5CLWA

Crystal structure of human glycogen branching enzyme (gbe1) in complex with maltoheptaose
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
658
structure length
637
Chain Sequence
VDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNREKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 1,4-alpha-glucan-branching enzyme
publication title Crystal structure of human glycogen branching enzyme (GBE1) in complex with maltoheptaose
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 213
structure length 637
sequence length 658
chains with identical sequence B, C
ec nomenclature ec 2.4.1.18: 1,4-alpha-glucan branching enzyme.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5clwA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5clwA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5clwA01
2W07A 1FDLL 32C2A 4JQIL 1I9JL 1RUMH 1A0QL 4IS6B 4ZFOA 2CHOA 3LMJH 2ICWB 4H41A 1BG4A 3X12B 3H3PH 3BZ4A 1A4KA 3WDHA 4CRPA 4KDTA 5K9QI 2VL4A 1SQ2N 1FO0H 5IWLA 1T1YB 2D9QB 2QQNL 2YFOA 4WJ5B 4X4YA 4KK9C 1DL7L 5TQ2L 4LLUA 4YHIB 4AMKL 2QHAA 4BS0A 1QRNE 1ORQA 2QHRH 4GOSA 3L5XL 3F5KA 4LEXH 4BQ8A 5I73B 4PGDA 2DQDH 1V7ML 3DETD 1X7QA 4U1SA 1OP5K 4JFHE 3JVGA 1V7NL 4RCAA 1AQHA 4MYWB 5E8NB 1QNSA 4DJMA 3L3KA 4PS4H 4GBXB 3RJYA 3FFCB 1X5GA 2A9ML 3NFSH 2DD8H 2GFBB 3UBXA 3SDCC 2JCCA 3G04B 5IMKA 1I75A 3D1MC 2G9HA 4P2CG 2PO6A 2E27L 1E4WH 1NFDF 4KRMB 5B22A 1U2CA 3QCVH 1M1SA 3VI4F 2GJ6B 4HHAA 3CUGA 4F3FB 1RVFH 3BUBA 1L6XA 4MADA 4NBXB 4HWBL 7FABH 1UWGH 4YDIH 5F7YC 4JE4B 1T03H 1QZ1A 2CETA 4P3DB 4MWFA 3ETBF 4XNYL 5CWSA 1LHZA 2A83A 3WFBH 1YEJL 2P7TB 5HHOA 1KEGH 2R69L 1IAMA 5DC9B 1Q94B 1SEBB 2CDFB 2E40A 4R26L 1E6OL 4UTAL 1VGKA 1I3GH 3SCNA 2XT1B 1F11B 1EOKA 1E71M 4YE4H 3UTSE 3PTQA 1UQSB 3BKML 3ZT7A 1YEHH 2FO4B 2J7DA 3CLFH 3LN4A 1XGUA 3T0EC 1QEWB 4NHUA 4YDJA 3U7WH 4YLQT 2PWFA 4LHQB 1UWXK 2NY2B 1OW0C 5IM7A 2GTZA 2UY6A 1AGDB 5IROC 4PJFB 2ZOLA 3BP6B 5GS3A 3WS6A 3LEVH 1A9BA 4V28A 1XF3B 1JF5A 1E73M 4KKCC 4YQXH 3CU1A 2IXUA 1MCRA 5CCKH 2DQGL 4PV8A 2LVEA 5AZEL 3V6OA 1FL6A 1CGSH 1C08A 4LSDA 5I1DB 2R0KL 1IL1A 1NC4D 1KXQE 3L3DA 4K3DL 5A2BA 4WHYH 4XX1E 5A6BA 4OCWH 1MAJA 3C60B 1ZGLP 4IRSC 1GVIA 1KUMA 3O4LD 1EOMA 3SY0B 5GHWH 4EUPG 5SX4I 3ZKQD 2H9GB 1JGEB 2VDMH 4JHZA 2XKNA 4OCSL 2XN9D 3QUYB 2XIBA 2BCKA 4ZG1A 1IGFH 1KN2L 4HXAH 3MNWB 4CN6A 4IUGA 3HA0A 4LKXA 5E03A 2XVLA 5EU6D 5C08E 4MA7H 5ISZD 2Y9RT 2BDNH 1WP6A 4AH2B 7A3HA 2IFFL 3AFLA 1NGZA 3UDWA 2FR4A 3MUZ1 5CEZL 4NQCA 3RVTC 4POZC 5A8OA 3MMEA 4AEEA 1T22B 1NFIB 3MSGA 1B3JA 5F97E 1HXKA 1MCLA 4GG8B 4QO1A 2FX7L 4MNLA 1T1XA 2YPKB 5ID0B 4MSWA 3TEUA 5IG7B 3H9HB 1P6WA 3JV0A 3TESA 1DBKL 3I84A 4FTVA 2VDKL 1SJVA 2RGLA 1U0QA 2VABA 3ARFC 2XFXB 3CV5A 1HVXA 1E70M 4XCEA 2Q8BH 2V3GA 1FO0A 4ATLA 1V6YA 1CPUA 1UZ8B 4QOKA 1R5IB 2GITA 4QXGH 2GK1A 1W3HA 5ID1B 4EI5C 3TBSA 2CLRB 2EZ0C 3HG4A 3GNRA 3PQYE 4AK1A 4KVCL 4KK9D 1BOGB 1H11A 1U8NA 3SHSA 3KYOA 3OWEA 2B4CC 1K85A 4S3JA 5HYEA 2PXYA 3NABH 2OSLA 4ZUVB 3O3BA 3FQTB 2V7NB 4I48A 3UAJC 2X05A 4Y5YB 1G9EA 5DDHB 2PKDA 3QEGH 3WL1A 3LSOB 2NX5A 4XNZC 1I9JH 5BO1L 3DX7A 1YYML 1A0QH 2WWMC 3PHQA 2X4OB 2VIRA 2DQXA 2Z93A 1CGXA 4ELMB 1CFBA 2VLRA 1YECL 3RM4A 3U1SH 2CKSA 3M46A 3CLWA 5C6TL 3G5XA 5C09B 3BEVB 3MV8D 1YPZA 3UTQA 1HKKA 4FQXB 4L9LC 4P9MH 4Z2HA 1TTGA 4P5MB 2FZ3B 5CSGA 3P4MB 3V6ZA 1DL7H 3VW3L 5TQ2H 3S7GA 4AY1A 2FGWH 2R1WB 4AMKH 4CMHB 1BVLA 2EDWA 4KRTA 2J5LB 3B43A 4JM2F 5T1LA 3VWJB 3VM5A 2J8GA 4NX0A 5TDPA 4LQFL 5DEGA 3ZDZE 3BVUA 4I3GA 1V7MH 3CCHA 3P30L 2HLFD 4DEPB 5HY9A 5IKCB 3GKWH 4CNIB 3K4ZA 3BUYA 2FJHB 4UQ2A 2A9MH 1CQYA 3W39B 2FX8L 4C57C 5BJTB 3QR2A 5IB4B 1VACA 4GZEA 3O6FA 4M48L 4G80B 4ZPTB 2E27H 3LPGA 1KTCA 3B5GA 1L4IA 3I75B 5IEHB 4JPKL 1ECEA 1HKLL 1CDIA 2GT9A 4MA3A 2UYLA 2EO1A 3IJ7A 5M17A 4ZNCD 1WTGT 3IDUA 5SWSE 4HWBH 2KQMA 3TYFB 2NY5C 3QEHB 1B0GB 3S5ZA 3OKNB 3RVUC 2VXQL 2XICA 1O5DT 2AXFB 4Y19E 1U8MB 4XNYH 4YBHA 1MRFH 3VFGL 4WV1C 4LCCC 4MMZC 5BRPA 4LFHG 4L4VE 1YEJH 4JKPL 5ESAB 2R69H 3WXWL 1D9KA 3KNBB 5JPNB 3FAWA 3SE3A 4ODVL 1QUNA 2ICEA 5DRWA 1IEAA 4R26H 2WC7A 4Z2LA 1MFAL 4P23C 3W0WD 3JSSA 5C70A 3CHFA 4XGZA 3I9GH 4DQOH 2W60A 3DJ9A 1T7YA 4CVZB 2XN0A 1E56A 3OG4B 4WU5A 4RMRA 2X9WA 4OZFG 3JUZA 5CJ8A 5MERB 5E08L 1FNFA 1PBGA 1US2A 1HINL 4NQXA 4RGMB 3W27A 5CBAB 3W5NA 4E8CA 1KJVB 2PR4L 3L3GA 2ZUNA 2L4OA 3QDJA 5GJTL 5AZEH 1S5IH 4G6AD 4O2EB 1YN6B 2P46B 2R0KH 4POZD 3AROA 4DWSC 4K3DH 1H3GA 5HDQL 3W53A 5JHDB 3E0GA 3G5YA 4XNQB 1I8LC 5IVXE 5DJAA 3PZNA 1QVOA 4LCWD 4ALAL 1BZ7A 5CSYA 2GUOA 3ARFD 1QR4A 3GJEB 4PJ5E 1ZWIA 5I1IH 1SBSL 3ZKSD 3TA3B 3V5DB 4PRHA 2NW0A 1F2QA 3OKEB 4OAWB 1HXMA 1NP0A 3PTKA 3REWB 3VA2C 1ZE3C 2EZ0D 1A1NB 5I1HL 3HRZA 5K9OB 1PYWA 2DSWA 2FL5A 4Z7UB 4DAGL 1GXEA 3FB6B 1N0XL 5DJ8B 3MBEC 3UAJD 5K59F 3DVFA 1A2YA 3VXRD 5FHBL 1NBZB 2FX7H 3VSUA 2CK0L 1UKQA 3T77B 4FP8L 5MEPA 4OM1L 2WWMD 2EDDA 5C92A 1DBKH 2VDKH 5KVEL 3QEUB 4ACZB 1MVYA 4OV5A 4ZXBB 4OCMC 1M05B 3B9VA 1WWWX 4P8XA 3TZVB 5ACZB 4R3SA 5D6CA 3WFHB 4V2XA 1CL7I 1Z5LA 2C5DC 2P8LB 3AXLB 4YDKL 5F7HA 4PMNA 4QCFA 2QHLA 2VAAA 4ELMF 1IC7L 3U0PA 4CD8A 4P99A 4BSVA 1GZPB 5E9DA 2YPLA 3FO9A 4JFYA 