5CLWA

Crystal structure of human glycogen branching enzyme (gbe1) in complex with maltoheptaose
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
658
structure length
637
Chain Sequence
VDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNREKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human glycogen branching enzyme (GBE1) in complex with maltoheptaose
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 1,4-alpha-glucan-branching enzyme
total genus 213
structure length 637
sequence length 658
chains with identical sequence B, C
ec nomenclature ec 2.4.1.18: 1,4-alpha-glucan branching enzyme.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5clwA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5clwA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5clwA01
1BQSA 3SCVA 5JXAL 5DJZA 1REIA 3V5DA 2DDQH 5L2KA 3LN4B 1FSKB 3M17B 5J6HA 3HMWH 5CPTA 3SCNA 4WEBH 4DVBA 1I3RB 3MNVA 4Z7VF 1EAPB 1UWGL 2YOCA 1OD7A 3UG5A 1T0OA 4OGZA 2DM4A 4BQ3A 3LCYA 2WVSA 3GUTA 2YEZA 4XPHH 5BXFA 1PYWA 5TDPB 5MHSE 3EHBD 2R9HC 2CGRL 4FS0A 5TF1H 5F7WC 3MCKB 1NH6A 5KSAD 3WBDA 4A6YA 2VLJB 4XP9H 5KS9B 4H25A 2FD6H 2W0FA 5ALCL 2ZE0A 5E94B 4L4TB 2HMID 5EC1A 4F57H 5C2UB 4YHGA 1S9VB 4KJQD 1M01A 4F2MA 4JRYB 3T77B 4D0DB 5EOQH 1C8YA 5I73B 4LSTH 4G8FA 1W2KT 1UWSA 1CLZL 4ZPTB 2GJRA 3V5KA 3GI8H 4FQHB 5EORH 5T1MB 3IVKB 3MLUH 4RMTA 5IHSA 4X99B 3O3UN 4RWYL 3OLDA 3GJFB 5A8MA 2EO9A 1E27A 5FM4A 1U41A 1AQKL 1T5XA 5K59F 4Y5YC 5B21A 2V5YA 2XA8L 3HE7B 4W6WB 4BKLB 4EN3A 1ZEAL 2DQJL 2VLRD 3IGUA 1PLGH 3NAAL 3O3DA 3H6JA 5CINL 1H5VA 4OCYH 5FOBB 1V5JA 4RE3A 2BNQB 3OV6A 5JXED 3LHPH 2L0DA 1FFOB 3GMOB 2FBOJ 5F3BA 3IDMB 1CFTA 3N13A 5BV7H 4IEFB 4M5ZH 2X9WA 1FNEA 4DW2L 3WMBA 4HUVA 3WFHB 1T83A 1T3FB 1W0VB 4XCEA 2I9LB 4LEXH 4JKPH 3IDNA 4NN6C 2MPAH 4PGCA 4A3HA 3UYOD 3S4SB 3MRPB 3REWA 3MNWA 2MANA 5F44A 5A2LH 1AD0B 3DETC 3SGEI 1SBSL 1A6WL 4E41E 1K8IB 3VG9B 1MFAH 1YY9C 2R2HB 3RA7L 4QRUB 3VMNA 4GJTB 4ZOBA 2VX7A 4P2QE 3WKNA 1PS3A 1I9RL 2IQ9H 5FGBA 4ACPA 2AK1L 3UROR 4R8WH 4JANB 4CAGA 2NY7H 2FEDC 4X6FB 1AGBB 2D24A 5E6IA 5GJTH 4ZTPL 1FYTD 3VFNA 4HKXA 2I9TB 3OXSB 5DO2D 1OARH 4DOHE 3N06B 4OAWA 4H20H 3QFDB 1OPGH 4GSDH 5EULV 1UM5H 4ZG1A 1MHHA 4HV8B 3O9WC 2P5ED 1M04A 5IQ7L 2V2TA 4KJYB 4B53A 2IAMB 4M6MH 1G94A 2GAZA 1VHPA 5IB2B 4WFED 5ISZB 3RIAF 3DX9B 2JE8A 2ZCKH 4OD2B 4JFHE 3L3DA 4MB3A 5H94A 1OTSC 1SJVA 2G75B 3GMNB 4HAGA 4M00A 1E4WL 3TO2A 4L5FL 3B5HA 3HZVB 1QR1A 1LP9E 1HXKA 1Q9WB 4MS8C 2ERJC 4PJBE 4DGVH 4PIRF 3U4EA 1VBUA 5GGTH 4MJIA 1ZT4A 5C07A 4RNRA 2W61A 2A83A 1D7FA 2F19H 3TN0B 1UZ6F 4J3VA 4LP4A 5DHYB 4OZIF 5CWSA 2W9DL 3MODH 2WWCA 3SCQA 2H8PA 1ZVSB 1M7DA 4DUXA 3OKDA 4O2FB 3Q48A 4PJ9A 5E5UB 3ZO9A 3QOMA 1E6JH 4CBPA 3PZMA 1IGYA 1JGEB 5AG9A 5E4EB 4U3XA 5JHLH 4HZ6A 2HJFB 2JJWA 4ZD3H 3ARGC 1MJJB 1KBGL 1F45A 3L6FA 3T4AB 5D1XB 4NFBA 1A7RH 3S36L 2X05A 4ZQKB 4P4RA 2V17H 3DXAA 4FQ2H 2RGMA 5HGGS 2R2BB 4PS4L 4LVHC 4M9PA 5IMMA 1XR8A 3GHEH 5ABDE 4E41A 1LO0H 2UZXB 4XTRC 1F4YH 3AREB 5JW3H 1I8LA 5DHVA 5DT1H 5DGQA 5GS1A 4TTUA 5I3DA 5HHMB 3PGDA 4OZFA 4QY8B 4LF3A 1IMHC 3HG3A 2UY7A 3QUML 2WMIA 2NY5H 2H3NA 3QHFL 1OD9A 4LCUB 4X8JB 4F7MB 2QLVB 3WFHA 3AGVA 3A6CH 3HU7A 4FNLH 4HS8H 3MGOA 4J3XA 4HV8A 1IEAB 2QSCL 4IOFC 3OXRA 2UY4A 2J5LB 1AO7D 3CAFA 4JO2L 5CCKH 3TC9A 1ITXA 1R7OA 2WK2A 1W3LA 4D0CA 5EPMA 2DD8L 4O02L 4WWKD 1UACH 5CS7A 2APFA 2QPSA 1D6EA 1S7QB 1W72A 5MEQA 4UT7L 4XPBH 1MQ8A 4L3CB 2Y24A 5HDBF 4S1QL 2G9HB 4XXCA 1B0RA 3JWOH 1IGIL 2YUVA 5MENE 3ARBD 3QP3A 5DSCB 4UTAH 3SDAD 1NBZA 1D6VH 2W91A 2EYSB 4M03A 5CWSB 4GPNA 3RM8A 2IGTA 4IRZH 4ZAKD 2AJ3B 4FTVE 5GZOD 3GI9H 4QTIH 5IOPB 2R0ZH 5EBWB 1U8KB 3TBWA 3O9WD 4J8RB 1JP5A 4P8WA 4HIEA 1EQCA 2V3DA 4OBRA 2BVPB 4AEHL 5INCB 2XN9D 3SQOH 2J3SA 3TIDA 4OZ4A 3CUFA 4OGAD 3PQYA 3JSSA 5D6DC 4BFIB 1Y7VA 3O2DA 5H94B 3MLWL 3JUYA 5DURB 4TN9A 2VLKB 4F7EB 5FHAL 2D31A 2E7MA 1DZBA 4NQCA 3TN0D 3PHAA 4I5BA 2DYPD 4YDVB 3VXQA 3O2WL 1AXTL 1T7XA 3O11A 1QFUL 4HPYH 1WWAX 3O3EA 5FGBC 2P48B 2VDML 1QNOA 2AEWA 1JZ2A 1LQSR 4DGIH 5D7IA 2WANA 5K33A 5C0DA 3RNKA 3PHSA 5C0CB 1VENA 1EMTH 2Q76A 4JFEA 4Z7QE 3MXWL 2ESVE 1WZLA 4JFDE 2QADC 4X99A 2C3VB 2X8RA 3F6IA 4KJQC 1ED3B 4KVNH 4X5WA 1NJ9B 4NZRH 2G3MA 4P23D 2BSSA 3UBXA 3QXDB 4L1HA 3RMEA 3LEYH 3IDYB 3NTCH 3QJFB 3D2UD 2W65A 1FAIH 3KR3H 2CDGB 4Z77B 2A2QT 2WMFA 2EIZA 4PJAB 3WKZA 3INUL 4Y4FC 1YNKL 3NZHH 1JMXA 2B1AL 1IGJA 4ZYKA 4CGTA 1KGUA 7FABH 1CGSL 1BJ1H 5TQ0L 4K2UH 5E1QA 4MX7A 2OWWA 5L0QC 2CERA 1AD9B 1OAKH 3JV6B 1UB6B 2PR4H 2GHWB 2OX5A 2AEPL 3TH4T 4D0BB 4TTDD 3L4XA 5EMYA 1N26A 3AXIA 4PGCB 2VMFA 3BAIA 2PO6B 4P8UA 3H0TB 3R4DA 1LWHA 3PWPB 4KZDH 1J86A 3U4BH 2AJUH 3GMPB 3TLRA 2YPLD 3B2UC 3KDMB 4HPOL 4NP4H 4KHXL 3T1WA 4LQ1A 1U91A 1T1ZA 1KBKA 5A6SA 2VISA 1PZ5A 4XPHL 3BZ4A 3IDIA 4P4KB 1LO4L 5C0BE 3UJIH 5I6SA 1K8IA 1MWAA 5M17A 1CFQB 2DS4A 2XTKA 4OCYL 4HOWA 3BSHA 5KTEH 2J78A 3CFDB 1P69B 3S4SA 4L8BA 1SHMA 3S3JA 4GO8A 2FSEB 4ERSL 1R6VA 3ARUA 1ISVA 1CWYA 1PD6A 4I77H 3QDJB 3O0RH 1KLFA 2A73B 4CD8A 4ZSOE 5I1CL 1BQCA 1NPUA 1YNTA 3ARFB 3RNQA 4X0KB 4IOIA 4CL7A 1KG0B 5C0CD 1E3ZA 3ZHDA 2F7RA 1RZKL 2NY1D 1P53A 