5CLWA

Crystal structure of human glycogen branching enzyme (gbe1) in complex with maltoheptaose
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
658
structure length
637
Chain Sequence
VDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNREKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human glycogen branching enzyme (GBE1) in complex with maltoheptaose
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 1,4-alpha-glucan-branching enzyme
total genus 213
structure length 637
sequence length 658
chains with identical sequence B, C
ec nomenclature ec 2.4.1.18: 1,4-alpha-glucan branching enzyme.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5clwA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5clwA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5clwA01
4DUWA 3AIEA 3WY2A 2J7FA 4GFTB 4HJJL 3AAZA 3MV8B 2X4QB 1XD1A 1ZANL 2EDQA 4YGVA 1T03L 4UTFA 1QVOB 5JO5B 1K8DB 5H37G 3EYFB 4I5BB 1F11B 1MAKA 1AJ7H 4LHUA 4OGXH 4M6OL 2HYMA 5IROA 1QNQA 4FG6D 1MJ8L 4ZXOA 5C0GA 2EIZB 1U3YA 1YJDL 4D1JA 2A3CA 1JYWA 3HC4L 4PRIA 5F1NA 5DFAA 3QULB 5EBMA 1FH5H 3RWEB 1MREL 5MEQA 4YGAB 4EEEA 4B41A 4UQBA 1RUAH 4MVBD 2AK4B 4QRTB 3DO3A 1P2CB 4XAWL 2Q8AL 3DC0A 4D0DA 1MLCA 4N9OB 3GBEA 1NUFA 4U6YB 3NCBB 1G7PA 4M1CC 2VITA 2W61A 4AZBA 4L1HA 1BFSA 4PGDB 4WO4D 5D7JA 4GBXD 1D9KB 4XAWH 1HVQA 1OGGA 2XV6B 4K94L 4K8RD 3VNYA 4U1HA 2HRPL 2UZXB 4UUJA 4PRPA 1KJ2B 2ATPB 4ELMB 2Z4QA 1A1MA 4LCWA 2HH0L 5D7IA 1XGPA 3RA7H 2VISA 3S5LB 3FAXA 1B3ZA 5FF6B 1AD9B 4WW2F 3EYUH 5I3DA 1YEFL 4HQQH 1FVEB 3GYCA 2F7QA 1BIIB 2Z1KA 3IDIB 2R4RL 4PJFF 5EG6C 4CU7A 3RHWF 5A16A 4UB0L 3GSOA 3RY5A 1NFKA 1BPLB 2YZ1A 3JWDC 2E8ZA 2ZX6A 2ZX5A 3ARZA 4HZLA 1JFHA 1R3KA 4TSAL 4GI8A 5GJSH 4YHZH 4NNXB 2DKUA 3PZVA 4Y16C 1OD7A 3GUTB 4W8BA 2W0FB 1PX4A 1MJ7L 4RGNE 4C58B 5JNYB 1CFSB 1H0DB 2H2PC 1CZ8L 2XJ7A 1LE9A 5JIKA 3RVVD 2CKBA 2JALA 4LCUA 1OD0A 1F6AA 1LE9B 5I8OL 43CAA 4CMMA 4NZRH 4RGMB 4NQCD 1RVFH 3L7FA 1RMFL 5I1DB 3L1OL 5CJBA 5KVGH 4OZHB 1RHFA 1FAIH 3QH3A 3QIUD 3PZOA 3KE0A 1D5BA 4K7PX 3OZ9H 3T0WA 5JDJA 1NLBL 4AD3A 5GISL 2XGIA 1F3JB 3L6FA 5IJKC 2IBBA 2CRYA 2HLFC 3MLYH 4XCEA 1YY9C 2BRRL 1C12A 3CLEL 4EI5C 5JMOC 5LXGH 1K3ZA 1E6PA 2G2RB 3LIZL 4Z76B 4PSPA 3DGGB 2YKLH 2BSTA 5HYQA 4CN6A 4XVUC 2J3SA 4PTXA 3CZEA 2LVEA 1I3VA 2MSPA 1A02N 5I16B 3FQTA 5B39A 2ATPA 2E6PA 3GIVA 3TT3H 4PTTB 2OI9B 2E9WA 4XB3A 3CTTA 4CVZA 3MUGB 5DA0B 4J3TA 3BZDA 3DBXB 3P0VL 4TXEA 3G04A 3OR6B 4K3DH 3CVHB 4OV6F 3FOLB 1MCWW 3RJXA 2X0HA 4JHBA 2HKHH 3VCLB 3V8CA 4PMYA 2A1WL 2ITDB 3QDGA 5ID1A 2RGSA 3NH7H 3ROOA 5HYSA 4LLDB 1KPVB 1SJEB 4QEGA 3KPSE 1A3HA 3EYOA 3V6ZA 1NUGA 1UQYA 3CFBA 4WWKB 1K4DB 1AY1L 3MNVB 5M3WA 5D71H 2H32B 3QEGH 1JNLL 3P9WB 2VIRB 4PJDA 3WENA 4PY8J 5JW4R 1IKFL 4POZD 4XMPH 5GNXA 3D85A 2X1IA 4Y5VB 3MRPA 4LSSH 5CIPB 3BRFA 2MFNA 4UQ2B 4FXGA 3RWIA 1NGWB 4LHUB 3SGKC 2A83A 4KVNL 3H3BC 5A6BA 1XSIA 4XV0A 1L8NA 5HHMB 4LEXH 5CBEA 4HWBL 1CF8H 2VWEC 4M02A 5JIWA 3MGOA 2VR4A 3CC5B 4D3CH 4XXCA 4KTDL 4M5ZL 3QIBC 3M46A 3SDYL 3JUYA 2R0LL 4AD1A 2ZG2A 3ESUF 3HC4H 3BCDA 1MHCA 3LS4H 2L4OA 1A7OL 3GSXA 4GKZB 4DQOL 1NBYA 3SIMA 3PWPB 1BX2A 2NY5C 3TWCL 3KL0A 3GMRA 1QSFD 4UV4L 3X11B 4FQXB 4Z7QF 4NGHH 1XGTA 1G7IA 1PBYA 4JAMB 2HG5B 1LO2H 3HNSL 3QHMA 2Z31A 1N59A 5DRWB 2G41A 1KV3A 5TD4A 4R0LC 4PUBH 3BT2H 3HAEG 3II1A 3VG0H 3T0XA 3MV9A 4GRLC 3M07A 2XSAA 4UDTB 3WFBL 4GINA 2GJRA 1NCUA 1TJIH 4L9LA 3T65A 5C7XL 1LK2A 1WBXB 2WMHA 4GG6E 4YHKL 2UY5A 1OM3L 5LQBL 1G6VK 4LFHG 5F9WB 3EFDL 5IESL 3CHCA 3NJ3A 3QUML 4NN5C 3EJSA 2F74B 5ESVA 4F8TA 4IEFB 3AB0C 5AWNH 3VJ6B 5J12B 4H2CA 1I1YB 5FYLE 3GUTA 4EANA 3MV11 1MWAL 5A6AA 4OSUL 1JD9A 3B2VH 2A6KB 4UIMB 3TBSA 4W6XB 5IVXE 3ZR5A 4UNIA 2BOBB 4L29A 4LGRB 1J12A 3TV8A 1KYOJ 1MFDH 2HVKA 3QJFA 3MRNA 5HYJB 1JGVH 4NQEA 1G1CA 3VXMA 4N0FB 1FIGL 4TRPL 3MMDA 5CQ1A 1IKNC 4JHZA 5DVKA 5HGAA 5EOQH 2E8YA 4HKZA 3BH8A 3EYVB 4PJHE 3A0OA 3ZL4H 3EDDA 2DT1A 5EO1A 2ED9A 4ELMA 4FTVE 5D2NA 3CFCL 4JLRA 5CD3A 4PMUA 4PTUB 4IPLA 3RGVB 1IGIL 1UFUA 3W5MA 5I1LA 4OZIF 2W59A 5BRZA 1XF1A 3ORJA 5EPMA 4JQIH 3VTRA 4ZUTA 4E2OA 4MCYB 3DGCR 3KR3L 3GB7B 3BE1H 4UNVA 2HFFA 1N26A 4FK9A 4QRPA 1MWAB 4G43B 1MW1A 3FTGB 1CECA 4CD8A 1FORL 1GPFA 1T7YA 1SMDA 5DD5H 4YX2H 1UD2A 4OCMC 3EYVA 4ZPVA 5GRXG 1G7LB 2BK8A 5F3BB 4I18B 3QDJB 2YKKA 1UJ3B 5IMKB 2DWDA 4QXTB 1JG9A 5DO2D 5IBUB 4I3RH 3VXMB 4PGCA 4X8JA 1WZ1H 1E3XA 4X0KA 2XKNB 4IRZH 2XN1A 1K8DA 1CLXA 1LWJA 3TO2B 5F7FA 5JXED 5DFTA 1MCBA 3D85D 5TFSH 4U1IA 4KKBC 5D96B 3B6SA 3L7EA 4KKNA 1NC2D 4YPGB 1XF5A 2G9HA 3QCUH 5DT7A 4MXWL 2YD2A 1Q6EA 3FFCD 3LB6D 2DL9A 1AFVL 1E1EA 1A21A 4PRAA 1TZIB 3FQNB 4YAQB 5GGTL 5KOVC 5C0NC 1X6LA 1AR1D 4KXZI 1MJUH 3MJ8A 2GTZB 5BQ7B 3NCMA 2GT9B 2GSIB 5DC4B 5SWZB 5J3HD 4D0BA 1XCQB 4EDXB 3MV9B 2ZUYA 4F7CB 4NSBA 1INEH 5EMYA 4WDIA 4LCWE 4MYWB 4A6YL 4MA1C 4G9FD 3NCYP 2NY7H 5TF1L 3FO9A 4LPCA 1SVCP 1KCVH 3RRQA 3OGSA 1J5OL 4I2XA 2E0PA 2VN4A 5HI5D 2IXVA 2J8UB 2YRPA 2CETA 3BW9A 4I0PA 1WWWX 4F33A 1OQXA 1HCFX 4HTYA 4TOQA 1H15A 2APTA 2BFVH 4J4PD 4W8AA 5AAMA 3UZEA 1EFXA 3OSKA 4MAZA 2IWGA 1FIGH 1S9YA 3CH8A 3HPLB 4OBRA 4BUGA 4EDWH 2X4PA 1FNHA 2Y72A 