5CLWA

Crystal structure of human glycogen branching enzyme (gbe1) in complex with maltoheptaose
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
658
structure length
637
Chain Sequence
VDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNREKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 1,4-alpha-glucan-branching enzyme
publication title Crystal structure of human glycogen branching enzyme (GBE1) in complex with maltoheptaose
rcsb
source organism Homo sapiens
total genus 213
structure length 637
sequence length 658
chains with identical sequence B, C
ec nomenclature ec 2.4.1.18: 1,4-alpha-glucan branching enzyme.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5clwA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5clwA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5clwA01
1OGAD 3WHE1 5I6SA 2R69L 2Y07L 5BQ7B 2BSTA 1AGFA 5DRZB 4PJ7B 4U1GC 4XNZB 3UC0L 3WFHB 3ARVA 1X9QA 4BSVB 1M71B 4TUOA 2D3LA 2Q8AH 4B3LA 1KPRB 5HYFA 3PZNA 3QHOA 1G7LB 2RIKA 3UAJC 1BBDL 1KIQA 1U8PB 3MTRA 1S9YA 1A7PH 5T1DL 3W27A 3Q6FB 2VSCA 1P9MA 5CWSB 3PHOB 3MSPA 5HHVL 3TO2A 1XF3A 3RUGA 4OKVA 4PEEA 1OTSD 1SEBA 2FZ3A 1FP9A 2JIXA 3OKEB 12E8H 1MELA 2ICEB 2W92A 3Q48A 5TE4H 5BS0E 1JNHB 2CDGA 2XFXB 1V02A 3O2DL 1QNSA 4J3XA 1JPTL 1UVQB 4LAQL 2HVKB 4FNLH 3WD5H 1OTSC 4LCCC 4JQIH 5ACZB 1RZ7L 2OTWA 1UQSA 1DL7L 3I2CH 4H8VA 4RNRA 5BVPH 1KB5H 2XM1A 3BP5A 1HYRC 2AV7A 1A6PA 3T09A 4P8VA 1MRCH 1A9EB 4M5ZH 2HLAA 2ZG3A 4PYGA 4XWOD 3BWAA 4GW1A 2PW1B 2XRAL 4JJ5B 3N9KA 1EQCA 1PG7W 1ODAA 4MDJA 4LMQE 3QB7C 2WMIA 2V7HA 1LEKA 1FVCA 4YBHA 1LO0L 2E8ZA 4J28A 1IVLA 3FT2B 3TH2T 3OV6A 3DI2B 4XWOC 1G84A 2VZVA 4E9LA 5E09A 2GK1B 2Z8WC 4NRZA 4D9RD 3OKLB 3VFSA 3SDDD 4UTAH 3U7YL 2DSUA 4G80A 2X4SA 4D0BA 3BVNB 4JFSA 5DMIL 5E2UH 3QDGA 5HDRA 3OG2A 4HTYA 2NXYD 3V0VB 1FZKB 1SYSB 2BVQB 1ZVYA 4JY6A 4PCSA 4JN1H 5FKYA 1BFNA 2VX7A 1A8JH 4Z7OF 5JXEA 4UQBA 5A2KH 3P77B 1HF6A 3SDDC 1R3KA 5MI0B 2CQVA 2VUYA 4F9DA 3ZE2E 3GBEA 2AXGB 3G5XA 3GUTB 1WFTA 4I0PA 2MHAB 2NXYC 1AMYA 1NP2A 4JRYB 2QSCL 5IT2H 1EFXA 2YA2A 1S8DB 1NKOA 1U2YA 4ZODA 1HYSD 4F9LC 2GK0A 5SX4H 5IQ7L 2XSBA 4JG1L 1QFUL 1BWWA 2X4NB 2VISA 1RUPL 4H20H 3GMPA 1MLCB 4TRPH 1OP3K 4LHQB 3MS8A 4N8VA 4ONFH 1Z9SA 1TFVA 4EQ3A 4BH7A 1YHTA 1HYSC 1LP9B 3O2WH 1DANT 4JM2F 2ED9A 1CFBA 1XGPA 3L2MA 3OGCA 4PB9L 3SDXE 1DWFM 1EERB 1S7VA 1OAYL 3PV6A 1JG9A 5H2BB 1YPZE 4UV7L 3L5WB 4MA3B 5KZCB 3U7VA 1RULH 1BFVL 2MANA 2UY7A 1HNFA 5D6DA 4RA3A 2LU4A 1EGZA 2XY2A 5HY9B 4X6FB 3UPRB 2QLYA 3OLGA 5A2BA 2W0FB 4Y4KA 4EDWL 5LQBL 4BZ2H 2EE2A 1JHKL 2X70B 1U8LB 5AD0A 1T03H 3T0AA 1W3HA 5B22A 1ZA6A 3RVTD 4KJPD 4LLUA 4RAVA 3MCG1 3PV7A 1NLDH 1MSPA 4E5XB 4JFVA 5E1AA 5DD3H 5J1AB 3RWFB 1KLUA 2VMFA 3STZA 2AGJL 1IGML 4FZ8H 2ZSVB 3RVTC 3CD4A 1X4XA 4KJPC 5HGHA 2WWCA 4PG9B 3NBNA 3UTPD 4Z5RB 5D1ZB 3PGDA 3JBG7 1N8ZA 4LFHG 2F8XC 4N5UA 2YL9A 1WK0A 3CFDB 4I2XB 2Z1SA 1BOGA 1C7TA 3C6LA 4RDQG 1DWHM 2BVUA 1QLFB 5DJ6B 2FR4B 3CPLB 4M7LT 1V0MA 3QXVA 4U2YA 4Z7UB 3LXAA 3O4LE 3QO0B 1X5ZA 2MSPA 3BQUB 1IBGH 4ZAKD 3W29A 2Y06H 3L4UA 3FQNA 3KXFB 1MCFA 4OLXL 5DEFB 4NOFA 5I9QC 5CSUA 3OKMA 4M4RA 1NCCL 1UYQA 1I1FB 3CPUA 4H0GA 4HXBL 5C0CD 5BVJA 2BERA 5E4EB 3TT3L 2EKSA 4Z7WF 3DUSA 4ZAKC 3JWNC 1MOEA 4H1LB 2XXCB 9CGTA 4NNXB 1XIWB 3PDDA 1OCQA 2QPUA 5H37G 2DI7A 2R69H 2Y07H 3QUYA 2EYRA 3SCMB 3UC0H 3NCYP 3VIIA 5CAYB 4MB4A 1BJ1J 1AXSA 3MRMB 5GS0D 4WI4A 4BQ8A 1HJWA 4S11A 1PZ3A 3LMYA 1BBDH 3TBVA 3PDOA 4PJEE 5DURB 3V9FA 4XBEL 4PLNC 1LE5A 5A8NA 3I6GA 1HHKA 4JM4L 1I75A 3CGTA 3JV6B 1DN0B 5BJTB 3MV9E 1OSZB 1Q6DA 1R47A 1FG9C 4L8BA 5GS0C 4LVEA 5CFHA 5HHVH 3VD3A 2F1AA 4MWFB 3BYTA 1WPCA 2E7BA 1ZLWK 3C6SB 2R2BA 1IKNA 1BEYL 2WBGA 3B8SA 5HDBE 1HOCA 2A3HA 1FFNA 4GAFB 3O2DH 2V3DA 3VX1A 1FAIL 1JPTH 4PTWA 4LAQH 4AY0A 4MNGE 1OHQA 3ARWA 2J74A 3U30B 4Q9RL 1RZ7H 3LPGA 5DI8A 2D23A 2NYYD 5GGSY 5IBLC 3LSOB 1DL7H 1H0IA 4D1IA 5FO7B 3AS3A 5HJ3A 5L2KA 3B9VA 3D2UA 1H15A 4HIJA 1H5BA 3H9SA 4HT1H 2YEZB 4Y1AD 3GH4A 2XRAH 2NYYC 1WAAA 3EJZD 1M7XA 2SEBB 4CU6A 3BW9A 2EXYC 3MV11 1MY7A 3MV7E 3AB0B 1T0OA 1I8LA 1G6RA 3WFEH 4E41D 3H9HA 3SGDI 1LO0H 4QXWA 2F19L 3MLZL 4PTTA 1I7TA 1CN4A 3QAZB 5DFAA 1DQDL 5LAXA 1T83C 4RAHA 4GZIA 1VACA 1TQCB 3EJZC 3KPNA 1YC8A 3U7YH 3RY5A 2XVPA 5DMIH 2N1KA 2QBWA 1T7XA 1BREA 1QNZL 1J8HA 3QQ4A 1YY9D 3D85A 5JHLL 4NDMB 5C07E 3G04B 2VDNL 4XNXL 2ADJB 4K9EL 3C8KB 1ZT1B 1E1EA 5EBWB 1K9TA 1G7PB 3O3EA 1HHGA 4G9DB 3OL2A 1GZPB 3VXUE 1YY9C 4OV6F 5IEHB 4OLWH 4QF1B 3P0GB 4HCRA 1ZLUH 5IG7A 2QSCH 3IDYC 1U2CA 2ESVB 3VNYA 2P46B 1IFHL 3AYSA 4OUUA 4G8IB 4QAWA 4ZE4A 1EJOL 5MEPA 3OG4B 3W28A 5L0QC 3FB6A 3D69B 5IQ7H 3U82B 4GG6E 4JG1H 4TX6A 3GDBA 1QFUH 1I1AD 1UWQA 5DVNA 1RUPH 3VIKA 3BZ4B 4UNUA 3EJTA 3WHXB 3DJ9A 2VQ1B 1U0QA 4U6HA 3BPOB 1XGTB 3KG5A 5CMAA 4ZUTA 3HKFA 1I1AC 1R85A 1JI2A 5CEZD 4WI6A 5KVDL 4M3JA 3MV8E 1OAYH 2OBGA 4UMGA 4UV7H 5I66B 1BFVH 1FH8A 1N26A 2MMXA 1YN6B 5C08B 3VRIA 4B50A 1XCTA 1MJ7L 5E9DA 4D3CL 4MNQE 4PJCF 5CZKA 3LRKA 3PZOA 1PQZA 2MCPL 3L3OA 1MWAA 5A6BA 3KPSA 2XGBA 2VWEE 3LRHA 4M61B 1K5NA 5ISZA 4EDWH 5LQBH 1UD5A 3PQYD 1KJMA 2EC8A 1JHKH 3HUJF 4X4MA 5BV7L 2IANE 1KCSL 2ZOLA 