4OBSA 4BH8B 1S9VA 2EDQA 5ADOL 5A8NA 1QD0A 2MMXA 3DMMB 4EIGB 2D3NA 3I6GA 3S9DB 3QHFH 4LCWE 2DWEA 1HXJA 2VZOA 3PL6D 1GVYA 3SE4A 1U8QA 2HT4C 5CPQA 3SOBL 3LHPL 4M8QA 2ITDA 4RBPK 4D72A 1E28B 3ZZ1A 4HZLA 4NQDE 3O2DL 5CIPA 2WZPD 4R8WL 1JRHL 1U58B 4NRZA 3V6ZA 2VR4A 1MAKA 1ZS2A 3RCNA 3N18A 2A6JB 1EXUB 1BD2A 4LFHG 3QO0A 4QRSB 3FNDA 5BXTA 2HTLD 4JHWL 2GYSA 2IH1B 5FYKH 1DWGM 2VCAA 2MQ0A 5HYQA 5J56B 3BPCA 3DGGB 1I1YB 2VDLL 1CS6A 2BX5A 5T3ZD 1US3A 2XKUA 5BROA 2IAMC 3CSBA 4U7SA 5D5MB 3UG4A 2P45B 5EH1A 2G3IA 2JJTA 2VYRE 3BT2H 2IEPA 4FN0A 3PUCA 4A6YL 2ILLA 1O7DC 1GOWA 4MSWA 4PTUB 1XYZA 3IJ7A 1NFIA 2C1PB 1OLLA 3OF6D 2X44D 3DBXB 1N7ML 2N56A 1G7JA 5F9JA 3UAJD 1QVBA 3WQWA 3MBXL 1KB5B 1QPKA 2YEZB 4GXVH 5F9WB 2W38A 2EJ1A 2F15A 4HUVB 1RU9L 2Z1SA 3GJFA 5CJ5A 4UI2A 2ZX7A 3HA0A 5CJQL 5E9DA 2IGFL 1F4WL 2UYLB 3MV11 3CVHA 3VG0L 4JE4B 3VGEA 1F3DJ 1KWKA 2NY3D 4PJIA 5HVGB 4RFEA 2JJSA 3H3PL 3RTQD 5IG7A 1Q8MA 3SIMA 4DGYL 5D2NA 2PN5A 4PP1C 4V2BA 4P2QA 4X6EA 5EU3B 2ZX8A 3FN3A 4UQAA 3PZGA 1E6NA 4HIIB 1JPFA 3DECA 4ZFOB 4QXTB 4ZUVB 4CKVX 2A3HA 3CDCA 2AKRB 3DXAE 4I48A 4P3DA 3HE6D 3GIZH 3VE0A 5EORL 1JTTA 2A6KB 4DTGH 3MFFA 4KKCD 2VZUA 5D7LB 5FUZL 1PVHA 3HN3A 1TJHL 4XPAH 1S7VA 4WGWB 1RJLA 4YPJA 1A6TB 1PGRB 2BNQA 1B1YA 4WKHA 3F58H 1DWFM 2XN9A 3IJHB 4QHUB 3IETB 3IJ9A 4IOSD 3EO1A 3E3QE 1IAIL 3HR6A 3M17A 4FQPA 5DRZB 3HZMB 1MLCA 4HHAA 4ZAKA 4TRPH 4RDQG 1H15A 1A9BA 3GSRB 1LL6A 3OGRA 2PYED 3MACH 1J9YA 2CUHA 3T2NH 3PL6C 1PYWB 1DQDL 3DTXA 3BKYH 4KXZI 2W5FA 3NCMA 3DVNA 3SDXF 5C0JB 2EPLX 3CZKA 2CBIA 1CDCA 1A4JB 3BDYL 4N8PA 1S3KH 4U1NA 4N0CD 4NP4L 2R1YA 4L4TA 2VB5A 1EXUA 3SDCC 2A0LD 5C08E 1QHPA 3PGFL 1LO4H 2EE6A 1GPOH 1XGPB 1LE5B 4ZUSA 4JG0L 4RMWA 3KPTA 4MQ7A 1LEIB 1YJDH 1XIWA 2OYKA 2CDGA 5E0CA 1MFEH 1FV1B 5JW5B 3ARBA 3MRNA 1KULA 3AHXA 4OLXH 3ARGD 4UNUA 1TQCC 3B3IA 5E5RB 4JO4H 4JZJA 4S0TD 3PWJA 3K7UA 4P2QB 3WEOA 3L3IB 3D52A 1TCRA 4Z2IA 4NOFA 4PJAA 4NO0D 4NZCA 1GH7A 2XKNA 2JB5H 4BS0A 4KUCD 2GSIA 2VITB 4WRLA 1I1WA 4E0RB 1HIMH 6FABH 1DQQB 1YEEL 1YN7A 4WHCA 1WP6A 5J57B 5T3XD 4MNQD 2DSKA 4P2RB 1IGFL 1VB9A 2VQUA 4GQ9H 3BVTA 1B31A 2Y5TA 1BF8A 1IC4L 4BSWA 5FM5M 5ID0B 4NYLB 3IAPA 1TVBA 4U6HB 5HDLA 3TNNB 2J2ZA 1VKXA 4CD6A 2V5MA 1U91B 1R5WB 1HI6B 4O2EB 3NJ3A 3PGDB 4OZFB 2WMIB 3CO4A 3AB0C 2Z93A 1MCSA 4RFEB 2ADFL 1MY7A 4HUNB 4LLQA 5SWSA 4LHUD 4YX2L 1NGXA 1QKZH 3SQOL 3MMEB 3ZHLA 4MXVE 2Q3ZA 5F7UA 4PRNB 4MZ3A 3MROA 2NR6D 4HUUA 4G43A 3UTSA 1LNUB 2WVTA 2R23A 5I8OL 5CD5C 4HD9A 1KWGA 5C8BB 4JHWH 2NY5C 1IGCL 1RJZA 2FSEA 5D7JC 1F90L 2DMBA 2W59A 3NCFB 4KTEH 3HE7D 1C5CH 4L29B 4JJHA 1VACB 4RIRB 2AABH 1KGCD 2QJDA 3W82A 1NCWL 1HXYA 2WLZA 1A7BA 3P2TA 2NW3B 2E40A 4PG9B 4X0KA 5I75C 3MXVH 5DRZA 2ZUTA 1WDSA 4KI5E 4NO0B 1QFHA 4K3HA 2PCPA 4MADA 4MCZA 2W0PA 3GMQB 2FEEL 3U0PA 4IMLA 4CVXB 3VFSA 3VGGA 4CU6A 1D5XB 3D9AH 3CDFA 1MJUL 1OAQH 3MUIA 3QEGL 5JDSB 2ITDB 3WHE0 4P2OB 4AK1A 4HS8L 5J3HC 2BVTA 1UHVA 4HFWB 1O6IA 5FGCB 3QWOB 3VXQB 1KLUB 2J75A 2QTEA 2ICWB 5EN2A 3PWLA 4EOWH 2ZWZA 2IANA 2AV1B 3ZR5A 4PMZA 2PYEE 2WWKT 5FV1L 4AZIA 2NXZB 1B2YA 2CD0A 4UINL 3A21A 2GK1B 4NUGH 3FQUA 3AREC 5E8DL 3DX1A 3QUYD 5E9DE 4KHXH 1WAWA 2NZ9D 2AI0L 4HK0A 5IOPA 5KAQF 2J8OA 1Z9OA 1MLBB 5I1EH 3T04D 3FO9B 4UB0H 5T3XE 2PF0A 4QHNA 5D7JA 3BKML 5CFHA 5JXEA 4DJMA 3WMCA 2E9MA 4N0UA 1U8LA 3UZQA 4PUDA 3VXSE 2ATKB 4FTVB 1CU4H 5GPRA 1IBGH 5D8ZA 4Z7NE 4MJIB 1AGDA 4WFHE 3D39E 1XZ0A 2JB6B 2ZG1A 4LNRB 2BP3A 3NIGE 4HDIB 1UWRA 3H3BC 3BGFC 2NY4B 3HCVB 1A6VL 2VISB 2RJMA 1AP2B 4U1JA 5I1IL 2AP2A 3TN0A 3PZOA 3T0ED 3EYPA 3K3QA 1LVEA 3TBYB 4EIZC 1PKQB 4CW1B 4Q6IA 2ZX6A 3QAZC 4QRPB 1KCVL 5LWYH 4Y5VA 2JF1A 1NC2B 5IHUL 2EKJA 2E7LC 2XFXA 4XX1E 1MYRA 3ESUF 5T1LB 1C12B 1OTTC 3W11C 2IC2A 4AD2A 5F7FA 3MRJA 1MWAB 1CDHA 4LSPH 4TVPE 3S35X 4ETQA 5KW9H 1RFDL 4I3SH 4QHMB 3BZ4B 2J8UE 3Q6GL 4P4KA 4XRCA 4DCQA 1OINA 3ULVD 4RSVA 1T2XA 4JFZL 1OSZB 5CP7B 3SE8L 4U6YA 4TUOA 1I7UB 4PRPE 3K2MC 2NYYC 2V7NA 3W0WB 3EKCA 1Q6CA 4NRYA 7FABL 1WDRA 4RGNB 5DHVH 2VX4A 1NGZB 4V1DA 3PDGA 1H5BB 1IEAA 1NUDA 2JCCB 4ODVL 2XA3A 5ICXA 3TIDB 4ZXOA 5BRZA 1ND0A 2A6DA 4K7FA 3O6FD 4D71A 2NY2C 4KKBD 5D1ZA 4QXUH 3RAJH 1HQRA 3WNKA 4EK7A 3CFJB 1TG7A 5J7CC 1EJ6A 1IAKA 4X7TA 2HRPL 3QIUC 2WBJA 3P9LB 5HYSB 2ZXAA 4ZE4A 1RJYB 2FYYB 2NY6B 4Y16A 4C4KO 3BN9C 3VMPA 4UILL 1IM9D 3RL2A 2GFBA 4WHYG 2D23A 1SM3H 4RAVB 5IUSA 3ARFC 3WUGA 5A94A 4C4KT 1QSEA 4GI6A 3EYFB 2ZUQC 5ID1B 4JFVA 1DUZB 5I15H 1QSFB 2BY3A 1MFCH 5JZ7C 5GGTA 3MLRH 5BS0E 4TRPL 5JW4M 4HU8A 1LG1A 4JFFB 2EDRA 2AABL 2H32H 5JNYA 4KWUA 3EJUA 1H3UA 1TMCB 4QHNB 5D7JB 1E5NA 1WFTA 3KLAA 1EJOH 1YY8A 2DQHH 1U3JA 5FB8B 4W5ZA 4P5TB 3TYGH 2HJLA 3PGCB 4IIQA 5DD5L 4NQTA 1JPST 1ZLUH 2XTLA 1BGAA 2X4QA 1TUXA 2HVKA 2IH3B 3VFMB 4B9YA 1E4XI 4HDIA 3SN6N 1JAKA 1MJUH 1N5YL 3PWNB 2PF6A 2JF7A 2YL8A 3CZ8A 2NY2B 3OF6A 2F8QA 3MRRA 4Z2GA 3UTPE 4MDIA 1FNFA 1MW0A 1IAIM 3LKNB 1AKJB 4G6FB 3AISA 4NQSB 3QFJB 1OL0A 3NSMA 3W24A 1EGZA 4GRLA 4IDJH 3BD5A 4G8IB 3HZ3A 2OTWB 5GGRB 3OZPA 1MCBA 2IANE 3QXTA 3TJHC 2VWEC 3VSUA 1ZB5A 3HMCA 5IQ9A 2QEJA 5HPCA 4HA1A 1I75A 2BDNL 2SEBB 3TM6A 3ALGA 3WDHA 5SWSB 1K9FA 1XV8A 3LSOA 3CUPA 4RAUB 1BVKA 1SYSB 2ZKHL 