5AC4A 1CBGA 4DWSD 4O2CA 3MLXL 3VSUA 5I2IB 2NCMA 3LHPH 4WKFA 5B8CB 5KOMC 1JPFB 4NPYB 5IROC 3VXRD 5B38A 1JNHB 1T80A 1I8KB 1Q0XH 4QTIH 5CGTA 1GPOH 1MHHB 3T0ED 5JUVA 3VIPA 4FXGB 4IOFC 3WF1A 2JK5A 1QQDB 1CR9H 1RZFH 4WWKC 5TQ0L 3VFTB 2UY4A 4WUUD 1A0QL 1AGDA 4TUKL 2YD8A 4KZDH 1HXMA 4M8QA 1EZVX 2DQXA 3W53A 5JW3H 1CFNA 4DGVL 4X6BA 4AMKH 4Y1AA 2JJTC 2EYTA 5D1QC 4UQ9A 3M8OL 2Y2WA 4LVHC 4HK3N 4MD4B 3FMGH 4BKLB 3VOCA 2JB5H 1DFBH 4ZDHA 1JNHA 2XT1B 3WFCH 5F6IB 5DUPH 2E9JA 3OKEB 4OFPA 4M1CD 3G6AB 1CCZA 2W67A 3KJ6H 1E28B 1Q9OB 1LDPL 1UT9A 5LCVH 1WK0A 1UQZA 2V5CA 5LCVL 1XR9A 1JPTL 2FH8A 5F1SA 5HYIA 3MV01 5I79A 5DLML 2FYVA 1Q38A 5KVDH 4OLUH 3VXNA 3L5XL 3VD3A 4WTWA 1PY4A 2DYPD 3W11D 2CEQA 3HUJA 4NOFA 4LHUG 3QI9A 1WBZA 3KPSA 4KJWC 4HPGA 1FBIH 3HI6H 1A4JB 3OAYH 1AGBB 3BVUA 2BY1A 2R2BB 3LN5A 4NQXB 3LV3B 5D1XB 4PJDE 1J8HE 1ONQA 4FOMA 2IFGA 1RU9L 4J4PC 3QNYB 4X5LA 2D03H 4ONHB 4X5XA 4N0UB 2KZWA 1YEHL 3SKJH 1JFXA 2NY2D 4DOHB 4MA3B 3W24A 1TXKA 4FQPA 4K23H 4CMMB 1WWBX 1FH5L 3OZOA 3BPLB 2KPNA 2P43B 4RIRB 5T1KB 1FYHB 1JWSA 3EOAB 3PHSA 4FP8H 1NWTA 1KXVC 2EYSB 4M4PA 1UD6A 2ZPKH 1D5ZA 5C0IB 5FO8A 2OZ4H 4LSVL 2CDGA 2EICA 1G6RH 1BOGB 5F7DA 1EHLL 3I75A 1EDGA 4PJGA 3EFFA 4RX4D 2X4TB 5I1JL 3GSOB 4P3CL 3LN4A 2EE6A 5KSAC 3WY4A 1TZHB 1TJGL 3D3VE 2E3ZA 3LQAL 3ARED 4P46D 3MI6A 1KJ2L 4NUGH 3ZYIA 1QFUL 3DURA 4H5SB 1B0IA 3DDGA 4PRHD 3G5XB 3FXYA 2DD8H 2F5AH 5INDA 1FCGA 1VENA 4PRHA 2EDKA 3WHE1 1KEGL 2XVGA 3BVXA 2CLRA 1NMAH 1AGFB 2EDOA 1Q6CA 5DR5H 3MV9E 3ZKXB 1EHNA 4EIGB 5A6LA 4M1GL 4L3AA 1VESA 2AEPH 3IXAB 4U1HB 4OZGF 1NDMB 2J4WL 3NACL 1GHRA 1EZVY 4GG6A 3OKDA 4JM2D 1XR8A 4BF7A 2WC7A 1US3A 3VWKA 4NJ9H 4LSQH 4ELMF 3OKMA 4RFEA 1GL4B 4UILH 3O6KL 5IHSA 1SBSL 2H8PB 1QI4A 4OGYH 2X4UB 1P9MC 4PD4K 1ITXA 2NT1A 1A7NL 2Q86A 3HMWL 4LASL 4L8DB 3TPUB 4UOJA 3ULSA 4WNQB 3OLGA 1A7RL 3FN0H 3JWOC 5D8JH 1EK3A 1F4XH 5MEOB 1FSKB 1GJWA 1ZAGA 2PKDA 3LKQB 1A6VL 4ZAKB 4YXHL 3SN6N 3MSGA 1FNGA 4HOXA 2J6EA 3NA9H 4PGEA 3IU4H 5CJOL 3RZCD 4YGVB 3IGAA 1JF1B 2KUTA 4MJ4A 5IVOA 4FTVA 1NCNA 5D2NE 1UZ1A 1L0QA 2O93L 2O9OA 2GUOA 1KIQA 3O9NA 4WFED 3CU7A 4RWHA 4GMTH 5JW4N 4QLLA 2WVVB 5A94A 1DWAM 5D7SL 3OG4B 3KZSA 2OTUB 4P49A 1B3VA 4RWYH 4UINL 4WO4B 1AC6A 1O0VA 1EMTL 5A2AA 3MOQA 4K94H 5IBUG 1AKJB 3H9ZA 4HWBA 2SEBB 4LGPB 4YXLH 4NQXA 4QRPE 4JHAH 4HV8A 5JA9A 4OZFB 5BZWB 3RWGB 4APQB 1MI5E 1L6XA 1E4KA 4Y4KA 1OTTD 2XFXB 2J2ZA 3T4AB 1EIBA 2AJ3A 3T04D 3DHMA 1G6RL 3LMJL 3W0WB 5MEND 5C0AD 1JJUA 1KTRL 2J79A 1DQJB 3DSFL 2PXYC 3KWWB 4YHLH 3VFMB 3GSXB 4GAFB 1DUYA 1BLNA 3ARDA 4PJCF 2XG4A 1VAHA 5I30H 3WSQH 2BVPA 1ZTXL 4LLWB 3STBA 5A6MA 3EYSH 1OAXH 3SHSA 3DO7A 5IVXB 5C09B 5L88H 3FRUA 3GO1L 1A6TA 1WZLA 3CDGA 4GT7A 3MLPA 2YPLB 4GQRA 3STZB 3CUIA 3I6KB 4YHYB 1YQVH 4O58H 5FKYA 4JVWA 4IJ3C 3GMNA 3K4ZA 4XGZB 3L3DA 3AXLA 4DOHE 1GZPA 2HFEB 1E72M 4OJFH 3W5NA 3H9HA 2E7LA 4MJ6B 1LD9B 4AJ0A 3HAEH 3R06B 3BUIA 4X83A 3WCYA 4BFEA 1IQDB 1KCUL 2R4SL 2HLAB 1X5IA 2FH6A 4Q9QL 3VXQB 1PSKH 3SDXB 4HGKC 1YEEH 2HWZL 5HVHC 2OW6A 4FNPA 4GUPB 5ID1B 2WW5A 4O51B 4I2XE 4LCIH 2GDVA 1OAKH 4KQ3H 4U6HA 5L2KA 1D5IL 1ND0A 1DFBL 1CVRA 1GJUA 2FATL 3DRQA 2X4PB 5ISZE 4M62H 3MCKB 4N0CC 2GJPA 4YK4B 5LA1A 1CFVL 5K9KA 3LPWA 1NGZB 4JCMA 4HZAA 4JQXA 2GTWB 5I66A 1HI6B 5GS0C 1SYVB 1E73M 3LRGA 1GQLA 1VEPA 3W2DL 3L4WA 3VFRB 5A8PA 1MXGA 1VSCA 2XA3A 2EYRB 2EDLA 5HHNA 2A9NH 1I3RA 3SGDH 5GHWH 1BSIA 4JKWA 2F53B 32C2B 3MROA 1FYTB 5HGGS 1NL0H 4POZC 4KRLB 3FO2B 4XWGH 5EZIL 5DJ6B 1JPST 1P1ZB 2GSJA 4LVOB 1KOAA 1E4JA 1U91A 4OUOA 3MRRB 5IBTL 4NNYB 4H20H 1LL4A 1ORSB 1DSFL 4NQDD 2WHLA 1DWIM 5H94B 1J05B 4R9HA 4Y1AE 3BEVB 5J6HB 4K3EL 4X4ZA 3V5DA 4XTRC 4XCCL 4ZTPH 4KFZC 4KJPD 1ZT4B 2ZWLT 4TUFA 1H3GA 4YAQA 2CIPA 1YDPA 5AYQA 3IDMA 5D9MA 4GW5B 5KBNC 1UR2A 2ITCB 2O5ZH 3DYMA 4BSVA 1JF1A 1WEJL 2X4RB 3DV6A 5M7QA 5A2CA 4HKBB 5GZOD 1YEJL 3SDAC 3T4YB 4U1IB 1C08A 4X0KB 3DJ9A 1QPPA 4MHHI 1JAEA 3GSNH 3PL6D 2VR5A 1C16B 2OM5A 3DUHA 4BZYA 1NOWA 4HC1A 4PJIF 5JQ6H 4HFWA 3TCXA 5FOBA 1V7NL 3I2CH 4IIQC 1CFQA 4O2FB 4X6CB 1PFCA 2NLJB 4RZCA 2R1XB 3HUJE 1E4XI 2WMKA 2D0FA 5GRUL 3GKZA 1JD7A 1Z9MA 2JIXD 1G0CA 1RK0B 3OR7B 3EDEA 4CNIB 8FABA 1U58B 2MQCA 4QRPB 4E9LA 5IB3B 5BMFH 3JV6A 3RFZC 3OAZK 3SDDA 1J8HA 1QD0A 3WL9A 1DN2A 1LLOA 4JFHE 4X4YB 4M61B 5GJTH 4LLAA 4F57H 4JR9H 2BDNL 3OZ9L 2RFXA 5DEFB 2EPLX 2ZSVB 2B20A 4DM1A 5FO7B 4CVXB 5AG8A 3FQRA 3CNKA 1PSKL 2C7UA 2IPTH 2KKQA 3SDCB 2BNUA 3IJ9A 3PHQB 1LP9A 1TFHA 5IHZB 5LBSH 1OAYH 2HVMA 1MCWM 3SCRA 4J6RL 4X7CC 5MEPA 2B5IB 1LK3L 4PTUA 1JNNL 2DTML 3FRPG 3L4TA 4OZ4B 3ZDYE 1MCJA 3I02A 3IFPB 4NC0B 1V02E 3E6HA 4HUXA 5BVPL 4LSUL 3BRDA 2NLJA 1B0GB 4PJGE 4RAVB 4GAJL 1Z2KA 2YLAA 3LXBA 3ALWA 4MS8D 2VXTH 5EB9A 5C07D 3D3VA 5AD0A 1E6OL 4X9IA 3WHXB 2A6KA 4UIMA 4S11A 5SX4H 5JPNB 4OTXH 5D1XD 3RVUD 4GAYB 4PRHE 4L29B 2VZSA 5HD8C 3HB3C 2O9RA 3PDDA 5IMOA 5HPOA 3SOBL 3VXPA 5KAQG 4U1KA 4EKXA 1R3IL 3JV0A 3MMEB 3NIFF 3S3SA 3ZR6A 3SDAA 3CFEA 2WKGA 2J8GA 3ES6B 5D9NA 3VIKA 3X14A 2OQJA 12E8H 2AERT 1K6QL 3WQWA 3QHOA 4HUUB 1N5AA 1SR0A 4AEHL 5D7KD 2B5IC 4JRYD 4WEUD 3PHOA 5D72L 5D8WA 2XZCL 4U1GC 2YDQA 4KI5F 5SWQB 5D9OA 5D2LA 4KQ4L 2BRQA 4ZEPA 1MQ8A 1SJVA 