3CC1A 3DX8B 1C8XA 1EQPA 3DO7A 4QDMA 5FCZA 5L9DL 1UA6L 3GTNA 4A6YB 5FL1A 3CFBA 4JQXC 4LDEB 3X14A 4U1NB 3D3AA 2VLME 1TETL 2CGRL 4RDQF 4X6CE 1NBYA 3EMZA 4PCTA 1OTSC 3CFDA 2WW8A 8CGTA 5BO1H 2IQ9L 1YYMH 2QSQA 5FGCB 2JE8A 3PDDA 1NPUA 1P4BL 1YECH 3SGEH 3WL9B 4HKJA 2DAVA 3RL2A 5JW3H 4Z2KA 3ECBA 5C6TH 4PJHA 3IDXL 4N9OB 5CJ5A 1GPOL 1I1AB 5F6IB 3CMOH 3BIKA 2VDQH 2R23B 5MP6L 3WJJA 4MB3A 1ZT4A 3OJVC 3KVQA 1UM6H 3BZEA 5JUEL 5CILH 2V7HA 3Q0HA 3QXUA 4LSUH 4M93B 3C5ZD 3LV3A 4JO4L 4W70A 2BOCA 1BJ1H 2OL3L 4OZIF 3O3EB 1LEKA 2J8FA 3GMOB 4OZGA 4RBPK 4LQFH 1QTYT 1JN6B 2E3VA 3MV7D 4L29A 1QFWM 3I3DA 4P0DA 1S7VA 3SCRA 1AR1D 3RVUD 3P30H 3W2DL 5D9NA 1P84J 4M6NH 1BYCA 5I16A 4OZ4B 3T8XB 3KYMB 5GS0L 2OYLA 1SR0A 4W86A 1HJVA 2AAAA 4PLJC 1W3KA 25C8L 3BIAX 2FH6A 3L5IA 5HI4C 5DQ9B 2GJPA 1KLUB 3MLSL 5HGAB 1F13A 3O6LL 3QDHA 4P23D 3W0WB 4HKXA 2ED9A 4DN4L 3BC9A 3TIEB 4M48H 5TDNB 2VZOA 3QEQD 4KHTH 8A3HA 2HFTA 1XH2A 1NLDL 1Q0XL 1HKLH 5HYJE 2OW6A 1X5XA 4AD5A 3TF7C 5C0JB 3F5JA 2VR4A 3AZTA 4ZFFA 3JV6A 3UBXI 1WAAA 3RWJB 1IKFL 5CMAB 2WCGA 4HU8A 4M8UA 2CBJA 2GK0B 3NFNA 1QFOA 2VXQH 2VN7A 3AMDA 2YL9A 2PETA 3MLWL 4LOUC 4QHUB 2KUTA 4R7DB 2E6QA 5GSRA 3ZYJA 3QHTC 2C1OB 4V1DD 2H32H 3GSQB 1ODUA 3HLAB 1PX4A 5I2IB 1FFOB 4ELKB 3TTYA 4DWSD 5IB1B 1KIRA 2ENYA 5GGSB 4JM4H 3W0KA 1MFAH 2WZPD 1D5MB 3PABA 5BS0D 1JF6A 1MAKA 2DQIL 3WLBB 1N8ZA 3Q3GB 4LCWB 4WSKA 2AV7A 5KSAC 1F6AB 5B3JE 3W26A 4BF7A 3OXSB 5DRZB 1MIMH 1IT9H 2VLKA 5KS9B 1YEGL 3BQUA 5E08H 3QH3A 1JPGB 1HINH 3LN5B 2JCCE 3ULSA 4PGJA 3CMGA 2Z31D 2AK4D 1OM3H 4OV6F 2PR4H 1A9EB 1KCVL 2HLAB 3VXSD 3H9SD 4DKEH 5GJTH 4PJAB 1JZ2A 5E0QA 5A6JA 1F4YL 3EJSA 4H5SB 2HN7B 4IOIB 4PTXA 4HUKB 4OFYA 1CLVA 5HDQH 5FIEA 4M80A 4NRYA 2EO9A 3MBED 1K3ZA 4LP4A 1CS6A 4YBQD 2R4SL 1S7QB 3BJLA 5HPMA 1VERA 3GSXB 5A8PA 2CUMA 3VRIA 1AKJB 4ALAH 5DS8A 1MEXL 2V17H 3FFDA 4OF0A 3MJ6A 2DL2A 3C6LA 3AYRA 5HHOE 2IBZX 3OTTA 3WNPA 4G5ZH 3MJ8B 4OKDA 3MRHB 1UQYA 3E1F1 3B8SA 3C9NA 4Q2ZA 4MAVA 3EOBA 1MW3A 2E4TA 1YQ2A 4K7PL 5C07D 3IB4A 5I1HH 4L8DB 2OYPA 4Z77A 4Y5VA 2EKSB 3VIPA 2MSPA 3HPJB 3MV9B 4GRMA 4M24A 1G7HA 5F3BB 3BW9B 5FDWA 4L3CA 3O9NA 5FHBH 5M03A 4PPTA 2Q76B 5J6GA 3ALGA 2PYEA 4FP8H 4OM1H 2CLVB 4G6ML 2A3HA 4E41A 4TUOA 1WWCA 1HCFX 1FG2B 2HA1A 1BECA 3GMNA 5I15L 4GI6A 4F7TA 3BSGA 3LRHA 3CSBA 4ZXLA 1OLLA 3V6OE 5AY7A 2WPGA 4U6HA 2D7PA 5ICYB 4PBXA 1ES0B 4ZAKC 2DKSA 1IAOA 4PJ8C 4YDKH 2OZ4L 2GYSA 4N9GA 4KV5F 1IC7H 5JXAL 1R5WB 1GQKA 2OWWA 1RJYB 1BGAA 1VPOL 3C5ZB 4Y1AA 2G5BA 2CLZB 1UR0A 4D71A 3IS1X 4G3YH 1SJEA 1D7FA 4L8SB 3D18B 1TETH 2DI9A 2VQ1A 2CGRH 2VXSH 3I02A 3LIZL 1FZJB 3DX0A 3WY1A 2A3CA 4ODXB 1CLOL 2ZKHL 3EFDH 2XJ7A 5L6YL 1WDRA 1CIUA 1P4BH 2H45A 2C7FA 2VXVL 1GONA 4LCYB 5HI4D 2DWDB 3IT8D 1XZ0B 4NQCE 2BJML 3IDXH 5LJYH 3FCTB 2ZXQA 3SUSA 4QXUL 5DZOA 1QLFB 2GY7B 3Q5TA 4JY4A 5HYQB 5ADOH 3V4UL 1XGQB 1LDPL 3IDYC 4OJFL 4EBQL 4ETQA 4PMRA 1WCBA 2W66A 3QIBA 2VITB 1U8JA 2H2SC 3P0YL 1QQDA 3QHOA 1QG3A 3MUIA 1OAXL 4JO4H 4LHUG 3KPRA 5J9PB 3QI9A 2OL3H 4Q6IB 3LKSB 4QRRA 1XD0A 1DQTA 2GVYA 3MS8A 5J11B 4QOKE 5MENB 3DBXB 1IC1A 3S4SA 1NAKL 4PMOA 2X7LB 1GJUA 3W2DH 4M8QA 2Y5TB 5TH2A 2H32A 5CSZB 1UGNA 5HHQB 2HP4A 2NY0B 1NDMB 4HIJA 3PWPA 4X6FA 4MJIA 4WHTB 5EU5B 2FWOB 4M1RA 5L2JB 5TQ0L 4GQPH 4XWGL 4F9LC 4XBGB 1HN1A 3B2VL 1NWRA 3MLSH 1T2XA 3O6LH 3QWOA 3VNZA 2Y8VA 1M04A 1NCWL 3TN0C 4TVPD 1XF5A 2OI9B 4LPYA 4DN4H 1OLZA 3NCBB 4P5TB 3WFCL 4HIEA 4JG1L 5JOFB 2NX5E 1Q0XH 1MJ7L 3MFFB 5LA1A 3RGVD 1CE6B 5TGBA 5KSAD 1BQCA 1ONQA 3JXAA 5KANG 4R97C 5DUML 3HG1D 3MKKA 3AMLA 3P77B 5GRXG 3FT4B 1E55A 3BAKA 4OFDA 1HIML 4HZLB 5T3ZD 2Z31B 1JCKA 4XPGL 2DQTH 1YPZE 3VXSB 1QRNB 1MLBB 3H9SB 3P40A 3MLWH 3LB6C 1ZLWH 3ZR5A 3IXAA 1MAML 5GRVK 4QNPE 4JR9L 4HK3N 4BA0A 4PY7B 1R3KB 1HJQA 4JHAL 4H1LG 1A5FL 4P4KC 4XWOD 4P46B 4OF5A 3LPPA 1FYHB 5EZOH 4P4RA 3BUQA 4APQA 1TZHB 3CX5K 1H5BB 5F1KC 1NQ6A 4LEOA 4UB0L 3UTOA 3N04A 3SUVA 3PE9A 1KB9J 3WFLA 3QNYB 1VJSA 4HA3A 5DSCA 1YEGH 3BH9A 5JNYA 1CDBA 1RIVL 2XQYK 5I1JL 2VWEE 4NQUA 1PY9A 4QTHB 4GRLA 4URIA 5BZDA 1KCVH 3EGSB 1SJHA 4G8EB 4U1MA 4WO4C 1LILA 4BZ2L 4NKMA 4V27A 4QKXB 4ZQKA 1WIPA 4CCCA 3QZWG 1F4YH 1ZGLB 3MRJB 3WDJA 2IAMA 1G5AA 5D1ZC 5I2UA 3ULUH 4MDJB 2R4SH 12E8H 1PKOA 1REIA 5DHYA 1NGYB 4J1UB 1S9VB 3GI8H 3PDOA 1HHHB 3K7UA 4U6TA 3S2CA 3OV6A 1E0WA 3RP1A 1UYQA 4POYA 5BOPA 4YXKL 5MEOB 3FOMB 1MEXH 2EEBA 3FTGA 2VCAA 2B5IB 1FJ1B 2AQ1A 3MRCB 1X4ZA 2WMIA 3LKQA 3P11L 1KN4L 3BVWA 5IF0B 1CE1L 1U8OB 3GJFH 1DHKA 5DJXA 2V3EA 4GQRA 3LQAL 1T2QL 1C8QA 3TTOA 3H55A 4ZAKD 2B2XL 4N8CL 1JNHA 4K7PH 3LZFL 3OLGA 5H2BA 4FQHB 3NCMA 1CZ1A 3KPMB 1BSIA 3T65A 4PUBH 1BGGA 3OKYA 5CAYB 1A7NL 2Y7QA 3UCQA 2WUCH 1LEGA 5AUMA 2APVA 1JNJA 5FYLE 4YAQA 1QYGL 2NMSA 3OX8A 3S5LA 1IGMH 2FHCA 1GW1A 3LKRA 3LAFA 1ZT7A 1CK0H 1XEDA 1HOCA 2YC1A 4KGLA 3GZAA 1YJDC 3GO1H 3ARUA 4KZDL 5MEQB 2DT0A 3NCEB 3IYLW 2J4WH 5JIIA 1JWMA 2ZCHL 3MNVA 3ULVE 3WF1A 3QO1B 4QHNB 2DMBA 5JXAH 2MOVA 1QOKA 1KJMB 2H2SD 2OL3A 1VPOH 5L88H 3FXYA 4BH8B 1RSFA 5C08B 3MANA 1RZIB 1OSZB 1QHZA 2UWFA 2YS4A 4QYOB 2RJMA 4Y4FC 5GS1C 1R3JA 2YA1A 3GEWB 4UDTB 4PRHE 1JP5A 2CJUL 3LIZH 1IGTB 5B39B 3EO0A 3PL6A 1B6UA 2VL5B 3MI6A 2ZKHH 2A3AA 