1B88A 4G5ZH 4ONOA 1MLCB 3EYQD 4KKNA 4DVBB 3WJJC 1GVIA 1NCBH 4DN3L 4PGEA 2BK8A 1U8OB 4YWGL 2RFXB 1QI5A 3DV6B 4H0GA 4JRYE 2ESVB 2OK0H 4IPLA 4K71C 1QYGL 3LPGA 4PJHA 2MWCA 1JL8A 4ZOEA 1MXDA 1MF2H 1NAML 1FZOB 4HGWB 2XZAL 5HTSA 1X4XA 4JFSA 3BDBA 4PLKD 3VTRA 3DX9A 3I9GL 1S7RB 1IKNC 5AD0B 1M71B 3E2HC 3QDJE 1P1ZA 3PDOB 4QOKA 3FB6B 4HCRL 4XMPH 4Y2DB 5CGTA 1FPTH 3WF3A 2FJGB 3G08B 3SE4C 1UFUA 5I23A 1MCRA 2R69H 1ZGLP 2CXGA 4WO4A 2Z35A 3ULSB 1OSPL 1X7QB 4WFGE 1GJWA 3PNWB 1AQMA 5D4YA 2YDRA 1RK0B 1CF8L 1UD5A 1D9KB 1L7TL 4M6AA 2EADA 2X2IA 1V7NH 3OKMB 3P0GB 3Q3GA 4HFWA 3SPVA 1S9KC 3KHQA 1R5IA 4PV9A 1ORQB 5FYLD 3NUKA 1ONQB 4NM4H 3LY6A 3F5WB 1GHRA 1DDHB 2DEPA 2VI0A 1NCDH 3QDGA 4QF1A 3RVVC 4ZFOL 4ZXLA 1R3JB 5DJDA 3F7QA 5EU7E 3STBA 5K59E 2VOTA 4ZAKB 3DXAB 1QZ1A 5AAWA 5C86A 3T77A 1G1YA 3MC0A 3UERA 4JVUA 4KTEL 3TBSB 3BVVA 5CILH 2XG9A 4LVNB 4MHHI 3BHBB 3DSFL 2DSWA 15C8L 1UD2A 3TFKC 2B2XH 4YR6B 4APQC 1QBLH 3AHVA 3VX1A 1WFNA 4L4VD 4GMTH 5HHPB 3QQ9D 2YZ1A 4WIQA 3CH1A 5T1KA 5JIPA 4HZ7A 2GCYB 2MKLC 5I1GL 1BYBA 4FQCH 1CL7I 4ZMAT 2DQIH 4PYHA 4W88A 4NDMA 4NKDA 1HJSA 1MAML 3DO7A 4AISA 5JO5A 4KRUA 3DX7B 4FQXA 4JRXA 4NQEE 5I75B 2CGRH 1BQHA 2NNAA 4G6AC 4NF7A 3MMEA 5CINH 3T0WA 1OP3H 3WH6A 4F7TB 2J88L 4LPUA 3VFOA 4OOZA 4QYOA 1L8NA 1K6QH 4QTHB 5GRWA 1E15A 4FNPA 4HEPG 1X9QA 2DLEA 3WN5C 1V02A 2BSTB 3G5XB 2FNBA 4NQCD 4AT6B 3FAXA 4ZFFA 1BHGA 2RAMA 5ECUA 2NW0A 5HHOA 5GS2H 3IFOB 4JFUA 5JOEA 1KJMB 2XNAB 4NQDA 1JCKA 1B0IA 2D7OA 3VGAC 4WJ5A 1WISA 4GG6B 3LKRA 5CZVH 3QUXD 1NCTA 4R4ND 2BVEA 5C6TL 3HG4A 3CUJA 4HZ8A 3IGAB 5DD6B 4F2MB 5A2JH 2QF8A 3IRPX 5B38A 5I1DA 5HI5D 1QP1A 4EBQH 4N90E 1A6WH 2GT9B 4ZUTB 4Y1AB 3BH8B 2DIBA 2D7TL 2DBLH 1MCKA 4JHBA 1CXFA 4NQXB 1WWWX 4YFDB 5SV4A 5E8NA 2WCAA 9CGTA 3V79C 5E2WH 5A43C 3MFFB 4OF0A 1M05A 2PTUA 1I1AA 4NBYB 2ADIA 1KPRB 4W68A 3LIZL 4KZEL 3QO1B 1N8ZA 2BSED 3I3DA 2O93L 3H9SB 1IGCH 2LAAA 3MBEB 3MZTA 3MJ9A 1FVEA 1FQ9C 1YY8B 3VXUB 5ISZD 2ZKHH 3UESA 5JIKA 2H32A 4NZTL 3AZSA 1WIOA 2D4DA 3HI5H 5EC1B 1W9UA 4E5XA 1NDMA 1MIEL 5JW4R 1XF4A 3D18B 5EUOB 4JO1L 4ZPVA 1JRHI 4H25B 4UUJB 3FB8A 2ENSA 2GJPA 2ICES 3D85A 2R0KL 3EFFA 4J3TA 4ODXA 1BIIA 3PV6A 1NMCC 5TDOA 1HF6A 1Z9MA 4Q74A 3RTQC 4LCIH 1ZGLB 3UZVB 1BJ1J 3K4DA 2UZIL 3VGAB 3G5ZB 3WL1A 2VIRB 5I2IB 5AEAA 1R85A 1OQXA 25C8H 4F3FB 4NQSA 4OQTA 3SE8H 5JA9A 2WMJA 4ZUUB 1KIQA 5T1MA 1OAQL 4M80A 3VNZA 1UJ3C 4OCLC 4NOBA 3G5YB 4LARL 2A3CA 2M2DA 1SEQL 3PHQA 4C55A 1OPGL 1VAHA 4L1DA 4Z0BL 2C0HA 1JNLH 3E2HB 1URLA 2R0LH 3C5ZB 4U0RB 3OKOA 3BPNC 5CKGA 4KPHL 5E8OA 5EOCJ 1HJUA 3LXCA 1N0LA 3A47A 3BKJL 4OV5A 1CL7H 2M8XA 2QR0A 4ATWA 4JRYA 1MH5A 1K8DB 3HI1A 1JGDB 3VXRD 2IMMA 1KCKA 1X4ZA 5I5RA 2WLYA 1JD9A 1UR0A 4WJXA 2VH5L 1B4JL 4PJ5A 43C9B 4LOUC 2G5BB 2NW2A 3ILQC 2F19L 4GKNB 4HULB 2APBA 3NBNA 2MHAA 1CLCA 5F6HI 3OPZH 3ZLQC 1VCAA 1YMHB 5IIEB 2JEQA 1WPCA 2WAGA 2CBVA 4HPGA 1Y0LB 1TZIB 2PXYB 1WWBX 5HJ3B 3MV01 3ZL4L 3X13B 4LLWA 1CGSH 5DUPL 3AROA 4OIAA 2NY2D 4Z7NF 1C7SA 5IK3B 3VD3A 3VIHA 5HBFA 4U4BA 2LQRA 3P0VL 3B8YA 5EO0B 1U8NB 4BH8A 2R4RL 4WO4B 4MAVA 1KENH 2Z35B 3NACL 5KANI 3MV8D 5MENA 2QMKA 4TUOB 3BP7B 3C60B 1E4KA 5HDQL 1TQBC 1A7RL 3S36H 3PHOB 4NN5C 3B5TA 3MA9H 5C0FA 2FBJH 5TE6L 1G7IA 1JHTB 1YYLL 1S7RA 4GINA 4MAYD 4OZIA 1G7HA 3Q3GB 5LWYL 3FQRB 3JWOL 4JKWA 4X5LA 3WLBB 3LZFL 2HTLC 2MKWA 1E4JA 4BUHA 4U1GB 2J7HA 4BQ4A 4AZ8A 1H0DA 1ZA3B 1MWOA 5B39G 2OK0L 4BQ5A 4QCIA 5KOMC 1HCVA 1NCNA 2UUDK 1IC7H 4X98B 3KPLA 4LGPB 3NMEA 4OQTH 2R2BA 2GFBB 1RK0A 4XZBA 1NGPH 1GOIA 3PIQA 3EDKA 3RP1A 3O0RL 3NA4A 4OSUH 5D7IF 2DYPA 4JZNB 3W9DA 2X4TA 4HCRA 1HNYA 1ZBCA 4AJ0A 4O51B 5EU4B 4NZUH 4QOKD 4O2FA 2EIBA 4V2CB 2FEDD 5BV7C 4HG4K 4GXUM 2AV1A 5BOPA 1FYTE 3C5ZD 2Q76B 4GW5A 3HTLX 4HXBL 3SHSA 3QRFM 1WCGA 4OZGB 4Z78B 3TIEB 2X1QA 3MJ9H 3HMXA 1RPQA 3AIUA 4XVUC 4PP2B 3TNMB 1P4IL 4WHYH 5KVFL 1KFAL 1BF2A 1GGBL 1CN4A 4B9ZA 4NCC1 4I3RL 4OM1L 5EIIA 5HPOA 2F1BA 2MQ3A 1K4CA 3EZJB 5JQ6L 1JNHB 4UQ3B 2F54E 4WTZA 2R8SL 2YA0A 5FHAH 1ADQL 4Y8DC 4G8IA 5JBEA 2AQ3A 4GKLA 3BO8B 4R7DA 4ZO6A 1MLBA 5C0NC 4X4ZA 3MRJB 4M48L 4EN3C 1AKJA 1N0XH 1WC7B 1NQ6A 2XY2A 4OV6F 3MLRL 5EIVA 5C09D 5GRJL 3SDDA 4LAQH 2PO6A 3SJVE 3AM8A 4OLEA 1BZ9A 4BSVA 4C57C 4MYWB 4R97B 1F02I 4J6RL 1BOGA 4JHZA 4Y5YA 1DN0B 2B5IB 1J1PH 1FSKC 4E41B 5J3HD 3RKPA 4X0VA 4K3EH 3TO4D 3EO0A 3DVIA 1JXKA 3W0WE 1AQHA 4YXHH 3O4LE 3MV9E 1AGEB 1GCFA 1CTNA 4ELME 4OF5A 3MR9B 5I17A 3FXYA 3ILPB 4Q7DA 4OFYD 1G7PA 4NNXB 4BH7A 35C8L 3TVMA 3FT4B 1QA9A 2RHEA 3RHWF 3PJSB 3T0AA 4PTVA 1VDGA 3TA3D 2A1WH 4JFYA 4RISH 4HGWA 1DL7H 5DVLA 2B20A 3V6BR 1I8KA 5JBDA 4MAYC 1YQ2A 1WCQA 2J88H 4KFZC 5CILL 4GW1B 3K8KA 1QBBA 5EU5A 5ESQA 2Y6SD 2XWJA 1YMMA 2FYVA 4DGYH 5CZXD 3PWVB 4KDTC 2P24B 2YUXA 1WCBB 2OZ4L 3QCVL 2FX7H 1ZVYA 4PUEA 1LK3H 1CXKA 3KVQA 3WIHA 5BVPL 5HHVL 5KSBA 3KPRB 3WQ6A 1FO0L 1WBZA 3OAUL 4U6YB 3ZKNC 3W25A 1BFNA 3NABH 5DMGC 5BXPA 3BXWA 1T7WA 1UA3A 5F6HJ 2K3TA 1H8SA 1CZ8H 1KNOA 3DROA 2DQIL 1XYFA 2PTVA 3EJJX 4L9LA 1BWMA 2VDNL 3VRJA 5ACZA 2XG5A 2N4IA 2YD1A 3OKKA 4P2OD 1ZS8A 1S8DA 4S1SH 1F6LL 4MA8L 1BAGA 1CFSA 2WSPA 4GBXA 2WNWA 4JHAL 5D1ZB 5KSUA 4I18C 4C7DA 3SDDB 5DO8A 3O6MH 3STZA 1OP3K 