2IPUK 3GXFA 4Q0XL 5GGVL 1H4PA 1NCTA 4YJZL 1J18A 3DETD 4FS0A 3VNZA 3W37A 1I1AB 5A2IH 2VLLB 2DH2A 4FMVA 5T1DL 2XG9A 2YWZA 1QNSA 3OG6B 1HNGA 3G6JA 2UUDH 1KLUB 5ALCL 3P77B 1HI6A 1QSVA 3C87A 1Q72H 3RILA 3ARGA 1BECA 4PJ7E 2NY2C 3ZDXE 4CMHC 2D31B 1AHWB 4NQCA 3S4SB 1KB3A 4G6MH 4CCDA 3LMJH 3GJEB 2IUZA 3RWFA 2A38A 3E0GA 4UT6H 1EA9C 1X44A 4U1MA 3UBXG 4FQJL 5FM5O 5JDSB 1UM6L 4LAJH 1NWUA 1CFNB 1KBBA 3TCLA 2IC2A 4KRUA 5DJXB 4ZOCA 5FB8A 3W38A 2DLEA 2X2YA 1UYWH 3D50A 2R2EB 1WTGT 1A7NH 1WIUA 2BSRB 2MTPA 2WNGA 3JTSA 2J6EH 1KG0B 5CHNB 4EVNA 1NCBL 4H25B 4PMXA 1MI5A 5IEHB 3FB5A 3BH4A 3ZJ7A 2VUYA 3MLVH 4KZEL 2NY0C 4QTHA 4JE4B 2NZ9C 5GGSB 5AY7A 3OJDB 1E9LA 3RUGE 1E71M 1XT5A 4KV5F 3CGTA 2JJWA 4LLMA 4MDIA 3VX1A 1KPVA 1SJEA 4PS4L 4KHXL 3DBXA 4DVRH 3ZZ1A 1A6VH 3H7BB 3IAPA 3VCLA 5JZ7C 3HNVH 2AV7B 3QWRA 1EVTC 3GM8A 1KCRH 2FJFB 5BXFA 4KHXH 3KXFA 4YBHA 1A3LH 4BZ2H 1ZS8A 1WBYA 2FR4A 4FZ8L 2YBRA 4JR9L 4ODXB 5FL0A 3QWOB 2CBUA 1R5IB 1VACB 1AHWC 4NHCH 1F3JA 2AK4D 2Z8RA 4XC1L 4MNMA 4PR5A 2G2RA 2G60H 3CAFA 4LVNC 5KSUA 5C0FA 4UQCA 2XUCA 4D6DA 4ZE4A 4YDIH 1JHKH 3C2SA 5EZLB 2MHAA 5F7NC 5BO1L 1S7UA 3LEYH 4U0RB 2Z1SA 4KK5D 3RBGA 1PJ9A 2HKHL 3OB8A 1D5BB 1F8TH 3CZSA 1UVQA 4E4PA 4EQ3A 3QHTC 3RJDA 3CZNA 3LKRB 4XPFL 3NCYS 1B88A 4Y2DA 5H35A 2O61B 5E8OA 2X44D 2Y5TA 4RDQG 4HUVA 2C0HA 1WZKA 1QSZA 3KPMB 1FN4A 4NRYA 4OF7A 3BVTA 2VX7A 2ZNWA 2APVA 4YH6A 4YLQT 5L2KE 4AK1A 5ISZA 1HILB 3TO2A 2Q76A 2VYRE 2NY6B 3WN6A 3LKQA 3DHPA 1MQPA 4LIQL 1S7UB 2PW2A 1T1WA 4L3EE 4HIHB 4PJAE 3Q0HA 4HIXH 3OXSA 1DBKL 3C8KB 4XHQA 1C8XA 2GCYB 5KSUB 1OB1B 2J88H 2NR6C 1TQBC 4ZSOB 1IGCH 1RULL 5L8JB 5L88L 3RPKA 4PTMA 1M04A 1FZMA 3F5WB 4HZ8A 5ELIA 1FC1A 3KLSA 4LSTL 2FB4L 1BTCA 2HT4D 2F61A 4JFXA 4L4JA 3QQ3A 4L8CB 3O4OC 5DQJA 4JFDE 5ITBH 5CP7B 1U8IA 2G4FA 3AZSA 3VILA 1EBPA 3SY0B 4WUKL 2YDSA 3QUXD 4F7PA 3V52H 4DVBB 4OFYA 3AM8C 1N6QL 4DUXA 2BNRD 3CFDA 3MRMA 1XV8A 5B8CC 1S7TB 4IDJL 3HN3A 3O6LH 3OHXB 4S1DD 1H1NA 1S9VB 1F58H 2IAMB 3FB5B 2NXZB 5EBMB 4ZO9A 4QCIA 3HS0A 1MCPH 1HJXA 3HZMA 4TUKH 1AI1L 2IQ9L 4KTEH 1JZ8A 3ULUC 4H8UA 4P4KC 4R3SB 2DSZA 4EJ1C 3PV6B 2XVLA 1AQKL 2E7CA 1DDHB 3APGA 3EYFA 4AL8L 1SYSA 2FD6H 2WUBL 2M8XA 2EIZA 5T3XE 5L8KB 2D3LA 3WN5C 5C8BB 5HPMB 1JNNH 2DTMH 3OAUL 1RUPH 4ZD3L 3MSDA 4TTGA 4PJ8C 1ESWA 1T1YB 3SCNA 1TDQA 4GXVL 3D6GA 3ZE2F 2V3DA 3W9EB 3U7AA 4KROC 2OW7A 5I74B 4GO8A 1AXTL 4W89A 2APXA 3D0LB 5C1MB 3WQ6A 1RI8A 4H1LB 4MD0B 5ICXB 3S2CA 2WAGA 2P5EE 1K9DA 2ZUSA 2DBLH 4YHOL 5TF0A 1UWRA 5ERWB 4ENED 3LRSB 3MJ7A 4C83B 1JDAA 1A7QH 1V7MH 4E5XB 1U8HA 1LP9E 4KDVA 1JL8A 4X80H 3UR8A 1UCBH 4HDIA 2OSLB 3LAFA 1NKRA 4N0CD 4OFYD 4PJ5B 2I9TA 3MLWH 4PBGA 1GPOL 3WXWL 1H49A 3NGBC 5B39G 1G7IB 1DVFA 5I1EH 1QACA 5DD0L 1V02A 4W4OC 3TJEL 1IILE 1N5YL 3SCSA 3KYNA 1AXSB 4M24A 4YDKL 3THML 3KPPA 2FDBP 3WLBB 3BPCA 4JO2L 3BIBX 1FNEB 3ZHKA 3VIMA 3X14B 1XR9B 1CWYA 1DEDA 2WQRA 4WVRA 5IQ9B 4D8PA 4N8CH 1PYWA 5JUEH 4AD0A 5I23A 4OCNC 3D51A 3UO1L 2Y9RT 3VXPB 2IPKA 2WZIA 3QB7C 4ETYA 3KYAA 2DM2A 4KRNA 3W9EA 1HWGB 3NFPA 5DEZA 4ODUA 3CXHJ 1T1YA 4PRDA 4ZDHB 5KSBF 1MUJA 3GMQB 4CKVX 2CKBH 4BK4A 1DL7L 1U30A 5E5RB 3ULUE 2WB5A 3AS0A 4G8EA 2YUXA 3GNPA 2VH5H 3BSZL 3QO1A 4FLQA 2HLAA 1DN0B 1MFCL 4MX7A 3VFSB 3AIVA 5E7FA 2APWA 1RVFL 3NCEB 4RNRB 5D2LE 4HMCA 3TLRA 5GZOC 2EEBA 4LU5H 5D6CA 3PGFH 4WI6A 4JFVA 3BDXA 3CDFA 5EA0H 2XZQL 5LGKA 1T0NA 4MSWA 1I8KA 4PG9A 2MQ3A 3WY1A 2XN9D 1I9JH 3NVQA 2YXFA 1KB5B 3G6JE 4JFQA 4HHAB 5FOJA 1OD8A 4KKBD 2B0SL 3G5ZB 4EKJA 4JCLA 5IKCA 4RA0C 3W39A 4PJ7A 1W9VA 3CK0L 2QQNL 4G6ML 4NQCE 1FZJB 5FCUL 5A8QA 4LLWA 2BVTA 4PV9B 5CZXC 4PJXF 1BLNB 2CIKA 1GCYA 1HHGA 4AL8H 2PO6A 1GYAA 5IBLC 1RJLB 3U4AA 4NKDB 3GMOA 3PABB 3CMJA 4LKCA 4G7YL 1ZLUK 3W0WA 2BXZA 3KJ6L 5IQ7H 1WDPA 1P7KB 3TZVC 3FO9B 4JZJB 3QUZC 3U7WL 4JM4L 1RD6A 5I18L 1A6ZB 3G9VA 1T66C 3ALXA 5F96L 1OP3K 4DN3L 1N6UA 2WMJA 4OZFG 2VDPH 2MQ0A 2RB8A 1UD4A 2C1PB 2NNAB 4MMZC 1OQOA 3K4DA 3ULVC 2VRJA 5CJXC 4OM1L 4DGVH 1V05A 3BUQA 2Z0BA 1U95A 3RUGA 1F02I 1BVKA 5DHVA 3QZWA 5FA3A 4LCCA 3TBYA 4I13B 3EJZC 4PMOA 2I24N 4R90L 4PMZA 1UQSA 4K7PY 4OCYL 1I1WA 4KZDL 2QQLL 5SX5K 3B6SB 4YPGA 3UTPD 3WN5B 4U7KA 4PBXA 4CVUA 2J5LB 1X3DA 4OIBA 4OCSL 2AAVA 5KTEH 1R3IH 4MMXC 2OJZL 4M81A 1MQQA 3HC3H 4AXNA 2OJZH 3JTTB 1WAWA 1JYNA 4GLRI 1YN6B 5FUCE 4J28A 4K9EC 3OKNB 4WI7A 1QTYT 3KXFE 2JKXA 4B9YA 4P4KB 5DK0A 1KIUA 1R24A 4JZ5A 4FFWC 3OLEA 4CGTA 2QADC 3AYSA 4YDVA 4WIWA 1D5XA 5FGBC 2ZOXA 3S98A 2QV2A 2XHYA 4IMKC 1IAKB 3KHQA 5KZCB 3A6CL 3UTTD 3V2AR 3LQMA 3GKWH 2XN9E 5ITFB 4HT1H 1X9QA 4E42A 1X5ZA 4HD9A 4M3JA 2J1KA 3C5ZC 1MWAA 3AIBA 3FO1B 2UYLA 1G9HA 2VDRH 3O3BA 5KN5A 1AP2A 4PJ7B 3OXRA 1HYRC 2XY1A 4JKPH 4LRIC 4YHIB 3SKOB 3SQOL 4F7MB 4XP6L 1M71A 3U7YL 2BY0A 4TPRH 1CLOH 1AKJD 4LLMB 4MDIB 3RGHA 5KVEL 1J0HA 2ATKA 4MXVF 2EDYA 2XN0A 3F7RA 3R1GL 5E8PB 5SX4I 2YR3A 4Y19E 4HK0B 3C9NA 2YUZA 3IDXL 5F8QC 5GSVA 4CADA 4PRIB 3JTSB 2BSSB 4QOKD 4AEIH 3G5XA 5E0FA 4L3EA 4PJAA 5BZDB 1T3FB 3SBWC 3V6OC 1YNLH 5ADPH 4QNPE 1F11A 4CCCA 2RIKA 3WF2A 2XG5A 4Z7VB 3VGAB 4CL7A 1RZIB 3DX4A 1LO5B 3PN8A 4AMCA 5E1AA 5HHOD 2Z91A 2OS7A 3RL1B 2NY0D 2G5BA 3MJ9A 5E99L 3RWFB 3K4AA 5F9OL 4OGAC 