA 1SHJA 3VNUA 1EXWA 2G1KA 2QE6A 2IOQA 3NB0A 5K0FA 3CVYA 5GGXA 3PUWA 4HNSA 4PYOA 5F1PA 1AS3A 1UXGA 1WZNA 3SJBA 2ZYDA 1HFWA 5KYYB 1TUEA 3AEXA 3ZBPA 1JHPA 5J40A 3QVTA 2NUAB 1FNCA 2Z30A 3PEFA 3PPVA 3FFBA 4Q7KA 3IV9A 2HLHA 3M5PA 3X43A 3QVOA 5DYGA 1W0CA 2NU6A 2OV6A 3P0EA 2IIPA 8AT1A 5JMOA 2FMTA 3MOGA 1T36A 1E1LA 2QUAA 1RXVA 1Z15A 1FYVA 1GD1O 2POQX 2JIOA 3AFGA 3L9XA 4CGYA 1CDZA 1M3SA 4HSGA 5IN5A 5JNUA 4LDZA 1UC8A 2XYPA 4US0R 4V0MA 4YO8A 4S3MA 5GJCA 6GPBA 1EVQA 1EVJA 1GSAA 3SZOA 4RF3A 1I6LA 2VXYA 4ZI2A 1QH0A 2AD1A 3MRVA 3RHZA 1EB9A 5KU7A 4HZGA 4NBLA 2WG1A 1C80A 2I3BA 3KJXA 3PNMA 5AXAA 4EGSA 4UTPA 2BTQA 4ARSA 1PR6A 4NRDA 1LC3A 4XI9A 4F4JA 1R2QA 3R24A 2GN8A 3QX7A 1E96A 3CW2A 3TSAA 5IT5A 2FSUA 4PLWA 3SXUB 4X6UA 1BOFA 4OHCA 2J9RA 5EPUA 3WXMA 1WQ4A 4QYTA 2VJMB 3WMWA 4ID9A 3QOXA 2F9MA 1DKNA 5F98A 3L7YA 3L6DA 3AILA 3AF2A 1GYPA 2EZTA 4IP0A 1W5AA 1NP3A 3GFOA 3GRUA 1DIBA 3OZ7A 4C7KA 1UM9A 2IYRA 3LM8A 4X97A 3UATA 4PCUA 5F2NA 3LU1A 4D4KA 3ABZA 4HBZA 4IS2A 2JA2A 3MBIA 2WYVA 3IJPA 3ISVA 3KLNA 3PWKA 4XWTA 4Y1EA 5BOVA 2JH9A 3UAYA 4ALLA 1OLSB 4PU0A 5LOVA 4JYZA 4U6QA 4B2LA 3LLUA 4NBRA 2FEKA 2I7CA 1DUVG 1JNXX 4U3JB 4JENA 3TJMA 1N9ZA 1N77A 4J0KA 4X1IA 4J4BA 1FRFS 3C8DA 1MT0A 3BTVA 3IO3A 1U31A 4GVXA 3ICVA 1U6JA 4HATA 1J8MF 4K2HA 4XYMA 1NRJB 1QDEA 1NNI1 3UQZA 2FCRA 4G65A 2NWQA 2BY4A 1NBHA 3ZE7A 5AK4A 2JCBA 3NBXX 4IRUB 2DQZA 2PSHA 3DR3A 3MMNA 5F5NA 1IRIA 1OD6A 4DMUB 1UQTA 2NG1A 4DOMA 4EY4A 4DV1B 1P4GA 4GQIA 1QFMA 4I55A 1CUFA 1VYUA 4RHYA 2GJ9A 4GZMA 4TWZA 2IOHA 4WLFA 1QP7A 2G82A 3GRZA 1YFJA 4EGJA 3KC2A 5MFPA 1JAZA 3UJ8A 4WDQA 2E4XA 2XV1A 3V7WA 3KEFA 4KDRA 1TW3A 3AB3A 2GPBA 1IY0A 1NW9B 2BUCA 1JQLB 1N25A 3MELA 4O4LB 2J3HA 4FZ3A 4KI7A 4RF2A 4B73A 5IT9A 4ZI5A 2LD4A 1JX6A 2BMAA 1O95C 5H59A 1XD2B 4GE0A 