4BQ2A 3LRSB 4XNQA 4OD1H 4V1DD 4G9DB 5D7LE 2EEAA 1MCHA 4ONFL 1S7SA 5HDQH 4Z7UB 3MRMB 3U82B 4ONGL 1JPFB 2Y06H 4OB5L 4KI5F 2JCCE 4JFDD 5F89A 2X70A 3DX4A 1OB1A 3QULB 4DEPB 3BIKA 3BT2L 4MB4A 4V27A 4JFFA 1ZGLM 3PGFH 5DI8B 4KQ3L 4I0PD 3QEQD 1EFQA 1V08A 5GHWH 4NCC2 3AXLA 3FO2A 1D9KD 1YJDL 1RJZB 5ERWB 2VKWA 4Z7WE 1JNNH 3V7MA 3FKUS 4OLXL 4BFGA 1FNSL 1EO5A 5KBNC 3NIDF 4GW1A 1A2YB 2I5YL 2WNGA 4F80A 1RU9H 4LMQI 3IDJB 5KZCB 2FGWH 3G04B 5E8PA 2UUDH 3ULUE 2QQKL 5GGVH 1PEZA 3AREA 2ARJA 3QCUH 4N8VG 4X4MA 3C09C 4G9FB 2XXMB 4DWSD 1U93A 3ARFD 3FFCA 2ZCLH 1DVFD 4Z7VB 1US2A 2D7PA 4OFIA 4KRTA 4CKQA 3RDKA 2HA1A 5C3TA 3SDDC 2MNUA 3WEXA 3BKJH 3L9RB 3Q5OA 3W6MA 3IRZA 5BZDB 2NR6C 2WIMA 3IJHA 5HHOE 1Y0LA 1XGTA 2P7TA 3SDYH 4H8VA 1HNGA 4L8SA 4PEEA 4P2OA 1ZHNB 1LL7A 3AXXA 2CO7B 3V6OA 7TAAA 2BJML 5TPWH 4WO4C 5DVOA 1Z3GH 3HRZB 4CU8A 5HYIA 1QI0A 1MCPL 3N85H 2VLKE 1X5GA 4M3JA 5CAYB 1KCLA 1J1XL 2YA1A 4K3DL 5L2KD 2YN5A 5E1AB 5TDNB 1SYVA 3F7VA 3HAEG 5JOPE 4OLWL 2VN7A 4G7YL 1AJ7H 1E55A 2FB4L 4ORGB 1JGVL 5ADPH 3ZDYF 2LU4A 4CVUA 5D72H 4JVPA 3QYCA 4U1MA 2VDPH 3QFJD 3KL0A 2BOCA 2WHKA 3QEUA 1FL5A 2FL5A 2WQRA 3EO9L 3HMXH 1T20A 3TJHD 4K94H 1W91A 3C09B 1DQDH 4ZUUA 5CHNA 4U1NB 2VL5A 3G6DL 1QFWL 4Y2DC 1N4XL 2B39A 2FO4B 2HLFC 4F8QA 4U3HA 5I30L 4PR5A 4Q6YA 4QRSA 5JUEH 3UTQA 3NDZA 1MRDL 4U1SB 5BQ7B 2P8MA 1FHDA 1ZGLA 4FXKA 1FVCB 4XI5D 2BRRL 5GISH 1GUVA 3RM9A 3D9AL 3L2MA 4LPTA 1BIIB 3PV6B 2AJYL 1DSFL 5EA0L 3GDBA 2Z93B 1JAEA 4MJ6A 3D85B 5JPNA 2P1YA 4N68A 4XBGA 3BZFA 2DWEB 3TO4A 4GH7B 3ECBB 4XPTH 1E4LA 5HSFA 4JFFD 4JM2B 3CFCH 4AMXA 1X4YA 2DLGA 2DM2A 3MNZB 3P9WB 5ALCH 1V3HA 4D1JA 3L5HA 3SE9H 1MFDH 4U6VL 4WDIB 4UBDC 4DM1A 3MNWB 1VEOA 2HKFH 1S7VB 1NWRA 5H2BB 2WIIA 2HFTA 5JHDD 4LU5L 3KYOB 1E4KC 3HE6B 1VEPA 4GRWE 4EZMA 4EXKA 3CH9A 2YPVH 4YEEA 4WV1A 4PRBA 1B3XA 4JB9H 3NABL 5SWZE 4YFLF 2X7LA 4XP6H 4R4BB 2YZ8A 3ULVF 4F9JA 1R5WA 2R23B 3T8XA 4X6EB 5CD3A 4F79A 5J6HB 1UYQA 1BQLH 5MP6H 1QI4A 1NGXB 4KQ4H 2P5EE 1PSKH 1HL9A 4HJGA 1EGJA 2XZQL 5DQDL 4APQB 2O5XH 3FQXB 4FLOA 3BOVA 4TYUA 1IBGL 3FTGB 3KPRD 5BXFB 2UWEA 4XBPB 3EDEA 3IETA 4L8CA 5E9DB 5I19L 3PG2A 4GG6E 5DLML 5ILTH 1ADQH 4D8PB 2FR4B 4L3EA 2CKBL 2FH6A 5IV2B 4F37K 3GBNL 3SCMD 5EU3A 3FN9A 4HKBB 5HHNB 1S46A 3G6AA 3OR7B 1A9BB 1AGCB 3GSRA 4P49A 5IG7B 4R4FH 1C8XA 1CFNB 3RZCB 3V0VA 4NZJA 1W9XA 5KVDL 4Y1AA 2OI9C 4F7TA 4G42B 1Q0XH 1I1RA 4QXTA 4RRPA 4ZUVA 2ZIDA 4OZHA 3Q1SL 4E8DA 2Z8SA 2C8NA 2E7BA 3LQAH 5DRWA 3WFBH 4KI1A 5HYSG 3ECBA 2CIIA 3PXJA 4JN1L 5JMOC 5HD8D 4GQQA 1JNNL 3F7YB 3U6RB 1S7TA 5ENWA 5L7XL 1FVEB 1YC7A 1KACB 4Q58C 1EEYA 4YX2H 1UR1A 1K85A 5D7LA 3GSXA 4KC3B 5I18L 4OM1H 3PZVA 2Y9RT 3OX8A 2A3EA 4NJ9L 4KRMB 3RNQB 2Z1KA 2J62A 3K4ZA 5GGVL 3DHPA 2BCKB 2F54D 2AEIT 4MAYB 1OARL 2NY4D 1HQ4A 2G3NA 4V2XA 2DN7A 1DBBL 3GSNA 1SEBA 3KPNA 2ZOKB 4MJ2A 4ONHB 3VGBA 1IKFH 5HYJB 3WNMA 1G7LB 3GNMH 4H1LB 4HFUL 2W63A 1HKLH 5IJVA 1MFNA 3MA7A 2LV4A 5HD8C 2A6IB 4LMQE 4QXUL 1Q1JH 4KK8D 5DWUL 3RAJL 2EPNA 1DQTA 2JIXA 1UWQA 2GK2A 2YUWA 3U36B 3LD8C 2XIDA 1ECEA 3HNVH 4UT6H 4XGZA 3UTTB 1AXIB 2FX8L 5FL1A 4G9DA 4HLZH 4C58B 2A1WL 1P7QD 4OZHF 4RISL 5BYWA 2J47A 3RPIB 4AZCA 1QRKA 3V5HA 4AG4H 2UWFA 5JW5A 2IG2H 5K9JL 2PW1B 3NN8B 4GO6B 1P4LA 1NFIB 1YEDB 1F4XL 4M7KL 1D5ZA 5DSCA 2W60A 1CICA 2X2YA 3AZRA 3VCLB 3ZE0E 1VSCA 2FHBA 4Z76A 1XH3A 3V6OE 3BAXA 1Q94B 2OZ4H 3VILA 2EPMX 4NQCE 2GTWB 4AY0A 4K9EL 4Z7VA 1IAOA 1ZJAA 1KBGH 2Y7QB 4L3ED 2AJSL 2H2SC 2NXZD 1W1PA 1LDPH 5FHBL 1M03A 4W4OC 5GRVK 2VE6B 1KLGB 5I30H 3QG6B 1HQRB 4TOQA 5H37G 1OGBA 1CGXA 3OTTA 2BVDA 1V3KA 4R96A 1WZAA 1J0KA 3EJYC 3MRHA 5ESVA 2IPKA 1H3GA 3KPMA 4DKDC 1RP9A 1UWXK 4X6DF 2MQCA 3BAJA 3ABZA 4XWGL 5KW9L 3WEXB 4XVUD 3QH3A 3O6ML 4JFYB 1DBML 3QDMA 3TVMB 5K9OA 4L4JA 4HC1A 2BFVH 2GITA 3BP6A 3NCJL 1V6WA 3F5JA 3T09A 4F9DA 1UACL 3ZE2F 3N11A 1PX8A 4DWSB 3QIWD 3QQ3A 4UOW0 4BA8A 1QI3A 1ZS8B 4PRDA 3OGCA 2DQEH 2VL5B 4PTTA 5DDHB 5KSVA 5EU5B 4ZS6C 2EXWC 3WJJA 2GK0A 3ZDZE 2LTQB 5GHWL 1EHLH 4UOZA 1DUYA 2W9EL 2DYPB 2XZQH 3SGJC 1T2QH 5DHYA 1NCCL 1W9PA 3MJ7A 2IADA 5IW3A 5GSRA 1JPTL 4AENB 1RHHB 2HKHL 1C16A 4YZFF 3ILQD 3PTQA 3MLWH 4KJPC 1JZ5A 2CLZA 3AICA 4DKEH 2A77L 1Q6EA 1BM3L 1FNAA 5DGRA 4QCIB 1IGYB 1JGUL 4XVSL 3ZJ8A 1A21A 4PP2A 1VGEH 3U1SL 5GS0C 5IHRA 1C8QA 2DGAA 4XC1H 1RD6A 2HJLB 5DC0A 5DJ6A 3F12B 5F7HA 2D03L 3L5WB 4M7JL 1BGXL 3MRHB 5CZXC 2HISA 3C8HA 2WSKA 3B43A 3GSQB 4AQOA 2O5ZL 4QKXB 3D5OF 5FCZA 3BZDA 3GYCA 3FFCB 4OF8A 3KLKA 3DRQA 1I4FA 2V5RA 1UH4A 3OJMB 1E6SM 4X5XB 2Y25A 4CW1A 3L3JB 3F4VA 1U8KA 3T4YB 3QEHA 3G6JB 3G6MA 4X8JA 2QHAA 2FB4H 4M7LL 1MCJA 2DOCA 2ZUYA 4OD3H 4JFOB 4QRTB 5HHMD 2VDPL 1WO2A 2HVJA 2EECA 4PJIF 1KQZA 4R3SA 5EZJA 1LEKA 4GRWH 1WLHA 1YPZF 2YD7A 3WH9A 1DLFH 2ESVA 4HX1B 3HJEA 3AAZB 4OFPA 4DFHA 3IB4A 5E56A 3IK2A 1I1CA 1PKQA 4X6FA 1GOOA 4GUPB 4POYA 3ARVA 4UTFA 2KKQA 5DXWA 2WMGA 1GONA 4L3CA 2CITA 1MRDH 5HVFB 2FWOA 4W84A 4DK3A 4TSCL 3DYOA 3RUGB 4XAKD 3RL1A 4MXWH 1MRCL 4NRYB 4ZXBB 2IAMA 2J8HA 5TF0A 1HE7A 1UWEL 4KQ3H 4OZGE 1I8MB 2MCPH 2B4CL 5F70A 1BPLB 5JNYB 4LCCC 1T1YA 2QMJA 5TQ2L 5J1AB 4J8RA 2Q8XA 5C0AD 1OD0A 3A6CL 3DVGA 1VIWA 1NOWA 4P7RA 3KYKL 32C2B 4QHMA 2XICA 