2GITA 1D5ZB 5C0IA 5HYEA 4UR9A 4OQTA 4GOSA 3WIHA 4TVCA 3CVHH 3IDYB 4JFDA 1M03A 3UROR 2VLJB 3CHDA 1H8SA 4Z2GA 1FL5A 3LIZH 5GS1B 2GJZA 4RMSA 4QRSA 3AHTA 3RAJH 4R96B 4JPWH 1ZGLP 2IANB 5E2UH 1JNLH 5F89B 3T0BA 1LNUB 1NC4A 3PWJA 4Y4FD 4Y88A 3WIHL 3ZE1F 4O00A 4G8GD 3WLBA 4ONHA 1C8PA 5EU3B 5E6YA 4ZFZB 2YL5A 1XGQB 1QFWI 2AXFB 5E9AA 4PRWA 4EOWL 3FQXA 2BNJA 2Z93A 4OD1H 5HDLA 2E40A 1XGQA 3ZKXC 3U46B 1EO8H 2VN7A 2FRGP 1QEWB 1T83A 1NEUA 2ZX7A 5IFTA 2P5WE 4OD2A 4IMLB 4KK5C 1KENH 5D1XC 3RVUC 2GSGA 1KIPB 4OLWH 5IFHH 4OD1L 2DQIL 5FV2A 1XD0A 4QRSB 1E40A 4G6AC 5FM8A 4FNQA 4HUWB 5GS1A 2D9CA 5EOQL 2FX9H 4P8WA 1CU4L 3ARTA 4KKLD 4YHZL 4P7NA 1Q6GA 1AVAA 1HSBA 4ZNEE 1BYDA 2P5WD 3V6BR 5JMRA 3ARUA 1NEZB 1BHGA 2ADGA 4ZTPL 4UB0H 2GITB 4LEOA 5I73C 4TSBH 5JPNA 3RIFF 1NCAH 1CFTB 4P2CG 1I7TA 1PZ5A 2X4NA 5CUSH 2XKUA 1MCFA 2P5EA 5TE7H 3I3DA 4OZFH 1Q4NX 1OTUD 3DX6B 1H9VA 5F7EH 5AUMA 3M45A 4LYPA 4LYRA 4J1UB 4P3DA 3CXDH 3BD3A 3GBML 4R2GD 5EOCL 4ZSOE 3WH6A 1F2QA 4NNPH 1SFSA 4BZ1L 2DH3A 3REWB 2R1YB 3MREB 3PWNB 1QR1A 1K9FA 3HZVA 1HKLH 4MJID 2CDEB 5E24E 3ZTJH 5T1KD 1OTSD 1E4IA 2F5AL 2A6IA 1OSZA 3MZTA 5IWLA 1EJOH 5J9PA 5JBFA 3S3PA 4QHMB 3CHEA 4ODVH 4CN4A 1NCBH 3RZCC 5DTFB 3VIFA 5FO7A 1C7SA 4IDJH 2Q7YA 4XHJD 1S7TA 3NABL 4FZEL 2QBWA 3CO4A 5DEFA 1KF9B 5E09A 4P23B 3EGSA 4M9OA 3V7AE 5B8CA 1CTOA 3IT8D 1JZ7A 5EC2B 3MRBA 3VFVA 3WL9B 4EI5A 5C2BL 5B39B 1HJSA 4Y5YB 3T3ME 5FCZA 2OZ4L 3D5OF 5DQJB 3CLWA 5IB3A 3EYSL 4PRHB 2A3BA 4N5UA 4FP8L 4V1DA 4IS6B 4HWEH 2ED7A 3LH2L 4MJ2A 3QIBB 1WTLA 2FZ3A 2EECA 3V52L 1IC4L 3J8F7 3ULUD 1GSMA 3TH2T 2HJFB 4MD5A 4P5TD 1I7RB 4GW1B 1EX0A 4LXFA 4QRUA 4ERSH 4ODHL 3VW3L 1IGFH 1HKKA 1WWCA 3UC0L 1QI2A 5F7DB 1YEDA 5D6DA 5DJZB 4P2RB 5I5RA 5L9DH 1MRCL 3C6SA 3EYPA 1YN6A 3VXSA 2XM1A 5FO8B 1HQRB 5BV7C 2HVJA 4DN3H 3GMMA 5C0DB 3TBWB 3VPLA 5FKAB 4KRPD 1UENA 3MPCA 4RISL 1TVHA 4GO6B 1A6AA 4R27A 1OAZH 2FJGA 4RAHA 4HJGA 4H0GA 3MLTB 1VERA 4LLYB 1TQWA 3VXMD 3SDXE 4GMTL 3SE3C 4PJ8A 2DIEA 3K7UA 4UFIA 4XPFH 4GKSB 4WK9A 3QCTH 4WCYL 1VFMA 1HHHB 4MNQB 4N1CA 4PG2A 4BH7A 1JGLL 3UJTH 4W81A 5LA0A 1KPRA 3ZO9A 5DUPL 2VXVH 2XACC 5A16B 4NO5B 1HP5A 2IGFH 2Y4SA 4HU0A 3P30H 5DVNA 4H88L 2Z35A 4P9HH 3P0VH 2VRQA 3U48A 3B2UD 3EZJB 1A4KA 4HWEL 3MC0A 4JM2B 3RVXD 3W0WE 3KLHC 2EO7A 1UZ8A 5CP3A 4PJEB 1QNRA 3GMLA 4Z78A 1ACYL 4HPYH 3KLLA 3HKFA 1LEIA 2BFGA 2ESVB 4WI5A 1UA6L 3MCLL 3TIEB 4TUOA 1W9UA 3TPKA 4M6NL 3ZHDA 3QT2A 5IMLA 3NCOA 3EYQD 3L3JB 4MXWH 4EAMA 3DXAE 2JJVA 1CXLA 5I1LB 1U3HD 3DXAD 5CCKH 4NT6B 1C5CL 1FG2B 1MRFL 3ZJ8A 5E9DB 1QSED 1NLDH 3Q3GA 4HG4J 4CRPA 3GNOA 1Q0YH 3P3YA 2I60L 4R6UA 3WFLA 2EDHA 3RDKA 3HB3D 4GKOA 1Q94A 4JB9H 2B4CC 1P4BH 4RRPA 3RWDA 3PJSB 2Z92A 5IM7B 2A74B 3D9AH 3L3DB 3BGMA 3BJLA 4K2UH 3EUUA 3ELAT 4JM2F 4Y16B 1KJ2H 4NUGL 3BDBA 5D96C 3VGFA 3JBG7 1HHKB 3OKKA 2VLRB 4LEOB 1CVSC 2AJXH 4S1SL 5IW3A 2FO4A 2A6DB 4LLVA 5D9SB 2WSKA 5DD3H 2IPKB 1HSBB 1WZMA 2LFGA 3AAZB 4LAQL 2XN9A 4DCQA 1N5YH 4AM0B 4HPOH 5KZCD 3TTOA 1YJDC 4D8PB 4NRXB 3PNWB 5JORA 2E4TA 2IGTA 1KTBA 1A1NA 4Z7VE 2NZIA 3N1MC 5C08E 4Z2JA 3N85H 5FHAH 2C4FT 2ZG1A 2ICWA 4IMLA 5GGTH 4WY7H 5I1HH 1S9WA 3G6JB 4LBEB 1T21A 5HNNA 3SO3B 3JWDH 3BWAB 4D2NA 2W0LA 4R4BA 3ZM8A 2VCCA 4WV1C 1OHQA 4F15B 5GQBA 1OL0A 1EFXD 2Q3AA 2G5RA 4Y19A 1ZT7B 2OTPA 1AXTH 5EULV 1DBAH 5ACZB 3EHBC 1JGVL 3MBEC 5CP3H 4G8IA 4GRLB 3MLYL 2VZ3A 5E2UL 3G6DH 3DXAB 2QTEA 4UTAH 4E5XA 1ZMYA 1RZ8B 4PGBA 3LSOB 3IFNL 5DD0H 3RVTD 2OTUA 4PRBA 1A1NB 4Z7VF 4Y19D 3RX8A 4K7FB 3S6CA 3PNWA 3MLWL 2Q6WA 3KG5A 4GW4A 4JY5L 2DQDL 1JTOA 1W0VB 2BMKA 2DT0A 4QHLA 1RHHB 1MCSA 4NQUA 1OVZA 1S3KL 1E4XL 4ZAKA 2D23A 3QG6A 5DK2B 3VI4F 4FQCL 2BCKA 1T89A 1LDSA 3RGVD 5BV7B 1B0WA 1U8PA 1ZANH 3AJ7A 3PJSA 1KEMH 5IM7A 4D72A 4JG0H 2ZXAA 3EO0A 4R7DB 1A6UL 2AXGB 2A77H 2JCCB 4FFWD 3WQ4A 1HE7A 1I7UA 4OM0L 5IFJB 5MHSE 1XAUA 3UBXI 4KMQA 1ACZA 2ZCKL 3UTQA 2WWMC 3KPRB 2DB8A 4OBSA 2Y7QA 2X4UA 3OQ3B 4BQ8A 4AIOA 4J8RA 1T0MB 1GOGA 1M6OB 4HJ0C 1P9MA 2P5WA 3B9EA 2FB4H 3QDJD 5EB8A 3VFPA 5GRYA 1NDGA 1XR8B 3OHXA 5A40E 3G04B 1HJVA 4GH7B 2ZSVA 3T2OA 4FQIH 3MUGA 4P23C 5T3XD 2ZUTA 1DWFM 2FJHB 3ARBC 4E42B 5DSCB 4BFIA 1JGEA 4D9QD 4ZNEA 1XYFA 3GMLB 3BH8B 3ZLQC 4K71B 3O6FA 1IAKA 4ODWB 4HS6A 2YMXL 5HGAB 1I9JL 4ODHH 4AG4L 3RIAK 4H5SA 3LD8C 5DK3A 2P8MA 4BH8B 1SEQL 2P24A 3JVGA 3OWEA 5EA0L 4G8GB 4HFWB 1TJIL 4HCRL 4ZSOA 1E4WH 2N4IA 3OPZH 3UXFA 4U3CA 3BCFA 4ODTL 5ENWA 2NY7L 3HMXA 3TA3B 1E4NA 4JDTL 2GJ6E 2W92A 3QH3B 3MRGA 1R3LB 5CBAB 4U2YA 1QLFA 1TPXB 5FK9B 1RH9A 3DVIA 3CLFH 3WD0A 2HT3C 5L2JA 2CD0A 5HDQH 1ECEA 4M7ZC 3GSWA 2VAAB 2V9QA 1B2YA 4WHYG 1UYQA 2A73B 4ZUUB 5TDNB 3BKCH 5T33L 4FZEH 1DBBH 2GJXB 2F9BT 3LKOB 3MXVH 3Q5TA 3OX8A 3IFLL 2Y06L 4X6DF 3T65B 4XMKH 1WDQA 3TO4B 1F6FB 1BOYA 4ATWA 5F96H 1F4YL 1RZKL 4K2UL 5JW5A 5F7HA 1VJZA 1A6ZA 1O5DT 5ENWB 1SY6A 3BN3B 1JPSL 5J11C 2EDWA 2B31A 4V1DE 4CW1B 2DQFA 4XP4L 4Z7WE 3VFNB 4ZG1A 2MOVA 5E99H 3LEVL 2R9HD 4N0YL 5D7JD 3T0EC 4PMRA 5HI3C 2V2TA 4OI9A 1R0AL 3DHUA 3QG7H 1H3VA 2F7OA 1RIUH 5IGXL 1KXTA 1G1YA 1U8KA 5DJAB 1J10A 2LU4A 5D5MB 1G0XA 5IKCB 4YDIL 1R46A 1BEYL 4P23A 5A2FA 3B43A 2FJFA 2VKXA 3VXSE 2VJXA 3VDCA 1UA6H 2W60B 4KKLC 5B21A 