5CLWA

Crystal structure of human glycogen branching enzyme (gbe1) in complex with maltoheptaose
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
658
structure length
637
Chain Sequence
VDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNREKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human glycogen branching enzyme (GBE1) in complex with maltoheptaose
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 1,4-alpha-glucan-branching enzyme
total genus 213
structure length 637
sequence length 658
chains with identical sequence B, C
ec nomenclature ec 2.4.1.18: 1,4-alpha-glucan branching enzyme.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
A PF02922 CBM_48 Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5clwA02
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 5clwA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5clwA01
4N90E 3VINA 2BDNH 1QWUA 2H3NA 1KTCA 3LY6A 1B3VA 1WKYA 4FQXA 4DKFL 4WIWA 4XVJH 1A7RL 1UYQA 2W9DH 3VX1A 3QPQD 3O45B 3WV0A 1G9NC 4G7YH 3GSOB 1FE8H 3IDIB 5SWSA 1GOKA 4I48B 5EN2B 5I1CH 1KCRH 3ILPB 1FV1B 1ZBVA 4HIEA 4Y19A 4Y89A 4ETQB 5HHOB 4KQ4H 3WHE0 1T0OA 3QI9B 1JGDB 3U7YH 2FGLA 1MIEL 5FHBH 4CJ1A 4XT1C 4GBXB 1NDMB 5DD1L 2DSWA 5HJ3A 4GQ9H 1VFAB 4IS6A 5SWSE 1N0XL 4B9YA 1H3GA 5DJAA 3WS3A 5C0ND 1ODZA 3HG1D 4CRPA 4BQBA 1T0MA 4F2MB 2HJLA 2QQLH 3VNZA 3WN5C 3MSDA 1KJVA 1AFVH 1EZVX 4AQOA 3ALWA 3CZFA 3QPQC 4TVCA 4IOIB 4U3HA 3L1OL 5JUEL 4XMLL 4D6EA 2UWEE 1AD0B 3VTRA 3S5YA 4PGEA 1TJHH 5F7LB 2IPTL 1QHPA 5JUVA 1AI1H 5GISL 3P9LA 1UZ8A 1T22A 2F5BL 3DX1A 1A4JB 3QIUD 3KEHA 1EIBA 3WY3A 3WE6B 3VWJD 1V3MA 5GRWA 4LSSL 3REWA 3O9WD 5GS0H 5FDWA 5C3TA 3GHBL 1OGAE 2IH1A 4MD4A 1YJDC 5GRZA 4KROC 2X42A 4LNRA 5D1ZB 2GFBB 3VWJA 3PN8A 4FABH 1JFQL 2XQYG 4H5SB 1RHFA 4XCFL 1AXSA 1CFTA 2Z93B 3RVXD 4F9LA 3K2MC 2V7NA 5HHPA 5ANMA 3WKNA 3EJYC 4L4TA 4G6MH 5I1GL 1IEHA 5EDXA 4Z95H 1BQSA 1AQDA 3RU8L 4O2EA 1OAKH 4CNIB 3PZOA 3QIWB 4Z2GA 1HDMB 3SCPA 3QG6A 1GC1H 4JY6B 1FO0B 3S3PA 3KPNA 3MRGA 4WI3A 1BFVH 1RJZA 4I8DA 5CD3B 1LO5A 2ICWI 1CLYH 4OF7A 3O9WC 4UUJB 4Z77A 1MQKL 1GZQB 4FXGA 4XPAL 5MEPB 1LD9B 1FVEA 4JVUA 4HUWB 4Z76B 3GMPA 1PEZA 3CHCA 5KTEL 3UDWC 4I18A 1NFIA 4OT1H 2JJWA 