3DX8B 2OSWA 2I5YH 2OXGA 2DL9A 4P46D 1I7ZA 3SKOB 1HQ4B 4Y4HB 2NCMA 4NQCB 1QACA 2A83B 1EAPA 5ESAB 1TQVA 1V3MA 3ZT7A 2V3EA 3PWUB 3OQ3B 3QCUL 3B8SA 4RNRB 1OP9A 1MQKL 4Y16B 3A5VA 5I1CH 2AJSH 1UVQA 3IFPA 4TNVF 4AIZA 5LXGL 4J27A 4HIXH 4EKXA 1YEFL 1HINL 4NFCA 2G75A 3P11L 3SDXA 2E7LA 4D6HA 4ELMF 2A74A 3WO4B 5E95B 4KUZH 1RIHH 3O4OB 1ND0B 2A6DB 4P57B 4H8WL 4HQQH 2GVYA 5C6TH 2CIPA 1JGEA 4XPGL 2IPTL 3MJ8B 1S9WA 3DIFB 2Q1EA 1YEIH 4LASL 2IF7A 5D2LF 5AAMA 3U0TA 1ZT1B 2FIKB 3F7RA 5DYOB 1OM0A 1WUNT 5IVXF 1CWVA 3D4YA 3CUHA 5D5MF 4MNGE 1M7DB 3L3OA 2JELH 2W65B 4N8VB 3ULVE 2E27L 3CPLB 5DMKB 1U30A 3W53A 4LLDA 1P5VA 2HG5A 1U33A 3LIZH 3CSGA 5I16B 1LL4A 4PRIA 1T7YA 3JXAA 1NLDH 4GUPA 4LOUD 4Y19D 1XF2A 2W60B 4AZ5A 3O9NA 4URTB 3MGOB 4X5XA 3SCWA 3DUSB 4QT5B 3FRPA 2DL2A 3GSVA 2F5AH 1JYVA 1IILE 1IKFL 1T5WB 5ABHA 15C8H 4M3KB 1EIBA 2F8XC 5D1ZC 2AXFA 3TCLB 4AZCB 5KG9A 2WCGA 5F7DB 2J4WH 1CNVA 2GQHA 1I9EA 1Z6JT 4PJGE 4EE9A 3S88H 3ZKQD 2ZSVA 1IC1A 4WI9A 1FNEB 2X7LB 1U0QA 5E2UL 3V9FA 4PJDE 2X2HA 4TVDA 3BPOB 2YR3A 4NJ9H 4NQED 2X4OA 1I8IA 5HGDA 1LDSA 4ETYA 3EGSA 4K8RL 3NIGF 3WXVL 2W62A 5A3IC 2O9OA 4XPTL 2N1KA 1V02E 4KJWD 4HLJA 1T6VN 4Q9BA 4U0QB 3RUGE 2ZPKH 3U7YH 3G6LA 1RZGA 2FDBP 3CCHA 4JFTA 5J12C 3QI9C 1K6QL 3TCXA 4TOYL 2FR4A 2BHZA 1KJ2B 3A4WA 2AV7A 4WI3A 5T1DH 2EDNA 4QGYA 1IQWL 2G9HA 5J1AA 4PRID 5CSGA 3NIYA 3OR6A 5GRZA 3SCPA 5BXSA 4LLMA 2BSRA 4FQXC 3T0DA 4IM8A 1UB5A 3HNVL 4UT6L 5D70L 5EBGA 4FMVA 1JN6B 2VLME 3QPXL 3BRDA 1HP4A 5CJOL 5J9PA 4UUJA 2DF3A 4G6JL 3BUIA 4QDMA 2OSXA 2A3BA 1O7SA 3BP4A 4U6XB 5HYJA 3X3FH 5IBTH 2FL5B 1CICC 4PBVC 4JPIB 1PSKL 3VXUA 1HHIA 2V2XA 3MRGA 1R75A 5HI5C 2X9XA 1NL0H 5DUPH 1RUAL 2ZZUT 1U8PB 5BS0B 3VXRB 1M05B 3S5LG 2FX9H 3UTSE 3NZ8B 2ZOKA 3VWJC 2JEPA 3V8CA 4PJXE 3KPSD 2LABA 1FL6A 1AGBA 5FCUH 2NX5E 2CKBH 3BKYL 4Y4KD 4ZOCA 4Z0XA 3IKCB 3BP5A 1YEHH 3MJ7B 3UTTD 1OGAE 3EYUL 5BXRA 3DI2B 2C26A 5KVDH 5C3LD 4RQQB 1HZHH 2C3GA 4ZEPA 4J3UA 1ES0A 5E1HB 4FXGA 4MJ5A 4X9BA 4AYGA 1DVFC 1FFNA 1B3WA 3U57A 2X6MA 4PRAB 5HYJD 3U2SA 3HG2A 4PR5B 4UT9L 2PXYA 3RRQA 3U7WL 1VFUA 3O2DH 4P5TD 4LVOC 5FYJD 4YN5A 4LLUB 2VL4A 5E2WL 3ARDD 2XFRA 2EACA 1BEYH 1CG9A 3NCJH 1E6ZA 3PTMA 4OSUL 2AEQH 2FHFA 1FZMB 1TTUA 3MBED 1QBML 3OKLA 4PJ5B 1Q0YH 2BC4B 5GZOC 5IESH 1T2JA 1DBBH 1IAOB 1OQOA 4H1LA 3MGTB 1U8JB 3C6LC 1YMMD 3LRMA 1KGXA 4MD0A 1U36A 3P77A 1V3IA 2HH0L 5T5FH 3DTXB 2JIXB 3BP4B 5F9WC 1LO5B 5FKPB 2EO1A 1T5XB 3TFKD 1ETZA 4Z7OF 1VF8A 5DK3A 2BNRE 2ED7A 5CP3A 4KMTL 1TA3A 4ML4A 4WJ5B 4XNXL 2PWHA 2QQLL 3IDYC 3ZTJG 1B3ZA 2XPGB 3PZ9A 5BWFA 5C07D 1GGBH 4HKJA 3ZSTA 3VXME 1IM3B 4PTTB 1LEGB 4XVJL 5GNXA 5D7SL 1BFSA 2E3VA 2IGFH 2QQNL 3RIFK 4ZS6D 2VLLA 3MRKA 4RMQA 5IFPA 4LARH 5DQJA 3ZQ9A 3VIMA 2NY0C 3FZUC 1ODAA 5DRWB 2ZUQB 3QR3A 1WGOA 3ZL4H 1JNLL 5AYIA 2ICWJ 3NGBB 2LFGA 3E6HA 5EZIH 2J7DA 1SR0A 1XGYH 2CUIA 1EERB 5I71B 1T21A 4ISVB 1U8QB 1I3UA 3RI5F 3MRPA 3WEZA 5ACZB 1FORL 1F5WA 5F96L 3HNSH 2D3LA 2E7CA 2YRZA 3KS0J 1KJVA 1QO3A 4HIJB 4DWHA 5KSAA 4YDKL 3HZKB 5JMRA 1NWSA 5IV2A 3S3SA 1XGUA 1OB0A 4WEBL 3FB6A 3LS5L 4JGUA 4ENED 2BV9A 1A4JA 1MVUA 1VADB 5FUZH 1ZWIA 2VURA 1EX0A 1MRCH 1A5FH 3TZVA 3S3PA 1N6VA 4HKBA 5HHNA 5GS0L 2KQMA 1RK1A 5I1KL 5D2NE 1QWNA 5IB1A 4M82A 4NQVB 5IJVB 4P0DA 3AIBA 2GSJA 3VWKD 2ZG3A 5IR1A 1WAAA 4S10A 1JI1A 4JDVA 2CKBB 4RZCA 1GSMA 3I2CL 3OMZA 1OWWA 3U7AA 1CVRA 2QBWA 3RVUC 2X1WL 4PRIB 1MQRA 5L88L 5DI8A 3AB0B 5DEGA 1IQDA 5FCSH 4Z77A 3WIFA 1KB9J 4QF1B 1JVKA 1YUHB 2X09A 4AIUA 4M56A 2GFTA 3RPIA 3U79A 1FN4A 1CLZH 3EJZD 1LE9B 1CIUA 3V0AC 3MRQA 2CLVB 4QXGL 4UFLA 4HBCL 3HRPA 5FGCE 5I66A 1U92A 4U6TA 3FCTB 1T03H 4JG0H 5I1EL 4IRSB 3QRGL 1V3LA 4DN4H 2FLRT 4HWEH 2WMPA 4LEOA 3JV4A 3AC0A 2DQFB 2Q86A 1HK6A 3C8KB 3KPRE 3ZDYE 4JHAH 4JO4L 4NM8H 3S35H 1YY9D 1JPGA 3V6FA 1T1ZB 1V0MA 2JB5L 1KXTB 2V9TA 5E2TL 1T1WA 4NKOA 3QDGE 3QIBA 1RJLB 1V7ML 3BH4A 2DWDB 2ZOLA 3P30L 2XRAL 5BCAA 4OFDA 3O3AA 3OR6B 3BGMA 3A22A 4UZUA 1ZLWH 2YHGA 2AJVL 3ZKMC 3MMUA 5D93C 4UCFA 1BQHG 4Y5VC 2HWZL 5J1SC 1AD9A 2E9JA 4UV4H 2JALA 1WTGT 4PB9L 4PTWA 4MQXC 1ZXQA 2G3JA 5BMFL 3GHBH 3ARGB 4F7CA 1S7UB 5DJ0B 4RGNE 4LHQB 4XPFL 4AL8L 4YHMH 4PPTA 2VKXA 2J7EA 2BVYA 5A95A 2ADJA 5KVMC 3KWXA 3SURA 2EDEA 2NX5A 4LCCA 2IXUA 3CLFL 3VD7A 3KYMB 2OYMA 1NEUA 1WBXB 5E2VH 5IFAL 1QNSA 3AIVA 4C7FA 4PJCE 5D9PA 3OB0H 3D0LA 4XC3L 4GBXB 2ZJSH 4H04A 2AVGA 3TA3C 1LO3H 5C71A 5I8KL 1KBBA 3GJFH 2VWEE 4W5UA 1UXWB 3QI9B 1E72M 3BE1H 4QRPE 3GIVA 3GMMB 2CJUL 1NKRA 5E0QA 4C56B 3NFSL 4Q0XH 3HS0B 4FP8L 3O3BB 3ZKSD 1A3QA 5IVZB 2VLRB 3MCG1 2V5CA 3BIKB 3EFDH 5D8JH 2EZ0C 3PF2A 4MQTB 3I3EA 3RGVB 4R7DB 5E2UH 4L9LB 4U1HB 5EU6E 4OGXL 4K7PL 1HJQA 4LLAA 5E70A 1MCDA 12E8H 3A4AA 4XVJH 3PQYB 4YPGB 2WXDM 2YUZA 4Y2OA 3X3FL 3L3OB 1B3JA 3OLIA 1RUKL 1BWWA 1DEDA 3ME0A 4JFQA 3SDAB 4PJGF 2AXGB 1TFVA 1FHGA 3RZCD 1RH9A 4MA7L 3IDJA 3MCLL 2EH8L 4CCEA 5FIEA 5D72L 4GLRH 4EAMA 3FB5A 3BVNB 3QPQD 2XIIA 2APWA 1MAJA 3HI6L 4OCSH 4BQ6A 1NBYB 5MI0C 5T1DL 4O00A 2Y36L 1GOMA 4WFFD 1EVTC 3TYGL 2HJKB 5IKCA 1HOCB 2Y07H 3EJTA 4UQ3A 4TUJB 5A3ID 5L8KB 2J25A 4K07A 1S7XB 3ARDC 1OT2A 1NEZB 4IM4A 1T1XA 2IPUK 5IMLA 4PJGA 1U3HA 4L29A 2AERT 4K3GA 5DO2C 1ZHNA 1FFRA 