4GOXA 4WZAA 3NHWA 1PJCA 2BUBA 1YGPA 1WPQA 2CDBA 3B1KA 2Z2YA 4ZI7F 2XMBA 4WFKA 4BNDA 3OOEA 1NOJA 2DECA 2OL4A 1OI7A 2AHRA 2OBYA 5IJ0B 1VMAA 4FGSA 2O2EA 1NFQA 3QVLA 2R8YA 2CLSA 3UK6A 1XK7A 2G76A 4MQLA 2RKWA 4PYKA 2BSQA 2RHMA 2DBZA 1J49A 2VTEA 4FEGA 1A7UA 4JJAA 4K0KB 1X7ZB 2ON6A 3Q2IA 1GGVA 3F90A 4Q12A 2VQDA 3P32A 1FNDA 1PQPA 4MYTA 4ND8B 4RNDB 4RXMA 5DHQA 5EJMA 4CCYA 5CDTA 1II9A 1PWEA 4LK3A 2DPHA 3F9IA 1NTOA 2WM2A 2VYVD 1NOKA 5DMXA 1TT5A 3BFVA 4MAAA 1YB5A 1GTZA 1EX6A 2G77B 2QZ4A 4K6MA 4XIFA 5KHLB 4BKOA 4BS9A 1R0XA 3H5IA 2CBZA 5K0ZA 4S05A 1D9ZA 3GUZA 3F6YA 1VPWA 2BHRA 2IYOA 4FEEA 5IF9A 4NBWA 3AVTA 4CTKA 5K8JB 4TKUB 1S2MA 2N47A 2RHHA 4LOLA 4BLUA 2XE8A 1Q17A 4O4JA 3IIJA 4QLBA 2A0YA 4L28A 5M7EA 1OASA 2R8PA 1GQOA 2XGSA 1AGXA 2IHUA 3AY0A 4DJFC 3KR0A 4C3OB 3DV9A 4ZVTA 2ZI3A 1H69A 3A9SA 5FH9A 1Z4KA 3G59A 3HDJA 4GLLA 4UMDA 5DSTA 3KAKA 3RFVA 2KB0A 4AQ7A 1GPBA 3UG6A 1XZMA 5KWEA 1KK0A 2E0IA 3QWAA 2WT9A 4MB2A 2PZFA 4PC7A 2XNJA 4DIEA 3KUCA 1WETA 5SYAA 2Q1WA 2XDAA 2J0UA 4J4TA 4MIEA 5FI5A 3WLRA 4ALIA 1TU3A 2X22A 2FP4B 1LPNA 2IPXA 4D0GA 4EJSB 1QPZA 1NP6A 3UEOA 3CRMA 1G3QA 2FMUA 3DVRX 4YQFA 1QIIA 4HLUC 2B6NA 4BLQA 5F76A 2PL9A 3C7AA 1ZQ1A 2TMGA 4AY4A 1IE3A 4RBNA 3B3JA 3NWPA 4UULA 5FTMA 1V9LA 1TJ5A 1OC2A 2D1FA 1LBEA 3W6UA 1I94B 2IC5A 2FPXA 7MHTA 2EBHX 4BNMA 2A88A 4GRDA 3QVVA 2PCLA 1KR2A 4QUKA 2VTVA 3IHLA 4HYEA 4RNCA 5EHXA 4ZOLA 4UJ3A 3HZZA 4J3JA 4TYYA 4RORA 3EZ6A 5B6IA 3VPHA 4LF7B 1CC1S 4HNTA 3R6TA 4WN9B 4HNVA 3NHZA 4BMXA 5MN6A 3CRQA 1E8DA 2CWDA 4ZCRA 5JAPA 1N3LA 3AUJB 4JI6B 3IOBA 4QTTB 4D9KA 1K5DA 3THXB 1H9CA 4NPHA 4KNVA 5KYVA 5G53C 5BSFA 3RFFA 1UBUS 1GG9A 1S89A 1VSUA 3EIHA 5BNFA 2Z56A 4WOBA 3LC2O 4MVJA 4QYSA 5IJAA 3ZYZA 4EGAA 3N8KA 1IJFA 1XP5A 2J4CA 1PT9A 3F3SA 2IIQA 4IHJA 3U26A 