3VDAA 1NDGA 1YY9C 2OJZL 4WHDA 5IT2H 5IB2A 1CEOA 1DZBA 4X4MA 2VXVH 3KWWA 5F7UA 2D03L 5DF0A 3WENA 2BJMH 2OCFD 4H2CA 2ORBH 3BISA 4PMQA 4NZTL 3GSWB 4QXUH 4XAWL 2FHFA 3TN0D 1IV8A 1NEZA 3V4UH 4G9FD 1LDPH 4GS7B 4OJFH 4EBQH 5JOEA 4W4OA 3RGVB 5EOCJ 2XTJE 5JBEA 3P0YH 1PZ5B 1BX2A 1VADA 4YPGB 4BH7B 4ZENA 2EXYC 2L7UA 4F8TA 3GUTB 3GZKA 4Y4KA 5HYSB 3HAEH 4LVEA 1X4YA 4G6KL 1YNKH 3PQYB 4UINL 4L1HA 2D0GA 3I6LE 1WFUA 2EH8H 3OJ2C 1LK2B 1UWQA 1FVDA 2R39A 5DXWA 1AQDB 2R2BA 3LB6D 4HMEA 2BOBB 4F80A 5KVGL 5JDSB 1LE9B 2Y8KA 1YNTB 1RJZA 2XWTB 4FQQA 5E9DE 2HFEB 2YPLE 5TQ0H 4XWGH 4P4KD 3B3IB 4IIQC 4ZUTA 3QQ9D 1R85A 2PBOA 1H0DA 5K9JL 1NCWH 2WYSA 4D1IA 2EDXA 3RVXD 4E5XA 43C9A 1JAEA 2YD1A 3VVGA 4PJXA 5E8DH 2P4AB 3WFCH 1YNLL 4JG1H 1EIBA 3AIBA 5DJYA 1E4IA 4ORGA 5E6ZA 3OGOE 4NNYA 4Y8AA 4AZBA 4XAKD 4PTWA 4QLKA 5IFTA 5DUMH 1JGIA 1FNGB 3VA6A 2HJKA 1JDCA 3DDGA 4KTYA 4CW1B 5E5UB 1HIMH 4JCLA 3BH8B 1R3HB 2XWBB 3B4NA 4XPGH 2CESA 2C3WA 3PGDB 4HS3A 4HU0A 5BROA 4WFGE 4YHKH 1EJOL 2H26B 1X6LA 1HTYA 2DQFB 1U8LA 1N6QL 1JNDA 4HPGA 1MAMH 4FQCL 4JR9H 3DSFL 4QCIA 1TFHA 1JNLH 4JHAH 3MGAA 2OJEB 3GNML 2DM2A 3LH2H 5D1ZD 1NOWA 1W2VA 3BPLC 3P9MB 2MHAB 5D6DA 3H7LA 5ERWA 3WEMA 2XV6B 3D85D 4OZGE 4NCC1 2ZUUA 3LPWA 4IHOB 4EKJA 4HZ7A 3GJFA 2YL8A 4PTUA 1BWWA 3ARGB 2C3VA 3QUMB 4MD5B 5IFJB 4UIMA 4FK9A 1C5CL 3NN8B 3JV4B 1T0MB 4RE3A 2GY5A 4G42B 4PRAB 2Q7YB 1NQBA 1GOQA 1RIVH 2EEDA 3QCTH 3OKMB 5I1JH 1F97A 1VGEL 3HI1B 5A94A 3WKZA 4PG2A 3D2UB 1T83C 3QO0B 1NC2B 1AO7D 3QHNA 4BZ2H 3VG9C 4LYRA 1SVZA 3GMLA 5FUCE 2BMKA 5TPWL 4XTRD 5EO1B 1CFQA 4OOUA 4Y19B 1J05B 3AYSA 1LK3H 1R5VA 1H1NA 4OD2B 1QVBA 3HRPA 4L4VB 4LCIH 4Z7WA 2O26U 2VH5L 2LU4A 5HI3C 1CYGA 2WVSA 5DK0A 1WC7A 1CXFA 4JHOA 1FQ9C 3BO8A 4YXKH 3CZKA 3W25A 3QNXB 5A6AA 1XMWA 2R0WL 4LHUD 4HP5A 4PSPA 3P11H 2BVTA 4Y7MA 3U5YA 4Z2JA 3IFOB 2P5EA 2K3TA 4PRBB 5AYQA 2FRGP 5ABFB 5EUOF 3O3DB 4N8CH 5JORA 3BAIA 3RY6A 1XGTB 3ARBA 3LZFH 3QUZB 4Y5XB 4BQ3A 2CR3A 3K2MC 4P2YA 5FM5M 5FO7B 1CCZA 1HKFA 4GW5B 4P49A 4YGVB 5EOCL 4Y4FD 4Z0XA 4X5WB 4UQ3B 2WZEA 4HFWB 1OAUL 2VLKE 5EU7E 4XP5L 5IMLB 1UM4L 2D3NA 4NO2B 1WZKA 3HZMB 1YY9D 3F58L 4OCYH 1Z9LA 1L7TH 2HJFA 3VO0A 3ZE1F 2PBGA 2IANA 5IVXB 3AIVA 3FB7A 3SCSA 2DLHA 2ZCHH 1GQIA 2JKXA 4JN1L 4PJ5B 3MLVH 3SGEI 1Q6DA 5E5MA 2DIJA 1HEZB 4C58B 5IJKA 1MWOA 2AEQL 5A3ID 3KHOA 2CKBH 4AEIH 1A6TB 3HAEA 1VEPA 2EXYD 4I4WA 1K8DA 4WI9A 3D3VD 3MRIA 4H8VA 1CICA 3DX6B 4U1HB 5FA4B 2YIHA 4YHYC 1EXUA 2CJUH 4PMUA 4LSTL 1YC8A 1D2KA 5B8CA 3D39D 4PTVA 2D4FA 1AIFA 1U8KA 5I1CH 1U36A 4BQ6A 2OJZH 5JOPE 1N5YL 2J8UA 1V02E 3IJSB 3VIJA 4X9FA 1S7UB 3CFIC 4MJ6A 4D0CA 3VE0B 1Q9OA 3SEPA 1DLFH 4NHCL 3CZSA 1TZ7A 1HILB 4OTXL 4K3JH 5AYUL 3ZE0E 1S9YA 2XGIA 3VMOA 4WUUD 4G8GD 4N8VG 2X4NA 4MCYA 2PYEE 2DLFL 4U0RB 5D7IA 3RWDA 4I3SL 3S3SA 1ZEAL 3GSNL 3EDFA 4NN5B 3CPLB 4LRIC 1QI5A 3O4OB 4FXGB 4G6KH 3OAUL 4UINH 2R29L 4UT6L 4Y88A 3SKUD 2OSWA 3MNZA 3BMVA 4C56A 1U8HB 2ZUYA 5EBWB 2X89D 5GSVA 2LTQB 4WY7L 2DQCL 1RMFL 4LAQL 3DX1A 3TPUB 5KVGH 3DARA 4RL3A 4X6CB 4ODSL 4YC2B 2PTUA 2VAJA 4FMVA 4QHLB 4Y1AE 5DJ6A 5FOJA 3WKNA 3BP5B 3TLRA 2CITA 4CU7A 1CENA 5JLZA 3G9AB 4L4PA 5MHSE 2HMIC 5K9JH 2PF0A 4R4NC 5M94B 3NGBB 3LD8B 4IMLB 5IDIA 1YNLH 3OIHA 3FQXA 4XMPL 2G4FA 4X5XB 1FRGH 5BXFA 4U6XA 4ODBD 3VGAC 2X4QA 2EXOA 3T0AA 4R27A 1T21B 5C0CA 3BDBA 4FQ2H 5A6BD 1K9DA 2Y5EA 3QRGH 3CFJB 1WBXB 1GOGA 2IG2H 3HFMH 4WI4A 4H04A 4JREC 2X42A 1CFTA 1AO7B 3CC5B 2NW3B 4DGYL 4LLAA 4ZUWB 9CGTA 3OXRB 3QUXC 4FQCH 3DSFH 1HI6A 2F5AL 3VJ6B 2FEEL 3GNMH 1P5UA 4EOWL 3IKCB 3KPPA 4IOSD 5L0QC 3ALPA 3KPRE 2P24B 1TQWA 2WVVB 4QRRE 3MCKB 4O4YL 1I7UA 3BPCB 2WAHA 3R0MA 4L8BA 1ZB5A 4NO5B 1NCUA 1CD1B 1N3NB 3BWUC 1VFAA 3NJ3A 1VIWA 3LEXB 3PWPE 4MJIE 4WTZG 3T4YB 2JF6A 2RB8A 3IRPX 4DOHE 1FN4A 1I1YA 3ZQ9A 4UOW0 4ZFOB 3P73A 4FTVD 1FGNL 4RGNE 4X4XA 3K46A 2HISA 3QWRD 3BZ4B 1A4KB 2QMJA 3VXME 3LXCA 2KH2B 4KJQC 2D31A 1DBBH 3B9DA 1ZHKA 4X4YB 5CD3A 3L3JA 4KI5E 4LLUB 1A6PA 3U7YH 1ORQB 4DK6A 1RHFA 3KPLA 2PXYD 3VU2A 5ITFA 4PJ7B 4JDZA 2YZ8A 4AZ6A 4PGDB 1BEYL 1X7QB 4U1SB 3RDTC 1NMCB 1I4FA 2ZUQC 4K94C 1KTDA 4X7FC 2CKBA 3L3KB 3NA4A 3WD5H 3X3GL 5GGQL 1JIBA 2NW2A 1WISA 1IAIL 4HOXA 3UBXB 2JCCB 4LVNB 3IKKA 4Z0BL 1ZA6B 5IMKB 3LRKA 1BF2A 2G9HB 2PO6B 3WNNA 1EO8H 1OAUH 4YN5A 4OFVA 3C8HA 1UM4H 2Y6SC 2YBTA 4WW2F 2XFFA 2NTFA 3T0WA 4LKCA 4HHAB 4W93A 1I85C 2HG5A 1K4CA 3S34L 2W9DL 5I74C 5GRUH 3HZYB 5JIKA 4N8PA 2CK2A 2JFEX 1WT5C 5CWSB 1KFWA 4JN1H 2A83B 1FNLA 3MRDA 3OQ3B 2ZE0A 4FZ8L 4WUKL 3QXAA 1CXIA 3VWKC 2AEQH 3CFEA 1QHPA 2J7BA 2YUWA 3MLTA 1PFCA 2O5XL 3THCA 1VGKB 5F3HA 4MS8C 3WQ6A 5HDBF 1RZJL 4YFLF 4DM2A 3LN4B 5EB8A 2YZ1A 1T66C 1XGUB 3VXQA 3BN3B 5D7JC 4LSTH 5IBLD 1YMMA 5L8JB 1JG9A 1V3IA 4NHUB 4MNGA 4YDJB 3N85L 5FKAA 3STZA 1AFVH 2ADIA 2AKRA 5EBMA 1BGXL 4E9LA 5IM7B 1UWSA 3UZEA 3P4LA 2GTZB 4PLKC 2W9LA 2ZOLB 1A9BB 4NHCH 2HMID 1AHWA 3A4AA 3FZUC 4OTXH 5EA0L 5AYUH 3AXXA 4R4ND 1NMBL 4TTDD 4W6WB 1CT8A 2E0PA 3ALWA 4PV8B 2EIBA 5DD3L 2FE0A 1FL6B 3SJVA 1C08B 1FE8L 4EK7A 5D71L 1IL1B 5BW7A 1D6VH 1UA7A 4EANA 3L3DB 1N26A 2IGTA 2Q6WA 4JRYA 3OZ9L 1ZHLA 1UOKA 1ZEAH 1GC1C 3GSNH 1Q6GA 2YDRA 5I78A 3KPSD 5CLTA 1KR0A 1GZQA 3OAUH 4OLWL 