1C93A 1QO3A 1CWYA 2QQLL 4I3SL 4JFDE 3CVHA 2I9LA 3FTGB 4AY1A 3IF1A 2EH8L 5ETUA 1KXQA 2VLRD 3QSKB 1ZJAA 3MUAA 1QEWB 1UH2A 2AGJH 3T1FB 3CZFB 2PYFA 1IGMH 5DD5L 1CFTB 1GJUA 1NUDA 1CT8B 3VGAC 3S4SA 3VM7A 1GGTA 5MEQA 3GSVA 4FG6D 3OJ2C 3VA6A 1PG7L 1LL7A 2F8QA 5IW3A 3OR7B 5GRYA 2XYCA 4DOHE 2BVEA 3EO9L 5FK9B 4XRCB 3OF6A 2R0WL 4C7GA 2VR9A 1UH3A 1MW1A 3X13B 2CRZA 1V5JA 3NIDE 4FG6C 3RDTA 4OCXL 1T1YB 1R6VA 3F8UB 2V5CA 4FZEL 4HAGA 4OLXH 4PV8B 4BFBD 5I73C 3HU7A 3HCVB 4LCIL 4EN3A 4WO4B 4HF5L 4JM2D 1KCKA 4HXBH 3UBXA 4N0UA 4LARL 3TT3H 1AQ0A 3MI6A 3C5ZD 3W53A 1UB6A 3W6LA 4HPYL 1N64L 3SCNA 1KR0A 4LEOA 4LKXB 3FAWA 4LCWE 4N9OB 1CDCA 5DLML 1CBVL 2VIRA 4OZGF 2JEQA 4JM2C 3CDCA 1WIOA 1YMMA 2X42A 1FBIL 4PIRF 1XF5A 4Z76B 1HE7A 2DLEA 3C5ZC 5C0BE 1DUYB 1IGCL 2WBJA 3B3IB 3ECBB 3MMEA 5HI3D 3DYPA 4DQOL 4L3CA 2DM4A 4HMCA 4BCEA 3U5YA 4XBEH 2XWEA 2DT0A 1D6EA 3G6JE 1NFIB 1SMOA 3CH8A 4JM4H 4RE3A 4KPHL 4OI9A 4C7DA 2HYMA 3RY4A 2J8OA 2W62A 4BQ2A 5M17A 3AHYA 1NDGA 5HI3C 5I1JL 3RZCD 1GCYA 3WDRA 4JPWL 2JB5L 3FQTA 3TIDB 1BEYH 1RIUL 3CDFA 4NO0A 1KIPB 1TTFA 1FAIH 3OA5A 3PZGA 4PJGE 5DJCB 3GIVA 4YC2C 1EEQA 4XVTL 3RZCC 1QUNA 1VFUA 4Q9RH 2YJQA 4PV9B 5CIPA 4PMDA 4EI6B 3UYPA 3KPRE 4WW1B 1IEAB 2V6HA 4F7EB 3HE7D 1Z9MA 4CN6A 1G7IB 4HU8A 3H2WA 4IIQB 2E7LA 4GRWF 4W84A 5KVMC 2GT9B 3CCHB 3QIWA 5C0AE 4ZO9A 1CXEA 1QBBA 5FB8A 4M8QB 5DWUL 3HE7C 1MI5D 2Y9RT 4NCC2 5GIRB 4PJ9B 4U4BA 1MIMH 2F19H 3MLZH 4LVHC 5DO8A 1MHHB 2XWJB 3F7QA 1DQDH 2YZ8A 2FCBA 4Y2DD 1B0GA 5LWYL 5L8LB 2AAAA 2Z31B 5JW5A 5DRXB 1GL4B 3DX0A 1B4JL 2HG5A 1YA5A 3CFBA 4ZS6D 4MJ2A 2XZCL 3RIAF 4P8XA 3VXRB 4V1DB 1QNZH 4KRUA 1D5BA 4IMKA 3OKOB 4W6WB 2YD5A 5JHLH 1AGEB 4BQ5A 1UWXK 1H3TA 3L3KB 2VDNH 4XNXH 1WTGT 5EC2B 3FOMB 4LSRL 4Y2DC 4K9EH 4ATDA 1NBYA 4ZS6C 5F88A 4D94A 5EN2A 3U7BA 1TDQA 4MAYB 4K7PL 4L4JA 5F7LB 4L4VB 3B5TA 5MENB 2GJXB 3W81A 3AMDA 3MJ7B 1EX0A 1IFHH 3VFUA 1CDIA 5DK2B 1EJOH 3H0TB 1NEZA 2WCGA 2GFBB 2RGLA 4ELMB 3RWHA 4JFQA 4IHOB 4X99B 5TQ2L 3A23A 3MLUL 4MDOA 3BXNA 1KTRL 4H25B 2IMMA 5JW4R 2D31B 4LPVA 3FOLB 2V7NA 3A6BL 4OCLC 3S5LG 3FQWB 3IDGB 1RH9A 3S5LB 5FYLL 1V7ML 2MTPA 3HZMB 1D2KA 1IQWH 1BYAA 2MOVA 1Z9OA 3TH4T 3VSTA 2ITDA 3P9LA 4PJAE 1GZJA 2ZOKB 5FF6B 1NARA 2DQGL 3E1F1 4GW4A 5KVDH 1Q6FA 3P4MB 1Z9LA 3L5IA 5HHMB 3MJ9A 3FRPA 3T77B 4XNUL 5EC1B 4YPGB 1PD6A 3CK0L 2QADD 4K71B 3WO3B 4NKQB 1OD7A 2CJUL 4WWID 1MJ7H 3AVEA 4ELKA 4D3CH 1MFVA 4JZNA 1UWTA 2EPMX 1G9NL 2MCPH 2X4RA 4ZOEA 3SUVA 3ARFB 2ATPA 3VFOB 1M7DA 4PJHE 3FXYA 2EDTA 3QHFL 1KBBA 1CGSL 1YPZF 1GVIA 2NY5L 3KE0A 1YYLL 5BV7H 1SHMA 1KCSH 5DJDB 2QADC 2NT1A 1CR9L 2QQLH 3BUYB 1K6QL 1PJ9A 4I3SH 3MU7A 1IAKA 4ALAH 2DOCA 5LYRA 2EH8H 1CE1L 1JPFB 1MCLA 1Q0YL 2XKUA 3SGDH 5J11B 4YR6B 3BIBX 5C2UB 1WBZA 3WIFA 4WU5B 5DD5H 1ZHBB 8FABA 3MPCA 1XSKA 4PRDA 5J6HB 3BUBA 4EANA 4PMOA 4B7IA 3FT4A 3ZJ7A 3FZUD 1PG7H 1M53A 1FO0B 4Q7NA 4LYQA 4FQIL 2BOCB 3E6HA 4WV1A 3EO9H 4APQA 2R0WH 4MB1A 1JN6B 4UAOB 1Y7VA 1XYFA 1QSED 3PWNB 2HVJA 5DRNA 4P2CG 3QNYA 5SWZA 4OCXH 3FZUC 3T0EE 4LVNC 1MLBA 4FZEH 4PMYA 3BPLC 4TNVF 4LCIH 3VJ6A 1OQOA 3RWIA 4HF5H 1INEL 4WI5A 3MRNB 4E8DA 1FG2A 4K23L 5DK0A 4G42A 4LARH 5D7JD 5EH1A 4FS0A 1SJHB 3E2HC 1N64H 4OZHF 3RJXA 1IC1A 3F7PC 3OXSB 3NIYA 5DLMH 3HG1D 2A1WL 4JVUA 5DJ0B 1CBVH 1KTCA 2H32A 2XTJD 3RUGE 1A7NL 1HKFA 1D9KB 4YAQB 4OLEA 4M5YL 4W7UA 1BVLB 2PC8A 3GM8A 1FBIH 2G41A 1MJJB 5D7JC 4CU7A 1P7KB 2DLFL 4HKXB 1HWWA 2DSKA 1JGLL 1V02E 1PY4A 4DQOH 2ATKB 2XTJC 5KSAD 1ZSDB 3KLSA 4ZOBA 1BAFL 3C8HA 4KPHH 5ESQB 1HHHA 4X7FC 3SE3A 4YGAB 4ISVA 3BLPX 2VVSA 3L4XA 3L4ZA 4R2GB 1MVUB 3TBSA 1KT2A 2Z91B 1XCQB 4P2YA 5I1JH 5DJXB 1FV1A 4PJEF 4XWGL 4JPWH 1F6AA 5KSAC 3NDZA 2Q8BL 1RIUH 4M29A 3WQ5A 1E27B 2OLDA 2VLKE 2BSRB 5KTEL 4NC2B 2FIRT 3ZT5A 1LG1A 2OZ4A 5DUBA 2FO4A 1BVNP 4HUVA 4XVTH 3JV4A 3DSFL 4S1QL 2Y8KA 1ORQB 2J8UB 3IGAA 1QSFB 2DQFA 2V2WA 4XT1C 1CZ1A 1MCIA 2C7UA 4JFFE 4MDIA 3GXIA 5FM8A 4Z2LA 2NY1D 2JJTC 4P3DB 3QDJD 3B8YA 3QDGE 4NWTL 4POUB 4YXHL 1QTYT 5TE6L 3LRSA 4MX7A 1Y6NR 2YR3A 4MNKA 1OIMA 1F02I 1HXYA 5INCB 2NY1C 5FYLE 1QNQA 3ROOA 3SJVD 4UINL 4JDZB 5LWYH 4PJ5B 2AV1A 3CZJA 4I9WD 1DUZA 1NGPL 3WFCL 1JWUB 2HLFD 3MNZB 5MERB 3VD7A 3ARXA 3S8WA 3W37A 3V6FB 3CFEB 1IM9A 4NRSA 4LSRH 2R8SH 2MFNA 3FRUA 1WKYA 2CDEB 2YRLA 4ML4A 1NLBL 4P5KA 1G6RL 1IAMA 2HLFC 4NQEB 4Y5VA 3VM5A 3BIKA 3NCJL 4K7PH 3M6DA 1XSIA 4G8GB 5IKCB 3NSXA 4P8WA 1P2CA 4LP5A 4X6BA 3AXHA 1E4NA 1E6JH 4X8XA 1CLCA 4OCWL 1C8PA 4P2QB 3PWJA 4JHBA 4J12A 1HVQA 3DMMA 5CSZB 3QXAB 4XCCL 3L3JB 1R3JB 2YKLL 3WNPA 5DD6B 1O7VA 3HZVB 3WS6A 3EO1A 3UTZB 4J1UB 1SVCP 3A6BH 3RKDD 3GSXA 3TONA 1ZE3C 3V6OA 1AKJD 5FYLH 1CU4L 2WINA 3DOSA 1V7MH 4Z78B 5BS0D 1P7QA 4HCRL 3V5KA 2ZUSA 4BQ4A 3OLIA 1DDHA 4WFGE 1E3ZA 3LQAC 1FHGA 1BYCA 1R75A 3ARDA 3RKDC 3X14A 1NWTA 1IC4H 5E5MA 3GJFA 3KPPB 4XNUH 3VRJB 1JIBA 4H8HA 1QFWM 5F7FA 3RPIB 2CJUH 1BZQK 4RIRB 3GSNB 1QR1B 2VITB 1G9NH 1GC1C 2XFYA 3QI9B 4XHJD 2XN0A 3QHFH 3DV6B 2DN7A 1CGSH 2NY5H 5D2NB 1F4YL 1YYLH 1A6ZB 4G9FA 1VGEL 3RNQB 1JGUL 3GSQB 2C1PA 3QWOA 3MLVL 4L8DB 3SGJC 5IF0A 1CR9H 3HS0B 3QUMA 2E9MA 4B15A 2IBZX 1K6QH 1MUJA 2X44D 2P8LB 3L7FB 5FGBA 4WLCA 2FJGA 4M7JL 4NHUB 3STLA 3C09B 2Q20A 