3TPZA 1V3VA 1XXHB 5TT0A 2XWQA 5FI3A 2FXVA 3ZY5A 4Z5XA 2Y92A 4OB6A 4PYRA 3KZ1E 621PA 1L5HB 2XOXA 3LAWA 3FMGA 5JARA 5DLYA 2BKLA 4TZ0A 1IG3A 2QZ9A 2ZJ7A 4LQCA 5DU2A 1NASA 3ZWNA 3CNQS 5ALFA 1TPZA 2P9ZA 1QG2A 1Y3BE 3UCFA 3D02A 3N1UA 1HLGA 2F1HA 3GXBA 2ECOA 4KWCA 4DSAA 2PXCA 1DC3A 1E8NA 3BRWD 1E0AA 3LJKA 3DTVA 3UT0A 1MU0A 4LBVA 4ZD6A 3TKAA 2VH5R 3I09A 3ZOZA 4UXIA 1AGYA 5BMVB 1W581 2QUHA 4UU0A 3RM3A 4Y98A 4EA8A 1I30A 1Q21A 2VQ3A 2H1CA 2C04A 4CQLB 1OZFA 2ZRHA 4BJ6A 3GHYA 2B3DA 2I67A 2AN1A 2GEVA 2PWBA 3KJEA 4KV7A 3RF6A 3KTDA 2IYZA 3GLSA 3GLUA 3KV1A 3OLXA 4HQNA 3F6EX 3K9WA 2YJNA 4ZCPA 1F17A 4ZVQA 4A4DA 2A9FA 2ZE6A 5DN6A 2GEUA 3MEQA 1V7CA 2LDXA 4KCGA 1TU4A 1T9HA 5IKEA 1UFKA 2CE7A 3M49A 4PAQA 2E4YA 3H2IA 2GJAA 1F6DA 4KQKA 4BWGA 4ZGGA 1UXJA 2ZI5A 2ENWA 3ENWA 5U1PA 4BIIA 2CLOB 2DHCA 1A95A 4YJ2B 2FPIB 3AFMA 4NZ9A 2ZP1A 4HTAA 1DB3A 2OO5C 3CLRC 4NULA 5IWCA 1W36C 2AR9A 1J7KA 3I9NA 3OSZA 4JLDA 4MCAA 3WLJA 1MOZA 3U0VA 4FJ0A 1E3TA 3TSYA 4HAIA 2IUYA 3TPFA 2AOVA 4BEBA 1O08A 5DCUA 1YT5A 1L3IA 2ZW9A 2CT8A 4F3TA 4MMZB 2HF2A 2X2FA 3TTSA 1RQGA 3FE2A 3S1LA 3UOAB 2JFQA 3MJCA 2V6MA 3G13A 4KQXA 2IHBA 4EGQA 1DJLA 4ZYVA 1TYDE 2OBBA 3FIJA 4QXAA 3HYLA 1IZ8A 2X6QA 4JT4A 4NBKA 4O4HA 1FL9A 2BFFA 2XNKA 1S9HA 2GNAA 4WZ6A 3U6KA 4LJSA 3AVYA 3FX2A 4HB0A 4GZ3A 4L4RA 4LVNA 4WINA 4G0VA 3HI6A 3F9RA 1ENPA 4QUBA 3TQSA 7MDHA 5K20A 1UKZA 4YJFB 1Z0DA 1D3AA 1US8A 3ADBA 1GDTA 1X39A 4WAUA 4Z7QB 2GD0A 2VWHA 4CNQA 1YQQA 2C7OA 2FRDA 1GFIA 1NUQA 4PSAA 4HQ6A 4EECA 2AFHA 3WL3A 1L7QA 3ZW8A 3ZWXA 2C3UA 4CDNA 4QARA 3GARA 1D04A 1OY1A 3MERA 1SKMA 1QQAA 1W87A 3OY2A 4FOPA 4WK4B 4BO2A 1J2EA 1JEOA 4C03A 3LK6A 3QSYA 1EUDA 1PR1A 3DWFA 3TD9A 3PX2A 2YYYA 2P62A 5KOJB 1PYOA 1EGVB 4MYSA 4EK9A 3LKVA 3SHFA 4FT4A 3N8GA 2Q62A 3SQMA 4DQUA 4JU9A 