2R29H 3NOIA 3WD2A 3F5WA 2XKNB 1HWHB 1RMFH 4LAQH 2BCKB 1J5OL 1SM3L 3QUXD 2G75B 1QFHA 1G1YA 2BSED 4LKXB 4JFVA 3GHEH 5D7KE 1WZ1L 2CHNA 1BAFH 1AGCB 2I07B 4XP6H 2YWYA 1B4RA 3O2VH 1NGZB 2FR4B 1ZMYA 5CD5D 3QDJD 4I0PA 1QBBA 4FNUA 4HWUA 4NQCB 1JHLL 3MMEB 1VDGA 1U3ZA 4UFJA 1IFHL 3VDCA 5BWFA 1T1XB 2IJ0C 1E6SM 4MSWB 1QI0A 3RA7L 2FBOJ 4FLRA 4FTVB 4BQCA 5D4YA 2VABB 4DGYH 4GG6A 1INDL 1FO0B 5KOVC 5HJ3A 4ORZC 1J0IA 3L2MA 2F5AH 3MOBL 4QOKB 3VXPA 4AL8L 1W8NA 3I50H 2GITB 4PGZA 4EOWH 2GK1B 2K7QA 4KJQD 3TBSB 4QWWC 4O4YH 1H8OA 2AOSA 4MJ5A 3QFJD 3KYOB 3TV8A 4S1SL 1F45A 4RAHA 4GQQA 5GNYA 4Y16A 2PXYB 2OSLB 5GGSY 3O3BB 3B9AA 4ZTPL 4I48B 1MH5B 5HVHB 1EVUA 5EORL 1X3DA 1ZLUK 1RZGA 3RDTD 1ZHBA 3DX7B 3F5LA 1BIHA 5E2VL 1XHGA 2VIRB 5GGVY 2Z93B 2BHZA 3PZGA 1U30A 3OGCB 2VLRB 4FNLL 3L5WB 4URTB 4PJ7F 3G5XB 5JZ7C 3QYCA 3ILQC 4KK8C 1LLOA 1T2JA 1YPZB 3IVKA 5DGQA 3UTQB 4RGOL 1D5ZA 2Y6SD 1BYAA 4XX1G 3V6ZB 1XAUA 4LSQL 4FABL 1QHOA 1BVLB 3MRLA 2A9NL 4HCRL 3SDDA 3LXAA 1EUUA 2CXGA 5T1LB 3MA7B 3UR7A 5TDPB 1V3HA 5DEGB 3EBAA 4Q0XL 5JHLL 5DA0B 3ULUE 1DQLH 2GSIA 1BEYH 1UJ3C 3MRRA 3CCHB 3BZFA 4O2CA 5HY9B 1ZS2A 2OLDA 3ARDC 3FKUS 4KKLC 5FUOL 3BUYB 3OJDB 5C0AA 1GHRA 3X3GH 3U48A 3VWKD 5GGQH 3JWDL 4UQ2B 4OGAC 1IAIH 3AIWA 5D1XD 4NWUL 3UPAA 1Q8MA 2GSJA 4MS8D 1VACB 5IJVA 4GKZA 3O6FB 5B39G 2WKLA 3CDFA 1T66D 5D7JD 5C6WH 5GS2H 3II1A 2GT9B 4MA3B 1RIHL 2UYLB 1QA9B 1ESWA 1EGJH 3CXDL 1V3LA 1AQKL 5ACLA 3S34H 2W9DH 3PWVA 2B1HL 2YWZA 4PLKD 1PZUB 1XIWA 4NJAL 3FZUD 1DUZA 3DIFA 3WN6A 4ML4A 4Z76A 2QKIA 1I1WA 1NFDA 4HUXA 4IRJD 4Z7WE 1JMZA 1D9KB 3O9WC 4XPBL 2JJTC 2GJXB 2WZHA 3GSNA 2ICEB 3RY4A 3ZKXB 5HYSG 5DRWB 5A2FA 1VFFA 2O5XH 1IEAB 3B8YA 3CLEL 5INCB 1R7AA 3KPSB 4P2QE 3DUSB 4KQ4H 1KYOK 2P5EE 1KFAL 2QQLH 4XGZB 5IQ7L 1DSFL 1MJ8L 3RIFF 5IUSA 3H8NA 1NBVL 2W60B 3N85H 4JKWA 3VGDA 1FGVL 1BGXH 1KACB 1QSEA 4WU5B 1YYLL 2CO6B 5I18L 1ISYA 5D4QA 4NO3B 4NQXB 5LYRA 3CZJA 4QGTA 1KPVA 1NLBH 5EA0H 3L3IA 1RZFL 1NMBH 3L3GB 3PWLA 3IFLH 3AC0A 1CGUA 3QDJB 1X5JA 5ECJE 5DD3H 3S8WA 5D71H 4P59L 5ESQA 1IE5A 4Q7NA 2WLYA 4EKXA 4L4TA 5EN2A 4MNQD 4TX8A 5GISL 3OKLA 4MAYC 3G5YB 2IANE 5DJAB 4HZ6A 1TQCB 4M3KB 4OLWH 4ONHA 1QVOB 5HD8C 4NFCA 1BZ7B 4M5ZL 4U49A 2GUOB 2DEPA 5LQBL 2X1QA 1ZWIB 1SM3H 3SCMC 4F7PA 3U9PL 4Z9KB 4IM8A 1HXMB 3BVNA 3BQUD 1HCVA 5HTSA 3OF6D 3JUGA 1A3RH 1MSPA 4QWWD 5E24E 2VDPH 5CEZD 3UJJL 2YL5A 4YJZL 2GSGA 3HRZB 3LHPL 1PYWB 1E72M 1J1OL 2F74A 2FL5B 1CLZL 1PSKL 2UVEA 3NIDF 2BY2A 4AQ1B 1A2YB 1IFHH 3N1PC 3HE6C 2HT2D 4HUUA 1UR8A 2XTJB 5MEPB 1LO5A 2X09A 3OBAA 1NCDL 1Z2KA 4L1DA 1CTNA 1JGVH 3VMPA 4WI6A 1C92A 4IPNB 4OV5B 2P8PA 3SBWC 5JIWA 4LMQI 4KK8D 2FDMA 5D7IE 4YBLC 3KXFD 2RHEA 4NZJA 4PRID 4R3SB 5D6CB 4KDWA 1QFPA 3IU4H 3VH8A 4XC3L 2CRZA 1QACA 4PGBB 5E9DB 4F79A 2YPLB 3FO9B 2WM0A 3LXBA 4JFYB 5IW6A 4F33A 1SYTA 3DO7B 4C56E 3VFPA 3UTTE 2M26A 1FYTD 5IIEA 1KV3A 3CFBB 2F61A 1L7IL 3EOAA 3LVEA 4ZTPH 3CXHK 1TQUA 4RNRA 4W7VA 1NBYB 5EORH 1P9MA 5F7NC 1N6UA 1DVFA 3CFDB 4IS6A 4C59B 1VAHA 1X5AA 5D9SA 5E2VH 4OKVA 3ARDD 1FA2A 4E41D 1KWGA 1ODZA 1FVEA 3CSYA 4KKLD 4IM4A 2VLJA 3X12A 3U5UA 3T1FA 1J0YA 4FNLH 1HL8A 2X8RA 4HKJB 4TNVF 4YEEA 3RL2B 1KELH 3ECBB 3NIGE 4PJHB 4Z18A 3VGFA 3DHPA 2OR7A 1BWMA 2Q3ZA 3BIKB 5J89A 4L9DA 3TVMC 2ZXBA 4RGOH 5T5NF 1ACZA 2XZAL 1W0WA 4BZYA 4Z8FH 4LDLB 3BZEB 1EGJA 2JF1A 2APBA 1GUVA 3RI5F 1R6VA 2V7HB 4JFDA 2ILLA 4MA1B 1HJXA 1RIUL 5TFSH 3LV3B 2BOCB 1EAPA 2IALA 6TAAA 1LEKB 4M02A 1RU9L 4OZGB 1ZANL 3SQOL 3FMGH 4Q0XH 5JHLH 4L29B 1U2HA 1S7VB 1CBVL 3BLBA 1KC5H 4WK9A 5I16B 4IRJB 1TCMA 5FUOH 3FFCA 1FP9A 3GBML 3UETA 2GFBA 3JWDH 5ANME 4GPNA 4JZ5A 4JM2A 3STBA 2ZUWA 4DKAA 4MD0A 3MTRA 1R46A 4HKXB 1J7VR 4S1RL 4PRNA 3T3PE 5CGMA 1OT1A 4OIIL 1L0QA 1B0IA 1UB5A 1T7WA 4FNPA 4YIQA 4J4PC 1JZ8A 5D93B 2NSXA 2GKIA 1Z9MA 4RMUA 4WKAA 1RIHH 4JJ5A 3RUGF 3CXDH 1AQKH 4UFHA 3JV6B 4JZJC 5J12B 3ROOB 4NJAH 1WIOA 3KGRA 3NFNB 3UG3A 3TNNA 1KNOA 5GS0C 5E95B 5BQ7A 5GSRB 2E5EA 1F4XH 1ISXA 4XUYA 4HW6A 3VXOA 3QCUL 2CDFA 3HMXA 5HHVL 5I75B 3L7EB 1FIGL 3F6IA 5D9PA 1HP5A 3OZOA 1KIRB 4LXFA 3PABB 4MAYD 4WCYH 4CDGC 4PUEA 1N8ZB 1TUXA 1KFAH 3VFMA 3ARGC 5IQ7H 3ZLQC 1MJ8H 3TTSA 5DUBA 3AREC 4NQEA 2XACC 5ESVA 2WB5A 1JD7A 2ZOXA 1CI5A 1UFUA 1T6WA 3INUH 3SCMD 1L0XA 4OLUH 4R0LC 1YYLH 4HBQA 1KCRL 2VLKB 1S78C 3BP6A 3BQUB 3QH3B 5I18H 1GGTA 5B4MC 4PSRA 3S35H 1TXKA 3ULSB 2DN7A 4YHPA 3PP3K 2X9YA 1JYXA 3IFPA 3I3BA 3A5VA 3UZQA 4JB9L 3AU1A 4Y4HC 4F9PA 2JJVA 4P59H 1H9VA 1U41A 4JGUA 4P2OC 4PJGF 4NRYB 2NY3B 5HPMB 4W87A 5GISH 1BBDH 3HE6D 2AJXL 2EABA 2A0LC 2W4XA 5H37H 1Z0NA 4PTTB 2H9GA 4ZO8A 3VRIB 1AR2A 1ITBB 1JGEA 4K8RC 4OD3L 1ZBWA 5DS8B 3BGFB 4M5ZH 3FFDB 1AE6L 5AEAA 3UJIL 3NCYS 3ARTA 3C6LB 2W59A 3WFEL 2AVGA 4G6JL 3N1AA 3U9PH 4HDIB 4HIIA 3WQ5A 3NIYA 1G9MC 4F7CA 3KHQA 3C9NB 1RP9A 3EOBB 5F7MC 4Y5XC 3QUZC 4KJYA 3UJJH 3RWFA 1MF2H 3RKPA 4XNMB 3LHPH 4Z77B 4PD4K 4Y5VB 1YMME 2IBZY 2BVEA 4OFPA 4MNGE 4JKMA 4RFOL 4GRMB 1R33A 1G7HB 2GJZA 1UD6A 5FDWB 4L3CB 4LSRH 3KLSA 4L3ED 5D2NA 1GPFA 2PYEB 1QNRA 4E41B 1FNEA 2E7LC 1NCDH 3EZJB 3GMNB 4W7UA 2XFXA 1V0LA 4F7TB 4ZEPA 2WBJC 3REVA 1EVTC 1BLNA 2JIXD 3SJVE 3LRSA 4U6HB 4WWID 4AZCA 4JRYE 2EO7A 4KPHL 3SCWA 