4XHJC 1CE1H 1B3JA 3CLEL 3TZVD 3JUYA 3Q5YA 2COQA 4N9GB 2EO1A 2O61B 4J3SA 2FYYA 3VMNA 1I7UA 3U7AA 4LLVB 4X5XB 3IGUA 3WH7A 3QNZA 1DEEB 2D7PA 1DQJA 3S5YA 4FQLL 3D39B 1LLOA 3Q5OA 3TZVC 3OMZA 2P5WD 1U8HB 3CFKB 4FQIH 4L1HA 3SPVB 3IK2A 4PR5B 4YHPA 3UYRL 4LSSL 1E4XI 3GXDA 2EDRA 4CKVX 1BLIA 2UVFA 1E6PA 1T04A 4KJWC 4U0RB 3KPOB 2YWZA 1QHOA 1WFOA 4I48B 3BSGA 4CMHB 2UY2A 1W0VB 1AGBA 4NC1E 3ES6A 3KLHD 3U48A 4YXLL 2WP3T 5F3BB 5J89A 3L7EB 2WZHA 1TCRB 3POCA 1INEH 4HMDA 4IMLB 3OX8A 3IU3B 2A0LD 4OOUA 1TUXA 32C2B 2PXYA 5GRVL 1ZHKA 7CGTA 3KLHC 1BGXL 1A6TB 2HN7A 4DKEL 1B3ZA 4P7NA 4XVJL 1NBQA 2A1WH 4N1HB 1A7NH 1DN2A 4U1NA 4M5YH 2A0LC 1QI4A 4PTUA 3P9MB 3B9KA 5JOFB 1JYVA 4S2SB 3O6FB 4Y5XB 2DLFH 3DVNA 4P5MA 2NW3B 4YO0A 4P4RB 1JJUA 1CE6A 3W6MA 4U1MB 4JB9L 1JGLH 4GIAA 1XF4A 2K3TA 1V0KA 4AYGA 3U4AA 1LNUA 4M82A 3NFSL 4AIOA 5JXAL 3DO7A 3A6CL 4M1RA 3SDCA 4KY1H 2A6IB 5KVGL 1VKXA 5T5FL 2H45A 5L2KE 3LOWA 5EZJA 4XWGH 5HGAA 4DFIA 4L4TB 1J05A 3H9SE 4LPWA 3VXQB 1UJ3B 1NCNA 2Q8BH 4PREA 3RIFK 5LGJA 4NQUA 4X6DA 4U1SB 4KI1A 1GXEA 5CS7A 3SE4C 3TBTB 5KTEH 1WAAE 3CFCH 3DXAE 3SO3C 3RJYA 4MJ5B 3BXWA 3S37L 1XD1A 4F79A 1BJ1H 3DSFH 4OJFL 4S1QH 1XHGA 3LS5L 2H9GA 2NY0D 5GGVL 1BYDA 4ODTH 2O5YL 3LQMA 2X4OA 4PYSA 5GS2H 2L7JA 3ULVF 3LS4L 2A9ML 2AEWA 4Y19A 3BRDA 4ODBD 4PJGF 1E4KC 4WUUA 4BK5A 4YEFA 4NWTH 4YXHH 1SEQL 5C8JB 2VDOL 4ZNEE 1JD9A 2NY0C 5TE6H 2J4GA 1MCEA 2AJYL 5C09A 4AM0B 2YDQA 4OGXL 1DHKA 1FNGB 3O4LD 5CKAA 2M2DA 4U1GB 1F90L 1NPUA 1PZ5A 4KHXL 5DD0L 3G9AB 2HFFA 4GZJA 1G7MA 4PBVC 2ZX9A 5AYUL 2AI0L 1OGAB 1T0MA 4WUKL 4NKOA 3RIKA 1NGPH 3WFCH 2RHEA 5EORL 4O4YL 1NUGA 1AR1D 3IJ7A 4JFUA 4OLZL 1XGQA 4X5LA 1MCWM 3QA3B 5J06A 3WNLA 1U8KA 3QRFM 5DYOA 3FFCD 4G8EB 3BP4A 1IGJB 1EZVY 2FBJL 4KKAD 1G6RH 1RD6A 2X7LB 2DL2A 3NCJH 3RBGA 1AR1C 3VG0L 4ZD3L 2CIKB 4NFBA 4XNMB 4G6ML 4L4OA 5KSBA 3L3DB 3QEHB 5J7CC 1OIFA 1H4PA 4OCWH 2L4OA 1QZ1A 4H8WL 4LCCB 4KKAC 3MRKB 1ISXA 3T0BA 4BA0A 3ZZ1A 3Q3GA 3GSOB 1MQQA 4XCCH 2BNQB 2ERJC 2YKLH 1SM3L 5E9DE 3F5KA 1QFHA 1HDMB 4ZDHB 5GRWA 4QDMA 1V7NL 3IXAB 4X9GA 5TH2B 5D1XA 1YUHB 5IV2A 3KPSE 1N6UA 1CICA 3FAXA 3OKNB 3R0NA 5IEKB 2CXGA 3HRPA 5T5NG 2DWEA 1D7FA 3LKSA 1C1EL 4P99A 3EFDL 4HCRH 4X4ME 4BH8A 2RAMA 4U1HB 1N3NB 5D4YA 4HEPG 4HUNB 1G7HA 3DV4B 3MSDA 1K4DB 4OT1H 1WBXB 3QP3A 3HMWL 4HHAB 3QCUL 1KXQE 4XVSL 5K9KA 3AY4C 3ARUA 5IJVA 4C4KT 4HS6B 4HZ7A 3VE0A 1HX0A 4PJAF 3WKNA 3VCLA 1L0XA 1CF8L 2PB1A 1UR2A 3BPCA 2VXVL 5GRZA 4V2BA 1CEOA 5FA3A 5SX5H 5CEYB 4G7YL 5JLZA 3LDBC 2VH5L 4NZUL 1F4YH 3LKPA 1MYRA 1GAFH 1VGEH 2Q6WA 1N82A 1I85A 1NSNL 3FB8A 3MLVH 1XCWA 2F2HA 4QT5B 4JLRA 4HIHB 4ZFFA 2Z8RA 3G6AB 1AHWB 4M7JH 5ID1B 5GHWL 2QMKA 3VFMB 3MJ9L 4MLSA 4UNVA 1X7QB 3CLEH 2VX4A 3KYKL 3MJGX 2YXFA 1UZ8B 2NXYB 2LE9A 3HA0A 1EGJA 4HLJA 5E70A 3H7BB 5AYBA 1KGWA 4GKZA 1YEGL 5JIIA 3MBED 1A4KA 3HAEG 4POYA 3HAEB 4DZBB 3OTTA 2HT4D 4FQLH 2DI8A 4WNQA 2D0GA 4ZXBA 1NWSA 4JFHD 3EJUA 2GTZB 2F53B 2DQEL 3OJVC 3UYRH 1QG3A 4LSSH 3GSWB 4UNTA 2EEAA 3QFJA 1U93B 3CVHH 4UOW1 2FJFA 2P4AB 4TOYL 3MBEC 4BYHA 1QRND 1ISWA 2HT4C 2PTVA 4HZ8A 5IHUL 1OGTB 2BNRE 3G9VA 4YXLH 5D96C 5IWLC 1LL6A 1FP5A 3L9RA 1UD2A 1ZGLP 3JV0A 2OMNA 5GRUL 5A8OA 4O5LL 3C9NA 1T3FB 1WISA 5FO9A 4JO2L 4UQCA 1LO5B 1OF2A 4F33A 2CHNA 1RZIB 3SCQA 5B39A 1BGXH 1I1CA 2JCCA 1JGEB 3MRQA 4DKEH 4XVJH 2R4RL 4NRXA 3SKOA 2CITA 3TNMB 1E40A 3WO4B 1P69B 4LHUD 1RK1A 4F37F 5IM7B 3VXNB 3L5JA 3S88L 4PY8J 4J4PD 3WKML 4JB9H 4BS0A 4X6EA 3VXTB 2Y8VA 3IFOA 3QEQB 4MJIA 3KPMB 5I8KL 1BX2A 5CINL 1WZLA 2GY5A 3RWGA 3H8NA 3NFSH 1P1ZB 5JXAH 2R1XA 1MFEL 4LPUA 1KEML 3KAAA 1R3HA 3UTSB 4JQXA 4N0FA 1UWSA 4UU9B 5KVGH 2OS7A 1A1MA 4J4PC 4HKJB 5T5FH 1HXKA 2X4PB 1X5YA 4MQXC 3BYYA 3VGHA 4NKDA 5JPMB 4D0DB 4ZFMA 1XR8A 3VH8A 1P53A 2IEPA 1WV7T 1FZJA 3S37H 1NH6A 5CJBA 4UTBL 4OJFH 1KIRA 1A6UL 5DDHA 3D9AL 1B4RA 3LS5H 3LCYA 5GGVH 1LL4A 2O5YH 2BXZA 4P48A 2Y5TA 1ORSB 4OKDA 5I9QB 3ZKXC 5KBNC 3LS4H 4W93A 2CGRL 2A9MH 3FB7B 2OW7A 4BQ9A 1WDQA 3B43A 4V2XA 1S7XA 3TEUA 4R96A 4QOKA 1SEQH 4HWZB 1Q9LA 3IFPB 2VDOH 3QJHB 1A6VL 2ZSWB 4ZAKB 5I1IL 2ZXAA 4RGND 2AJYH 1XF2B 4MA7L 4OGXH 4UFMA 1BQHG 1KF9B 1BQHB 1PIFA 2OR9L 1E4XH 3DECA 2OZ4L 4NT6A 4UZGA 2EZ0D 5C0CB 1F90H 3QUZD 4UBDD 5DD0H 5CEXB 4OIFA 5CIPH 1GIGL 3IJYA 2XVNA 4EBQL 5BXFA 4RGNC 1WWWX 4ODUB 5AYUH 4M6ML 5ESVB 5EZOL 1LG2A 5GNYA 2AI0H 4WUKH 3WXVL 3W5MA 1FL6A 2EZ0C 2APTA 2ZKHL 5EORH 4O4YH 3QXUA 3BJ91 3W39B 3QUZC 4UBDC 5F7NC 4JFTA 2VZSA 4LCWD 4OLZH 3MUJA 2C9AA 4ZUSB 1B1YA 7A3HA 4L29B 2UZYB 4OFYD 1OGSA 3C5JB 1W2PA 3CFJB 3SCSA 4PRHB 1YEKL 3QHZH 2ICWB 3RWEB 2FBJH 1ECEA 2BSSA 4XUYA 2YRZA 3U0WL 4ZD3H 4P23B 2UYLA 3HNTL 1D5XB 2ARJA 5F89A 1HJQA 5F1NB 4BUHA 1JCKA 3S34L 4JO4L 4HG4J 4Y2OA 3DUHA 2G60L 3JTSA 4H8WH 2J7GA 1FNFA 4ACZB 4RMTA 3U9UB 1K4CA 2KKQA 5DRZA 4PJ7A 4HS3B 2AVGA 4BSVA 1C5DB 5ABDE 1L0QA 1V7NH 2DTML 2JTDA 3O8XD 2CIPA 4YZFF 3ULVD 2A74B 3KDMB 1U8PA 2WNWA 1QHZA 1C1EH 1A14L 3EFDH 4XB8A 3MXVL 4H88L 2CLRA 3VXSA 3Q6FA 4X0NA 2EYTB 3HMWH 2AEQL 3QCUH 4EK7A 3O8XC 1NC2A 2YS4A 2XQYK 4XVSH 4Y1AB 3ULVC 4O02H 1JYXA 1JHTB 2ICEA 5BZDB 5TJWK 4NO3B 4M3KB 4UT7L 2H26B 1CF8H 5IVXB 3KL5A 2PF0A 2VXVH 1S9XB 5C0AD 4G7YH 2W67A 