1S2OA 4R8RA 2PNFA 2X4DA 4DR4B 3E27A 2OV2A 3W5AA 5T4BA 4CF7A 4AKSA 1YU6A 3OTOB 4DR1B 3UK1A 5HM6A 1TCUA 1P2UA 3ORFA 1GPKA 3WO0A 1QGYA 4NK5A 4ER3A 3VZDA 3EXEA 3WRXA 3ZKWA 3VDRA 1WMDA 3EW9A 1BN7A 2EFJA 4ZPXA 1QIMA 2DT5A 4HLDA 2LRHA 4I36A 3KL4A 2ZBVA 1AKMA 2PUCA 3NLLA 4Y2GA 4ROTA 2J6IA 2QSYA 5EOVA 1VKZA 3C70A 4CCYB 1TX4B 1PG5A 1RAFA 4I9FA 1NJ6A 5DMHA 1YQDA 3GRAA 3H2ZA 2OEPA 4G63A 1TCAA 3HBMA 4W7SA 3UAZA 3WI7A 4RFSA 3RYTC 2O5RA 3AHCA 5IPFA 3IJRA 4GRIA 1XVTA 4Z0PA 2DQKA 4YJ3F 2K7ZA 4DCVA 2RGRA 4ILKA 2WR8A 1BGVA 4D8UA 4BNZA 2OXCA 1VLZA 2M6RA 2YR0A 4Q1CA 4BMNA 4BCDA 4YONB 5EKSA 1JECA 4DSUA 1K98A 2YASA 4DLBA 1DG3A 3OOJA 5AJHA 4ME6A 3V4LA 3DAYA 4DBLE 1ZVQA 1E0DA 2HDOA 5EP4A 1SD5A 1ULUA 3NETA 2PZ8A 3ZHVA 1P1CA 4D9MA 4UNNA 5JAOA 3IMGA 2HUNA 1A72A 4IGKA 2EW1A 3E5HA 3KEOA 3DMNA 1Z56C 2V0CA 1CQIB 5H02A 1FFWA 1TZJA 4Z4GA 4U0KA 2NXEA 3F97A 3I34X 4M0PA 4A27A 3PUVA 2C0PA 1WKBA 2X76A 2QIOA 4JJGA 1KY4A 1Z4OA 3NTOA 4NU6A 4BE9A 2HYIC 2ZZKA 2B9EA 2ZQYA 2GXUA 3FAZA 5D51S 3NVDA 3ILYA 2E85A 4NS1A 4HRAA 3E9NA 3TLZA 3Q9LA 4ETIA 3ED1A 2G04A 4LRWA 1T8PA 2X40A 3B8HA 2HZBA 1U7WA 2Q6VA 4M9ZA 3S68A 5CFLA 2O52A 3KHTA 1X1QA 2HI0A 2BW0A 3FXAA 4JODA 4NV0A 4OEHA 3R8CA 1S7GA 1DKUA 3PB3A 5GONF 5JRDS 1P1HA 1GZUA 1P9RA 1R0BA 1RFGE 2BI4A 2VPXA 4V0SA 5BSHA 2FZEA 4AG3A 3BBPA 1CRQA 2JAOA 3MTBA 2R8XA 3K9GA 9LDTA 2UXCB 3DHEA 3C1OA 4FS3A 4R3NA 4YRBA 2QTFA 4FQ5A 3E3NA 5HTKA 1PFVA 4CEIB 5KNCA 4Q4HA 4CJXA 5LMZA 2AMYA 2X86A 4U8GA 4L1KA 4B3FX 4WRRA 4ZDIA 5GV8A 1MXHA 1QS0B 1ISJA 4UOQA 4DY6A 3PL5A 3A04A 1FS6A 3C24A 2LR0A 3RS0A 4F93B 1FPMA 1THZA 3HCOA 4MXDA 5JU6A 1Z4NA 4E22A 4YUXA 3DFIA 3IAM1 4JASB 1MDBA 3DC2A 4MS1A 4YLYA 3BGWA 4NXNB 2ANCA 1QMGA 2ZUVA 2ZRGA 4XA8A 4LJ6A 5BOSB 1CB7A 3B38A 5DB4A 1EWYA 4IIYA 3I4FA 2WWVD 1EPUA 