4TSCL 3TVMD 2F8QA 1IAOB 3U4EB 2J78A 4N9GB 4XC3H 2J7GA 2VCBA 3WH6A 1D5XA 1IM9D 2BSTA 2G5BB 2RQ8A 2D2OA 1RAMA 2V7NA 4HH8A 1SJEB 4XNXL 3HNSL 1U8IA 4Y5YA 1L7IH 4FFVC 1BQHA 2VQ1B 3JTSB 3VRLF 3I02B 3U30B 1JXKA 4K7PX 1AVAA 4HA1A 2X4OA 1XCQA 1IMHC 1MFVA 3VX1A 3UBXG 4PBVC 3WY2A 1QW8A 5HYIA 1W1VA 4K3GA 4LGRB 1DQDL 2V5YA 2VVSA 5F21B 2OK0L 2F54E 2F7OA 3SKJL 4EJ1C 2R2EA 1OGSA 2XZAH 4LSVH 2GIYA 3Q6GL 4LQ1A 4J4PD 4ETQB 1DFBL 1UH4A 2DQUH 3P4MA 3QIBB 4HOWA 4JO3H 3MODL 3KPRB 5JDJA 3QI9B 4GG6E 3O4OC 5CKGA 2R56L 3VD9A 1VFUA 4FQ1H 1RU9H 4XP1L 1ZANH 3SQOH 3S4SB 5I9QB 1CBVH 2XSAA 1G0XA 2A77L 2LTQC 5TH2B 2H32B 5GS0D 4ENEC 3PL6D 4HIJB 4X6FB 3PWPB 4MJIB 1F58L 4U6YB 3GDBA 3R8QA 3JWOC 2Q3AA 5EWIL 4DOHB 4EIGB 4HFUL 4NT6A 3QIWC 3K4AA 2F1BA 4OZIA 4JZNA 3OJMB 3QWOB 3MBXL 1QBML 1XF5B 3LD8C 4RGNB 4OIIH 4OLVL 3I75A 1GHFL 3QB7C 5C9JA 3EYSH 4HIEB 3U46A 3ZYZA 1E4XI 4PRPD 3RX8A 3PWUB 5TGBB 2N7AA 3ARED 2VURA 5HHME 1ONQB 3F7PC 1E4KC 1WAWA 1C1EL 2WP3O 3D0VA 4GXVL 5IQ9A 3C87A 3JV5A 1BFTA 5B4MD 3HMCA 1TMQA 4HKZA 1JPTL 4U7SA 5DRXA 1UQZA 1HNFA 1RUQL 1NC4A 3IXAB 2EYTA 3DX3A 1HWGB 2R8SL 1OGBA 5ADPL 2X44D 3HB3C 4P2OD 4LLDA 4X7CC 4XB7A 1E6QM 3O4LA 4P4RB 5DURD 2A0LD 4FOMA 4APQB 2ZCKL 4K8RD 4LEOB 1JVKA 2G60L 2XN9A 5L2KD 1W1YA 1WFOA 2R1XA 2G3MA 4JRWA 4BQBA 4XVSL 1OT2A 1MIEL 1RHHA 4N1HB 4P48A 4KWUA 5EU6A 1W9XA 5C0AE 2ERJC 4U6VL 4TYUA 5DSCB 3O6KL 5ISZA 3VIHA 3BKJL 3BH9B 1NKOA 5JNYB 5M3WA 1J86A 2V5TA 3BKYL 1UVQA 4N5ED 5DQDL 4GUPA 4MHHI 5L7XH 1V6VA 4TSBL 1TVDA 5BZDB 4JPVH 4NNPL 5CUSL 1TVPA 1SJHB 4KDTC 4NKMB 2HVKA 1UWEH 3LQZA 1Q4NX 3WD4A 1LMKA 4MNHA 1G84A 1MFBH 2IAMB 1PG7L 3N06B 2DJUA 4J3TA 4M6OL 5BZWA 5DHYB 5DJZA 3PDOB 3O8XC 1OD9A 3KL0A 2YN5A 2Z35B 3RRQA 3WDIA 1IGCH 3FTGB 1EFXD 1AE6H 2WBJD 4K71C 5EOQL 2WMIB 3LKQB 3TPKA 3V5DA 4G6JH 5DJXB 2WC3A 2FJGA 3JVGC 5F1NA 5DA4A 5EG6C 3VI4E 4NI3A 4HH9A 2VDNH 4MXWH 4JY5L 2QQQA 4FA8A 4R8WL 4NCC2 3NAAH 5FHAL 1JNHB 1R3IL 4BK4A 3VINA 1FZOA 5H2BB 1KB5L 3FB6A 3DVNA 3AXIA 2B4CH 4M1CD 3T65B 1H3PL 2Y7QB 4KRUA 4FFVD 4HS6A 1LEGB 3L2LA 5AUMB 3UTZA 3CVHH 4YAQB 3S5LB 4R2GC 2O5ZL 3LKRB 1ZT7B 5EIVA 5TDOA 3V79C 3WH9A 2MQ0A 3GBLA 1HOCB 2YC1B 4P57B 4GXPA 3O3AA 1JNNL 5IHUL 4EI6B 5HVFB 1NJ9A 1KTKE 3MV8A 3BFOA 4WF7A 4RIRA 1JWMB 1CFVL 4KPHH 5DEFA 1SVCP 3AAZA 4TSCH 3MNVB 4RFNC 4UU9A 5SWZD 5LGHL 3TC9A 2O61A 5A2CA 1JI1A 2WBWB 1I3VA 2OL3B 1U92A 5EDXA 2F53D 2COQA 3IAPA 3R06B 4U1NA 1A7QH 3L5HA 2DDQH 1R3JB 3VFRA 4Q9QH 2W38A 1U58B 3WUWA 1EJ6A 2W65A 1E0XA 1W9UA 3EO0B 3PL6B 4ZFZA 1UYWH 4ENED 3TYGL 1NDGB 4D0DA 2DICA 3VUPA 3O6ML 1FG9C 4GLRH 4F8XA 5IB2B 2AABH 4NQSA 4C7GA 4G7VL 3KWWB 2VRQA 3Q1SL 3WS6C 3QIWD 5IBUB 4PRWA 1X5YA 4UMGA 4ZS6D 3VGGA 1IGIL 5LKNA 2XN1A 3RO8A 1N82A 1NEZB 1YN7A 3V6OC 3SKJH 4X98A 3C2SA 2ZG3A 3ZHDA 2QMKA 3BEWA 3Q6GH 4BZ1L 1A3QA 1DFBH 5F89A 3VDBA 1IAII 1OW0A 3HMWL 5GQBA 5LGJA 2F7PA 1BX2B 3MODH 1BF8A 5IROA 3KYAA 3KYNA 1EBAA 2R56H 4LLYA 5D70L 4Y4KB 1P4LA 3QIUD 4XP1H 2NY5H 3A4XA 2X40A 4W8BA 3T2PA 2WXDM 4YXLH 3ESVF 1JFXA 4EUPH 1RZKL 5D2LA 4NWTH 5D7SL 1FVDB 5I30H 2HT3C 4TNVK 1MY7A 1QKZL 1RJZB 4FQQB 5EWIH 4F57L 4JRXD 4HFUH 3HB3D 4QLLA 2DIAA 1NUNB 2WIMA 4ZUTB 4IRSA 3W0WA 3EJJX 4Z7NF 3R1GL 1H0DB 4OLXL 3UDWC 4E5XB 43C9B 3PZQA 4WJXA 3RI5K 4OLVH 1OCQA 4LP5A 1GHFH 4PJXB 4QHKI 1TENA 4XVUC 1PG7W 5DJYB 1MPAL 3VGBA 4ORGB 4LGPB 1OTUD 4NNYB 5LCVL 2UZYB 2NT1A 1RH9A 5HXMA 1C1EH 5A95A 2VR5A 3RWJA 4GXVH 1AQMA 4PBGA 5EBAA 3EYPA 2HJKB 5F9WB 5HYJD 6CGTA 4QRUA 1TTFA 1KIQA 4WI3A 5C7XL 2C26A 4UT7L 5T3ZL 2X4SB 1TZGL 1FAKT 3WN5B 4HS3B 1JPTH 1CR9L 1U8LB 1C16A 3GSQA 4S11A 5IW1A 2LU3A 3CU7A 5KZ6A 3NA9H 4QCIB 4MQ7A 4U1JA 5ADPH 2F1AA 1WWBX 1RQ5A 4JPIA 1DWFM 4NO0D 1QRKA 5C2UB 3A22A 2VX4A 4LVOC 4YWGL 1DJSA 2ZPKL 3O8XD 4JANA 4LCWA 4BUGA 4K7FA 2ZCKH 3ARFA 2G60H 3GJFB 3THDA 3WL0A 1V0KA 3OXSA 2C3VB 3H7BB 5I1KL 1HWWA 4UIMB 4XVSH 5HVHC 1MIEH 4UV7L 4XPFL 3FFCE 4KH2A 5C0CD 5ILTH 2APXA 2JJUA 1Q1JH 2MCPL 3WFZA 3O6KH 5FFLA 1X1NA 2X4RA 2VRJA 4XP4L 1JYWA 4ODTL 3BKYH 1OWQA 5DQDH 4TSBH 4C54A 5E1AA 4NNPH 2A74A 5CUSH 3L95A 1G7IB 3GMLB 2BMKB 5FYKL 3GK8L 1PG7H 3CVHA 1CFQB 3VXRA 3VD3A 3AIEA 1F4WL 4IOFC 5GRJL 2VMFA 2VUOA 4M03A 3AHZA 2IGFL 4NC1C 1VESA 2FNBA 4R2GD 4AMXA 3ARXA 4Z7WB 5I17A 2XUCA 2C7UA 4U0QB 5DK0B 1WC7B 3LX9A 5DJDA 3BO8B 2V9QA 5EFIA 2WC4A 3H3BC 5KTEH 2F8XC 2WHJA 5EOQH 4PB9L 1HE7A 5CJOL 2ICWJ 2EECA 1OAKL 4GH7B 2P5EB 1FHGA 1WQVT 3HC3L 3MYJA 1F00I 1S7TA 2EC9U 4L9LA 2JK5A 3WDPP 5FHAH 5BXPA 5JORB 1B90A 2NR6C 2EEAA 4KJWC 3ARBB 4F15B 5DD1L 4YDLB 1KB5H 2DMCA 3HCVA 2VWEC 3Q2CA 4NQEE 3F7VA 4D6JA 4Z0XB 5F3BA 3SDAC 2I9TA 3T2OA 4LPXA 3A0OA 4PJFE 4D9LL 5I8OH 2O5ZH 3NCFB 4H0HB 4IRZL 1ZLVK 2OX5A 35C8L 5LAXA 4D9QE 3GBNL 2HJFB 1UXSA 1LO4L 4P9HC 5F72S 2IANB 2ZX9A 3WIHL 3BRFA 3ZSTA 2CCRA 3FB7B 5CKAA 5FF6A 1ES0A 4M3JA 1CFVH 3K8LA 5LGHH 1QW9A 5M5DA 1NUGA 4YNYA 3SE3C 5IEKA 1RJYA 2I24N 3ZKXC 3C5ZA 5KBNC 2YD6A 1HHIA 1TJGL 4GRWF 4PRDA 3HAEB 4I4WB 2UY4A 2NTSP 3MRIB 3MV7A 4UNUA 1CICB 2Z8VC 3GMPA 1W3JA 5E8PB 1OIFA 1EXUB 4J28A 4R96B 5HDLA 3CUJA 4WV1A 4LCCA 3TYGH 1K8IA 1AIFB 1U8KB 2HT3D 4D8PA 1B2WH 2J8UB 5DYOA 2AJZB 3NFPA 4G7VH 1J1XL 3Q1SH 4RA0C 4MJ6B 4PFEA 4D0CB 4P23A 