4FZ8H 4L29B 3WDJA 3D5HA 5BXRA 1KJ2L 4J23A 3SE3A 3ZYJA 1KF9B 2DD8L 4PY7A 5ENWA 4L3EB 3QB7C 3V5DA 5DK2B 2A83B 9CGTA 4DGVL 4K3EH 3Q1SH 4ZFOA 4S1SL 2HKHL 2IF7A 1EFXA 1IEAA 1KIPB 2XN9B 1S7XA 4M8QB 3U9PH 3SPVB 1S9WB 4PJAB 5DJ8B 1HT6A 1R5VB 1G7JB 4HT1H 4I2XB 4IRSA 3MUGB 4POZC 2IG2H 5J12C 1S9XB 4LLYA 5A3HA 1XF2A 3V4PL 2W59A 2FX7H 5I78A 4WCYL 2J12B 3L3HA 4PJEB 4ZS6C 4F7CB 4KJQC 4KRMB 1RULH 2YSSB 2WIIA 3TYGL 3MREA 1OWWA 2ZOKA 4WI7A 4PRIA 3NFSL 3UCQA 4G6FB 2DDXA 2C3VB 2DQGL 2VL5A 5FGSA 3L2LA 5ISZD 2YA2A 3GIZH 4R8WH 3PGCB 3ILQC 4PRHD 4GXVL 3M46A 3ET9F 4OCMC 5K33A 4F2MA 4XC3H 3RM8A 1NCWH 1QLRA 4WJXA 1I7UA 3W24A 2LTQC 2IPKA 4RMVA 2X8RA 5L2KB 4EDWL 3ME0A 2EJ1A 2TAAA 3EOBB 4HCRH 3WSQL 3LPGA 3GSNB 1E4MM 4N0CC 2GEEA 3RWIA 3SOBL 1KTRL 3BZFA 4PRPA 1EXPA 3N04A 1KPRA 5CZVL 2A3AA 5DRWA 3PDOB 2V3FA 2VR4A 3VIMA 1NDGB 3ZDZE 2PN5A 3REVB 1HF6A 1G9NH 5H2BB 1H3TA 3IXTA 4AY0A 2Y36L 4AENA 3RGVA 4IISA 1ISWA 1HOCA 1S7WB 4JFDB 5ICZA 2YBRA 3FOLA 3ULVD 2GFBA 4YDIL 1PY4A 4PUBH 1WCBA 2QHRL 5F7EH 3CC1A 4I5BA 2EDLA 3D39A 1C12A 5I1CL 1D7FA 4Y5VB 5C0NC 2EIEA 4LCIH 5DF0A 5FO7B 2HRLA 1OB1A 2DTMH 3C60A 1J0HA 3OKKA 4LRNH 3C8KB 1LEGB 3DDFA 4AW7A 3MMDA 1DQLL 2EDTA 3HN3A 3WUZA 4DKFH 5EORL 2P5EA 1A7NL 3FZUC 1UYWH 2FBJH 1GXEA 4NWTH 3EGSA 3IJSB 4OCYL 3MBED 4X7CC 1NMCB 5K9JL 4OI7A 1RU9L 2FH8A 4X6EA 3IDYB 4WI6A 2BNQD 5TFSH 1NMCC 3V4VH 3N15A 1E70M 5BOZG 4HS3B 5MEQB 2MNUA 2R2EA 3LMYA 4GG6E 1LNUA 4GRLB 2FSEB 5A2BA 2NY3C 5F88B 2CLRA 1I1CA 1I7TB 1LGVA 1JWSA 5GXBB 4PS4H 3FO9B 4JFFA 1FNGB 1SBSL 2VJXA 3MJ7A 3L7FB 3W11D 1PS3A 5J9PB 3DUHA 4HZ7A 2D4DA 2R1YB 3AC0A 1ORQA 3CIQA 3DHPA 3H6JA 2AMGA 4K9EC 5CJBA 1RZFH 3QH3B 2DT1A 1XSJA 3EFFA 3KPMB 4LGRB 3RIAF 4XC1L 2GK2A 1H3UA 3SUTA 3DRQA 2OK0H 4NKDB 1V02E 3UTTD 4QXUH 1RK1A 4ODVH 4OGXH 2GK1B 4U0RC 1ZHNA 4KGLA 4Z0XA 1S7QB 1CZ8L 1JK8A 1UZ6F 4MX7A 5E2VL 3WJJA 2AK4E 1ZT7B 4HDIA 4DGIL 3SCMA 2MMXA 2L7JA 4U05A 4ODVL 4GPNA 5J89A 5MEOB 3L9RA 1QI2A 3BD3A 4DM1A 3O4OB 4HC1L 2Y07L 4RWYH 3B9KD 2PETA 5DQ9B 5I1EH 1QHZA 3MLWH 5BS0E 3SQOH 4ODTL 1S7TB 4R96B 3K80A 3NOIA 3MCG1 1GORA 4IIQC 2HLAA 5EOTA 5TDOA 3HMXL 5AZEL 5MI0B 3GHEL 3ABZA 4FQCL 4JDZB 5ICYA 4ZUVA 5JPNA 4V1DA 4GRWE 5CAYB 3U0WL 3G08B 4FQHA 4AL8L 4JR9L 3RM4A 