2X8LA 2GBGA 5KOYA 3QG1A 1DLIA 3L8ZA 4L6AA 4O2AA 5EIOA 4DVGA 1Z4IA 5LPNA 4Q48A 1PLLA 3W5DA 1ISSA 4JL6A 2PY6A 3BM5A 5IAKA 4HEA1 3VVMA 4JB8A 4G97A 3B9PA 2GCOA 3JALB 5DBGA 3E9QA 1WMBA 1XTSA 3NYRA 3PFNA 5D86A 4G2NA 3S28A 1MAUA 5TNXA 1UT8A 3MUFA 5E6RB 3JZDA 5BN5B 1IN5A 1ECCA 1D2AA 3VKHA 3HCRA 4HTFA 1ZZEA 4NOMA 4RLSA 3LA6A 3QLJA 3FVRA 4HYYA 5CXQA 2ZBRA 1H2RS 3VPGA 2EERA 2DC1A 2OTCA 4IH4A 1E0JA 4GIBA 3ROXA 4JJIA 1E2HA 1U8TA 2D1TA 3N2KB 2KLBA 1T1RA 4DG8A 3DAPA 4Q4AA 1QGUB 1OLUA 2IYTA 8ABPA 2IH4A 2D62A 1XZHA 5K2OA 4J0EA 1ZXBA 3O8QB 4IYJA 4ISBA 1M54A 4D8VA 1X77A 3BMXA 3KO8A 4BO0A 4LW8A 3P9KA 5CX1A 1KS2A 3TTVA 4PTLA 4ZAWA 1ZOLA 1Y4DE 2C5FA 5EYPA 4EHNA 4DR6B 1F8GA 3IP8A 1Y5NA 4RK1A 1XJ5A 1G8SA 3AHDA 3BSFA 4KE9A 4LV6A 3K9NA 1IULA 3H5AA 4D3FA 5DNUA 4Z9AA 2HF9A 5EA2A 1AHPA 5IKXA 1KDVA 5FP0A 2OHFA 5ICSA 2GXQA 3F67A 3GUHA 2ZOSA 3OPVA 4AJJA 4ZTZB 3HRKA 2O8BA 4HAOA 1NXPA 1Q74A 2AT1A 4ZT7A 3G89A 1JXOA 3DR5A 2WM9B 4NCJA 2HA0A 1FW8A 5CVEA 5KJEA 4CLEA 3B60A 1E2PA 4KRXA 1IHYA 4WZBB 1M1ZA 2UZAA 5E1DA 2PUVA 2GBCA 3WGKA 1TI7A 3VM6A 4H18A 1BDJA 2WEKA 4XJXA 4B7CA 3HB0A 1E3WA 1T5LA 1RWOA 1WAMA 4JX8A 4DIUA 3BL5A 4MR7B 2GYUA 4PYNA 5KCMA 2YWCA 2EJWA 4J16C 4AX4A 4ETMA 3QITA 1TMYA 3PS9A 4TWBA 2D5LA 3ICOA 3DZ8A 1QUFA 3M5WA 2IU3A 2NVUB 4YAUA 3DZIA 4DT1B 3SDZA 1RADA 4DR2B 4OD0A 1XEXB 2FKAA 3ZCSA 5K01A 1E2QA 2ZRCA 4P3PA 1B6TA 2RHJA 1IBSA 2DPYA 4WLOA 3M4ZA 4CPDA 1M2NA 1UBHS 4LQLA 3VU9A 5FDFA 4DKXA 3GI1A 3ZIAA 4BC0A 3IQZA 1XCLA 4WA8A 2G9NA 1SC4A 1GTVA 3VGJA 2A6PA 3VR4A 1X8JA 1MJGM 1YL6A 3LP5A 5FTWA 4TSRA 1S2IA 4R1LA 4UE6A 1H0SA 1Y6JA 2BD0A 4OI2A 1NVFA 2PR7A 1Z73A 3G6WA 4Y6GB 2HRQA 2JZCA 2QM3A 2XVAA 1XAHA 1RHJA 3CTPA 3FUXA 2IU4A 5FOVA 3RT7A 4F85A 1CJSA 2Y1KA 1DV2A 2GD1O 4N0EA 4MULA 1NOIA 1K3UB 3C8ZA 4J29A 