3WDIA 3QRFM 1GGIL 2F54B 3WD1A 5JOFA 3ZTNL 3TTSA 2AOSA 1RU9H 3DUUA 2C1OA 4HLJA 3EDJA 4K3DL 3MRPB 4DFIA 2VO5A 4R4FL 3SDXA 5GGSA 1KIRB 3SUVA 4PJ8D 4JIEA 1YECH 2R1YA 1YMHA 5FB8B 1PZ2A 1DQDL 4M80A 1KIRA 1D6VH 5F1NB 4KKAC 3L5XH 4MHHG 1I7ZA 3K0WA 1H3PL 3MRKB 5JDSA 3EYOB 2ZCHL 3N9GH 3L4ZA 3HLAB 3MO1A 4JKKA 1XRVA 1BVLA 3HMXH 3MZGB 4LLDA 1CGTA 4JFYB 4ISVB 4JFZL 5TE6L 1DL7H 3RZWA 1OTSC 2VAJA 3A6CH 4WFFE 3LXAA 3RTQC 2WBJB 3BZ4A 3STZA 1F3RB 4Z7NF 3OR6A 1WJ3A 1RHHA 1M7IA 4MA7H 4YFLF 1LO3L 3SEPA 5JIPA 1OW0A 3MACL 4P59L 3NDZA 1QFUH 1WPCA 4XHJC 2DOCA 3WUZA 1UG9A 3FMGL 3D69A 5B4MC 5I78A 2H41A 1VKXA 3DXAA 5CSZB 3ULVF 2DT3A 4LSVH 3D39B 4CW1A 1YNLL 2Q87A 5ADPL 4GIAA 5INCB 1XGYH 3LMYA 3F5KA 1D9KC 3C09B 1ZLUH 2R2CA 1EQCA 3TZVB 3TYGH 2UY2A 2VKWA 3BAEL 3VWJC 4QT5A 4AEIL 5BXSA 5AYBA 1S7VA 4NZJA 4WU7A 5I1IH 3WFEL 1UWQA 2SEBA 1A14L 1D5IH 3VFOB 4XPGL 3H7LA 3VIJA 3BXNA 3MJ8B 3DVGB 2W9EH 3FONA 1FFNB 3GK8H 2GAZA 2HWZH 4PRAB 1MHPL 3HMCA 1GAFH 2VXTL 4G7YH 5IVZB 3SO5A 3BZFB 3ES6A 3HNTH 3CSYA 3SKMB 3QUXC 3IANA 2EQDA 3KXFD 4NNXA 1HINL 1IGFL 3EFDH 4K8RH 2DJ4A 1QX1A 2Z91B 3DX7A 2CPCA 2P5ED 1XF3A 4Z7VA 3NTCL 4KTYA 4QWWD 4RAUB 5C08A 3QQ4B 5E6IB 3VD4A 2VUOA 1BIHA 1MCLA 1C5BH 3MMWA 1UA3A 3VDHA 1NSNH 2E27L 5IMKA 4DKDC 5CPQA 2CLZB 2AK1H 3GJFH 3MYZA 4KJQC 3QCVL 1B0GA 4EN3B 4G80A 2YJQA 1JMZA 2IAMA 3WUGA 1S7QB 1YEKL 2FX7L 3UTZA 4TSBL 3PHAA 3MV9D 3WJJA 2J47A 1BZ9A 5MEPB 4YHEA 4AY0A 2H8PA 2PTVA 3T0DA 4XZUA 4OCRH 1ZHNB 1MY5A 1ZA3B 3C09C 4IM8A 5D2NC 3S36X 3POCA 4IRJC 4JJ5B 3STLB 4X4YA 2GK0B 3HRZB 5KN5B 1ZA3A 5EPMB 3TZVD 4PJXA 4S1RH 4YFLI 3LS5H 4AYFA 3V0WH 2DI9A 4QRRD 1Q0YL 1I7UB 4RZCB 3SCPA 3H8NA 3F6LA 4WEBH 1FZMB 4POYA 4CNIA 1UZ8B 3L3IA 2AAAA 5FOBB 4NWTH 4ZS6D 1M4KA 4P7QA 4YE4L 1WITA 1B0RB 4N8CL 1CLYH 4XNZB 1C7TA 3MBEA 4RGOL 1GC1H 5I17A 3ULUL 4JFTA 2IH1A 3PG2A 5DMGC 5IFAH 3QG6B 3ULUH 1UWUA 2Q76B 1RAMA 5ABEA 2FEDD 4KY1L 2ICWI 3FO0H 1KTDA 2CMRL 4C55A 1JF5A 3GFUA 1R3HA 3T0AA 4B53A 1BG9A 3I85A 2YPKA 2CBJA 1FLTX 3VJ6A 1BFTA 3B9KD 3HG3A 4NQVB 3QFDA 1F90L 1U93A 3CSGA 5E8OB 4BUHA 2BJMH 3SCMB 1ZKAA 2GAZB 5TF1H 3QJHA 1A7QL 1V7ML 1RZ8A 4ODTH 2PXYD 2OCFD 2FEEL 3GBNL 4HH9A 5F44A 4J3WA 4F2MA 2WMGA 1WVZA 4MDJA 3UJJH 1ZSDB 2VTFA 4M6MH 1WGOA 1FP9A 1JCKA 2DEPA 2LE9A 3ARFA 2MPAH 5HDBF 4N8VG 4XXDB 1CGVA 1DWGM 4BZ2L 5HDRA 1B6DA 2F53A 2PYEB 2YMXH 3L3KA 2IBZX 4XCFL 4PP1D 1IEHA 2BOCB 1LILA 1WBZB 1L7TH 3DLQR 3AIUA 1UZ6F 4NKDA 1TZGH 1OWWA 1CDUA 2EXWC 3O2WL 5FGSA 5IVNA 2HKFH 5HHNB 3RP1A 5DJ0A 3HI1B 4DTGL 3K8MA 4OFIA 2E9LA 1KCRL 4OB5L 3WLWC 2GJ6A 1W72B 2AVGA 4DKFH 3IS0X 3T1FB 2DLGA 3BYYA 2AMGA 3VUPA 3RNQA 3MBED 3MOBL 2WXDM 1XIWA 4GI9A 3U6RB 2R23B 2EO9A 3DRQB 3O11B 3WFCL 1T7WA 4KROB 1OP5K 1CE6A 3O2VL 1BQHB 1BP3B 4JVUA 1NCDL 4B3KA 5DHXB 3QA3A 4U1NB 2RAMA 1HQ4B 4D9LH 2YD4A 1U8QA 3HR5A 4NKOA 5JW3L 2VQ1B 3QFJE 5C0CA 1UXSA 5I15H 3H3PH 1VFAB 2ICEB 3ALPA 4WJXA 4LF3B 3QUZD 4P8VA 1CR9L 2ERJB 3MNZA 2R0WH 1QQDA 3M8OH 4N90E 4Z7WA 1QBMH 3MFFA 4FMFA 1PZ5B 2X4NB 2XFFA 1N7MH 1EOMA 1B2WH 4OZGB 1XH2A 5B38B 4ODUB 3AREB 3B9KC 5IHRA 1DEEA 2R23A 5EFFA 2V3EA 1V08A 1W2VA 1AHWA 4JHWL 4NQCB 3S4SA 1JYVA 4M7KL 4Z5RB 4NSKB 4FNTA 3MLUL 1LEIB 1WDRA 2DM4A 5D5MA 4G9FA 3DO7B 4IBLT 1S9YB 3ARYA 4PBWD 3QHNA 4ZENA 2OBGA 1A7BA 1NFIB 2D1ZA 2NX5D 4X8XA 1FV1A 1IGML 2ZE0A 3O4OB 3QQ9C 2XFYA 1QVBA 1KBGH 3PZGA 1US2A 1X5YA 2DQFB 3KS0J 1HJUA 1G0YR 3JXAA 3HZKB 3VH8G 1X5FA 3DROB 1C91A 1ZL1A 4B0MM 4DGYL 3L3KB 3WBEA 1XH3A 3VRIA 3DYPA 4JFDD 3V4UH 3B9AA 1BGXL 1IC5L 1HWWA 4DKEH 1DHKA 3MYJA 1ISXA 5CJXA 5CEXB 1XGUA 5D4QA 2VL5B 5I1DA 4HXAL 4P46C 5DD1H 4H1LA 1YEGL 3BHBB 4D6FA 1WIOA 4U5IA 3FQUA 5DD3L 3IKCA 2YIHA 1MCEA 1Y0LA 2VLJA 1IAIM 4HS8L 4HWNA 4KMTH 1ZHLB 3MSPA 3TT3L 4ZS7L 2VLJD 1UH2A 5DUBA 1YMMD 1K2DA 3ZMRA 4WJ5A 3AS3A 4ZAKD 1N64L 1Y6KR 1QBAA 1P5VA 3MRGB 5DD6B 5C6TH 1V0LA 1U8NB 2ZUWA 3KPNA 4PGEB 5D4YA 1YZZA 4DKFL 5DT1H 4ONOA 1RUMH 2VDLH 1XSJA 1EEYA 1RIVL 4UIKL 4EI6B 3CX5J 3E6HB 2ZOKB 4U0QB 5IHBA 4R3SA 2EDFA 1PIFA 4LNVA 3VG9C 2NT0A 3C5ZA 4I18A 5F9DC 4LGXA 1TETH 1A7PL 3G08A 1NBZB 1LHZA 1RIHH 3WIFA 1OSPH 2EDRA 5DXWA 5DSCA 1QW9A 3CV5A 3F62A 4BFBD 3TNNB 2H2SD 3OMZA 1KEGH 5EU7E 2RQ8A 3BN9C 2NTFB 5E08H 3CMOH 3HCVB 2MPAL 1Q8MA 3TNNA 5IT2L 1F4YH 1RZKH 1XCXA 4JJ5A 2NW3A 3SY0A 4DEPB 2P5WB 3LRLA 4KC3B 3ILQD 3NFSL 2F18A 4JRXE 3CZGA 2CLRB 3IJ7A 4IUGA 1OGAE 4AEFA 4FQXD 2OSWA 4XVSL 4ZPTA 4A6YH 1AO7A 2PWDA 4AD5A 1EO8L 3LCYA 4OUUB 3WIFB 2IGFL 2R1XA 4IRSD 3F5WA 4WI9A 5ECUA 4HA1A 3VINA 1I1AC 1I3GH 4RFOH 1JRHI 3CZJA 4HLZH 2VH5L 5INDB 1TUXA 5IXEA 1C16A 3QDMA 3D2UB 5EFIB 2VXUH 1OGAD 5E2VH 3UPCA 2P5EB 3W28A 3SE9H 4DW2H 3QDMD 4WSKA 2C3XA 5AG9A 5C6PB 1CBVH 2XIDA 2CDGB 3A24A 3MO4A 1B31A 5CG0A 1FVDB 4RAUA 5C08B 3X3GL 2C4FU 1TQSA 3DIFB 2V2XB 3ROLA 4GKNB 5KVFH 2BOBA 4IRSA 3H54A 3MV8D 4RE3A 3RTQA 3MGTA 2WZEA 4GRWB 4P2OD 4DZBA 5SWSB 1NMCB 1QBLH 4EZMA 4HZ6A 3SJVB 4CVWA 3WEXB 4RA3A 1A2YB 2YRLA 4P23D 2JF7A 1ZOXA 2EKSA 3OKYA 5LGJA 3QUMH 3IKCB 1PKOA 3DX3A 1N0XL 3RI5K 4GZJA 2VXSL 3WIIH 3FONB 5IB5B 4S1RL 1P84K 3TC9A 2DKSA 5E2TH 3K46A 3VWJA 1EBAA 4PJXE 5EORL 2OTWA 2J7CA 1ZWIB 1WQVT 5GGUA 5T1MA 3G5YB 1BYBA 3L5IA 1X7QB 1MFAH 2VDKL 