2R9HD 2VH5H 4FFZL 4NZUH 4AT6B 5DVMA 5JTWA 1NSNH 3CLWA 1NCWL 4QRRE 5GHWH 4E42B 4RAUB 4X80L 2FHCA 3MJ9H 2F1BA 4MQ7B 3KYKH 2C4FU 1A9EA 2UWEE 3QUKB 4L8CB 3WL9B 3IDYB 3REWB 3ARBB 1LEGA 4AZ6A 3HE6D 4OGAD 4G6FD 2PW1A 2VCAA 1YEGH 5I15L 4XAWH 3D48R 4OCSL 3ZYOA 3AC0A 2X2YA 3AQUA 1L9MA 4TOQA 4KC3B 3UCRA 3PDGA 2VLME 2DQEH 3FQUB 4S1DD 3CMJA 2EPNA 3QUML 2VR4A 3HE6C 3QQ9D 4OGAC 4TOYH 5GNZA 3MLSL 1JFHA 2XYLA 3D51A 2EIEA 3H9ZA 5EU6A 4AZ8A 5KS9A 3F65A 3NSNA 4GRMA 3BVNA 5IHUH 1JNJA 2AW2A 1T20B 3OKDB 2OJEB 1F3JB 1I1AB 4S1DC 3WDQA 2NY2D 3V0VA 1TVBB 3TF7C 1FZKA 5KZ6A 1SYSA 3M07A 5GRUH 3QQ9C 4O5LH 2FWOA 4IEFB 3ZHLA 1VJSA 4X0VA 4JO2H 3P77A 3VIGA 4BKLB 1ZHLB 4M6NL 4WWKA 3TBWB 4O51A 4ZPTA 1BYBA 3HZ3A 2AXGA 4JY5L 1I9RL 5F9JB 2E6PA 2HJFB 2NY2C 1JAKA 2R4RH 1NUFA 4JRYA 4L8SA 1J1OL 1FNLA 1U9KA 4W4OC 1QWNA 1QNRA 4JEGB 1S8DA 1UENA 3TP4A 3V8OA 2GIYA 4HA3A 1JHLL 3IAGC 1C91A 2GJ6D 4YQXL 1TVNA 3S88H 4AEFA 4Q6IC 1TXKA 3WKMH 1YYML 2XNAB 4MNHA 3QWQB 2X4NA 5FYKD 4CU8A 1V6VA 1HCVA 5LVEA 5I8KH 5CINH 2JB6B 3HR6A 4WI8A 4L3EB 4GG8B 1MFEH 1KEMH 4AYSA 1LP9A 1QQDA 2E7CA 4FQHA 2G3JA 4ZS7L 2C1OB 5DXWA 5IJKC 4RA0C 1S5HB 3PABA 2AJUL 3VGAB 1S9VB 5DUML 3PBGA 2H32H 3WV0A 1F4WL 4TUJB 1W2KT 1HXJA 2F74B 2GEEA 5H2BA 3GGWB 3UTOA 1KN2H 1U95B 4P9HC 3L5WA 3H55A 3DHJA 4GAYB 2VJXA 2IC2A 2NCMA 1CD8A 1BBJB 4JGUA 4D9QE 4UTBH 1V6XA 1PX3A 1A6UH 3D9AH 5HY9A 5IVOA 4EVNB 5I1CL 4OGZA 4R7DB 4L9LA 4F7TA 5C0IB 4F9PA 5ITFA 2W0FA 2D3NA 2DT2A 5E2TL 4LYRA 4M1DL 4AZCB 1KJVB 1U8LA 3O2LA 1W0WA 4YE4L 5ABFB 2R0LL 2F54B 3C60D 3KHOA 3FHAA 4D6GA 3PHSA 5DJYB 1A6VH 2DJUA 3UMTA 5I1IH 4E5XA 4MA7H 5J1AA 1NQBA 3ZT7A 4NHCL 2PO6B 1RK0B 2XACC 2OR9H 3SKNB 2OZ4H 3EYUL 4HLZG 5EZLB 5KANI 3T0ED 4LP4A 2ZSVA 5FYJL 5H94A 1EQPA 1I8IB 3C60C 1H0DB 3C5ZB 3BRGC 4Z5RA 1GIGH 1V3MA 1ZHNB 2IALB 2EH7L 4EBQH 3AIWA 1L9NA 4NI3A 5ECJE 3WLWD 1UUQA 4M6MH 5EZOH 4I2XA 4YHYC 5I24A 3WXVH 5D72L 4AEHL 4AQ1B 2VURA 2C3VB 2ZKHH 3SKMA 3T0EC 2FR4A 3CPLA 1IAOA 3WH9A 1DBBL 5JNYB 4NQDA 3I3BA 1MHEB 3QO0A 1FNAA 3WLWC 3KXFA 4MHHI 1YEKH 3CSYB 5I1AA 4EDXB 2Y2WA 4XAKD 1UA6L 3U0WH 1KBGL 3CO4A 3AIBA 3HNTH 2OM5A 3ZKSD 1T7VA 5LGHL 4JO4H 2IGTA 4H1LA 5FGCE 2G60H 3NAAL 1C5BH 1CFVL 2DMBA 4NNXA 3SGEH 4CDGC 4DN4L 5I1HL 4HFWA 1I3RB 5E8PB 1I1RA 3SCMA 4GMTL 1X1NA 2LAAA 2BMKB 3IJSA 1NAKL 2LVCA 4QCFA 5JBFA 5FA4A 1CECA 4X83A 4D72A 3T0DA 3LV3A 2DTMH 5AYIA 5TE7L 1HL9A 4EUPG 2VLKD 4EUPB 2OSXA 4I77L 1KOAA 1L6ZA 1G9EA 2X2HA 1UWRA 4G9FE 1A14H 1RAMA 5CG0A 1F58L 3POHA 3JV6A 5BJTA 3HE7B 5T3XL 1OSZA 3MXVH 3BZFA 3GZAA 1JF5A 5HYIA 5KN5B 4K94C 3BCDA 4P46D 3MMWA 2AEQH 4QRQA 4MWFA 3U83A 43C9A 4LVHB 5DFWH 1NDMA 3EGSB 4JFFD 3D3VB 2AJZB 3FY1A 2RBLA 1WZMA 3M7SA 3WY3A 1ZA3A 4UT7H 4Z7WB 1MI5B 4X5WB 4UB0L 4QRPA 2J2ZA 4BSWB 1G01A 4P46C 3UTTD 2WANA 4FFZH 1G0YR 4Y16B 2IF7A 2RCSL 5IB2B 4Y2DB 4BFIB 1ZL1A 4HV8B 4TQEL 2BV9A 3PP4L 2ZUYA 1NCWH 4NZDA 4PY8I 2MNUA 2YPLA 4WKFA 3TA3D 3FONB 1WWAX 3GJFH 4Z7UF 3PZTA 3BP6B 1I8KA 3RVUD 4Z7NF 5EU7E 2XJ7A 3RO8A 2YEZA 5I6XC 1FJ1A 4C57C 5I15H 3ZJ6A 4UQAA 4XPGL 4QTHB 4OCSH 3X3GL 1HI6B 2EDLA 3TA3C 3QQ3A 4GKNB 4IOSD 2FJHB 4JFED 5DZNA 3VGFA 5EDXA 3UG4A 2FSEA 3RVUC 1VPOL 4R97C 4I0CC 3QUMH 1MCOH 2LV4A 2DF3A 2J47A 3HC3L 3MLSH 5IMLB 4URIA 3VKKA 3BEWA 4XP5L 4O58L 1EGJL 2AJXL 3VFVA 4MJ4A 4NDMA 5BWFA 2H6PA 1VCAA 3G04A 3MLYL 1GNXA 4UIMA 3C8KA 3ULSB 5EBWA 3LRLA 1J0IA 4JO3L 3X3FL 4F15B 1G7PA 1C08B 4M6NH 3V95A 3EJQA 1GOWA 1EBAA 1NMCB 4J23A 2HT2D 1I9RH 1Y0LB 3ILQD 4PMZA 4U1KB 4R4BA 2VRJA 3C5SA 1J1OH 3RZWA 2ESVA 4GRLD 3EYSL 1L6XA 1JHLH 4YQXH 4X6DE 1UWEL 3D69A 4PBXA 3HG2A 4WI3A 2XKNA 2HT2C 3A22A 3ILQC 1Q94B 3BJLA 4PMNA 3BZ4A 5FYJE 4GRLC 3P9WB 3D0VA 2XVKA 2FX9L 4N90E 4QRUA 2XZQL 1OD8A 4ZS7H 3CJJA 5FHAL 4U7MA 1D5IL 3MLTB 4Y19E 2AJUH 4X4XB 1GJWA 5DUMH 4GUPA 5DZOA 3VFPB 3E8UH 1F4WH 4WUUE 4YHNB 2ZUXA 4J3TA 3WIJA 5F70A 3QXWA 1Z6JT 3RL2A 1KPUA 3FQRB 4CBPA 1HP5A 3OLEA 5EUOA 5I66A 5C09E 1ED3B 3B9EA 5SV4A 3AHTA 1Z5LB 4PBGA 2BOBB 3DROA 4PJFB 4KDTA 4NWUL 1BZ9A 2VL4A 3EZJB 3S36H 5I1CH 2WIIA 3A6OA 3K8MA 4LHJB 4LVNB 1BGAA 2DDXA 3N17A 4M61A 4DK6A 3SUWA 2JE8A 5E2TH 1ZVHA 4M1DH 1OTUD 4YE4H 1QSEB 3GIZL 5HNNA 2R0LH 1T4KA 4KGLA 3FTGA 3J8F7 5EIIA 2VLJA 2W1NA 2W9EL 4P4KA 7FABL 3RMEA 1UZ6E 1PKQB 1QEWA 2EDKA 4W4NA 3T1FA 4NHCH 1ITCA 1CCZA 1QYGL 1M04A 3EYUH 1VESA 1OTUC 2ED7A 2DLGA 5FYJH 4NX0A 1CT8A 4XNZC 3QDMB 3GZKA 5D7JB 5DJZB 3GSUA 1OD9A 2C26A 2EH7H 1AP2A 2W5FA 2ITCB 5CJOL 1UWXH 2GAZB 3OR7A 5T3XE 1RJLB 3HG1B 3KPTA 4YDKL 3MLRL 4RMQA 5D72H 5FK9A 4ZFOB 2XTJB 5I1LA 1H49A 3ME0A 1HXMA 2YC1B 4UT6L 1PLGH 1W72L 5D2LE 3X13A 3W82A 4PJCB 5ID0B 4M43L 1JGIA 3AMLA 1DBBH 2Z1KA 1URLA 4XPHL 3S6CA 1ZBKA 3ILPB 3IAPA 4LL9A 3MRFB 2CERA 3HC0B 1WGOA 2WLZA 4DGIL 3HCVA 3HUJB 4K8RH 4KDWA 5KSAB 4LCUB 1JV5B 2N56A 1EO5A 1UA6H 3VDAA 4DCQB 1KBGH 3L3HB 2FL5B 3EO0B 5C0RL 1ITBB 1PX8A 5LGHH 2LU7A 3EKCA 2C4FT 5F44A 3NAAH 1CFVH 4DN4H 3EJYD 5I1HH 2OYPA 3KPQB 3RM8A 5EIQA 3W0WB 2V5SA 4WTXA 2CRYA 2K9UA 1JTOA 4FLOA 3WUGA 4Z76A 5IB4B 1NAKH 1JF1B 4ZFZA 1DUYA 2DYPD 2VZOA 3P73B 3B3IA 5D7LA 1UH4A 5TE7H 3V2AR 5AG9A 2A6JB 2AJ3B 3EJYC 3O3BA 1I9EA 4I77H 4W8LA 3DXAD 2E9BA 4WFHE 1NFIA 5LBSL 4Z7QE 1LMKA 