1A5AB 1A0OA 4D6YA 2VF7A 4IG4A 1ONBA 4BJ3A 1QRTA 2DERA 5G4KA 4QZVA 1F2TA 2ZJ4A 4HUJA 1Z2OX 2OKGA 2JVJA 3BRCA 2BGMA 2CB9A 3C39A 1G20A 3VDQA 4L07A 1P2TA 4TS9A 2B7LA 2QUIA 2YTZA 3MW8A 2EDAA 5BQOA 1EXVA 1W5SA 3WB1A 3ZUGA 5JMTA 3WX0A 4MW7A 4Y7DA 4MCJA 2HH9A 3HLKA 2WWFA 2R1VB 4ETWA 4KZKA 3CVOA 4YWHA 5E3IA 5SY6A 3IUBA 1UEIA 2PUAA 4WNIA 3KJIA 1CUWA 1GZSA 1NVUQ 3R7SA 3P20A 4DCSA 3ILVA 1HA3A 4GKVA 3COYA 5GMOA 1E63A 2WMOB 2HJHA 2HTFA 3DE3X 3UFBA 4F9TA 1TJPB 4QDXA 2YKGA 1NQVA 2OD2A 3WL5A 3GMIA 4LAFA 3TIVA 3KU1A 3C98A 3JR3A 5ALGA 1QYIA 3QQ5A 2YVKA 1GZHB 2IF0A 1MO4A 2QG9A 1EAYA 4WXEA 5AIAA 4DLRA 1X1DA 3R3YA 4RGQA 4Z4CA 4E46A 5FPKA 5AM3A 1V47A 3I62A 2XZOA 2QT0A 3EHEA 4JKOA 5LD2B 1OH8A 4YGXB 4D8XA 4P98A 1DKQA 1I4EB 5FBQB 1GUAA 1QQTA 3JQCA 1FRNA 1WW8A 2MMCA 1SQ6A 2VK4A 3DF9A 4KXLA 2P3QA 4N12A 1ABBA 1IPEA 2CD7A 1F4VA 3Q98A 5BW5A 4X3CA 3AVXA 2SKCA 4PFSA 2FP4A 4RU1A 3BXFA 1AVTA 4ZN6A 5LA6F 1EP3B 4AYXA 5C51B 5LBUA 2Q5EA 2X6TA 1HKUA 4JOQA 3G0BA 3QMPA 3CE9A 1KJJA 4GVLA 2WILA 2V7QD 4QUDA 3OIDA 2BIFA 4V0OA 5M5BA 3JQBC 3T9DA 4HNAA 1IRXA 4L8YA 2Q5JA 1KJ9A 3NGLA 5HOEA 4PSKA 2QAGC 1Y8QB 3ER6A 3K70B 13PKA 5CA0B 4BGUA 3BDAA 1XKTA 1XA4A 1A8UA 1Y5LA 3VR6D 4QJ4A 4X00A 1PGNA 4XB2A 2GN1A 1KWGA 1P2SA 5HE8A 3DF7A 4Y3UA 1RJ9A 4ABTA 4TL7A 4AUNA 1INLA 4E30A 2GLUA 3EZ9A 4L6IA 5CG1A 1EX9A 4PSDA 3OE1A 5JSYA 4F6RB 5MFZA 1QB7A 2RAVA 1UBKS 1RAEA 2WTMA 2YWEA 3CKYA 3UJBA 4N6NA 1IQUA 4Q4LA 5BXQC 2HQOA 3A4VA 1KTIA 2MT9A 3ZE1B 5F12A 5J3JA 3VYVA 4A6PA 3IHTA 4ZQGA 3AONB 3OAAD 4V0ME 4YROA 2B20A 2W58A 2P2NA 4BLVA 1K7FB 2LKDA 1WBBA 5K0CA 1DIHA 4NE2A 3N5KA 5EZYA 2AFIA 2I2BA 4P5PA 3K7EA 2XJ4A 4NECA 2HBQA 3C6XA 1GXSA 4HCJA 4E2ZA 1VDMA 4G5YA 3R3ZA 1H2EA 2BR4A 4RZIA 3SKYA 4G1UC 5CDHA 4LCEA 3F71A 4NSNA 1ZN7A 3CONA 4XDHA 1V96A 