4XBEL 1IMHC 1QBML 2X05A 5AWNL 2G3IA 3QI9B 1KJ3H 1FORH 4XPHL 5IEKA 2J6EL 1HKIA 1TIUA 4OZHF 4R2GC 2CITA 4FXKB 5C6TL 3IJYA 1AGEA 1UM4L 3BWAA 3P73B 4YDJB 1WAAE 1A5FH 4FQXA 3AQUA 4R96A 5ALBH 2B39A 1ZLVK 4S3KA 1N3NA 5E5MA 1FL5B 3DMMB 1W9PA 2IEPA 2OP4H 5C09E 3EO9L 5CFHA 3LPPA 1C5BL 2PXYA 1HEZB 5BJTA 2X89A 5ESAA 1IFHL 4V27A 3E8UH 3L3HB 4XX6A 5DO8A 2H26B 2G5BB 1DJSA 2ZX8A 4PJ9C 1LK3H 1RUQL 4LEXL 5IHUL 2OX5A 4GXUM 4UMGA 3LKSB 3BDYH 3OKKB 4Q9QH 4X6BB 1OAQL 4CD5A 2KBGA 4OB5H 1BFNA 2C3HA 3GK8L 2Y24A 4U31A 1NOFA 1S7SB 4JZNB 4Y1AB 5HYJD 2R2EA 5FCUH 1SVZA 4NZTH 1HJWA 4OM0H 2VQ1A 3NUKA 2F53E 1KJVB 4W85A 3WDPP 2W07A 1U8OA 3W26A 3A21A 4LLUB 4UQDA 5I8KL 4YHML 5A69A 1DE4A 4OLZL 3PDGA 2BVYA 5AYUH 2F8VA 4YNYB 5KSBB 5GNZA 2ARWA 3SGJC 4UFKA 1A6TB 2DQIH 2JIEA 3L3HA 1MFUA 3JSSA 2FIRT 3HMWH 1KPUA 2WAHA 3AY4A 4WI8A 3MS8A 1UGNA 1KENL 2H1PL 3OAYK 2FBJL 4CN1A 2R0WL 3Q6GH 5E2JA 1YEJH 2ZUVA 4TUJA 3C60C 3KWWA 1I9RL 1U8KB 5DJAA 5I16A 3EMZA 2IF7A 4YDJA 3CU1A 3GSNB 2I07B 2WCSA 1BBJA 4HPOL 5A3IC 1T2JA 2O5ZL 4HKJA 2CJUH 1GNXA 3BD4A 2X89D 4U4BA 2XFXA 3T4AA 2VDQH 5D7SH 4F37F 3KYOB 1CT8A 4GAGL 1RJZA 4JO1H 2ZJSH 1AQMA 5BS0B 2Y07L 2CUMA 1N8ZA 1EJOL 3B5HA 2GUYA 4JEGB 1TNNA 3LKPB 3QFJA 5C0CE 4FLRA 4EDXA 3LZFL 4HWBH 1MOEA 1P7QA 3HG1E 1N5AB 3SCMA 4JB9L 2ZKHL 1RZJC 2R8SH 4ZS6C 2E7HA 4BQ9A 2YA0A 2GT9A 3SDAB 3KDMB 4OT1H 4PJCA 3OAZH 2GUOB 4LDEB 5TDNA 3ZSTA 2GJXA 3D0LA 5GISH 3MMEA 3QJHB 1S5HB 4WW1B 5I75C 5LA2A 3WBAA 1BJMA 2VAAA 1HSAA 4QRPD 5HGDB 4YHNA 2HVJB 4MQ7A 3ROLB 2DLIA 5FK9A 4UQ3A 3L7EB 4OCRL 5DDHB 1H0GA 3MBEB 4TSAH 1HVXA 4WTZG 4GQ9L 1U3HC 4G9FE 2QJDA 5D5ME 5K93A 1B0RA 2R39A 2W0PA 4MWFA 1MYRA 2AJXL 4N68A 4IISA 2D7OA 3LXCA 2AJUH 4W6YB 1Q6FA 4Z2LA 4M93B 4LVOC 4NIKB 2JJUA 3FQWB 5A6KA 3F65A 2YD6A 1CFBA 4NBXB 2DWDB 3BQUA 2AXHA 4I0CC 4QXTA 5DURB 2IALA 1AGCA 1IGIH 4ORGB 1K4CB 5H2BB 2ZSWB 4OIIH 4G3YL 4GXVH 4GG8B 1LP9B 3VFVB 1OINA 1O7DC 2DM7A 1OGBA 5FXCH 4MNHB 1N6VA 5C0BA 1GZJA 4BQ5A 3EBAA 3IDJB 4KK9D 3RIFK 5MHSD 2GYSA 5ANMA 1IGJB 5DJ2B 4K8RL 1PG7L 1JGLH 2EDJA 5E8DH 1PG7X 1OP5H 1QOXA 3GB7A 4F7PB 1EO7A 4M9PA 3IFLH 3CLEH 3Q1SH 1S7QA 4YBLC 2VLJE 3UTZB 1MFDL 3AISA 4KRMB 1DUZA 1KR1A 4MLIA 1CDHA 2WP3O 1N4XH 1OAZL 4P2RD 1RUAL 1EEUA 3HZVB 3ME0A 2DQJH 3QUYC 4W7WA 1G9NH 1EEYB 5GRVL 3NYDA 2NY4C 3BYTA 3QDGD 4D6GA 3Q6GL 2LU7A 1FDLL 2CGRH 2NX5B 1FRGL 2XZAH 3U2SA 1ZS2A 2XGBA 4AY1A 4W4NA 3RQ3A 1ZXQA 1U8PB 4J3UA 1N6QH 4JDVB 4PJ7F 1U8NA 1R87A 1IGYB 1RUKL 1E0OB 1E27A 1X6NA 2DBLL 3BZEA 4GS7B 5FDWB 5LGHH 1FAKT 1LQ0A 3ZL4L 4PRDB 2YZ8A 4UQ3B 2VVNA 1I8IA 1MREH 1U3HA 2KL6A 1ZBVA 4MCZB 4WO4C 5J7CC 1O7AA 5A8NA 2IAND 1MRDH 1BQSA 3B9KA 1GH7A 4IRJD 4HFUH 5C0RL 3EO1B 3O41B 1YN7A 4N42A 1H5BB 2GW5A 3GJFA 3EKCA 2XXMB 4AZIA 1FL6B 1GGUA 4P48A 4J3VA 4WU7B 1CDBA 5M17A 4KAQH 2DQGL 1JUFB 4X5XB 3RY4A 1MJJB 4HH8A 1FZKB 4NZUH 4XP5L 1D6EB 5TDPA 1JAKA 3FAWA 4JRXA 5HHOB 3UYPA 2PWHA 3VIOA 3DMMC 1OGAA 3Q1SL 5IK3A 5DJ6A 3TP4A 1AO7E 2CKSA 2TAAA 5D70L 5A3HA 2YL6A 1I3UA 5HGBA 5CPTA 4HPHA 2Z31B 3QBTB 2YD1A 5JIIA 3U0WL 2X5PA 3KJ4B 4OCXL 3TESA 1RY7B 3QDME 1JBJA 1J86A 3K8LA 5FM5M 4OJYA 2QR0B 3WKML 3U9UB 4MNKA 4KUCF 1MAML 5K9JL 1V3HA 5CPSA 2DLFH 4XMPL 3KAAA 4FQLL 2C3WA 1EDTA 3BMVA 3WFDH 3FB6A 3INUL 4MD4A 3QIUC 4BKLA 1OAUL 1GGCL 1IC1A 1NMCC 4HFUL 3IAGC 1KJ3L 2FO4B 3IS1X 1HNFA 4LLVB 4P2OB 3MNZB 4ODVL 3JV5A 3O3DB 1T6WA 4UILL 2YD9A 3A4WA 3JUZA 4OGXL 2ICEA 1OPGL 4Y16A 3NDYA 3WDQA 4NRZB 3WUEA 1IQDA 1DQML 2XY2A 2LV4A 3BVNA 1ZJBA 4M8QB 4ACYA 1ZE3C 1ZVSB 4M48H 1XF2B 4R97C 2CHOA 2FYYB 1RZFL 3V6ZB 3W9DB 3GM0A 5ICYB 1ADQA 1MFEL 2VZ1A 5LBSL 4QAWA 1TQTA 4OT1L 2DQEL 4OLVH 4UNUA 1CENA 2CXKA 3NFSH 4ZTOL 3O81A 1HHIA 2FE0A 1CE6B 4WWKA 2F54A 3C08L 2VURA 1IEAA 2DQJL 5HOSA 4U1MB 5EUKA 4JN1L 3A6OA 5E08L 3SUWA 1WAAA 4TNWF 3R8BB 3QDGB 2ITDA 1JPFA 3ARFC 1PQZB 5FEBA 4NQSA 5EU7C 4JJHA 3X3GH 1I8LA 4CVZB 5BW7C 2DDQH 2H26A 5J4MA 3GXTA 5C09A 4WTXA 1VGKB 5GZNC 5D71L 1R7AA 5CSYA 3CVHA 5E2VL 3TIEA 5FGBA 3VA2C 3T0EE 4AD2A 1YA5A 4G8GE 2R1WA 1NGQH 2ESVA 3TJEH 5CJOH 3BE1L 4QLRA 7TAAA 3PTKA 4Z77A 4O2EB 1DQJA 4HOZA 4X99B 1AGEB 5GGQL 1TJHH 3CPUA 5K9QG 4KI1A 4PV8A 4S0TD 4IRSC 4KH2A 2GCYA 3QO0B 2Z8VC 3K2UH 4M6AA 1QFHA 4KI5D 4HG4K 3ALGA 4XXDA 3L5JA 5EO0A 3N9KA 5I19L 5GGUB 3MR9B 4JPKH 2B2XL 3CMOL 4FFYL 1B3WA 4N8VB 1LEKB 4OF8A 3OKOB 5DRXA 43CAB 3QI9C 1HHHA 1JUFA 1NEZG 2LTQC 4LARH 3W25A 5E95B 1L9MA 1EH9A 2QADD 3IDXH 4NQVA 4K3EH 3WEXA 3ILPA 1NAKL 1MI5D 1OARL 4X6FA 4Y2DB 4FNLL 5H35B 1QLFB 3WEMA 1FHGA 1TVHB 5F97E 1C8QA 1VGEH 3B2VL 3IGAB 5L2JB 2EH7H 2BZDA 2R69L 5A1AA 5BRPA 5CINH 2DKMA 3L1OH 1EUTA 1R6VA 5A8OA 2IH1B 1JTTA 4UBDD 4W6WB 1GOHA 2DWEB 2P24B 3A23A 3QR3A 4YEEA 4LYQA 1EAJA 4D6HA 1BFOA 3MUIA 2X4SB 3GRWA 2HRPH 5JTWA 4K7PL 2H32H 1IGMH 2HJFA 4MD5B 4BJLA 5I2UA 3OTTA 3TT1L 1M1SA 2DQTH 4HIEA 3SPVA 1BIIA 1KGXA 3TPUA 1UM5L 3PABA 4O2EA 4ZS7H 5FA4A 2Y07H 4HS8H 4BFIB 5DD5L 1B3JA 3D87B 1WZAA 2OP4L 5MENB 1WBYB 2FR4B 3QXDA 2V5TA 4LSPL 4YIQB 4W5UA 4ODWA 3QOKA 1B9ZA 3CXHK 5L0QC 1LQSR 6FABL 3EJPA 1GGBH 3GSVA 4B3LA 1HCVA 3IDYC 1SJHB 3HG1A 1A0QH 3T2PA 3CFJB 2V5YA 4WHYH 4Z7UB 4R0LA 3CDYA 3IXAA 1NDGB 4QRTA 3REVB 1DQTA 1FO0H 4PJCE 