3EYQC 2EDHA 4BYHA 3PWVA 1CK0L 3IXAB 5B4MD 1QW9A 4WU5A 1C5DA 3W9EA 1BOGB 5IHLB 1OTTD 1UQSA 3W11D 5EU7C 4FNTA 1A1NA 3BSZL 4PJDF 3KHOA 4I9WD 1WEJH 1U93B 2E27H 1D5XA 4GQRA 1PY4A 2P49B 1M7IA 5DUMH 1JHKL 5E09A 2DD8H 4O02H 3NYDA 2AEQL 5IMOA 4BH7B 1RULL 2PW2A 3LRLA 3R0NA 1BG4A 4X7FC 5TE4H 2A38A 4YXKH 3WUWG 5DS8B 4QXGH 4UMGA 1L0XA 5HJ3A 4GRLD 1NBVL 2XWJB 3RGVD 1W3JA 4HMCA 4DOHB 3MRFB 2CIKB 1EEZA 3VFUB 4QHLB 2I26N 5TH2B 4QTIL 5HOSA 4AMCA 3M1BA 1F97A 1UXWA 3QI9A 1FBIH 1WV7T 3PL6B 4JAMB 4U3AA 4LCWA 3JZ7A 1WFOA 5H35A 1G7IB 1XCTA 4X7DC 4AEHH 4CVXA 3DV4B 3FQRA 1G7PB 4NNXA 1KN2H 1RZJC 2YWZA 4RAVA 3UPRA 5EZOL 4D9LL 3S5YA 3QDAA 2C4XA 2VLRE 1KJVB 1QO3B 4HIJA 5D71H 3MOBL 3TBVA 4MXQD 4M1CD 2RCSH 3BH9B 1DE4B 4NBZB 4QLRA 5DFWH 4Z18A 3SUWA 4M6OL 4QCFA 5F7NC 5HDOA 4XX6A 1QEWB 3TWCL 1AXTH 4ODTL 4BZ2H 4ZUSB 2P5EB 1WE5A 4PTMA 2I25N 3AU1B 3O3DB 1XCQA 4TSAL 3VH8B 4KY1L 5D1XA 3RVXD 5DJAA 2EYRA 5BVJB 4PMDA 1I7ZB 4FZ8L 1QTYT 5CBEB 5D1QC 3B9KB 2R1XA 4NNYB 1HJXA 5F1IB 1TDQA 1CDYA 3JVGA 5BMFH 2DAVA 3ZSSA 4MVBD 3O81A 4UFHA 4HUXB 1U3YA 1FC1A 3VXSA 2YXFA 4HF5H 4Y2DD 3HAEH 4KK9C 4HU0A 4NZRL 4JZNA 4TSBL 4PJ7F 3MFGB 4OLZL 3ZE0F 2FJHA 1OB1B 3QNXA 3QULA 3QHMA 2YD4A 5F89B 1HYSC 5EDXA 2DTMH 3EJZC 1OOAA 1NGQH 3L7FB 4M43H 4J4PA 5L2JB 4XC3H 1KCUL 1UD6A 1AJ7L 3O4OC 3THDA 3MV8E 3GSOA 4K23L 3H42L 4UAOB 3CZGA 2VVNA 5BRZD 5GJSH 1FG9C 2GTZB 5DRNA 4EI5C 1PZUB 2Y23A 3STZB 2BC4A 5HHME 5GGUB 2P43B 5FECB 2PBOA 2PR4L 4J3SA 4NC0B 4Z8FH 4GAYA 3BGMB 5BJTB 1W0WB 2DJUA 5IB4B 5CEYA 4FP8H 3CZNA 3D39A 4HKXB 5ANME 2DWDA 2ZOLB 2I9TA 2AAAA 5F8RC 1QHOA 4MQSB 5E6IB 4FQ2L 2V17L 1AXSB 3ZE1F 1Q6FA 2EEDA 4HJ0D 3HPLB 1ZE3C 2EC8A 1KFWA 3HR5B 2EQDA 4K7PH 3LEVH 3VNYA 4PJCA 3UPRB 5F7EH 2EEBA 1FFNB 5K9OB 3AMLA 1B0GB 2GJ6E 1HTYA 3STLA 1RUKH 5BW7A 3HNTH 1R3IL 4JANA 4AG4L 1EUUA 3OR7A 4J23A 5DTFA 4TUFA 3S5LB 2JK5B 1OHQA 4XWOD 2V9RA 4JLRA 2YL9A 3IXTA 4I9WE 5C7XH 5DZOA 3EDJA 1AR1C 4N1CA 4NT6A 1MQQA 4HG4J 4HH9B 4YHOL 1PW3A 3SDCD 2E8ZA 3SKMB 5HPMB 1RK1B 3OZ9H 4Z2HA 3EOTH 5GS1C 4OZFH 5J6GA 3LN5B 3BAEL 5CMAB 2XVLA 2OTPA 2Y07L 5C9JB 3MA7B 3U9PL 1IM9B 1ZA6A 3DO3A 1KPVA 4WCYH 5EBAA 4KK5C 4KDWA 4HBCH 3HS0A 1EFXD 1DWAM 5KSAB 2CIIB 4OM0H 3ORJA 4CDHA 3BEWA 5E94A 5HGAA 5B8CB 2DQXA 3PWLB 5HDRA 5CEZH 4HWEL 2XN9B 1KF9B 3B9VA 5F71A 3O6FB 1VGKA 3V5DB 3X17A 1DCLA 3LPPA 4GI8A 2DQTH 3WFLA 1LEGA 3EAKA 3RU8L 4NQVA 1NAMH 3CU7A 1FRGH 5DJYB 5IDIA 3WQ4A 1DEEB 4YDIL 1J05A 3I9GH 1QLEL 3A67L 5D1QD 1JRHH 2OR9H 2TAAA 1H15B 2EXWD 1YPZE 1MCCA 3FQTB 5IFAH 3EOAB 1Z5LB 2YKLL 3RY6A 1CDGA 3QB7C 2ICEB 2DDXA 2ZOXA 2F7OA 2FECI 3BHBA 4XGZB 3GXDA 1MVFA 2UV3A 3DSNA 1FAKT 1HJVA 3ULUH 2XYLA 1HHKB 4KGLA 3CIQA 1P9MA 2AJVH 4WNQA 1KB9K 1Q38A 3QWQB 1HILB 4JO1H 4UV4L 4AIXA 2X0YA 4W70A 5HBBA 1I7RA 1A6UL 1INEL 4KAQL 1J12A 1EV2E 2P8MB 3EFDL 1ZWIB 3X13A 3MXWH 2P8LA 4W7WA 4XZUA 4NDMB 1WAAE 4TPRL 1DWHM 3OGOE 4OF6A 3TH3T 1BQUA 3VI4F 3H9HB 4H88H 4JZJB 5I1AA 1KELL 4XNYL 2NY0B 4PJ5D 1JBJA 1EHXA 4EVNB 1YQVL 1Q9LB 1T4KB 2Z31A 4RL3A 4WFEE 1SJEA 4X83A 5JHDE 1ES0B 5T1LD 3I75B 5DEGB 1F4HA 3CZSA 3R8BB 1PG7L 5I71C 4PJFB 2YWYA 1TR1A 2CJUH 2XN2A 3VIJA 5AYQA 3PXHA 3TTOA 2WVVA 1P1ZB 4PJAE 4L9DA 4ZSOB 1ZKAA 1CDBA 1E0VA 2XQBH 4GMTL 1GOFA 3VSVA 2IFFL 4XWOC 4KZDL 4JM2D 1CG9B 1BGGA 4CNIA 2VDKL 3FCTA 5C0AE 4J1UA 5DJYA 2CKRA 5IVXE 3ARRA 4M6NH 1I9IL 3FFDB 3VI4E 3QGVA 3AS0A 2DLFL 5JZ7D 1NC4D 4Y4KB 3NPSB 3BEVA 2X4RA 1D9KA 3AI0A 1CFVL 3P77B 1QQDB 1J7VR 4LX4A 3CK0L 5GJSL 1HH9B 2ITCA 2EYTB 3IS0X 5MHSD 3BH8A 1GZPB 4I18B 1UR8A 3RWDB 5ICZB 2J7CA 3HI6H 5F3HB 1FP8A 3ISWA 5B8CA 3RTQB 2WKLA 4JVWA 4UAOC 3D6GA 1E6OL 1NUFA 2R39A 4W4OA 3P4MB 5CJ8A 2NX5D 3SE3A 1HT6A 2R4SH 2BNQE 4ACZA 3MBEA 5FO7A 3ECQA 1D5MB 4OKVA 2KPNA 1NAKL 2XRAH 3QDGB 4GMSH 1G5AA 1G7MA 4O4YL 2GJXA 4X6CB 5E5MB 4L8DA 5LGHH 1NGYB 4P9HC 2DQUH 1XCXA 3CSPA 3L5XH 5HI4D 3UTOA 4YQXL 1ORQA 5LG1A 4PB9H 5MEOA 5GRUL 1CPUA 4M29A 1T0MA 1EHLL 4KROB 5F72S 1R3IH 1MFEL 4XWGH 5LJYH 5JOFA 2BS9A 5L2JA 4HWBA 1TVHB 2PWFA 1GOKA 2XM1A 4DUVA 2R15A 2F58H 3FL7A 2VC2L 2J5LC 1KCSL 2HKHH 2ZSWA 4FQ1H 3DXAD 5IHZA 3SUSA 3UG3A 5M94B 4PMUA 2R2EB 1J10A 3QUZA 5DJ2A 4IRJA 3I02A 1X5KA 5FYKL 2KZWA 5D9SB 1LO3L 3SCOA 1JGUH 1QOXA 4JDTL 5CQ1A 5DVKA 1PIFA 3SCRA 3QFJA 3SCUA 5ID1A 2Z8WC 1MCFA 1H3XA 4R9HA 4AIOA 4RMSA 4OZFG 5DT5A 2D20A 4FFWC 3G6JA 5C9KA 1CT8B 1P4BH 2OM5A 1ESWA 3WSQH 4M7JH 3TYFB 1CD1A 5KSBE 4K3JL 5D8JL 4MNLA 2EKSB 1XF1A 1I8MA 2DT2A 2WM0A 3SKJL 1P7QA 4HWZA 4XNMB 1KFAH 5LKNA 3MLTB 3SDCB 4YHKH 2X1XR 1YNTB 1Q6GA 3WE6B 3T8XB 1E0XA 4BK4A 2YMXL 4IIQC 3BLPX 3MX0A 1TE1A 3KDMA 2GUOA 2A77H 2DTML 1G9NL 2XACC 4Q9QL 4LSSH 5HXMA 1H3PH 2Q8BH 3DPBA 1BAFL 2E9IA 1WZMA 3DX8A 3ARQA 3IXTB 1KJ3H 4UFKA 3LH2H 1E70M 1OIMA 4LLYB 1MIMH 2CRYA 5J13B 3VWKA 4FFWD 3U30C 2XXCB 1GQKA 1JF6A 1H5BC 4UIMB 2O9RA 1N3NA 1JFHA 5SWQA 5DD1H 1G0XA 5F93C 4FZ8H 3WD5H 2CCRA 3MTRA 2RGSA 1HHHB 3PTKA 3EZ8A 4QXWA 4WWKC 3P4NB 1FL3A 2WHMA 2PW2B 3JVGC 3ZE2E 5E6ID 1OP5K 5HHXL 2DM3A 2NTFA 3P4OB 2DQDH 3S97C 2V5TA 4WHDA 1KXVC 3N0PB 5BOZG 4Q2ZB 4OUUA 1C08B 3HUJE 4PBXA 3D25B 1KELH 1H8NA 3OJVC 4YIQB 1JYXA 2F1AA 3FOMB 3KWWB 1RMFL 1EEZB 3TT1H 3THMH 1NCUA 4OUEA 2W0KA 