3H17A 3K2IA 4I2NA 5HQTA 2VNIA 2EZUA 1DP4A 2XBUA 1Y8ZA 3G3EA 3R23A 4FINA 4RGBA 2O8DB 2R4TA 1QPGA 5ENZA 1OLXA 2EIXA 4QULA 2RJ3A 4EPXA 1N0IA 1SVLA 2G3YA 3AV0B 3ZD8A 2W2LA 3TLXA 4GQAA 1Y34E 3GRVA 5CXXA 3GLQA 4JJ7A 1PFWA 2QTMA 4OQQA 2FPPA 3TBHA 3W78A 4GI7A 1JDBB 1MZVA 4MRMA 2O2HA 4EMSA 1U1FA 1I13A 4EZIA 3KUDA 5KWVA 3NWBA 1Z75A 3OCYA 4IWNA 5L53A 3B2EA 3E05A 3HDQA 1N2SA 1JLSA 3GLIA 3C6KA 4KVFA 5K3EA 2JIPA 3F6CA 2QT9A 5G0SA 5E9JA 2HJWA 3R40A 5CA0A 5EXSA 2HPZA 2H29A 4C88A 4LYEA 2R65A 2A9QA 4RX1A 1RRVA 5FWYA 3FTQA 4TLBA 3ELUA 3AEKB 4OB8A 1JKFA 1E5TA 1TZ2A 3PGLA 1ZP6A 1N8NA 3HN6A 4JBNA 3BJIC 4XB6B 2XNDA 2J4DA 4YAEA 3NHYA 2DMRA 1M34A 1Z6AA 1JR3A 1U8YA 3MJDA 4LXHA 4XXHA 5AR1A 2DSTA 4AZVA 4QNRA 5DLDA 2EG5A 3GK3A 2UXDB 2HF7A 4UNSA 3AFIA 4C4OA 1CPYA 3IOMA 5AW2A 5JH7A 1H9BA 1JHQA 1Y4SA 3RVJA 4RXUA 1WMFA 3QMMA 2WHPA 4WNCA 3UT5B 1YZUA 3M1YA 1O89A 4GRAA 5KOIA 3VMFA 1PI3A 3RS4A 4CQMB 4J49A 1YBHA 3N3BC 1UJNA 3NZEA 2BFEA 4PZLA 5ALHA 4PE5B 1W34A 5IU6A 4NNOA 2L17A 4RFLA 1X3SA 1PT7A 3BFJA 4Q3KA 3ZD7A 3O95A 2VA9A 3PI6A 1HDIA 1DUIA 1G2QA 2JK1A 2NYVA 3AJEA 4J03A 2PGDA 5E9QA 2Y2UA 3W5JA 4DNFA 3HSKA 4D43A 1B2RA 4O5OA 2BYTA 5CFZA 2EJTA 2I4LA 4ZEXA 5K6RA 4A1OA 3L82B 3NEJA 5M34A 2WJ3A 3AR3A 1SQ5A 2GF2A 3DP7A 4EA6A 4DT1A 4IDBA 4QTXA 2UU9B 3KL2A 1AKQA 2A5LA 4PCAA 5BWOA 3CLSD 3CLRD 2GFQA 3FLBA 2NXNA 1TECE 2YHIB 5F3DA 2EARA 3JYPA 3T5BA 5CDFA 1TLTA 3QH4A 5FULA 1XAJA 3AZOA 1HTBA 2HOQA 2XNSA 3ACCA 3FWNA 3R5KA 4QO8A 1Z2DA 4LTNA 4MYDA 3BK1A 2QL9A 4DSOA 3F6BX 2VDWA 3K4PA 3WLKX 3M33A 3EH1A 3NYQA 5HF5A 3IEXA 2LNDA 1M67A 1KBQA 3LCUA 4S1WA 3G0GA 2ERCA 2GPNA 4HEJA 3BORA 4MW0A 3TDNA 2H2FA 4CIBA 3LCCA 3CG4A 4AJHA 1GRVA 3QLUA 5AK0A 2DY1A 1R15A 2V7PA 1CRLA 3CM0A 1P3JA 3EVGA 3M4NA 4GAEA 5DYNA 1JDUA 1OYYA 1VE5A 1FP2A 