4PJ9A 1JNDA 4JY5H 3D0VB 2AS5M 1A9BA 1QKZH 1FFOB 3ECQA 1HH6A 5L2KD 4BQ2A 3NCJL 3OR7A 4GMSH 2IALB 3R8QA 1G94A 4NN6B 3I50H 3VU2A 1PIGA 4PJEF 4GQQA 3MLXH 4N0FA 3IAQA 4CD4A 4JREB 5HHVL 5ISZD 4Y2DD 3U82B 5KAQF 1SEBA 3LQZA 4Z2HA 4AQ1B 1QA9A 3LRHA 1RQ5A 5J1AB 2XPGB 4RCAA 5I18H 2YSSB 4XMLL 4ZXBD 1I7TB 1C08B 4AIEA 1D5MB 4V2CB 5GS2D 6TAAA 1JZ4A 3BN9D 4NO3A 4P9ML 3P2TA 4S10A 2MKLC 3SE9L 4DW2L 1ED3A 4Q6IB 5JR1H 3AY4C 2BMKB 4XP5H 3QUKB 4LPTA 4H1LG 5C0BE 4BQ3A 2Q6WB 5KS9E 5DVMA 2DJSA 2UV3A 4P7RA 1MHEB 5ANME 3SGJA 1PEWA 2JF1A 2NY5H 3KWXA 2NY3B 3C60A 3CPLA 4FHBD 3HUJF 1V3LA 2A77L 3P11L 3QHFL 4G5ZL 1BWWA 3C60D 5DJCA 4CU6A 2P42B 5TGBB 2ID5A 1N8ZB 3ZTNH 5FIPA 4HS3A 2FGLA 1XGTB 2AXFA 2JELH 2KDGA 2WBJD 2I5YH 4HDIB 1T2XA 4NN7C 4ZFZA 4WFHE 3MTRA 3TWCH 3U0PA 3BUBA 3PGFL 5IF0A 2NW2B 2EYRA 3C6LD 2Y36H 3F12A 1BBJB 3K80A 1ZEAH 3F8UB 3BVWA 1NCCH 4XZWA 5T5NF 4HAFA 1Q0XL 3DI3B 1M05B 5EORH 5DURD 1CLCA 5J56B 2XKSA 4OKDA 4XNUL 3ZSSA 1ED3B 3P0YH 3V7AG 4D9QE 4KY1H 1NUDA 4M1GH 3PWLB 1ND0B 5ABGA 1KACB 3ZKNC 2GJJA 4M43L 4AM0A 2HTLD 3H0TB 2NTSP 3G5VB 1NGWA 2QHRH 1BD2B 2W9DL 3MRLA 2RGLA 3EJYC 5E8DL 3WUBA 4Q22A 3D85B 1CZ8H 5J13B 1MF2H 1W72L 4Z7QE 1NC2B 3CH1B 4DN4H 1GHFL 5JHDB 2VZUA 3SUSA 2EIBA 2VIRA 2DM3A 4PJDB 4DUVA 4YBLB 4HUXB 1T5WB 3MXVL 3U36A 1Y6NR 5DC9B 3O8XA 5D7IF 3BH9A 3C5JA 1GZPB 3AHZA 5JXEA 2WCAA 4PTWA 4RSVA 4DM2A 3A3HA 1T20B 1MHHA 3QDHA 5FUOH 2ATKB 4LCYA 2V17H 2W60A 1V5JA 3U6RA 3FOLA 1X5LA 2OL3B 2C3VB 5DVOA 1A3RL 5DRNA 1HKMA 4F7MA 1CICB 4UDUA 3UBXB 5I9QB 3TVMA 4L4TD 5DRZA 5ACLA 1BVNP 3GZAA 3QPXH 1QFOA 1CGWA 2EH8L 1YEHH 3SKJL 5L6YH 5EN2B 4IRJB 2AQ1A 1JNEA 3QIWA 4JM2A 4NWUL 2JLLA 4YHMH 4XWOD 4KRPC 4DJMA 4Z78B 2D3VA 1S9XB 1CD1A 1IL1A 4IRZL 5I8EA 4L5FL 1HTYA 1EO5A 1RUPL 2ZUUA 3O2DL 5DWUH 1V6XA 4I3RL 3CUJA 4RDQF 2NY4D 3ALFA 3OXSB 1RZJL 3O0RH 2PW1B 3QRGH 4HIIA 4CJ1A 2ADJB 3VRJB 3FFDA 4QGTA 2VXQL 3NCFB 4XPTH 1NM9A 3WKNA 5FYLL 3OX8B 2Y23A 2R29L 2PCPA 4M1DH 4K3JL 5HGDA 2QPUA 1TZIA 3FQNA 2F54E 1XH0A 2VLKD 4Z7NE 4Z9KB 3V5HB 3GSWB 1PVHA 2EKSB 3UDWA 5F3HB 3D18B 4MXVE 5C0DA 1OGSA 5DS8B 1D2KA 4H8HA 2ARJB 5J6HA 1HXYA 3VXSB 2BY2A 3QUXB 1E43A 1A6AB 5KVEH 4NM8H 5E2WH 3WY3A 2P8LA 1JGDB 1CXFA 3QFJB 2A3EA 3MRCB 5CKGA 1V6VA 4IRSB 4EN3D 3LKNA 4YHYC 3T0EA 5AC5A 4G8GA 2AABL 4NFCA 2ESVE 5BOPA 1MIEL 2PTTA 3CMGA 4PGCB 4X8JB 1BD2E 3QDMB 5C0BD 3U5UA 5ESQB 3ARSA 1UD3A 1GGTA 2FZ3B 2AJZB 1MQKH 2J7BA 1WFUA 3VMPA 1JK8A 3H9SB 3S97C 4P59H 3PZ9A 5E00B 1AO7B 5E2TL 1BGAA 2HKFL 4UT9L 1ZGLB 1FH7A 1IM9A 2VE6B 1TFVA 5L7XL 5FYKE 1I8LC 3UTSE 4N1HB 3N13A 1NBQA 2IADB 3E2HB 2VB5A 3UYOD 5FM4A 3GSRA 3LHPL 2QSQA 5GGRY 4P8XA 1SHMA 1PD6A 2MJWA 3VWKB 4MCYA 2WPGA 3EIFA 1M6OA 5DJYB 5IHUH 4ESKA 2A6IB 3SDDC 2QL1A 4FMKA 5DZNA 3VXUA 3C5SB 4JLRB 1J5OH 4Q2ZA 3I2CL 5IEHA 1JHLL 4PUDA 3L5HA 1T03H 5TQ0H 5BWFA 4LNRA 2CDEA 5D7LA 3DURB 3MREA 2NY1D 2ERJC 3MRFA 5I1CL 5F6HJ 4F37K 4IOSD 2VWEE 3L5WB 5HVGB 2FEEI 3B9VA 4FTVD 1KC5L 4J12A 1W8OA 3U57A 5HHQA 3O6MH 5IQ7L 3M6DA 4V1DD 4TQEH 1R3JB 3TBVA 5HSFA 1BVZA 3FRUB 5GRJL 4F7TB 1MIML 1K2DB 2ADGB 3VWKC 4Z8FL 2X2JA 4XVJH 3BZFA 4WHTB 4Y8AA 1DSFH 2OLHA 4PRNB 1P4IL 1QNZH 5C9KA 1UR4A 5M5DA 3BP6B 2QF8A 5EU6A 2A3HA 2K9UA 4ZODA 2VDNH 5DMKB 3QSKB 2PYFB 3ZKQD 5LVEA 2WSPA 1GORA 1E6ZA 5IUSA 1CGYA 4HUKB 1CD9B 4G7VL 4OD2B 3O3AA 3H2WA 2CBIA 5A8MA 2D7TH 5IG7B 3Q6FB 4Z0BL 2ZXDA 5ID0A 1AGBA 4F58L 43C9A 4I3SL 1OGAB 1NCCL 1INQA 3IDNA 1JFQL 1GVIA 1CFVH 4NCC2 1OCWL 1UWEL 5J6GB 2VDQL 2PR4H 4RRPG 1FZKA 5J11B 3LRSA 3S4SG 5EU4B 4FNUA 2A3AA 1LNUA 1MHEA 1ITCA 4G9FB 1TQCB 5EU6B 3PGCB 1YEFH 3OJVC 5E6ID 3RKDC 2XN9B 4DCQB 3A4XA 3K2UL 2YXMA 4B16A 4TVSa 3JUGA 3RA7L 4WHTA 3KL3A 5KSAB 3TA9A 2WLZA 3E6FB 4OF3A 2PETA 5HHMD 5C71A 3V4PL 2YC1B 5FO9B 4PLJC 3WF3A 1S7RA 3IU3B 4N0RA 5KS9A 1QNZL 4AG4H 1G9ML 3BUPA 2BSSA 2AJVL 4C56B 4LSDA 3FO0L 3LQAH 1Q94B 4PRID 3I3BA 1TJGH 3WO4B 3UG4A 1GOFA 4LPVA 1R8LA 4XNQB 2BNRA 3A47A 3D1MC 3MLZL 4NCC1 3BKCL 1IZJA 5C09D 1S7WA 4WFFD 4RBPK 1CLZL 4ZPTB 4ZXLA 4K9EL 4UV7H 3L9RB 4PY7B 4XH2A 5GRVK 4MAYA 4WWID 1R47A 5HYSB 3CLFL 5I1IL 4U6VL 3REVA 5I77A 1MNUH 3O3BB 3F58L 4UT6L 3FO1A 3IDJA 1YC8A 1CICC 3WJJC 1JZ5A 1CD0A 1ZGLA 3G6MA 2QKIB 2GJ6B 4PTTA 1AP2B 3BKML 2ZXQA 3PL6A 2IADA 1U8IB 1OLLA 1S5IH 4XPAH 4PD4J 2AJZA 2ZSWA 4L3ED 4S3JA 4LHJB 5A43C 4YIQA 3UERA 3U5YA 4JRWA 1HDMA 5EUOF 5AZ2L 1EHXA 3NZHH 5FA4B 3BPNC 1VPOL 4QHUA 4X6DB 5FUCC 4KVCH 4ALAH 5T3XH 1X4XA 2H3NB 3FT3A 2BVQB 5GXBB 2XVNA 4Q6YA 1E6OH 1T1WB 4ELKA 2Y6SC 1XMWA 5I75B 1KB9K 4P9MH 4KGJA 3POHA 5EBWB 5ADOH 4LCCB 3TBYB 1JDDA 3MRQA 2DQTL 3IFOB 5C07A 5I1GL 3ARWA 1W2PA 4XC3H 5CZVL 1BYCA 4U1LA 2GDUA 4LP5A 3VFGH 3EJRA 4WF7A 2CK2A 3HI5H 5EBGA 5TPWL 2DIBA 3VI3F 1U8MA 3AFBA 1FN4B 3O9WA 2DQUL 2WM0A 5ADOL 4AMWA 3V5DB 1LF1A 5HHPB 2PBOA 2AK4E 1A6UH 1RZGA 1A22B 4R4FH 3UETA 1YEDB 4PJBB 4NNYA 4M7ZB 5GS0L 3LKPA 4AMKL 4FFYH 2X41A 3HE7C 4BFGA 3P40A 5EO0B 5I17B 4LKCB 2EEAA 2X9YA 3MUAA 3QYCA 4CU8A 32C2A 3MROB 3HUJB 3I9GH 3DX9B 5CEZD 4LKXA 3GRWL 2ZIDA 4PV9A 3GSNA 1KLGB 4F9PC 4Z77B 1I3GL 4RFOL 3QCUL 5CLTA 4F15C 4AIUA 3DSFH 2XYLA 2X6MA 1HHGB 1V7NH 4U3AA 4KJPC 4D9LL 2R1WB 5HVFB 1N0XH 4Y4KD 4J6RH 5EN2A 4N0YH 