4CADA 4E2OA 4Y4HA 4X80H 3IF1B 3U83A 1BOYA 4YHIA 2OSLA 2IQAB 3QR2A 3F8UB 4XBEL 2PWDA 5AYUL 1BLIA 1TENA 3GRWA 5C7XL 3QZWB 2JCCA 1NOUA 4F58H 5FYJH 4YHLL 1JIBA 4S2SA 4WW1B 1R34A 1KN4L 1R3JA 2PO6C 4NKIH 5DJDB 3EDFA 4GOSA 4S1RL 1D5IL 5DUBA 2VXVH 1HHKA 2D31B 5E99H 3G08A 3FOLA 4F33A 3U9PH 3QUZD 1UH2A 1YYLH 4OGYH 2OJZH 4LRNH 1NWTA 3TIEA 2R1XB 3RX8A 5IVXA 1MJ7H 3AXHA 1RUMH 4YEFA 5D7JD 5D7IB 2Y72A 3SUTA 4JCMA 2GJ6D 3JWDL 3HG1B 3B6SA 1FBIL 3RU8H 3QEQA 4MA3A 1BG9A 4MAZA 3MLYH 2ZICA 4WI5A 1PX4A 2EDDA 4NHUA 1RZGB 1XF2B 1J0HA 3H2WA 3Q5TA 3EOTL 1NARA 2A0LC 4CVWA 4P5TA 4LGXA 3CHDA 1W32A 4X6CE 4GXUN 5DJ6B 3KEHA 2DSZA 2YL5A 4LCYA 3BUTA 3PE9A 2IH3A 2HVJB 3B9DA 3K2UH 3W5MA 5EZJB 3GKWL 1WBYB 5DA4A 3UDWA 1UKTA 1OM3H 2BXYA 5AY7A 5FA4B 4H8HA 3DHJA 4KAQH 4TVPH 5MI0B 1EDTA 3SEPA 4MLSA 5EU6B 5FKYA 1NC4A 4S1DD 1QKZL 2ED9A 3MS8A 3TZVD 1IFHH 2AK1H 4HOXA 2G2RA 2VR9A 4G6MH 3WDJA 1GHFH 5L8LB 1BBJB 1CFBA 5EOTA 2R8SH 3VIIA 2YD3A 1LP9F 5IQ9B 4M61B 1ODZA 4R3SB 3QOKA 3JV0A 3ZDXE 3H55A 1EEUA 3CFIC 1BLNB 4XCFH 4OFKA 2DKUA 3KPMB 3AAZA 5IQ7H 3AMDA 2HH0H 2VDOL 4Z8FL 3KJ6H 4FNRA 4PJHE 4HJJL 3BP6B 3G6JE 1WITA 4PY7B 1C8PA 4S3KA 4PB0L 2F54A 4K3EL 2AK4E 2H26A 2HT3D 3BD4A 4QNPE 1CLOL 3UTSD 3VIPA 4R27A 4XNXH 1O5DT 1FJ1A 5C0JA 3MRLB 5F7EL 2XG4A 2YBRB 1HNFA 3VFTB 1CXEA 2EDBA 1R3HB 4XX1G 3N85L 4XNYH 2YMXH 4RGMB 4K8RH 3CTTA 1TVBB 3VFVB 4RAHA 2EDOA 3ARXA 4NC2B 4A6YB 1DUYB 3AOFA 2B4CC 2VRAA 4PGDA 5I1JL 3ZDXF 3WSUA 5TH2A 5M5DA 3BCFA 3N1PC 3NIDE 4AY1A 4E0RA 5I66B 2EPKX 4H26B 2Q20A 1JI2A 3IFNL 3KPSE 4RA0C 3EJQA 4KKCC 3GH7A 2FX7L 4N8CL 2XFFA 1T22A 2H41A 1OCWL 3EBAA 5D1XC 4DQOH 5F1SA 2Y5TB 4ZODA 1MREH 3TJEH 1ZANH 1ZL1A 3MV7B 1YEKH 2DIAA 3FTGA 1YZZA 5F7KC 4QRRA 5JIHA 1LHZA 2LU3A 3CMOH 5J11B 2JJTC 1CIDA 3DGCR 5JLZB 1TJGH 1A5FL 2YLLA 2Y1VA 5DEFB 3U0TB 4YZFE 2C9AA 1J1OH 1FYHB 1HI6A 1ACZA 2DICA 2AJXL 1J8HD 3S34L 4NYLA 1K8DA 1MPAL 4RDQF 4QRQA 4Z7WB 4AD5A 3DNKA 2ORBL 4D3CH 5J89A 4X0NA 3HZYA 4YDIH 5FKAA 4HP5A 3E8UL 1HHJA 4HH8A 5JHLL 1MCIA 2YS4A 1OGTB 4MA1B 5KSBF 5BV7L 4F8XA 2GSIB 2I60L 2VITA 1E6OH 1Q9OB 3T08A 3PWPD 3VFSB 5CBAA 1GJIA 3G6JF 5M3WA 4FABL 2GSGA 3AHZA 3F7YA 3U6RA 2W9LA 2YSSA 1RUQL 1Q9KB 3RWJB 3RWGA 4S1QH 2NSXA 1LO0L 3B9EA 4G8EA 4JPVH 4U6HA 1T80A 2I27N 4PJ7E 1TJIL 1DANT 5D6CA 3E0GA 3KE0A 1N82A 3OHXA 5EIQA 1TA3B 2DKSA 4MB1A 3O41A 1XH1A 1VACA 2BERA 5IB3A 3S2CA 4Z95L 1TVDA 4LSPL 3N12A 2EICA 5I1AB 5DD0L 2VZ1A 4PRHB 4P3DB 2E4TA 2XN0A 4JDVB 4ZXBA 3IF1A 4J2XA 1LWRA 4N1EA 5LYRA 4MCZB 4ZE5A 1O7AA 4UTBL 4CADB 1CE6A 3HZKA 3O8XA 1NFDA 1GQIA 5ELIA 4M81A 5ILTL 2DT1A 2A6IA 4D94A 5DMJB 1UD3A 1HSAA 5CXPA 4MTVA 1QRNA 5LQBL 5MEOB 3GBNH 2CDEA 4TVSa 4D9RD 3FZUD 4WDIA 4F15C 2WVVB 3HB3C 2VZSA 3JUZA 2HFGH 4V28A 4HAFA 5TDPA 2DRUA 4TVCA 5T5FL 4QFUA 3WN5A 3L3DB 3KYAA 2GJXB 3BD3A 4JGMA 4U05A 4RE4A 3B3IB 1KLUA 2OWXA 5ETUB 4WFGD 5IR1B 1MEXL 2Q8AH 2YRLA 3UEQA 3P4MA 2BJMH 4YHYB 2BNRA 1FH8A 4MQ7B 4BUGA 5JTWA 4G7VH 1P9MC 4M1DH 5L7XH 3RBGA 2NQCA 1RZFL 4MNQB 1UQZA 3V5KB 3AFLA 2Q7NA 3S98A 4AZHA 1YUHA 4WVRA 4Q6IB 3UBXG 3CLWA 4HEME 2DM7A 2CDFB 2QQNH 4JCLA 1XMWA 5E4IA 4JM4L 3V7AE 5FGSA 3MRQB 3VDHA 5A40E 4GRMA 3HFML 4JM2A 3TNNA 5EO9B 2ICWA 5EN2B 3LXBA 5EZIL 4OCRL 3BE1L 1JE6A 3ARBB 3MRNB 1ZLSH 1ORSB 4JRYD 2QSQA 4U0RC 4P8XA 2WP3T 2ZX9A 1XF4B 4HFUH 5EUOA 4JPWL 4EVNA 2X4PA 4WI7A 4ZPTA 4L8DB 2R4SL 3MLVH 2VLLB 4R4BA 5KS9F 3SJVD 4XNZB 1QSFE 2XOTA 4KKAC 1AR1D 5BO1H 1VA9A 3VXNB 3DX0A 3WELA 4LLVA 4YHEA 1FH5H 3DI3B 4WSJA 4PRNA 4OF3A 1Q6DA 2NX5B 4LCCB 3TP4A 3IJ8A 2O9TA 5ENWB 4DN4L 1ITCA 5FF6A 4AD4A 2O92A 3BGAA 4FNLL 2X5PA 1S7WA 3L5IA 1LO5A 5SX5K 2X1IA 4GRLC 3K8LA 4FQQA 4GO9A 5E08L 3EYSH 4XVTH 4H2CA 5C0AB 3H9HA 1E71M 1INDL 3ZKXC 4YHLH 2QR0B 1A7QL 2VXUL 4TULL 3VXOB 2DSVA 3BZEB 1UD4A 4NPYA 4I77L 3GNRA 3A4XA 1MHPH 1NKOA 4LK4A 4DQOL 5CD5D 1L9MA 3BYTA 3BIBX 4ZXBD 4M9OA 4HWUA 4YC2B 1DBKH 1GGIL 1LDPL 2AJUL 2OLDA 4G5ZL 4YHNB 1OWRM 4GKSB 5AUMA 2DI8A 3SCMC 5DQJB 4QOKE 1AI1H 2XN1A 4XP6L 1B90A 4WW2B 1UR4A 3QUKA 3GGWB 1YPZA 5E2JA 1A6ZB 5DHXB 3DVFA 4JY6A 3CCHB 3QUMB 5JBFA 1MJ8H 3UYPA 1E56A 4DKFH 4N0YH 4Q22A 1EVUA 3WH7A 4EJ1C 1R24B 4AD0A 4QHUA 4ISVA 3WS6C 5T3ZL 4R90L 2LE9A 3ESVF 1JDDA 1N64H 4RMRA 2Z4QB 1W9DM 1W2PA 4OF7A 3BC9A 1IFHL 1WBZB 1QNPA 4FXKB 2QSTA 5DR5L 4HCRH 1K5NA 3L4YA 3MRKB 3WIHL 5ITBH 3BEVB 4AMKL 5KVGL 2Q7YA 2XHYA 1T6WA 4U1LA 1A9EB 1X6LA 4R97C 2BY1A 5D9NA 1IRAY 1MCWM 1ZT7B 3RJDA 2DJSA 1BIHA 1T20B 5EUKA 1KCRH 1T89C 5HYJE 3X12B 4I3GA 4FRWA 4XNUL 1INQB 5HY9A 1KYOJ 2PB1A 2VDOH 3WF2A 1IQDB 2EYTA 5ADOH 1L7TH 5IFHH 1TTFA 1EO8H 3GSOB 4PB0H 4PJBF 3C60C 5EG6C 1ZTXH 2NMSA 3UTQB 4RBPH 4KVNL 4GXVL 4U2YA 4BZ1H 1U3HC 3PGCA 3GBML 4IIQB 4OFYA 5HDBE 4H7VA 4ZOAA 5EZOH 4D9LH 5DVMA 4ODSH 3D39B 1NDGA 5C0IB 5M03A 3NVQA 1HHJB 3C8DA 3HUJB 3CFDA 3MV7A 3ARZA 3KNBA 3MRBB 3O6KH 1PX3A 4GBXC 2O26U 1FNGB 4XVSH 3VXNA 4MX7B 1AO7E 1NMBL 1F42A 1KJ2H 1U95B 1KIPB 3GXFA 4Y5XB 4PRAA 4MDJA 4Y5XC 2UWEB 5E8EB 1MFVA 5IXEA 1DVFA 1YN6B 2WCSA 2AQ1A 5FA3B 3N1GC 3GJEA 5I76B 5FF6B 3RWIA 5IJKC 1O0VA 1NGWA 4S1RH 5FM5O 5T3XH 3RY4A 1J8HE 3ZYIA 5DD3L 4OGYL 5EZLA 2WMHA 4YFEA 5CSZB 1XCTB 1T89A 3U4AA 1QLFA 2APVA 4JFXA 4X4XB 