1J9GA 3WA7A 4HQLA 1RBMA 2YVAA 5B1YA 2Z3VA 4BQNA 1NHGA 2HIHA 3L4BA 3R5TA 4EUHA 5AVTA 1POXA 5F33A 5DGDA 2J85A 2A59A 3A9VA 2X8WA 1XELA 1LW6E 1SRRA 1GADO 2QSUA 2H6EA 3LWNA 3C3AA 5FNVB 2V9CA 1N1EA 2AJ8A 4YV0A 1GG2A 3RHSA 4XWKA 1C1HA 3P94A 1P77A 3Q0EA 1KE1A 5TE9A 3HDHA 1WVMA 4KYIB 1P4AA 3FTPA 2O2GA 3LBHA 3OEED 1DDOA 1W52X 4RKFA 4DA0A 2PNJA 4XDGA 2Y4NA 2ZQ5A 1H0RA 2OV3A 1XROA 3JD2A 1HURA 4RIFA 3X2EA 3KTAB 5REQB 4DW8A 1KO4A 2PZKA 1FC0A 4XLLA 1GT91 5FTKA 4ZPJA 1ZNWA 2YWXA 3AETB 1ADJA 2VEDA 1XZJA 2PWYA 1VLMA 2JKYA 2ODAA 1IK4A 2I71A 2RGGA 4R84A 3RBZA 2YHIA 1C7FA 1KY3A 1IATA 3R4VA 4P22A 2AQKA 3LUFA 2W98A 4JHXA 4QUGA 4E4RA 3FA2A 5I47A 1JMKC 2W9XA 4IIUA 2C82A 2DETA 2JKVA 4MVJD 3VV3A 4ARVA 1G8KA 3B6JA 4FCTA 1A96A 3CUYA 1TE2A 1I1QB 2PFKA 4MYRA 4P4TA 1RE0A 3HJBA 3QPWA 3UXEA 3R0IA 1BCRA 4NATA 3D3KA 2C29D 2Y68A 5T6BA 4O25A 3WGNA 5JJ5A 2J31A 2XUKA 5JDIC 4DIMA 4MI1A 2ZT7A 4L5BA 4PY2A 1T25A 5K05A 3GP3A 5SZIA 3TGLA 3SBOA 1FZTA 1HQDA 1KMQA 3VJKA 2GSWA 2ZT5A 3MRTA 2AOTA 4FB4A 2X0NA 2JJ2A 4BQQA 2F8TA 1AXRA 2HJVA 2WZQA 5EESA 1OA0A 2ADFA 5EMHA 1USGA 2BFBA 1CT9A 4M9XA 4D98A 3KQWA 4Q9LA 1RZRD 4YJDA 2WYUA 1GJRA 3DLBA 1BWPA 2P2ZA 3BIJA 5B4UA 2NO9A 4E08A 4B3CA 1II8A 1MVOA 1ZMOA 1N6PA 3I2IA 3Q12A 4NCNA 1QLJA 3DUWA 2FVXA 3IMKA 4QGSA 3RRYA 5DM70 1JPJA 4BGEA 5KNDD 4QEKA 3ZK8A 5H3CA 1K1EA 3WGHA 2OUKA 4L4YA 4QRDA 2Y1GA 3HYSA 3OT4A 2CL6X 2WK1A 1RJWA 3AR7A 3JQBA 4ABYA 4FB5A 5D5PA 2BE9A 4MSUA 3J7AC 1E7MA 4MQFA 5DF1A 3VRHA 4QJ3A 4UOZA 2TYSB 1E7YA 2CFRA 1R4NB 2AVDA 4MEAA 3ZVRA 1D4AA 5J2UF 2WSBA 3PFFA 4Z2YA 3N59A 3RARA 5LIRA 4H9GA 4TLLB 3S4YA 1VL2A 3OZBA 3DD1A 1NY5A 3FCYA 3N8NA 2XCSB 2ID9A 4IDCA 2H4ZA 5K09A 1SKUA 3M8KA 5C37A 1TMGE 2LXNA 1PJ4A 4Z1OA 4YRFA 1PUXA 3A4LA 1IZYA 5F3RA 5FPSA 5KS2A 1JAIA 3OT1A 3JQGB