1Q9OB 2TAAA 2B20A 2VZTA 1IGIH 4JGMA 1QSFD 3CX5J 3QHZL 1P69B 2DSUA 3QEQA 1S9YB 4JVWA 5ALCL 2JB6A 1J01A 3WFDH 1GOKA 2NXYC 3JUYA 4BZ1H 1NGPH 1OARL 2X4NB 4MCYB 3UMTA 4PJDF 1GOWA 4AXNA 3HMWH 3RWDB 1B3VA 3ULVC 2VZVA 2HFGL 3HI5H 1XRVA 4UILH 3L3OA 2OLHA 4FRWA 4WVRA 2X7LA 5T3XL 3MRBA 1MLCA 2EDHA 2Y5TA 3MNZB 3GGWB 1BAGA 4C56B 5K59E 4V1DA 3A67L 5GSVB 5D7SH 3LDBC 3VFUA 4XMKH 3PP4L 5GIRA 4DWSA 1QKZH 1QLEL 2ZUVA 2WWKT 4F57H 3W82A 5D7LA 3NIFF 4ETYA 5DJ6B 4NO0B 5BS0A 2YJQA 2IQAA 3R1GH 5JLZB 5F1IA 4OLXH 1NSNH 1NBQA 5HI5C 4R4FL 3V4PL 5FB8A 1ZJAA 3BCFA 4W8LA 1H8NA 2VDRL 3FQXB 5F7EL 5BXFB 4NZDA 2FH8A 4LPTA 1C5BH 4U6XB 4AISA 2X4QB 5LCVH 1G7PB 4ELME 5C0CB 1P6FA 1R86A 1F8TL 5CZXC 5C09E 3VPLA 1BM3L 3F7RA 5LVEA 2AK4A 4H26B 5C7XH 1FH5L 5T3ZH 3VXSA 3CUFA 1TZGH 1CFTB 1T7XA 3ZTJH 3ZM8A 4V2BA 1RV6X 2Z91A 2F58L 5JIPA 1HI6B 4C7DA 3MBEA 2DTMH 3KPPB 4HK3J 4M29A 4F9DA 4AIZA 1KLGA 4YWGH 1TNMA 1I7UB 3KDMA 3AISA 3AB0B 1VKXA 4L8BB 4ZO7A 1EA9C 1W0YT 4HIHB 3QHFH 1VFAB 1Q9WA 3MLPA 4AQOA 5EO0A 4UV7H 5IFHL 2XA8H 2ESCA 5FYJL 3V52L 2MCPH 1FN4B 4OIFA 3CHCA 1I1YB 3T04D 4XP4H 4OZIE 4QTHA 4J3UA 1T3FA 4WFHD 1FNAA 5C07A 3P73B 2YL6A 1KB5A 1OAZL 2NR6D 3QXWA 4WENB 4X4XB 5GNXA 3QAZC 4NNXB 5LG1A 4JQXA 4NZRH 2NNAA 5FYKH 2GJRA 3G6LA 1H4PA 4MDJA 4IEFB 1Y6MR 3SDAD 1F4WH 4UQDA 5GRJH 2D31B 1BFVL 2IGFH 4GAFB 4NDMB 3I85A 4XT1C 3NVQA 4OQTL 2DSVA 1ZHKB 4KTDL 4F58H 5CD3B 3L3JB 4WSJA 3TJHC 2X1IA 1W2KT 4PB9H 2CYGA 1S46A 1KEML 1WBZA 3KPLB 1MJJA 5CJOH 1OAKH 3HC0A 1YEFL 4JDZB 4MLIA 1W0VB 5ITFB 1P7KA 3HC3H 1I4FB 2BVPA 2YKKA 2PI6A 4D6GA 3O4LE 3BN9C 3G5VA 1KTDB 2IXVA 2CKBB 1A3HA 2O9TA 4WI8A 4FQHA 4HV8A 3TBYA 4N90D 1I8IA 4JAMA 5BRZD 4M8VA 5DD5L 5F96H 2I5YL 4WWKC 1H3VA 5C2BL 5ISZE 1MFCL 2EH7H 5EUOA 1HDMB 2VZ1A 3GMQA 3PXJA 4IRZH 4KROC 5DFWH 2NTFB 4LKCB 5FYLD 35C8H 2ESVD 3SCVA 2HG5B 4LIQH 1K4CB 1XYFA 3GBNH 2ZX8A 1A7BA 2E8YA 4NQTA 1LO4H 4OUUA 1KENL 2FIKA 1TJIL 1XR9A 3T2QA 3WIHH 1XH3A 4UBDC 3QXVA 1UADC 4KQ3H 4YK4C 4O5LH 4QHNA 1KQYA 3ORJA 3MRDB 4IDJH 3UTPD 4MXVE 4BH8A 3QXAB 2J3SA 1HHGA 1TJGH 3ULVD 3EBVA 3MLTB 3RM8A 2X1WL 4Q9RL 5ELIA 3SN6N 5F3HB 1K6QL 5DEZA 1KXTA 4J27A 3AS3A 4U1KA 3K1DA 3BJ91 1OY3B 3RBSA 3RPIA 3VXQB 1ZGLM 4MNGB 4K9EC 5FKAB 3STZB 3B2UC 5HHPA 2EPOA 5EU7C 2ADIB 2AKRB 5EBMB 1JZ4A 1J1XH 3F12A 3HS0A 2J7FA 5TE7L 5E1HB 5KZCD 4BQ4A 1AHWB 3VIIA 5HI5D 1CT8B 1MFEL 1L6ZA 4LARL 4OCLC 5ALCH 3RGVA 1GNXA 5KSAA 1R47A 3P4NA 3SJVB 1OARH 1CZ8H 2MQCA 3S37L 4FXKA 2EXWC 4YPGA 4TUKH 3HG1A 1ADQA 4JRYB 2Q6WB 4OZHF 2VQTA 3QJHA 1A3LL 4B5EA 1QOXA 4QP0A 1ZHLB 3WELA 1RZJC 4R7NA 3CDYA 5CZXD 1FL3A 3AS1A 2NY4C 1HSBA 3MV8E 1GZQB 3AMKA 5FYKU 3QOKA 2B7DT 1A7PL 3OGRA 3F5WB 3A67H 3BD5A 1LE9A 4V2CB 3PP4H 3SQBA 4CJ1A 1QLEH 3MJ7A 3Q48A 4DGVL 4O02L 1BJ8A 1QSED 2EQDA 3DYOA 1HKJA 3RNKA 4OLEA 3UROR 3RZCC 5DMKA 1KBBA 5FD0A 3FO2A 4R4FH 3V4PH 4Y5VC 1ZU8A 1QSVA 5SWQA 2VDRH 4I0PB 1OP3H 1SMAA 1OAQL 5F7EH 4N5UA 3DNKA 4KVNL 1C93A 4KV5E 3GFUA 4MB5A 3HJEA 3WKML 3UXFA 1F8TH 4CUCA 1EFQA 4LNRA 4Y8DC 3SGKC 2NY6D 4AW7A 1FH5H 4NN7C 2BVQA 2IC2A 1E0VA 1I9EA 4NZUH 3BXNA 4U3AA 4GG6B 1CXKA 2I25N 3M1BA 3CGTA 2F58H 5HJ3B 4KC3B 2ATKA 4AYSA 4AZIA 8FABA 3S6TA 3VDHA 4X4ZA 3KS0H 4OGXH 3QPXH 4ZS7L 3WNOA 2WMHA 3HG2A 1ISZA 2B39A 4MJ5B 3RWHA 4F37K 4ZPVA 3S98A 3TJHD 2NXZB 4TULL 1F3JA 4RMTA 1XV8A 1OCWL 4Y16B 2ZSVB 4M56A 3PV6A 5A1AA 3KWXA 3RHWF 2AJSL 2BK8A 1UZ6F 3EOYG 4AY0A 4U5IA 4ZAKA 3V52H 4PJ8A 1RZGB 2AW2A 4AG4L 1ZHBB 2XZZA 3W0WE 4BYHA 3EO9L 3QO0A 3IDMA 4C7FA 4DN3H 5HGGS 1GQLA 3P0GB 4QLJA 1M01A 2AJYL 4LGSB 3RIAF 1OGTA 1JHKL 1DBAL 5AC4A 5FXCH 4NUGH 2CDGA 2A3EA 3IVKB 1PY4A 3OKOA 4WWKD 4P7NA 1D5ZB 1BFVH 2KZWA 3LPFA 4LSPL 1KIPA 4KKBC 4KROD 3VM7A 2ESVB 3QUKB 3MRLB 4WFED 3SDDB 3WIHA 4ACYA 3MLUL 5CJBA 5E8OB 5IMOA 4BQ9A 1YJDH 1OP9A 3V6BR 1KEMH 3VMNA 3IFOA 5ABGA 4PY8J 3UCRA 4NKIL 4UAOC 2ZWYA 4TQEL 2GSIB 4TNWK 3MRRB 4UBDD 3BZFB 3V8CA 4O2CB 1IC4H 5CPTA 3VIGA 5I8EA 4G8FA 4Y2DD 4LSSH 2O5YL 3ALXA 5E2TL 2P43B 4LCWE 3W38A 5C0AB 1NFKA 4GQ9H 1E15A 1A1MA 1NCNA 1EEZA 3BESR 4X5WA 4OIBA 5IJVB 4GKZB 3MX0A 3OA5A 4S2SA 5KS9E 5DD5H 2BVUA 2QADB 2I5YH 2UZIL 5AZ2L 5C2BH 2CDEA 3NPSB 1HSAB 2F19L 3ZKMC 4QY8A 4LPWA 3ZDXF 3B2UD 5H35B 4F9LA 4WI2A 3GSVB 3C5JA 1KTRL 3PWVB 4Q9CA 1KENH 2EPNA 4O51A 1XIWB 2FATL 4KI5C 4RAVA 3TN0A 1G9HA 1NEZG 4KFZC 4JPWL 5HOSA 1U91A 1MQQA 3KJ6L 4X99A 5TE6H 4G9FA 1DWJM 4G6FD 1DUZB 3VXRE 2EC8A 1K9TA 2GTWA 3DIFB 3QGVA 3MUHL 4GLRI 4Z76B 2V5DA 2QKIB 4M4PA 1OSPL 1NFDB 4WW2A 4HUXB 3BP4A 3OMZA 3GSNB 3MGTA 1NANH 5EZLA 4Q9RH 4S1QL 4H1LH 2DSZA 1YEIL 4JM2D 5BVPL 4RX4D 1MNUL 2NY4D 4I13B 3KLHD 2LQRA 1K9EA 4CD5A 1L8NA 1KJ3L 3NCJL 1A6ZA 4P4KA 4Z7QE 1FFPA 1QSEB 2F5BL 2OMBA 1AC0A 4FNRA 1DBJL 2AXJA 2FECL 5TE7H 4FZEL 4QRPA 5JA9A 3I6GA 4GRLC 3ZHLA 1KPVB 1FCGA 1UR9A 3UERA 5T1MA 3CAFA 3L3IB 3PWLB 1IEBB 1X6NA 5D8JL 2X4UA 2X1OA 2FYVA 1WFTA 4I3RL 4CKVX 3H0TA 2JB5L 3S37H 4CGTA 3R4DA 3OPZL 3BDXA 1A3LH 2AEPL 1LO3H 4L4TB 5EN2B 5C0FB 2EACA 2ZP0T 4PCSA 2XWEA 3G08A 3OKLB 2NY6B 3QG7L 4U1LA 2J88L 1UWUA 4UNTA 1MWAH 4ONHB 1A7PH 1U8HA 4WO4A 3A24A 3QWQB 4JVUA 5MI0B 4JFFD 3GRWL 5D1ZA 2YBRA 4F7PB 4DGVH 2F9BT 1LEIA 1ZLWK 3LKOA 4QLRA 5JW4N 3D85A 3FB5A 