2W0LA 1OAYH 4QNPF 4M61A 4OD3L 3SDXB 5EBWA 3MMWA 2D4FA 5FO9B 5EOTB 1WC7A 1QEWA 3OHXB 4JKKA 3BLBA 2CDEB 3KPPA 1OGAD 1EDGA 3DHMA 4FG6C 3BH9A 1TZGL 3B83A 4KK6D 1IAMA 4NQEB 3WF0A 1R3HA 4OLYH 4CJ0A 5E8PB 1JHKH 3V4PL 3REVB 5TDNA 3WN5B 3IAGC 3CFBA 1AR2A 1I1YA 1F3RB 5FHBH 1FA2A 3GIZL 5ACMA 5CBEA 4OZ4B 3DV4A 5HHQB 3BVUA 3MA9L 1S3KL 3AS1A 3ULUD 4X7TB 1TJGL 4PY7A 1K4DB 5A6LA 3GKWH 1TJIH 2AK4A 3HAEA 4HSQA 2BNRB 3HC3L 3MBEC 3TBWB 3RWEB 2VLJE 4RA3A 3ROLA 3JV6A 3O11B 4Z95H 3SPVB 2P7TB 3BJ91 3VFVA 3HE7C 5B39A 4MNMA 2DT0A 4TTGA 2D7TH 1CE1H 4XVTL 1AHWB 4G6ML 1T1XB 4F7PA 5CEXB 3RGVA 1RJYA 5IMKA 1FNHA 4YHOH 1AFVH 1IAKB 3MUZ1 1EGJL 1A6AA 3VW3L 3RKDD 1L6ZA 3IDIB 4WFHD 5ITFA 4Q6IC 4DM2A 4ZQKA 1RY7B 4YXKL 4WCYL 3W0WD 1JV5B 2VTFA 1UB6A 4MA1C 1CECA 2ARJQ 3BX7C 4KY1H 3TPUB 2CETA 1CXHA 3LRKA 4WUUE 1H49A 3MNZA 3RNKB 4HMEA 4H8WH 4HQQL 4L8BB 5F9JB 3QXAA 4GS7C 4LPYA 4XCNB 1C1EH 4OLUH 4XPGH 1I85A 2XWBA 1OW0A 2HMIC 2UY3A 1LJYA 4ZUWA 4M1DL 3MOAH 4ORZC 1NCCH 1I4FB 2Z8VC 3NCBB 4QRQB 4Z7WA 5F9DC 1RZJL 1PZ5B 3RWGB 2YRPA 2DPEA 2VZVA 3I84A 5DR5H 5D71L 4WU5B 1B0WA 3W9EB 1W72L 5B3NA 3H9SD 3ZYZA 1HIML 1CLYL 4JQVA 3SKOA 2ZP0T 3W6LA 4OT1L 3U1SH 3W2DH 4AEEA 5IB4A 3C9NB 3QH3B 1ZLSL 3HG1A 2J12B 4XC1L 3GB7B 3O9WB 3UC0H 3ZJKA 3KGRA 3VXPB 1OF2A 1BFVH 4GIAA 3JWDC 1MWAH 1T1WB 2HJKA 4NKOB 1RHFA 3AY4A 4CN6A 3RUGA 3AXLB 3FO2B 1ITBB 5EC2A 5JW4N 4G7VL 1ZTXL 4IOFD 4HF5L 3SO3C 5FXCH 2H6PB 2GITB 3MRIA 1JUFA 4RGMC 3O4LD 3HC0A 4EI6B 4K68A 4MNGB 1LD9A 5IMKB 2Z92A 3SDAC 1NGQL 1H0DB 2C4FU 3LDBC 2AJXH 2Y2WA 2DT3A 2DQGH 4H5SB 1ZT1A 4Y4FB 5IBUG 1GAFH 5SWZD 1WQVT 2RQ8A 3OAZH 2AJ3A 1X5ZA 2C5DC 1GQLA 1NBZB 4WUKL 4MZ2A 5H35B 1UM4H 4U1GC 3WEMA 1W1VA 2QL1A 4TOYH 3VKKA 5KOVC 4JN2B 4QHKJ 2F61A 2V7HB 4O51A 2WB5A 4AZBA 5EU4A 3QXAB 4XCNA 3MREA 3H9ZA 2EDKA 2X4TB 3IFLH 1K2DB 1WFUA 1L4IA 4OZOA 5DS8A 2BNJA 4O2CA 2IJ0C 3BQUA 4PJDB 5CJOH 1FH5L 1ED3A 3OIHA 1OD8A 1PZ3A 4RWYH 1OVZA 4QHKI 3UCQA 2K9UA 2J8UA 5TDOB 5B38B 3L1OL 4H1LG 1BYDA 4MB5A 1BVLA 2YBTA 4S11A 1FP9A 5FDYA 3M1BB 3UETA 2XSBA 3U9UA 3QA3A 1QNZH 3RIFF 3ZKMD 4DZ8B 3C9NA 1OGAB 2ZUUA 3D3VB 3MANA 4GZJA 3NH7H 2XKNB 4WWID 4M8VA 1RP8A 5I2UA 3OKNB 4LNVA 3UTTA 1A6VH 5AYBA 1FO0A 3QEHB 4AMKH 5HHOD 1BJ8A 3GSUB 4GKNA 1UOKA 5AC4A 1MJJA 3L6FB 3T3ME 4XNMA 4AQ1B 4HIXL 1YEHL 4NO2A 5E8DH 1YMME 4NZUL 1OTUC 2L7JA 2ZUVA 3U4EB 3WH8A 2WW8A 2X4SB 2MPAL 2UY5A 4RIRA 3NN8A 1FP5A 4U7MA 5HI3D 1GCYA 1LEKB 4YNYB 5DT1L 5C2BL 5GSVA 4I0PA 4GBXD 5C0BB 4N0YL 3GNOA 1YEGH 3MJ9L 5JO5B 5CEZL 1PLGL 3NAAH 4LHUB 3N9GH 3WL9A 1ZVSA 2IPTH 4NN7C 1SBSH 3O8XC 4R90H 1P4IH 5D2NC 5KVFH 1RFDH 3NOIA 4NWTH 2CSPA 2AGJH 4LVOB 2YKKA 3KG5A 2IQ9L 4I3RH 5E03A 1I1AC 3U36A 3L3JA 4OZHE 4MNQE 2VE6A 4HIHA 3GUTB 5J11C 5GZNC 5JW4Q 5AZ2L 3S5ZA 4JDZB 1F8TH 3RWDA 2ADGB 1M53A 1MW2A 4E42A 2H2PC 3DURA 3RL1B 4FFZL 4ZFZB 3EHBC 3LXAA 1A4KA 3HFMH 3KXFE 1Q0YL 3REVA 3Q0HA 4P9ML 1A1MB 1PG7H 4YGVB 3EO1B 1FGVL 4FQQB 4IMKC 4IPNB 3NIFF 4PGJA 3VFOB 3UO1L 1ODUA 1QVOB 3CX5K 1HXYB 2DMKA 1KPUA 1Z9LA 5IB1B 2WHLA 1YEJL 3B9KD 2DDQL 2DI9A 5CEZD 1Z2KA 1QHZA 3GI9L 4CD5A 3MXVL 1VERA 4KMTH 43C9A 3AUVA 1Z3GL 1EK3A 1G6RB 2EIDA 3OGCB 4QRRD 5DD3H 2NLJB 1TZHA 5A6BA 2NY7L 4Y8AA 3FT2A 1E1FA 1GQJA 1CBVL 2XVGA 4GAFB 3NCCB 1DBJL 2WMKA 1V6UA 4PGBB 1SM3L 4X6DE 3RWCA 1GZPA 1FV1A 4I18A 3RDTB 3FB8B 2CHOA 3CHEA 4HW6A 5EWIL 3OWEA 2FD6L 3EFFB 1S5HB 3PIQB 3LKOB 3C5JA 1AGCA 1DJSA 1G9NC 1U8IB 1XHGA 2H32B 4Z2LA 4JZOB 4P99A 1FOBA 4L4PA 4Y4HD 3OLEA 4UOJA 3WD5L 5ICYA 1W9VA 4RX4D 2I24N 2CDFA 1JNJA 1MWAL 2YC1A 3EJRA 2G8ZA 4PJEE 3S37H 2ID5A 3G5YA 3LAFA 3IU3B 1FGNL 1NAMA 4NJAL 5HGBB 4HXAH 4NRRA 3M7SA 4PYGA 1ORSA 5CKAA 1H0GA 5E7BA 3CXDL 2VERN 1CFVH 1Q72H 5CSYA 3H54A 4P7OA 3TT1L 1NMAH 1GAFL 3SDDD 1BD2E 4MA8H 1GPFA 1H0IA 4XT1C 4BFEA 4CUCA 4FQJH 4HS6B 2XWEA 2DH3A 3VD4A 3GMOA 1Z5LA 4KROD 2EXYC 4PJIB 3KL3A 1W8NA 2Z9TA 4PSPA 5L88H 4NSBA 1FZMA 1KCSH 3HKFA 4FQ1L 4LLYA 4QWWC 1GGTA 2HKFL 3O8XD 5D9MA 5FCUL 3OXSA 1B3YA 5C0IA 4M5ZL 2YPKA 4QCEA 5L6YH 4Y4KA 4S1DC 1D5IH 4PJFF 1ZOXA 4W6XB 4UZSA 2BVOB 4UT7H 4XPBL 5D2LB 2W92A 4UDTB 1G6RA 2BMKB 4JB9L 1KCRL 3WE6A 6CGTA 4YFLI 3HB3D 4HWBL 4ZTOL 5L2KE 1UA7A 3ARDA 2OS7A 5L8JB 1UQYA 1WJ3A 3JBG7 5LBSH 1JZ7A 3HC3H 4KRPD 1J01A 3WSQL 1ZHKB 4P5KB 5E0FA 1JF1B 3OKOB 2L7UA 1T04B 4ODBD 4JM2F 2O5XL 2D1ZA 4X6DA 3Q6GH 3RHWK 3I3BA 2OSYA 3OKYA 4GI9A 2X4RB 1JTPA 1RZJH 1HXMB 1KIRA 1WWCA 4XNZC 5C0FB 4AD1A 1QFPA 2M1KA 2XYCA 1IKNA 3VFWB 5A3HA 4HUWA 1MCLA 5INDB 4AM0A 1IC5H 1VFAA 7A3HA 5DTFB 3FT3B 1Y6KR 1BTCA 1BMGA 3WS3B 3T3MF 3IFOA 3EUUA 2AV7B 4HPYL 3STLB 1ZSDB 2R56L 2RB8A 1EHAA 2V2XB 1TVHA 2VDMH 5CHNB 3IDXL 4YDJB 1ACYL 3UMTA 1FVDA 3BAYA 2OMNA 4JRWA 4LLWB 1E4WH 5F88B 1YEGL 1B2WL 5KS9A 4YHZL 3FQWA 4RRPG 2G60H 2X41A 5SWZA 3FFDA 3S96A 1XIWB 3PZUA 2NPLX 5HYSA 3BN3B 4EEEA 4ZS7L 3L4UA 3SKUD 5J6GB 2OL3L 1MCPH 4RWHA 2Z31C 4UILH 3WY4A 3L4VA 3H9YA 1CCZA 5EUOE 1GGCL 4OIIL 5E2VL 3VXSD 1D5BB 2YC1B 1YHTA 1H3PL 5TGBA 1CLYH 4PY8J 3O2WH 1OGAA 2HT3C 3LH2L 3LKNA 4XAKE 3WENA 2O9PA 2WQ8A 4RGOH 1GZJA 4EI5B 3OGSA 1AGFA 1RZKC 1DEEA 2WIIB 3DHUA 2E9BA 2ZXQA 3UPAA 1KGWA 4B3LA 1BVLB 4O5LH 5DD1L 3KJ6L 1TPXB 5DJ8B 4ZDHB 3WNNA 2X70B 4ZD3L