5CKGA 5T3XH 4XP9L 4WJXA 5KSUA 5FKAA 4HU0A 2WMPA 5TF1L 3EDFA 3QDJB 4FMVA 4ONHB 4GKSB 3MQIA 1P4LA 1U8IA 2FRGP 1T5WB 4PRPD 1MJ8L 5D5MB 4XH2B 4QHMB 1BM3L 1RJYA 3HTLX 1KIPA 1I8LC 1TVDA 4UB0H 4B9YA 1D5MB 3S6TA 3C8DA 4QGTA 3AGVA 4X7SL 2PCPA 5DJCA 4OAWB 1F45A 2JF7A 3NIGE 4F7MB 2BVOA 3CU1A 4OZGB 2RCSH 4PV9A 5BXPA 3DLQR 1CFSA 3U4EB 5KOVC 4TQEH 4Y4FD 4MCYA 3PP4H 3QFJE 4WW1A 4I18B 5EU3B 1IEAA 1JK8A 1PPIA 2KDGA 1G7IA 2Y25A 5I1EL 3TPKA 3VNZA 1PEWA 4R90L 4WFFD 4WHYH 1KB5B 3QOMA 4J7RA 2R0KL 3CCHA 4HWUA 2ADGA 4D6EA 2KUTA 4Y4FC 3TN0D 2DD8L 1DEDA 4XPGH 2J7HA 3X3GH 3MA7B 5GIRA 4WW2A 3PUCA 3CXHJ 2XV6B 2XTLA 5A16B 2EDBA 1VPOH 2QKIA 2UWEF 5DJ2B 4OZOA 2JCCE 5B3JF 4C55A 2XWJA 5EOQL 3HC3H 3TN0C 2WCSA 2Z31A 5DRXA 5D8WA 1MFUA 4XP5H 3QCTL 2HMID 2X9YA 4O58H 3VXRA 5DC4B 2CNCA 4V1DA 1EGJH 3I6LE 3OKOA 1GQIA 2AJXH 2NSXA 1N6VA 1AGEA 4G3YL 2JK5B 3L3KA 5JA8B 3MLYH 2AXJA 5EC2A 3FOMA 2B5IC 3V4PH 3VXMA 1HL8A 3GMMB 1RZJL 4JO3H 3X3FH 5TPWH 3VXPB 2ZUMA 2BCKB 2HMIC 4CVZA 1GH7A 3BN9D 3VGBA 5BS0B 3FW6A 1BWMA 2J75A 5F1SA 2ZWYA 1F00I 1UT9A 1E6ZA 4L4VA 3RKPA 5MENA 1JFXA 2GJXA 1IEHA 3GTNA 1XC6A 3F7VB 2WP3O 2V2XB 3EYSH 5DK2A 1JWMB 1FVDA 1DCLA 3GKZA 1DWJM 1UWEH 3BN9C 4KROD 1KJ2A 1PKOA 4X99A 4K2UL 1TJIL 5IB1B 4O2FB 2VXQL 1QLRA 1RSFA 3SCVA 5M5DA 4NBYB 3IKCB 5D1ZD 4QEGA 3KL0A 4AENB 3FOLA 1IJ9A 1XH0A 3S5LA 2XZQH 4KROC 1J12A 2CR6A 5FHAH 4Y8AA 1D5IH 2CBUA 4GAJL 4MSWB 1REIA 3HZMA 3W9EB 4KHTL 4QGYA 1QPPA 3QIBD 2DLIA 5FF6A 1ZLUK 5D1ZC 3O3DB 3BQUD 4QOKE 2QHAA 3TZVB 4XNQB 3GMLB 2YL5A 3V4UL 1N5AB 1QI3A 1CL7I 1I1WA 3MBXL 5EC1A 4YPGA 1W1PA 3CMOL 5T1KA 4K7FB 3ZYIA 4DAGL 4NWUH 3QIBC 3BQUC 1PSKL 4NNYB 1VIWA 3ARFA 2EICA 2P5WB 1WP6A 4DZ8B 1Q9KB 1V8HA 3LKNA 3F58L 1XIWD 2XY1A 2WZEA 1B2WH 5DJDA 1GOIA 2VQUA 5EFFA 4DVBA 5E4EC 2C5DC 2EQDA 5F3HB 1KCVL 3VMOA 7FABH 2EIZB 1T21B 3DX4A 1U8JB 3P3YA 4C56A 1XIWC 3CZKA 1QYGH 4YR6A 3FB5A 1T2JA 3KLLA 3K0WA 4OZIE 4WU5A 1HWGB 2ZPKL 1ZHBA 2BNRD 1GOGA 4AH2B 3VDHA 1ZEAL 3DBXA 2O9TA 1OAXL 5J6HA 4PJ8A 1X44A 2YRPA 5CJOH 1CLYL 1CTOA 6A3HA 1IL1A 4Z8FL 2BOCA 1CYGA 1FYTA 3KPLB 3MLRH 4J8RB 4YDKH 2I5YH 3IETA 4UT6H 2D20A 3PWNA 3HC4L 1TA3A 4M43H 3MCLL 4PP2B 3SDXB 2QJDA 2NY6D 4XPHH 4PJ7E 3TNNA 4YPJA 1XGUA 1GW1A 3LN9A 1QA9B 4YK4B 3ARSA 4LDEB 4PUBL 4MPKA 4KTDL 1YPZB 4NSBA 1E4MM 2QR0B 4DGIH 1GGUA 2Z92A 2FDBP 5DD1L 2IFGA 3GRWA 2NY6C 1MHPH 2OTUA 1ADQL 3SO3B 5C0RH 3VXSE 3OXSA 5DR5L 3BP7B 3NTCL 1WE5A 5E1QA 4Y89A 4HBCH 4M7KL 1D9KA 3QEUA 3LQZB 1MJJA 5KG9A 3BLKA 1P7KA 4XCYB 5I71C 5EBMA 4FP8L 4KRTA 2VSDA 3BAKA 1IQDB 2ATKA 3L3GB 4KJYB 1ZSDA 3TO4A 5LBSH 5CJQL 4XP9H 3AB0C 4J3VA 1CL7L 1NGQL 4DN3H 3A4AA 1OPGL 5SWQB 3HMXA 3R1GL 1FP8A 5TF1H 1VFBA 1XCQA 5DJXA 1EO8L 1YNKL 3RFZC 1AIFA 1MJ8H 1TQCC 2NZ9D 3IXTB 4F58L 4PMVA 1X5JA 1BM3H 5CQ1A 2ILLA 3O9WA 2BSRA 4XP1L 5SWSA 3O4LB 1VFOA 4BQ6A 4OZHB 1G7QB 3OGRA 4X7SH 1A1NB 4DO5A 4E8CA 2NY4B 2NTSP 1UB5B 3MR9A 1JWSA 1CI5A 3TYGL 2NZ9C 4MQTB 4OM0L 3VIFA 4GO6B 2FLBT 2W65B 1UD6A 1VB9A 4MZ3A 1XV8A 4TVSa 5F6IC 3WJJC 1OARL 1HH6A 1RIHL 5EU6E 4DWSD 5KS9E 5I1EH 2X4QA 5CGMA 2CUMA 3IJ9A 4R90H 2I07B 2ZUQC 4P3DA 5MHSE 3AIQA 1AQDB 3NZ8B 2R0KH 3NFPB 2DD8H 1AGCA 3SE8L 1JTPA 4DWSC 1QOKA 3QIUD 4OLYL 4ZEPA 1DQQA 2ERJB 2RB8A 4PJEB 3OGVA 1I7RB 4ZQKB 4AIEA 1HN1A 3MRIB 5D7IE 4AL8L 1RVFL 5EOQH 2BRRL 4HXAL 4PJ5A 2R1YA 2CO6B 4OZFG 5ITBL 4NKMA 4OZFB 1U30A 1UG6A 3QCTH 4OBSA 3BPOC 4WEUD 5KSVB 1KXTA 1UG9A 3CX2A 3MGOB 4Z9KB 5C08D 3QIUC 3S97C 3ARQA 4PMUA 2VNCA 4L5FL 4G3YH 2OXGA 3DURB 3VDCA 5GGRB 4P5TA 5HPOA 2A6KB 4WRLA 5CJXA 1E4WL 4K55A 3INUL 2CDEA 1RZJH 5IXEA 1J01A 4F80A 4W7WA 3GB7B 1NOWA 2WV3A 3ESVF 5E8NB 5E6IB 3ET9F 4MNGB 3WF0A 1XYZA 2YPKB 5HSFA 4PJIA 5ANME 1BD2A 2CKRA 5IKCA 1TZIB 1G0XA 1OW0C 3DX9B 4H5SB 3P4NB 1WT5C 3LDBB 3WIHA 4X7TB 2VQTA 3QWRA 4K2UH 1TJIH 2Q3ZA 2P7TB 5HPCA 4D6JA 2VXQH 5CSZA 1R3JA 3CX5J 4JAMB 4X0KB 5DD6A 5E24E 3HZVA 3DI3B 5IW6B 4J1UA 5CGTA 3AMKA 4FNUA 1GUVA 1UR8A 4RRPA 5EU4A 1JAEA 4MCZA 2BC4A 2VB5A 3D1MC 4KHTH 3AREB 5TFSL 1B30A 3PWUA 2DLTA 2A83A 2UY6A 3V4UH 3WFBL 4EKJA 5MP6L 5EG6C 1CZ8L 4QRRD 4WO4D 3MBXH 3RGVB 5MEOB 3U6RB 3VILA 4DAGH 1ZXQA 3N1GC 4IRSB 3GSNA 5C07B 3GNOA 1PSKH 3VWJD 1CK0L 4ZO7A 5D96B 3DV6A 3F58H 3T0WA 1QHPA 2R2HA 3X17A 4WO4C 1UWUA 4I2XE 1CDHA 3RNQA 3HS0A 4KQ4L 3O11A 1CDBA 2VLMD 2P8LA 5FECB 3OKKB 2ENSA 1KCVH 5BRZD 5AAMA 1NC4B 3VWJC 3I02B 5I76B 5ALBL 1J0ZA 4NQDE 1PX4A 3B2VL 3EYFA 1WO2A 2EECA 4N9GA 4BM7A 3KXFE 4NZFA 1JE6A 5INDB 4M6AA 4GG6B 3QUXB 4XZUB 4LLVA 1ZEAH 5D7KE 5CD3B 3FMGL 4I4WB 1OAXH 1DEEA 2UY4A 3D39A 4XXCA 3SUSA 1U8HA 3H7LA 3OWEA 4MYWB 4Z8FH 2F18A 3SPVA 4UOQA 4LIQL 3GO1L 1YEHH 5IVNA 4J3OC 3HC4H 1UCTA 1F4XL 5H35B 3MCLH 1W0VA 1VDGA 4LKCB 1ZLVK 4H8UA 3N04A 2YD2A 3MV8B 1LDPL 4PUBH 3WFDL 4KTDH 5F3BA 3UDWC 2F7RA 5C0JB 3GSRB 2D24A 1JPST 1IMHC 5K59E 2J25A 4HS8L 3K1KC 1QFPA 5DD1H 5D2LF 4OF8A 2IADA 4MNQB 1NMAL 4Y5YA 4U0QB 4LPTA 3RJQB 1RHHB 3KYNB 1YEDA 3M17A 5DR5H 1EV2E 3T8XB 4F2MB 3NTCH 4XCEB 2YOCA 5D70H 4NRYB 2IAMA 2VC2L 5E5UB 1GOOA 1A0QL 4FA8A 4FLRA 1GGYA 4M7KH 1HILB 4MXWL 3BWUC 1J7VR 4LNRA 2WW5A 1NCAL 3TTSA 5DJ8B 3O6FA 4Y5XA 5IFTA 4PJ9D 1DLFL 4P4RA 4JRXD 4LASL 1EEUA 4FP8H 4QRPE 4U1MA 2O5XL 