1JZ5A 3LS4L 1EGZA 2E7BA 3MV7E 1ISVA 1FZKA 3VRJA 4IMLA 5IHZA 1N4XL 1MUJA 2GSGB 3E8UL 2F74B 1GGUA 3VD5A 4HAGA 5C0RL 5DMJB 3IANA 2FYYA 4M7ZC 3QNZA 5KSBF 1I1RA 3WKMH 1U42A 3ET9F 3MPCA 3WQWA 4HUUB 1CBGA 5ACMA 3DXAD 4X7TA 5F1OB 3CC5A 3AI0A 3QEQE 4M1DH 3EFFA 4PGEA 2O9PA 2JJSA 1MI5D 3UPCA 1K6AA 3WV0A 1M7DB 1P5VA 2P8PB 1P4IL 1QR1A 3ZKNC 4PJBF 5D96B 1A7RL 4OOZA 3WHE0 4FF5A 3RM9A 3VH8B 1ND0A 4FNSA 4ZS7H 1G6RL 3B6SA 4KKBD 1N3NA 3V6FA 3WXVL 4HWNA 4ISVA 4LHUA 4F33B 5IW6B 3AS2A 2QL1A 4V1DE 4TULH 4HK0A 3DTXA 4JFXA 3T4YA 5IIEB 2PW2A 2UY5A 2NY1B 2HKFL 3EOAB 4AC1X 1XF4A 4RNRB 2AJSH 1AJ7L 4CBPA 3T0BA 2KPNA 1DVFB 1D5BA 3GJFK 4Y2DB 4AG4H 5BS0E 2C0HA 5D9SB 2AMGA 3WO3B 4OKVB 4K94L 2F7RA 3EO9H 3TO2A 4G7YH 1FVEB 3CSYB 4Q6YA 2VLJB 4JFED 5I1GL 3T1FB 1LO0L 3E6HA 4Y4FA 1AH1A 1JHKH 5GS1A 5TE4L 2CIPA 3AFBA 1B0RA 4JHWH 3MYZA 1I3RA 1W0WB 2LFGA 4C4KT 2AK4E 4DK3A 3ULVF 4LSPH 4JFDB 1T6VN 3VXSE 5GZNC 3H9SE 2FX9L 4U1IA 1CGYA 3VTRA 1FH8A 3DVGB 4EDXA 1EAPB 2IALB 4JL2A 1HKMA 2XKSA 4PJ7A 3RKDC 5JTWA 3S9DB 3TBVA 4POUB 4NKIH 3D69A 3U57A 1IM3B 2CPUA 5IOPA 4MXQC 1MCWM 4X7EC 2O5YH 1UR2A 4HEPG 4PJCA 4WI5A 2OS7A 3HAEG 1BTCA 4X6EA 1PLGH 2X6MA 4H1LA 2V9TA 1VSCA 4MLSA 1WLHA 5INDA 1ZVYA 5I1AA 3N50A 3D3VA 3U0WL 5J1TC 4N68A 3WIJA 4AZHA 4JM2B 1E28A 1ZA6A 4CD4A 1DR9A 3TV3L 3ZJ7A 4MD0B 3B5TA 3MMUA 4P2RD 1FFRA 1X5HA 3FL7A 4PRNB 5ABHA 1UB5B 2UZIH 2X4PA 3D39A 4YIQB 5GGVL 1MW2A 3ZSSA 2F8OA 5C07E 3P9LA 4JJ5B 4P8WA 2FHBA 4CVXA 2CIIA 4AEHL 1ZV5A 2BNRD 2E9BA 4NYLA 2G3IA 3HZYA 2V2TB 2FATH 5JA8B 4N0UA 1AP2B 1I1FA 1AXTL 4WUUA 1I8MA 3TNNB 1KNOB 1EHAA 1LD9A 4G8GA 4CMMA 5BQ7B 1OSPH 3QZWA 2GEEA 4HKBA 1IQWL 2EDFA 4LYQA 3VXOB 4EVNA 4DUWA 2X41A 2VDOL 7TAAA 1DANT 2XVNA 3U7VA 1MWAA 1YEIH 5GGRA 5SV4A 1GC1L 2BZDA 1MNUH 3GIVA 4PMVA 2BXZA 1FFQA 4YHNA 3VFMB 3CHEA 2X89A 3I3EA 4MDIA 3GBEA 2V5CA 2XWJA 1FC1A 5DUBB 2CRYA 3MACH 1KJ3H 4JFFB 4NQEB 3NCJH 5ESVB 1K2DA 4GO8A 2V3DA 1T1WA 2FBJL 4NN6C 2F5BH 4DVBB 2VUYA 2FDBP 5F7DA 1DBJH 5GPRA 5E4EC 4ZO6A 2YD5A 2OXGA 4YHPB 2HWZL 1HIZA 1F5WA 3IFPB 1YDPA 5D8JH 1JNEA 1ERNA 2JTDA 4NBYB 4R90H 3CVIH 3AU1B 4I3RH 3MA9H 2JB5H 1FSKC 4HPYH 4J6RL 4YHZL 4TVCA 2P1YA 2V5MA 3OPZH 3EYOA 2EEXA 5EPMB 1H09A 3WE6A 3TO4C 3JBG7 3AIUA 3TCLA 5HHNA 1T83A 1B4JL 1HT6A 4N0CC 3CH8A 1CD0A 4HT1H 5DTFA 4RFEA 5DHVH 1W72H 2YD7A 2OQJA 1K5NA 2G75A 4JGJA 1DUYA 2DQHL 1P53A 4HIIB 1T1ZA 3DO3A 3OGSA 2A6KA 3MLXL 5T1DL 4B41A 4F7CB 2DT3A 1AGCA 2QTEA 5BV7C 3LS4H 2I07A 3ZE1E 4KJYB 2XSBA 1J1PL 3RWFB 3K2UL 1J18A 2NZIA 3E8UH 4XXCC 3IRZA 5IB3B 3H42L 1R87A 3EW3B 4OGYL 4ZUSA 4XCFL 1A6VL 2GJZB 1UA3A 4TX6A 2ADJB 5ECUA 4X7DC 5D2NB 2Q86A 4TVPE 1FNEB 1ZBKA 1UENA 4JFEB 3QWRA 1RUPL 3UJTL 3REVB 1IQDA 1LL7A 3GNOA 3KJ4B 1BLNB 2AEIT 3QXTA 5E6IC 3IU3A 3LRSB 3NZ8A 4IMKC 1P4IH 3EIFA 3K74B 4AZCB 5ITBH 1ITXA 2FB4L 2J75A 2J8HA 4IJ3B 5I1EL 1A7RH 5T3ZE 1G6RH 4JY6A 4PLNC 1D5XB 5GZND 1WEJL 2BSTB 2EDLA 1NOFA 4MDPA 3U9UA 4AD1A 5JXEC 2ZOKA 5KVDL 1PGRB 3GXFA 1CD9B 1MH5A 3RKDD 4PG9A 1U8IB 1BQHB 3NBNA 1KSRA 1FDLH 1ZLVH 1AJ7H 3PHOA 4JQIH 3SKOA 5B8CC 5FA3A 1LVEA 5F6HI 3QFDA 1XCQB 2CD0A 4MVBC 3PUCA 4K94H 3OGCA 3KLAA 2GI7A 1JFHA 5I1GH 1JYNA 2WHMA 3L5WA 4LNVA 1LO0H 4DCQA 3SDCD 5JBFA 2W9EL 5TE4H 1KYOJ 1T89C 4K7PY 1N0LA 3SDXB 3L4YA 3FN3A 2A73A 1JGUL 2XWDA 2R2EB 1Q9LA 3O2WL 2QQNH 2EYRA 4N42A 1EHLL 3NACL 1M7IA 4OF6A 2VO5A 3IFNL 4QF1A 5I71B 4WU7A 2BNRB 3MA7A 3RHWK 3A23A 5HDRA 4FFYL 3GH7A 3L5XH 2DBLL 3MLYL 1BYDA 5DJ0A 1HNGA 1X5LA 1X5FA 4OFIA 5DQJB 1V7NH 4U4BA 2ZXAA 4TVDA 2ZSWA 3OJDA 4TRPL 3RQ3A 3AZRA 3MJGX 3X13A 1WFNA 4RMWA 1RUAL 1UD3A 2M1KA 4NT6B 3U0WH 1RJCA 4LRIA 4OZIB 2BRRL 2JIEA 3TV3H 4JZNB 4MD4A 2XN2A 1SEQL 2OP4L 1F90L 4XRCA 5B21A 1UB6A 4BSWA 5E9AA 5C9JB 2K7PA 3U46B 3T0ED 2YD2A 1QA9A 1TQBB 3DX9A 4B3LA 3L4WA 4NZCA 2FGLA 4JVPA 3D0VB 2LVCA 3QR3A 1ZKAA 5IQ9B 1LG2A 3IDGA 1GGYA 5GZOC 4KKCD 5C86A 4D6DA 4H8WC 1AXTH 4MAZA 4HKZB 1UEYA 5DRXB 1QWNA 3DGGA 1NC4B 2EYTB 1RJLA 2GJXA 4LIQE 5J13B 1I8KA 3RUGA 5I6XC 5INCA 4JFQA 2VDOH 3DHJA 1E6OH 4PB0L 1Y18A 4UTAH 3LPOA 4H7VA 4LLDB 3KPSA 2Y36L 1A47A 3O4LB 3TO4D 5A2JH 4IRSD 1GC1H 3BKMH 3DUSA 1FH9A 5A6KA 1U33A 2DL9A 3BPNC 1WDSA 4NQDD 5DHVA 1WWAX 1W72A 2EDEA 2XN9B 4N0CD 1MXDA 3T2NL 2R1XB 2H6PA 5LGKA 3QUXA 2Z8SA 1RHHB 5EU6B 2FBJH 1QI2A 3HPLA 4NO3A 5ISZB 2FGZA 1TA3A 4LPUA 2HWZH 4PN2A 1UVQB 2BFGA 1QNOA 4GUPB 2DQGH 4GKLA 2HVKB 3LQZB 3RVTD 2CUIA 3DLQR 4J6RH 4YHZH 1XGZA 4WKFA 3OHXA 4MNHB 3CXHJ 1M6OA 1N59A 4XHJC 5C8BB 2HTKC 5BZWB 5D1QC 5I0ZA 5DJZB 1E5JA 4YFLI 3SCPA 4FNQA 3BXWA 1B4JH 1CN4A 4OCSH 2VE6A 2FLBT 1WPCA 1KN2H 4QGYA 5E6ID 1S7WA 3WBDA 4EN3C 3TBTA 2FJGB 2WAGA 4PJGA 5F1NB 2ZUSA 4EI5D 2D7OA 3MLXH 4HH9B 5T1DH 4NXKA 3DRTA 3SE8L 1WIUA 1G6RA 1HF6A 2W67A 4K07A 4NGHL 2IFFH 1JUFA 3QFJA 3HE7C 1J1PH 1CVSC 2VERN 4JLRA 5CEZH 2Y24A 4X9YA 3K2UH 1FZOB 1PZ2A 1HXJA 4R6UA 3DVNB 2AERT 4WGWB 5JXED 3H42H 4LDOB 1C90A 4OGYH 1FOBA 4HS6B 3LEYL 4XCFH 1U3HC 3C5SA 3RDTA 3UTZB 3BOVA 3QULB 4NIKB 1AMYA 1H41A 1HQ4A 2WINB 4LX4A 5HDBE 5TDOB 2VXTL 3TFKC 2D73A 3EJZC 1RUPH 3UJTH 3O3AB 1PG7X 1PS3A 2ZWLT 2XRAL 2YN3A 2PW1A 1NJ9B 1EX0A 3MV8B 4E0RA 3CZNA 4RIRB 5LWYL 5C0EA 2EDBA 5J06A 3UX9B 3BSZL 1CG9A 