4PJXB 2PBGA 5FECB 1KGUA 2DICA 1NANH 4ZYKB 5C0EB 2IPTL 3G5ZA 4KPHL 3PZIA 1R5VB 1QHPA 1MLCB 1T5XB 5BVJB 3QIWC 3MUHL 2Y7QB 1P2CA 4NF7A 3BLPX 3RX7A 3TFKD 1KULA 3QIUA 4NQDB 5I6XC 5CLWA 4MSWB 3N1AA 4I9WD 1KCVL 3Q2CA 5EO1B 5C0CB 5JXEC 1L4IA 4NZCA 1FO0A 1Q9LA 1GC1L 4NQTA 1KG0A 3C8HA 4JO2H 4EVNB 4HKZB 4DK6A 5J89A 4U1SA 1DWJM 3W9DA 5ICYA 3UEZA 1DLHA 1INEL 3ZKND 3H3KA 4HIJB 5AUMB 4RNRA 4X4XA 1UD8A 5HDQL 3RM9A 1IAII 4XCNA 4ZFFB 1BD2A 3MRLB 3WMBA 3QJFB 4UIKH 4Z7OE 1JMXA 1Q9WB 3TOPA 2CCRA 3QO1B 3H0TA 3ARPA 2HMID 1MUJB 3GMQA 3LKSA 5C8JA 1W1PA 4D6EA 3CX5K 1IBGH 2VLME 1CG9B 2RR3A 1KR0A 2YL9A 1J88A 2PO6D 4AWEA 3HFML 2ARJQ 1GJIA 3ZOAA 3T1FA 5F9JB 3GNRA 3OGVA 1WUNT 4Y7MA 3VXOA 2NSXA 4HK3J 1JP5A 4K7FA 5IQ9A 4P4RA 5EZJA 1W91A 5IVXF 2O9TA 1QFWL 5TFSL 3UTSA 3PZNA 3S6TA 1UJ3C 2X40A 2CH8A 1W1TA 1MAMH 1ETZA 4OFDA 4G7VH 2IQAB 5CKAA 2X4OA 1CL7I 4PFEA 3BAJA 1R86A 4JHOA 3QAZB 5F70A 1FNLA 4MQSB 4M3KB 3VXUE 1H09A 1GIGL 4FN0A 5TE4H 4MS8C 4UNTA 4DKAA 3KYNB 4OLUL 2VL4A 2AK1L 3BAIA 4PJHB 5SWZD 4MB5A 4NO0D 5JR1L 2ZWYA 1BZ7B 3WELA 1EGZA 1QPKA 3CIQA 3G5YA 5EZIH 3AXIA 4R4BB 2IANA 5D7LE 1RPKA 3RGVC 2J25A 4FLSA 1FJ1A 1Z9SA 5HD8D 5BQ7A 2D20A 4I8DA 4X7SH 3T3PF 4GZIA 1UWSA 4GKZA 5AZEH 3BP6A 4F9PA 1T04B 1UYWL 1P4IH 2FHCA 1URLA 4HUUA 1N64H 2I5YL 5TQ2L 2WVVA 2E6QA 1WCQA 3JWOL 4MD0A 5ICXA 5EIIB 4F7TA 4PPTA 3NZHL 5F9JA 1QLEH 2E6JA 2WQ8A 2I26N 1ZB5A 2EBNA 4D1IA 5D9SA 1WFTA 4GMSL 5FYJH 4TVPH 3EHBD 2N1KA 5CGYD 4I18C 4ZQKA 3WHXA 1IGTA 2CPUA 1B2WL 5EU6E 3HZ3A 1W9BM 5HGHA 1XZ0B 3BP7B 2XPGA 3BUYA 5DJ8A 5MP6L 2VRKA 3HAEB 5T1LD 4Y8DC 3RVTC 3DUSA 5HTSA 2R29H 4LVNB 5GSVB 3L3IB 4JFFD 2VDKH 1AD0A 4WRLA 3AB0B 3O2LA 1QSFB 4HCRH 1AQDA 4NN5B 1KNOB 2VLMD 5E8PA 3SDAD 5IJKA 3D0VA 4FQLH 2QHLA 5JLZB 4P5TB 4RISH 4YDLB 2EABA 4G43A 3FB8B 5SX5H 1QW8A 1T5XA 5BVJA 1J1PH 3AYRA 1T6VN 1BQCA 1GZQA 4L8SA 2YEZA 5ABFB 2PWEA 2DAVA 3DNKA 5TDOB 4YXKL 5IMLB 4R0LB 1U41A 3U0WH 4X6CF 2HFGL 4PLKD 5CP7A 3L3OA 5ANMB 3CFJA 1HIZA 1VRXA 1WICA 5KVFL 1XF4B 5ITFA 1J8HB 3FQTB 3AIQA 2D7NA 1ZLSL 1MEXL 2CLZA 4PRPD 1VBUA 3PDOB 4LSRL 5I1KL 3AICA 5KEZA 3GHEH 4RFNC 2V17L 1YPZA 3FFCA 3RIAF 1A9EB 4OI7A 1GQJA 1WO2A 3WFEH 4RE2A 2NZ9D 4HWZB 1XF3B 5I0DA 3UJIL 4MWFB 1NC4D 4Y4FA 2X4SA 3HJEA 4NJAL 1F4XL 4ACZA 3X3FL 1JI1A 1TVBA 2BNRE 4AZHA 2P8LB 2YD5A 4GAJH 5J1TC 5HVWA 1HXYB 3UCRA 4EXPX 2WC3A 5C3LD 3CUHA 2FGZA 4HMEA 4JPIB 4QYOA 1EXPA 3RUGB 1AIFB 4XCYA 2UVEA 1F6AB 2FWOB 2ESVD 2OK0H 1WWAX 4Q6IC 2W9DH 3OZPA 3DARA 3F58H 2NY2B 1MVUA 3C8DA 1CFSA 1FGVL 1IBGL 3GMMB 2OSXA 4HUVB 3GZKA 5EU6D 1XGUB 2G75B 3U4BH 1TCRB 3LKRA 2DI7A 5CMAB 1FH9A 1WLHA 4YZFF 3QG7L 3QNZB 1ONQB 5JHDE 3ZDYF 4Y4FB 4LCCC 4MZ3A 3EDFA 3MR9A 2YUVA 2F54D 3CFKB 1ZBKA 4ODSH 5F7KC 3B8YA 1A4JA 1A9EA 2A9ML 1R5IA 1VACA 1UB5B 1DQLH 3GSQA 4JG1L 2CDFB 3PDOA 2XIBA 2CIKB 3M7SA 1XCTA 3A6BL 2FX9L 4LRNL 5JW4M 4Y5XA 3OIHA 4HF5H 3B3IB 5HHXH 1T22B 3RWCB 2FX8H 2Z4QB 4LCWB 3T3MF 4EI5B 5DVLA 1VGKA 5EBLA 1PKQB 2VLRD 3CC5A 3N1FC 5K33A 4GAGH 3SO3C 4NRSA 4S1QH 4NJAH 5DA4A 1NAMA 1P4LA 4HGMA 1CWVA 5C07E 3VE0B 1KN2L 4PREB 5TDOA 3VXUD 1ODZA 2EJ1A 3MUJA 4KK6C 5C86A 4O51A 4I3GA 4JFYA 4DWSB 1IC5H 3VXTB 3FT4A 4NZDA 1OP3H 4G8FA 4TOYH 5LXGL 5JLZA 4WKHA 2AK4A 3OBAA 3BKJH 4PJDF 2V9TA 1TG7A 4M43H 5E6IC 1G6RA 1KJVA 3Q5YA 4ZMAT 3RWEA 3CH1A 2EIDA 5EFDA 1KN4L 4YDLC 1UR8A 2D2OA 1BBDH 3CFBB 1S7SA 3AFLA 4QF1A 4NWTL 4U3XA 1WB0A 3AXLB 5DJ8B 3LRKA 3BVNB 4TPRL 4YXKH 4KK8D 4M7LT 3IU3A 2QQKL 4PMDA 3MODH 1CFTA 4ZTOH 1FGNH 1NP2A 3A67H 3O3DA 3I6KA 5ILTL 4NZRL 3NIGF 1F4WH 4URTB 3UC0H 4QRQA 3H9SD 1NAMB 1PLGH 2WUCH 4WTZA 5CWSA 1M05A 3O6FD 1W72A 2DMBA 4EUPH 4TVDA 1L0YA 2NXYB 1FH8A 3VG0L 4OQTL 1TTUA 2VABB 3HG5A 3GDBA 2V2TB 1NFDB 2Z31D 1WISA 4KGLA 5HGBB 1V6WA 2P7TB 3NA4A 2IFFH 2R56H 4G9DB 1INQB 3IDNB 2X7LA 4ML4A 2YPLD 3VGBA 4IIQB 2A6JB 4JQIL 1NMBL 5EU3A 1NCDH 1WC7A 4WUUB 3S96A 1JF6A 5KG9A 4IM4A 5A6BD 5HPCA 4OD3H 4XAKD 1AE6H 2H45A 4WUKH 1S9KC 2X1WL 3W29A 2HJLA 4LBEA 5LKNA 1NJ9A 3N1GC 2EACA 2VXVL 1IEBB 1X4ZA 2IQAA 5DLMH 3MRJA 1OAYL 5FV1L 1Y18A 4PP2B 2V3GA 2YBUA 1A2YA 5IMOB 3O2DA 1NGXB 4XNMA 5EZJB 1FGNL 1V6YA 3CFEB 5JXAH 3KPRE 1KIQB 3O41A 2FHFA 1R3LA 5CBAA 1XGRB 5TE7L 2BY3A 4FQIL 5E1AB 2J88L 1CG9A 2JCCE 3T08A 3MU7A 4GKNA 3RMEA 2H2SC 4L4TE 1YYML 1MVFA 2HP4A 3UTPE 3WNMA 4YR6B 1OAQH 1KCLA 3MRFB 5AD0B 5I30L 1BJ8A 3IDGA 5TE6H 3V0AC 1XEDA 5EOTB 1FIEA 5MP6H 3VGAC 5C0JA 1JXKA 1HF6A 4OZ4A 1I9IH 5LQBH 3ZJKA 5F9WC 2VC9A 3S5LA 4HBCL 4AEHH 3HE7A 1A1MB 3C6LB 4L4VD 2ZX9A 3C5SA 1KJMA 3BPNB 3O8XD 4CDHA 4H8WL 3PE9A 5EZOH 4L4VA 1SMOA 1X5KA 4LDLB 1QLEL 3JV4A 2IANE 1C93A 4YHIA 1YY8B 3R4DA 5D7JB 3OKMB 3BMWA 5C2BH 3L3JA 3HG4A 3QUYA 1DVFC 3SDDB 4LRNH 2UYLB 2FEDC 5T3ZH 4J8RB 4M7LH 4NZFA 1NCWH 5FYKU 1IM9B 2BP3A 4N0UE 2DLTA 3MLZH 4WUUE 5GS3A 5IFAL 1BM3H 4GO9A 1JI2A 3RZCA 1AGFA 4UQEA 3EOTH 1I75A 1RP8A 5H2BA 3TO4D 5HXMA 4UQAA 1MW0A 3C5ZB 1VGEL 4LKXB 2UY7A 5D6DC 5C0JB 2D7PA 4XB7A 1OB1A 3DX9A 3IDGB 4DGIL 1LP9F 4PMVA 1HT6A 3OLDA 1IGTB 3MMUA 1JWUA 2WBJC 2M26A 2XRAL 2UVFA 2X4TA 3L4UA 5D2LF 5SV3A 1O7SA 4XTRD 2XWTB 3I6GB 2CYGA 3RNKB 2AJSH 1S5HA 3QXWA 4NKQB 1VFBA 4I0PD 5EIIA 4XVJL 2XZQH 4U6XA 2AV1B 5IB2A 1CICD 4YHNB