2IXVA 3T65B 4E2OA 4DEPB 1OP5H 2BVPB 4JVWA 3TJEL 2IPKB 2OL3B 1OAZL 5CJQH 1MQ8A 4B9ZA 1CL7H 2Y1VA 4PJ9C 1NGQH 1IM3B 1AD9B 4H1LH 1OPGH 1YDPB 4B0MM 4W7VA 3R1GH 2YPLE 4OF6A 5F1IB 2V3EA 1MRFL 4DOHB 4CJ1A 3OIHA 1EO8H 4LLWB 5H37H 1MH5A 1YNKH 4L4TA 4PB0L 4X9HA 1UJ3A 1VFAA 1YN7A 3MRRA 4F58H 2J7FA 4U1SA 5EO9A 5AWNL 3MREB 5C0EB 3SCPA 4Z7QF 4ZPVB 4ZFGL 5SV3A 3TBTA 2K7PA 4XP1H 3R4DA 5FOBB 4MJ5A 1XRVA 4A3YA 4WJ5A 4MAYD 3EDDA 4NQCD 1EHAA 5M7QA 3QHMA 5JBDA 3TYGH 3RRQA 4ZUWB 3LKQB 3WJLA 3PTMA 1ZBWA 4OM0H 5T33L 4U5IA 3G6LA 3G08B 4YFLF 5K9OB 1OARH 3DO3A 2NX5A 3I9GL 4R26L 1OTTD 4MAYC 4DM2A 4LCWB 1DBKL 2AQ1A 3LKOB 5IK3B 5E0QA 3MUGB 3DX6B 4HIXL 4GW5A 1DE4A 4WCYL 5C0BB 1FNGA 3SE8H 4YHIA 1OTTC 4OLYH 3F5WA 2Q1EA 3LIZL 2EPOA 1T1XB 4NP4L 3MKKA 2AXHA 3GXNA 4AL8H 1LF1A 1RVFH 2BRRH 5AUMA 5HHMD 4HXAH 2M1KA 2ESVE 3ZKND 5ITBH 1KTBA 1OGAA 3MOAL 4YN5A 3MUIA 2CSPA 4ZNCD 2XG4A 4JCMA 4MADA 4L5FH 3DTXB 4RBPH 4KRLB 1A64A 3QA3A 4W5UA 3S35L 1V3LA 4LSQL 1IE5A 3O8XB 3ZKNC 1E4WH 3INUH 2E0PA 3ARGB 4G8EA 4D6DA 4EEEA 4ODXA 1BMGA 4R9HA 4FHBD 2X7LA 3IRPX 4K71C 5F1KC 5EMYA 4PJGB 4XV0A 3CH9A 2WC3A 3MUY1 3DWTA 4ZUVB 2H2PD 5ACLA 1PIGA 4FOMA 1LQSR 2P8MB 4CL7A 2D9QB 5HYSG 3KJ6L 4LCCA 1ND0B 4G6KL 1CGWA 5HYSB 3MRKA 3BZEB 2J7LA 5EUOE 4B41A 5E6ZA 3QRGL 3DDGA 5FYJU 4GLRH 1QNPA 4PGCA 3UXFA 1KQYA 4M48L 1NGYA 2H2PC 1HDMA 4FQ1L 5C0AB 3IXAA 1S78D 3JVGC 1KENL 4MNJA 5TH2A 5J11C 1C5CL 1YUHA 1JYNA 5C3TA 2YLLA 2WCAA 5IEKA 4PD4J 5TDNB 2EDFA 1W3LA 1T0NA 4LIQE 1N3NA 4OM1L 1F42A 3EJRA 1K4DA 1NCTA 2VLLB 2VLJE 2B8OT 4HHAA 1S78C 5TFSH 4TVPD 4WKHA 2VOTA 3WFBH 1KGXA 1KJ2L 3ARTA 1CZ8H 4HWBA 4FQXD 2DM3A 2EEDA 4UAOC 3MUHL 3MV01 4QRSB 4LGXA 5T1LB 3EOBB 4L9DA 1CK0H 4N0YL 1OT2A 5DRWB 3BSZL 5I2IA 4HPOL 2GDVA 4FQXC 3BESR 2FIKA 3AXLB 2VRQA 4KQ4H 4QT5A 3GI8L 1Q1JL 2QQNL 4U6XB 4YBLB 4OV5B 3SDDA 3G6AA 5A2FA 5BV7B 5ID1A 5EU7C 1JZ7A 2ARJQ 2GUOA 3VFMA 4U6TA 5IQ9B 4B5EA 1X7QA 5ALBH 4Z2HA 1Y6MR 4CD5A 3B2VH 2NY2B 3GKWL 4AMWA 1TZHA 1MW3A 1HHIA 3TGXA 3RJDA 4X9YA 1U8MA 5T3ZH 3EDKA 4X8JB 3CH1A 2DPEA 3FMGH 3HAEA 3MCKB 4DZBA 4P8UA 1A2YA 3WNMA 3O3AB 1UXWA 4X7CC 4F9LA 4UDTB 5CJ8A 4YDLC 4HPHA 3PWVA 4LIQH 3GO1H 1BVKB 3GSWA 2BY3A 3RX7A 3RTQD 4OZIF 1U93A 4LRIC 2GCYB 4QCIB 5BRPA 1N2RB 3LN4A 2GJ6B 3PHQA 4PJAB 5E94A 3QXTA 4NZRL 4ODWB 4BQCA 3SCUA 5JDSB 5F9WB 5JA9A 1LDSA 1LDPH 1NJ9A 1Q6CA 1CS6A 2WHLA 5D7LE 4MA1B 3RTQC 1T3FA 4H26B 4HS8H 5GJTL 1TETL 1QSFD 1FRGL 2WM0A 1XT5A 1GHFL 1NMAH 2DGAA 4UQ2B 4E0RB 2XN2A 6TAAA 1MCCA 3AS0A 2E5EA 3DHPA 1RZIA 3CIQA 5T5NF 1JGEA 1ZS8A 2CLZB 1A0QH 3TNMA 1AGDB 4MXWH 4O2CB 4D2NA 4WU7B 2HFGL 1NCAH 3AOFA 3BT2L 3G5YB 1DLFH 4LASH 3B5HA 2NTFB 3HG3A 4URTB 2O5XH 2CETA 3N18A 2JLLA 4GI8A 3TJEH 4HW6A 3GRWL 1P1ZA 5HYJE 1OAZH 4WF7A 1MCQA 4YH6A 5EO1A 1J1PL 3VFTB 4UU9A 4GO9A 3VD9A 4HKJA 3IVKA 8A3HA 2D2OA 3C08L 4GOSA 1MRFH 1B0RA 1R8LA 3ELAT 5JPMA 4PB0H 3PG2A 3A67H 1SYVA 3OLDA 4D0DA 2JELL 4YHYB 2BY2A 5AWNH 4KRPD 2BSTB 1AGFB 2FH6A 4KUCF 2ZX7A 2AAVA 4NQED 1S3KL 3T0EB 4XBGB 3HI6L 4TUOB 3U0TA 4MNMA 4C83A 5E00A 3RVXD 4G8GD 1LWRA 5ESAB 1KIQB 2MPAL 5T33H 5IIEB 4KRPC 4P2QD 4DVRL 1S9YB 3HMXL 12E8L 2CKBB 3FB7A 3I9GH 4C59B 4R26H 5A8QA 2W38A 4MAUL 3VXRE 5CSYA 3RVXC 4JQVC 4ORGB 1DBKH 5L7XH 5J6GA 4HWZA 3IFPA 2CH8A 2ZSWA 4FXGB 4ZAKA 1XF3B 4OKVB 1SEBB 2FZ3B 1XF2A 4LLQA 4HIXH 3AXXA 3TTQA 3VXME 1BQHA 1E56A 4WCYH 2CUIA 1KGCD 3QDAA 5C0CA 1GGIL 2CDGB 3RY6A 4M62L 3LIZH 5A94A 5HI4D 1Z0NA 5DVOA 4NP4H 4PTMA 4L4VE 2WAGA 3EFFA 1UYWL 3FT3A 5D6CB 4R5EA 2X4TB 1CG9B 5I16A 1UD8A 4Z0XA 2H2SD 5BXRA 1QSZA 3MOAH 2WWMD 4U3XA 4PRNA 2XT1B 4W8AA 2A38A 2FECI 1P84J 5HI4C 2JKXA 3WNKA 3WNNA 3RIFF 2ICWJ 4ZUSA 1KLGA 3JWOC 4L29A 3QI9D 5D7IF 3S35H 4LSQH 3WHE0 3VUPA 3BWAB 3CFJA 3WKZA 1PY9A 1U91B 2H2SC 4KV5E 2VLKB 1GQKA 2WWMC 1NGXB 1CXFA 2GJPA 4I13B 3IYLW 4PGBA 2GSGA 1RUQL 4XB3A 1LEKB 4R0LC 1L7TL 4JL1A 1FVCB 4LSPL 1D5XA 1JNNL 5IR1A 3QI9C 3MSGA 5HD8D 4P46B 1KUMA 3VFRB 4UFKA 5FM5O 1E72M 3NIFF 3NYDA 5D2NC 1OSPL 3WQVA 1HSBB 2ZG2A 3UROR 1UC6A 4G6KH 4JHAL 4JFFB 4NRZB 1QPXA 3VFSB 4ACZA 1NFDF 3QR2A 3QRGH 2EBNA 3TTOA 2P1YA 4PP1D 2DICA 3BHBA 4HS3A 3GYCA 2YUVA 1K2DB 2HJKB 5JIHA 3QDGB 5A2IH 4M48H 3GFUA 5HD8C 3HZYB 3UTTB 1KENH 1C5CH 1SVZA 2X9XA 5I6XB 2A74A 3KDMA 1ETZB 4PP1C 2VL5B 4OM1H 1BJ8A 3G5XB 4I0PB 1NOUA 4S0TD 2EYTA 5C0FA 4GXPA 3WIHL 1EFXB 2YA1A 1I9IL 1M1SA 4R97B 1KJ2H 1Q9WA 4Y1AA 4XNYH 4C56E 3GMQB 1JHTA 1T83A 1YJDC 4R27A 5F72S 4U0RC 2ADIB 5BZDA 3TCXA 1SBBA 3O2WL 4CMHC 3CUHA 1A6AB 4YGVA 3D18A 4N0YH 1S9XA 1GSMA 2VISB 4HK3N 1IGIL 3SHSA 3UEQA 1P6AB 3BSZH 4E41A 2CCRA 4HPOH 4MXVF 4N8VG 2J88L 3CU7A 1B3YA 4N8VB 4AT6A 5JPNA 1FYTE 2VXTL 4U6VL 5LJYH 4MXQD 1Q1JH 5FCZA 3D4YA 1DTUA 2F8OA 2QQNH 5AY7A 5K9QI 1T1WB 1XGPB 1RULL 3HMCA 1T2XA 2LU3A 1ES0A 3LKRA 4RAUA 2CKNA 2ZE0A 5BCAA 4MQ7A 2XZAL 2YD1A 3GKWH 3QUKA 4L8CA 3IANA 2Y72A 4LXFA 4QKXB 2EEBA 3MACL 3KYAA 4HX1B 4MXQC 5B38G 4BZ2L 3GSNL 3R06B 5B38B 5EPMB 1RJZB 5DMJB 1MAJA 1B9ZA 4DUVA 2ZCLL 1TQVA 5SX5K 5AYQA 2FECL 3FQUA 2QEJA 1PYWA 1AO7E 2RGSA 4GRLB 5A6AA 1BFOB 3QPQD 4C58B 4PRIE 2YPVL 4LLYA 3OAZH 3NJ3A 3ZR6A 2O26U 1ZA6B 3WQ4A 4U49A 1ITXA 2P45B 4J2XA 3OKDA 5HVHC 1F3JA 1I1AA 5E1AB 