5DEFB 1XSKA 3AAZB 4UU9B 5I1EH 5CP7A 3WO4C 1GJIA 2YHGA 4PGBA 2O61B 4KVCH 4PMDA 2EE6A 1I85A 1U92B 1WEJH 2FO1A 3RNQA 2JEPA 4ERSL 1EMTL 3WIFA 5KVDH 1E4NA 4HPOL 3VFRB 2IH1A 3SDXF 3VXUD 3WUWB 4L8CA 1HK6A 2W65B 1WT5A 4BFGA 4XCYA 2DQEL 4ZFZB 4BJLA 4D0DB 5FCUL 3VWKA 4YHEA 3DOSA 4NQSB 1XC6A 1GOFA 5D1XA 2WBGA 3FY1A 4AEFA 3B9KC 2LV4A 4DVRL 1LP9F 3LRMA 1YN7B 1FPTL 5D7JA 1JGUH 4X98B 3O2WH 1V6XA 3BEWB 3NACH 3VW3H 5F89B 4HWBA 3IFNH 5LGJB 1AO7E 2EE9A 2PTTA 3CH1A 3KYNB 2N1KA 4LLYB 2GFTA 2A6IA 1P4LB 3WNKA 2DBLH 1WUNT 5ICZA 5HPCA 1T20A 3KPTA 3AHXA 4IRJA 5D2LB 1J8HD 3SUTA 1TZIA 2BNQD 5KANI 1OD0A 1MCEA 1PKQA 4D0BA 2Q7NA 4LGXA 1RUAH 4M7KL 4RMQA 2BHYA 2FX8H 3C09B 1P7QA 4IRSB 2BRRH 2XIIA 4YO0A 4JL1A 4UT9L 4MHHG 4UOQA 3NH7L 1UCBL 3LN9A 2VC9A 1SEQH 2OP4H 1NUDA 4NQDB 1D5IL 5JUVA 2BSSA 4JPKH 2R0ZL 4HC1L 4H20L 4N0RA 1NANI 4KAQL 1RK0B 4GKSA 1CWVA 4NUJA 4X7SL 3V5KA 5EU4A 2Z0BA 3ROOA 4QRUB 1KIQB 2CQVA 1FP5A 4UFIA 4OSUL 2BFVL 1JZ7A 1RZKC 3VFGH 1SYVA 4PD4J 3FAXA 3V0AC 1C16B 4JKPH 3V5HA 1BIIA 2PWGA 3WXWH 4QRQA 1DWHM 3MO4A 5IW1B 3WD0A 2QPUA 4ODVH 2AV1A 3FJTA 3L7EA 2DKUA 4MQ7B 4U1JB 4MNQA 1E6ZA 5A40E 4JPIB 5D7LD 2IADA 5GRZA 1PAMA 1QBLL 5D1QD 4PJ7E 3S3PA 2GJJA 4JANB 4K7FB 4GSDL 3ARFB 4K8RL 4UCFA 2C1PA 4ZYKA 2CO7B 3AICA 3G6AA 3GB7A 2I9LA 4EN3D 1UKOA 1KPRA 4EI5B 1Z6JT 2D22A 2V38A 3SCOA 4HTYA 3OF6A 1FCCA 3D3VE 4JFUA 2X4RB 3FRPG 1G9ML 1ORSA 5FGBA 1E6NA 3BD3A 3MSDA 1A64A 3HE7D 5E1AB 3RTQC 2A74B 1U8QA 4UR9A 2VISA 3D39E 3L95B 1U2YA 4WDIA 1BQSA 2DH2A 1JTPA 2OMNA 3QDMA 3CVHB 1EZVX 3VXRB 4DTGL 4RZCA 1U3HD 4XNZB 1G01A 5HYFA 4PTTA 4LAJH 1ACYL 4M62L 4N0UE 4KKAC 1OGAD 3KR3L 4HUNB 5I17B 2C7UB 4GFTB 4CDHA 3VCLA 4WUUE 2RR3A 2E6JA 4ZTOL 5DJDB 5EFIB 3EJZD 4G8GE 5JO5A 1FNSL 3LKNA 3CHDA 1SBSH 4ZE4A 2IBBA 3EHBC 2WW5A 3TNMA 3KXFA 3JTTA 1TVHA 4HDIA 3HKFA 5E2JA 2ADGA 1K9FA 5A8NA 4PRIA 2WZIA 4EQ2A 3MYJB 3VH8G 1S7TB 4M43L 4L9LB 4WTXA 1XT5A 2JK5B 3PHAA 2MTPA 1IBGL 4PJIF 4NGHH 2QQKL 4XNMA 3E2HC 2WWDA 5F8QC 5C0BD 4QRTB 1FYTA 4DAGH 3HCVB 4Q58C 3VKKA 3WNLA 4HZAA 1EHNA 1N0XH 3HI6L 3F7VB 5GGTL 3BD4A 1KF9B 1UJ3A 5DUPL 3LEYH 2I9TB 1HXYA 1OTSD 1MHPL 2CK0H 3GSUA 3ARDA 5CEYA 1N5AB 3EMCA 2EIZA 2WV3A 2VXTH 2D0HA 4QRSA 5KVEH 5LAXB 2E9JA 1HJWA 1UXSB 4A3YA 1UUQA 2XRAH 3B9KD 4JFWA 3TT3L 3EYQC 4A2MA 5FF6B 5LWYH 4NSKA 1FVCA 1O0VA 3U4EA 4LFHD 2DRUA 1KCUL 4YNYB 2E6PA 4DGIL 5IEKB 4MX7A 4NPYA 4GAGL 2AXGA 1HHIB 4K3HA 1UA6H 5L9DH 4NOFA 1S5HA 4PRDB 5FO8A 4J3WA 5DVNA 1EMTH 5JR1L 4HPOH 3MV7B 2J79A 2WIIA 3GMPB 3JTSA 5D5MF 4PJEF 3IK2A 1F3DJ 5FM4A 4M4RA 4GW4A 3EJUA 1UC6A 2L7JA 1UH2A 2IQ9H 4LCCB 4WV1B 2DQEH 5A6SA 4PV9B 3NMEA 1U6AL 1K8IB 3WSQL 3AHYA 1E1FA 4PLJD 4D8PB 5DYOB 2Q8AL 3NFPB 3FOLA 2YA0A 4U1GC 3JWOL 4OD1L 4P23B 5AG9A 4EXPX 1GPOH 2DOCA 1U3YA 5MP6H 3QEQB 1JTTA 5D2LF 1FPTH 2JB6B 5JUEH 3MCG1 2PN5A 4FTVE 2F54D 4PJ9C 1YUHA 3CIVA 4R9HA 4GAYA 3L3OB 2FJFA 3MMDA 3ELAT 3MRBB 1MLCB 2XG9A 1G7QB 1VFBA 4LVHB 5AWNL 3VXNA 2GDVA 3NIDE 4LOUD 4V1DB 3WD3A 5GS0H 2VQUA 4ZMAT 3VFUB 1P2CA 1R34A 2LAGB 4U6YA 5GIRB 4DWSB 25C8H 3LCYA 3AHTA 4GKOA 4XB8A 1LF1A 4M7KH 4KRPC 5D7LB 3WQ8A 2MMXA 2B1AL 4XBPA 5BS0B 4MAYA 4GRWH 2IQAB 3HUJF 4UIKL 3D50A 5F1IB 3WMSA 2XQYG 2G2RA 3DI2B 2YD9A 3LKPA 5FB8B 4C55A 2Q20A 1NLDH 4YUEL 4OCXL 4XXDA 3PWUA 4H20H 3SCMA 3P9WB 5CPQA 3TH2T 3V0VB 3H54A 2WBKA 2VLRE 4J3OC 2OTPA 4HUVB 3OAYK 1IKFH 3IXTB 3GKZA 7CGTA 4X7SH 3IAGC 3DHUA 3WH7A 5I1LA 4G9DA 4GT7A 2ZUXA 5HHMD 2AK4B 3Q5OA 2BFVH 4B9ZA 1GZJA 2A2QT 2W0PA 4X0VA 1V05A 2VN4A 3DMMC 1RD6A 5J1AA 3RTQD 2DLGA 2Z91B 1MREL 5IHLB 2FECI 1KGCE 3UO1L 2XVPA 3MBEB 4HZ8A 5A2LH 3HE6A 5ENWA 4KKNA 4ZUUA 1QBLH 4AIZB 2DQIH 1KLGB 1OWWA 4XBEL 4NKOA 4PIRF 3KDMB 3O0RL 4KKAD 1Y6KR 4Z7VF 3UYRL 1VKXB 3HU7A 4GSDH 4EE9A 4K8RH 3GSOA 4DKFL 2BC4A 2E9IA 5BMFL 1Q9WB 1EEQA 2ZX5A 4XV0A 1MCSA 5EO0B 5ABEA 2ZXDA 1P9MC 2WMKA 2ZNXA 3RCNA 3NUKA 4YHML 5GGUA 1G9MH 3SGDH 3BX7C 1T3FB 4XMLL 2DM3A 5C07B 2Y4SA 4OI9A 1KB5B 4WGVB 2Q8XA 2ZZUT 4HQQL 5F9OL 5FYKD 2NYYC 2NNAB 3BAXA 1BD2D 3L3HA 4K55A 2EAEA 3D51A 5K33A 3I6KA 3RVWC 2R2HA 4L3EA 5CFHA 5IVZA 3G6JF 4M62H 1KR1A 1CWYA 4PLOB 2Z35A 1DEEB 5DD6A 5HGBB 6A3HA 4ZTOH 1C7TA 2JIXA 5I8KL 5LXGL 1UKSA 5I73C 3DC0A 1WBZB 1MJJB 4D9RD 4U3HA 3HC0B 4M61A 3EYQD 3TVMA 1P7KB 4JN2B 1LQ0A 4BFBD 3KPSE 4PJ8D 2BVPB 1IRAY 2AEWA 4FQJL 4CAGA 1JV5A 4GBXC 3G5VB 5E5RB 1BG9A 1IBGH 4JQVC 4KMLB 4PYGA 1IM9A 3U2SA 5DMYA 4PMZA 5HBFA 3ES6A 4HV8B 3MOQA 1E27A 3TBYB 1JPSL 1BQHG 3LS5L 1ZAGA 3K81A 4NM4L 3HI6H 5GGTH 4W85A 1I8IB 2XI9A 4JAMB 4MA8L 1JWSA 1ZTXL 3O3UN 3QSKB 1TIUA 4WEUD 1MHPH 1BZQK 3EUUA 3FQNA 4G6MH 1XR8A 5EUOB 3O81A 1E6RA 5I15H 3GMQB 1XF2A 5TJWK 4P57A 1HZHL 3QDJE 1A22B 4JFTA 4EI6A 3T3MF 4MQSB 4OUUB 1C5DA 3A6CL 5JW4R 2FIKB 1XR9B 3IGAB 1UEMA 4RDQG 3AJ7A 4JKLA 1XH3B 3W28A 2APFA 5FGRA 1J9YA 2OZ4H 1YY8A 4J4PA 1BFNA 3N13A 3DECA 1KCUH 4DGIH 5E1QA 4JDTL 4YEFA 1HHGB 4PJ9D 5SV3A 3KLKA 3OLDA 4JZJA 3R06A 1W8OA 3O6AA 1G7MA 5JR1H 1U58A 5ETUA 1KXTB 4NRZA 4GW1A 4U1KB 2X2HA 1V8HA 4PJGE 5CXPA 1ZA3A 2EYSA 3RPIB 3DI3B 1CLOH 4RWYL 2NY2C 1I7ZA 2J77A 1U6AH 5L6YH 4X6DF 3EYUL 5HHPB 3WSQH 4B53A 2WUBL 2Q8AH 1KWKA 4FQPA 3QFJE 4UOW1 4CD7A 2CPCA 1AGBA 3JWOH 4OD1H 3F12B 3H