1KLUB 3D0LB 2XZZA 4LK4A 4NM4L 5IHZA 3QG7L 1S7SA 1JZ6A 3QPQC 5GJTH 1FRGH 4JHOA 1N7ML 1GHFH 4BKLA 1ZHLA 5DMGD 2YXMA 4HJJL 5HGHB 3QQNA 1FC2D 4AEIL 3PGDB 5F9JA 3VWKD 2OW6A 5I78A 4QP0A 3TVMD 2HFGH 5DMGC 1OWWA 3BT2H 1QI5A 3RA7L 2XNAA 5SWSE 3T3ME 3O4OB 3VWKC 3WN5C 1PBGA 5ICZB 4IDLA 2AJSL 1X4ZA 2JB6A 1R0AL 2XWBA 3GRWH 3OKMB 3TVMC 3PQYA 3AISA 25C8L 3ZL4H 3G6DL 3D25B 1GZQA 1J1PH 2X1XR 5BVJB 2C1OA 5GRVK 2EKSB 2Z8SA 4NUGL 1S5HA 1I4FB 3C08H 1RU9H 2AK4D 4IPLA 3KWWA 3ARRA 4KK6D 1UD3A 4TUJA 2DEPA 2VLRA 2JELH 3AS2A 3GGWA 4ODSL 1U95A 3HI5L 1PVHA 4YFDB 1DLHB 2HTLD 1S3KH 4PRAA 4Z2IA 3MRHB 1PDKA 3HI6H 4UCFA 4UZUA 4HH8A 2DWDB 5DHVA 2XXMB 1J18A 4G6AD 1FCGA 1E70M 1AR2A 3PWPD 3KYMB 1B3XA 4KK6C 3PDOB 5FCSH 5C0IA 2MPAH 4J3UA 1LE5B 2F5BL 5EWIL 2DQIL 3BCFA 1E71M 1MNUL 3I6GB 4N8PA 4DVRH 4PJ5E 1JDDA 3HMXH 2WMGA 2HTLC 1KJVA 3WY4A 1FN4A 5J57B 4MAUH 1VBUA 2AXFB 4L8BB 2BNQD 4YEEA 3V6BR 1YNLL 4G6AC 5DJYA 2X89D 3AI0A 4XX1E 3TBYB 2PN5A 2V2TA 4QHNA 4CW1A 4YHEA 5EZLA 3GI9L 3UJIL 2CK2A 4JM2A 1HIZA 3FQXA 1GGIH 1T7YA 4EKXA 4M62H 1HKJA 1NANH 4I5BA 1ZMYA 2AEPL 3C5ZA 1FZOB 2ESCA 1ZHNA 2BFVL 3B83A 1CGXA 4PJIE 1BD2E 1UYWH 2WWDA 2WYSA 1A4JB 4HT1L 4XCNA 4BQBA 5GGUA 3JTTA 3IS0X 2C3VA 5TDPA 3PIQA 2J12B 5HJ3B 1RMFL 5L2KB 1QFOA 4U7SA 3FHQA 1UKSA 5JNYA 3BD3A 1O6IA 1H5BB 4XC1L 1MHEA 3B9DA 3UTQA 2DYPB 1E6QM 4PTXA 4JPVL 2JJSC 3WFEL 1W9BM 4EDXA 3DXAB 4N5ED 5I1GL 4D0CA 1RUQH 2P48B 1UWIA 2L0DA 3V52L 1L7TH 4LSPH 4MS8D 1OP9A 1JNNH 1GOQA 3AICA 4BSJA 4PTTB 2C8NA 1I7TB 1XGZA 3BE1L 3H3KA 2VN4A 3ZTJH 1OSPH 2DM7A 3RZCA 2PYEE 4X9IA 4JHAH 4KUCD 3DSNA 4PRPB 1I3RA 4N5EC 5IESL 1OAQL 1GHSA 2XI9A 2BMKA 1AHWC 5J9PB 3QQ4B 4MS8C 4X4ZA 3D85B 4KRNA 1BGGA 2F53D 4OLWL 1JXKA 4NN7C 2ZUNA 1T66D 3DDFA 5EUOF 4JFPA 4Y4FB 4M7ZB 3O3EB 1HHGB 1XZ0A 3HE7A 3OBAA 2FE0A 4WFEE 5KN5A 4RFNB 1E15A 5IG7B 5CBEA 1I1YB 4IS6B 3WIHH 1PG7X 1I9IH 4R8WL 4PG2C 1RUML 1W32A 4QO1A 1T66C 1ZANL 4OUUB 2AJZA 3FB6B 3MO1A 3TN0B 2XG9A 3I6KA 1O7AA 4FFYL 4Z7WA 1MI5A 3DNKA 4X5WA 1LHZA 2CMRL 3NZHL 3RQ3A 1WDRA 1IGIH 1R5IB 2Y7QA 1F13A 3D39E 4Q97A 2DT1A 2P24B 2J88H 5EU5B 4R4FL 2OK0L 1F4AA 3WN6A 4GT7A 2VXTH 4Y2DA 4U6VH 2B5IB 5DGRA 2FHFA 4BFIA 5IB2A 3BAIA 4HV8A 2A73A 5CZVH 1FL3B 5LKNA 1U3JA 2XPKA 1WIPA 4NGHL 5IVZA 5FCUL 3C87A 3TIEB 5I1KL 4HWBL 2XZAH 2HFEA 2BNUA 3BP6A 1WDPA 2CD0A 4AEEA 1WDSA 3QEQD 3PN8A 3MACH 5A40E 3WO4C 3MRPA 2VZUA 3U46A 3GSNH 5KVEL 5KAQG 4QTHA 1CGTA 3ZDYE 3FN9A 1HI6A 1XCTB 3UTSD 5E9DB 1G7JB 1FIGL 1NBZB 2ZCLH 4GKNA 1PQZB 4DM1A 2FJHA 2DRUA 1EA9C 4KI5E 4FMKA 1K5NB 1SJVA 3BN3B 4ATWA 4BFGA 2YPVH 2B2XL 4NQSB 1QO3B 4OSUL 3WY1A 4KROB 2I9LB 4ZYKB 1UXSA 4LDLB 5CLWA 4U1LA 3IF1B 1HKKA 3RWCB 3F7RA 4OIIL 2XG5A 1E28B 4NC0B 3QG7H 2PYFB 3BEVA 4NM4H 3U5UA 2VAJA 3ULSA 3UZQA 1N7MH 2OR8A 3BKYL 3D4ZA 4HJJH 3S4SG 3HLAA 3S4SB 3I75B 4CMMB 5MEQB 4XGZA 4AEIH 3PGCA 1Y0LA 3QIBB 3QHNA 4QLJA 5AC4A 4ZTPH 3LZFL 2VDLL 3W9DA 4L4TE 4O2EA 3U36B 5DT1L 4K07A 4U6YB 1KG0B 2ZCKL 3GHBL 5GRXG 3T0VA 2E7HA 3RA7H 4NQVA 1INDL 4MJ6A 5IB5A 4L9LC 4LEXL 2CPCA 3E3QE 4U31A 3TYFB 2AJSH 1N0XL 4XXDA 1R0AH 3MRLA 4EN3B 2EIDA 4P3WA 5DSCB 2BFGA 25C8H 3UBXG 1T2QL 3VO0A 3G6DH 4RZCB 3UBXB 2CPUA 1MQKL 3K2MC 1MJUL 3K7UA 4NUGH 1KTKE 1UB6B 2ICWI 2NX5E 4FQQB 4J3WA 4X4XA 4TSCL 4TN9A 2HJLB 2Z93B 3FQRA 4U1JA 4PRHD 4ODSH 4RGMB 3HI5H 5L2JB 4D6FA 1Z5LA 4HKZB 4OIAA 4D8PB 1H09A 3VINA 5FIPA 2BOBA 1XF5B 2BNRB 1MFBL 1HJSA 2EXWD 3GXMA 4P23D 3ZYJA 1U3ZA 4Z7VF 1AQHA 4FXKB 1FL5B 3FN3A 2F5BH 5D7KD 2DQIH 5EWIH 1MNUH 1ZT4B 4PMQA 1DWGM 2LTQB 5GZND 3L5HA 2EXWC 2X1PA 1QSEA 2YD7A 5IBLD 4WW2F 3GNPA 4P23C 1YNLH 4QTIL 3CNKA 3N13A 2NY6B 4K7PX 3WMCA 4YIQB 1NDGB 1AC6A 1KXVC 2O5ZL 4JDVA 2JFEX 1A7RL 1PKQA 1UKQA 1P4IL 3VI4F 4HJGB 3UJIH 2AQ3A 3GI9H 5GSRA 5GZNC 3WEXA 1XH3B 3CDGB 1ZAGA 2X1WL 2Q76A 2EXYD 2AEPH 5D7JA 1ZGLA 1W3JA 1RZKH 3N50A 1X3DA 2BFVH 2DQCL 5I71B 3ZOAA 4A3HA 1MXDA 3ULUF 5EOTB 5HHXL 1S7TB 2WW8A 2I9TB 4UDUA 1I7ZA 1RJLA 3HG1A 3O81A 1J5OL 1DQLL 4NN6C 3HHRB 4NSKB 3SIMA 2G5BA 1RMFH 5HHOD 5ID0A 2QSVA 1JFQL 4XC1H 2IPUK 1MIML 4JPVH 5J12B 3MRFA 2GI7A 3B9AA 2MJWA 2EYSA 4X6CA 4NZJA 4DWHA 5FB8B 3HUJA 2ZWLT 5KSAA 3H42L 4TX8A 4QLKA 1A5FL 5I1GH 4DCQA 3V52H 3EO0A 5HYEA 3WMBA 1MAML 4M03A 1J9YA 1FFOA 3BE1H 3WY2A 3PGFL 4JO1L 1O0VA 4KV5F 4JANA 3ARBD 2AEIT 3SKJL 2H1PL 2HG5B 5IESH 1OAQH 3KYOA 5JHDD 1ZU8A 1YQVL 3F6IA 5GS0L 1D5BB 1JF1A 5F6IB 3N1MC 5E03A 3JWDC 5I79A 4ZSOA 2HT3D 4PJFF 3W11D 3KWXA 3IB4A 2JJTA 2JIEA 4FQJL 3WSUA 2ZUQB 5F7EL 2A6JA 2AJ3A 3ARBC 5GRJL 2XKSA 5I8EB 1BFSA 3QZWA 3FL7A 5F88B 5EN2B 2WUBL 1E5NA 2GJJA 4D9RE 1G9ML 5A2CA 4DWSB 1WZ1H 1GOMA 3W11C 2HT3C 3PF2A 5C3LD 4Y4HD 1PAMA 4R8WH 2Y24A 1HCFX 3QDJA 1RUMH 4ONHA 1ZANH 4GKSA 3VFUB 1LQ0A 4MB5A 1LWHA 1T5WA 5JW3H 3MRCA 3RWHB 1XH1A 4XH2A 1L0PA 4FFYH 2B7DT 3BXNB 2CMRH 3NZHH 1TFHA 3QIUB 1IQWL 3NUKA 3IJ8A 2IQ9L 4W87A 4Y4HC 2OWXA 4OAWA 4TYUA 3SJVA 4JFZH 4R4FH 4F7MA 2OK0H 5F7YC 4OZGA 3VXOB 1YMHB 3SCWA 1KXHA 4GS7C 3JXAA 2W60A 1PZ2A 5EU3A 1CVRA 1DR9A 4NGHH 1VFFA 5FCUH 3P9LB 2CK0L 2DQUL 3EYOB 4JCLA 4GW4B 5I1KH 4HWBH 4F9JA 1RV6X 1XR9B 3FRPG 3A5VA 5F7HA 4X4YA 2PUQT 5ENWB 4L3ED 5IFHL 2FO1A 1WITA 5KVEH 1RPQA 2FLRT 1MEXL 4X9BA 3MA7A 4KFZC 4HWNA 4PJDA 1GQJA 3RWJB 1FIGH 3SN6N 4JZNB 2V5TA 1MFDL 2IXUA 2ATPB 4HBQA 5DJ2A 1M7DB 4NO5A 4ALAL 4KQ3L 1FYHB 4JZJC 3VD4A 1H8NA 4KKCD 2B2XH 2YD8A 2Q7YA 4MDPA 4OSUH 3WIIL 3VFNB 2OQJA 3LMJL 2ZCHH 3OQ3B 3HRZA 5HHQA 4M1CD 2D4DA 3REVB 3GJFK 4QHLA 1CNVA 2E27L 4OIIH 2X1QA 4UR9A 3OPZL 4Q2ZB 3LPWA 3HAEH 4KKCC 2E9JA 3GMMA 4M8VA 3BKYH 1AKJA 1QRKA 3V5DA 1E0VA 2BCKA 3A0OA 5BS0A 1F11B 3UR8A 3EYPA 1KPVA 4M1CC 2F54D 3FT4B 4HP5A 2ICCA 4RMVA 1JUFA 4RX4D 1LWJA 3NVQA 3LZFH 2VDLH 3F7VA 4WV1B 1EDGA 4APQB 3RX5A 5DT1H 4XVUD 1R46A 1XMWA 2PO6D 2HH0H 2ZCKH 3GHBH 3L1OL 3L95A 4QRRB 3UPAA 2HVJB 5DRNB 3SGJA 4RCAA 1GHRA 5D5MF 1JZ8A 1TR1A 3WD3A 1INDH 5IB1A 3S98A 2EO7A 2PWDA 2UWEB 2QQKL 2ARWA 3IKCA 4LEXH 3VWJB 1N0XH 3UTPE 1D5ZB 4XVUC 3RWIB 3WLBB 2PO6C 1T2QH 5JOPD 2IBGA 4RE4A 1ZOXA 2UY5A 4GFTB 1MQKH 5EZIL 1WBYA 1MJUH 1EHNA 5CEZL 2ZICA 3EZ8A 2Q87A 5KW9L 2GTWB 1FGVL 4LPYA 2GSIA 2VABA 3CDYA 4TSCH 3SDYL 5BRZB 5BROA 2B4CC 3OJMB 3TZVA 3FO1A 1SBSL 2XPGA 4OQTA 1INQA 4XNQA 2O93L 2VAAB 1ACYL 4U7KA 2H32B 1TG7A 1B3VA 2GK2A 1BF8A 3PTKA 1E1FA 5GZOD 3ZKMD 5EA0L 1UADC 1MFBH 3ARYA 4K7FA 4K3GA 2JJWA 3VGGA 1S7QA 3CUGA 3SDAD 5C0CE 3Q6GL 3HI1B 4NNYA 2GW5A 3PL6D 2BDNL 2P5WA 3H9YA 1Q9KA 4D9LH 2BY0A 4AMXA 5GZOC 3LEXB 3MJ6A 4PRBB 3ZKMC 1HHHB 2HKHH 1AY1L 5B8CC 1SMAA 4ISVB 2NY7L 4QTIH 3SDAC 1JVKA 2P5ED 3TBSB 2GSJA 2VDPL 3PL6C 1FV1B 2O5ZH 1T21A 1A7RH 2OYKA 3IDMB 1U8JA 4WGWB 1P4IH 3T2NL 5C71A 3S3PA 4FTVD 4AH2A 3SKUD 1XFPA 4S1SL 2FO4B 1E0OB 2DQCH 2H41A 2K1MA 3MX0A 4W5ZA 4WKAA 1LGVA 3JV4B 1JRHI 4ZOAA 2C7FA 5HHXH 4CADA 1E3XA 3OHXB 4GI9A 3IGAB 3KPLA 4PBWD 3D3VD 2DQFB 1J5OH 1DQLH 4B53A 2CYGA 3V5HB 2C7UB 2BY1A 2EDEA 4MDIB 4JAWA 1TNNA 1W9XA 5AZEL 1JFQH 1A22B 4JRXB 3X11A 5ICYB 1FIEA 5DQJA 5C1MB 2EE9A 2H3NB 3LRSB 3NACL 4HD9A 4MX7B 4Y16D 2QR0A 4UNIA 2YD6A 1YC7A 4QLLA 3ZLQC 3D50A 4WY7L 4HPGA 3H42H 1BVZA 1SFSA 1A5FH 1EUTA 3TWCL 5EBLA 1HXYB 3SE4A 5C6WH 1TJHL 4A2LA 1MAMH 4UFJA 5CZXD 1YNTA 3P11H 3PGFH 3BP7A 4JO1H 4UOZA 4X7DC 5HYJD 4Y16C 4JPIB 3SKJH 1TVPA 4KXZI 1Q6EA 2AV1B 5FUCC 2R8SL 2H1PH 1DUZB 2X10A 3TJHD 1YQVH 5GS0H 1CQYA 3ZO0A 4XCYA 5CZXC 1E4KA 1IM9B 4NUJB 2XVLA 4FQJH 5EFIB 4KMQA 2RGMA 5F7EH 4NQCB 1IQDA 3FRUB 3CV5A 4E41E 5GRJH 1C8QA 4KJYA 4KKBD 4OD1L 2CXKA 3TJHC 1E6JL 2WUBH 4Y5VB 4TNWK 3CSGA 1G9MH 4OFDA 3VI3E 3ZE2F 5SWQA 3V4VL 3CTTA 3BX7C 3MLWL 1P2CB 2J77A 3IKKA 4X6BB 5FUZL 4RGOL 1Q9OB 3EOYG 5ADOL 4KKBC 1RFDL 3IXTA 3MRDA 2ALWA 5DEGB 5E56A 3O4LA 1KC5L 4OZHA 2PBGA 2EDJA 1TVHB 2IQ9H 5J3HD 3ULUD 5H8DA 1U6AL 1BQLL 3EO1B 1PFCA 1IC4L 1V3KA 4OIBA 5DJAA 5CD5C 2W65A 4F15C 5M03A 1P7QB 1TQTA 2DJ4A 3NA9L 5A2AA 3APGA 1WC7A 2CK0H 2DQUH 1NMCC 4Q58C 1DDHB 4P2RE 5J3HC 1F2XK 3ULUC 4GO8A 2I07A 3SDXF 1VJZA 1AQDA 3CVIH 3NZ8A 3X14B 5I17A 1IKFL 3GJFB 1K8IB 5IFHH 4FNQA 3PZMA 4OJYA 1MRDL 3FFCA 4HUWB 4LLDA 1MEXH 4Z6AT 1E0WA 1K9DA 2ZZUT 1CIUA 1SZNA 4PLOB 1V3HA 2F15A 5FOOA 1MFDH 2G9HB 1IZKA 1ZLVH 4EZMA 5ABHA 4PJEA 1XH2A 4KQ3H 1I7RA 5JQ6L 3E0GA 5CEZE 3MRIA 2EDDA 1A3RL 4HZLB 4G9FB 4KRMB 3QWOB 2C1PB 3GBDA 1MY5A 4OZFA 3P4OA 4AZIA 1MUJB 3WIIH 4RSVA 3LMJH 4WK9A 1UM6L 3BKJL 5JBEA 2E27H 4LSDA 3DURA 2LVEA 4PCTA 2NLJB 5ICXA 4PMRA 4JN2B 3OPZH 5GGTA 3TPUA 1HKLL 4AMCA 1BPVA 1F6FB 1A9BB 3AY4A 1I7UB 3PQYE 1FC1A 3QNZB 1ZJBA 3CLFL 5CP7B 4EQ2A 4RWYL 3DX1A 3WUEA 4MNGA 2YPKA 3S37X 3EOTL 3MNVA 3DX9A 3P4LA 4H5SA 3MNWB 3P4NA 5J4MA 1LILA 2XN9D 1OAUL 2VLRE 1U8OB 4XB7A 1QBLL 2XWTB 3L1OH 4FQXB 4MD5B 1UQZA 3PZ9A 2ZX6A 4R4ND 4GBXD 3FN0L 2P7TA 3QDMD 2VCCA 1AGBB 3BGMA 2X0HA 3ES6B 2QQKH 4JAMA 4JREC 3K3QA 1NUNB 5IW6A 2GVYA 4IDJL 2YN5A 2EDHA 3OX8B 2ZXQA 1IEBB 5EZIH 2X2IA 4R4NC 4GBXC 2PXYB 5CEZH 2D0HA 1ZHKB 5KW9H 1FGVH 3ARPA 2WHJA 3SDYH 2HN7B 5HGDB 4XBPB 4AMKL 1BFTA 1X5HA 5EUKB 4P0DA 4YDLB 1SBSH 1IC7L 4EI5D 1ACYH 1YEJL 4XPBH 4U1NB 4CN1A 1CQKA 3B9KB 4HJ0D 1KULA 5EA0H 1BLNB 3PJSB 3U6RA 1ZTXL 3DVNB 3MBEA 4M4PA 4YO0B 4FFVD 4KY1L 5F97E 4AW7A 3Q6GH 2EDWA 2NT0A 1Y18A 1XF4B 2BDNH 5IMKA 4EI5C 5IWLA 2WB5A 3SY0B 3AS1A 3DO7B 4HJ0C 3RTQB 1G6VK 3W0WD 1AY1H 2UUDH 1QRNA 5D1QD 4FFVC 2NY7H 5CILL 3OKKA 1VKXB 3CFCL 1MXGA 2IH1B 2VDPH 1AO7D 3I02A 1TIUA 5EZJB 2G4FA 5HGAB 1HTYA 4DKFL 4PRID 3T2NH 5LGJB 5FL0A 1ZK9A 5E7FA 4ODTL 5DHVH 1QBML 5INDA 5C7XL 1WWBX 5D1QC 4S1SH 5HDBF 4I4WA 1R5WB 3QXDB 2OSYA 5F21B 2W63A 1WCGA 5HBBA 1VEMA 2CHOA 4PJXA 3AROA 4XTRD 1F2QA 1FH9A 3FO2A 1ACZA 5LA1A 4LHUA 4Y19B 5H35A 4BQ3A 2FEEI 3N15A 4JY4B 5AZEH 4LKCA 1BZ7A 1KB9J 4KU1A 4KJQD 1VGKB 4J4PA 5C9JA 2BSED 4WEMB 4V27A 2YL6A 1F3RB 3NACH 5AZ2L 4XTRC 5C09B 4EXPX 4HLZH 1MCJA 5C0JA 4UFLA 5FHBL 5F9DC 1I3VA 3BSHA 3IDJA 3P40A 4WY7H 4A2MA 3QCVL 4Q74A 5EO0B 3TWCH 2BZDA 2W07A 1TJHH 1HSAA 4KJQC 1UFUA 4ZO8A 3UJTL 4CNIB 4F2MA 4M24A 1G7MB 5HVFB 2ZXDA 3LH2L 1AQMA 2HTKD 3O41B 1T0MB 1YEEL 1TMCB 3G5ZB 1DANU 1HILA 4I18C 3NFNB 2ZUUA 4KRPB 1YEIL 5DJ8A 3WUZA 4Z7WE 3WENA 2X4UB 1II4E 1UM4L 1V0LA 5L6YL 1RZ8B 1A3HA 1U8KB 5DYOB 4F8XA 2BVPA 2HTKC 4HFUL 3BP4B 4OD1H 1QSVA 2OL3A 3NGBC 1GCFA 1NAMA 1IM3A 1AD9A 1YDPA 3VX0A 1KCUL 3V4VH 4X98A 3MLWH 4LLWA 5FUZH 4RGOH 5ADOH 1J87A 1RFDH 3NPZB 5C0EA 3MREA 5D2LB 4ZPVA 5CBAA 4NQXA 4AQOA 3VFGL 5FOBA 2MQCA 4NFDA 3ABZA 4GG6F 1KC5H 2CLVA