2EBNA 2I26N 5LJYH 5IBTH 2FE0A 3BO8A 3TO2B 3TEUA 1LP9F 3TWCL 3RJXA 2IFFH 4ZO7A 4ZAKD 1JF1B 5LKNA 1SR0A 4HJGA 5FO7A 1NCUA 5DT5A 3BPCA 1FZOB 5MEND 1CYGA 2MCPL 4KMTH 5I1DB 2WP3T 1FIGL 4NBYB 3PL6C 4ZUSB 4MCYA 4ODBD 3P0YH 4OJYA 1YUHB 3MCKA 1U8LB 3PJSA 4X7FC 5DQJA 4F9JA 2JELH 4UQCA 1B2WL 3TBTB 5D7JA 2DM2A 4RGNB 2DDQL 1NAML 2JIXA 3SE9H 3GNPA 4DWSC 5CZXC 3CMOL 4ZS7L 5MHSE 3M1BA 4UAOC 1PIGA 1V0NA 1ED3B 4OQTL 3KNBB 1E4XH 5C8BB 4I3SH 4R4BB 5HGHA 1T7WA 1OTTD 1M1SA 3VWKB 4IMLA 1IGIL 1QA9A 5F7YC 3ZL4H 4GG6B 1FYTA 3H7BA 3IXAB 3MR9A 1AO7E 1M05B 1HKLL 3PQYA 4OBRA 1NC4A 4XMKH 3M8OH 4P59H 2V17L 5E8NA 3UG4A 2JEQA 4OBSA 1GOIA 5DTFA 3W9EA 3LVEA 5INCA 1QW9A 4NWUL 2J4GA 1YEIL 2FX9H 1VGKA 3BGMA 4ZOBA 2RAMA 4P8VA 1OSZA 1A7QH 4LSUL 3DROA 3MRFA 4XCYA 2QMKA 3RL2A 1A22B 5GZOC 2D0HA 2X40A 2FJGB 4Y5YC 3VA2C 2BERA 3RUGE 5HDLA 3VFOB 3SCMB 1G6RB 1S5IH 4HWNA 5FO8B 3F7VA 2AJYL 2BRRL 1OB0A 1MVUB 1H4PA 1IAOA 4E9LA 5I66B 4HIIB 4AZGA 1MCEA 2X9WA 3SDDB 2VXVH 1G94A 3HUJA 1EMTH 4PB9L 5ILTH 4TOYL 1BEYL 3ZE1F 3GBNH 4S3JA 5D1XA 4W4OC 5JZ7D 2A6DB 3MGTA 4O4YH 4OD1L 3MJ8B 5FIPA 3HG1B 3QWQB 1FGVL 2HFGH 2FGWL 3QHZL 3LEVL 2UUDH 1IM9D 3SDAD 2O26U 1MFEH 2LABA 5D7LB 1E6ZA 2XVPA 1U3HB 2OL3L 1HN1A 3EDJA 3FFCE 4HWUA 5SX5K 3HS0A 1NM9A 3MYJB 3VWJC 3HJEA 4G80B 3NZHL 3GK8L 3I2CL 4IDJL 3FQWB 1MRCL 2ZUWA 5L0QB 2I9TA 2ZX6A 5CBAA 2FJHA 3WH8A 3VFUB 4I1NB 3WQ5A 2VVNA 1I8LA 5DJXA 5ICXB 1RJLB 1UA6L 3FRPG 4L3AA 5DUML 2YEZA 5CSZB 2ITDA 3X12B 4FNLH 1NCAH 5IESL 2ZCHL 3A0OA 1US3A 4YC2C 5DMKA 2B8OT 3VWKD 1TCRB 5IF0B 4QDMA 4LP5A 5D72L 3WUBA 3GNMH 4KK5D 5JBEA 2MPAL 4NN5C 4P5TA 2RJMA 3MA9H 1GRWA 1YEIH 3VD3A 2F5BH 3D0LA 3IJ7A 3EW3B 1NANI 3CHEA 3CVHA 1TPXC 3VXTA 5D9SB 5FUCC 5D1QA 4AD2A 1BBJA 3CZFB 4MA7L 2PYEE 1Y6KR 4LPVA 3HLAB 3SO3C 3H7BB 5D93C 2VLRB 1JNDA 3R0MA 2QQLL 2VCBA 5MP6L 3L5WA 4AYFA 4UDUB 2DQIH 1IGTA 2AKRB 4ONGH 4W4OA 2DLHA 3W0WB 4ZFZB 1BJ1J 2CO7B 4U6VH 3BP5B 3X3FL 4CVXA 5JHLH 4WJ5B 3U4EB 2HVJB 4RRPA 5L0QC 3CMOH 3QIWC 4P7QA 4KJQD 5JW4Q 4IIQB 4LNRB 5D1ZA 2UWFA 4OCWL 2YWYA 3KJ6L 5HI5D 1ODAA 5CEXA 2GUOA 3P0YL 2YBUA 1N82A 4P2OC 4G7YL 5HHPB 1OHQA 3RUGB 3SCMD 4NRSA 4PBGA 4BUGA 1I7ZB 3KLDA 4F3FA 3EYOA 5IFTA 2WWKT 4IM4A 1X5HA 1NEZG 1UWTA 5F7FA 1KFWA 2GSJA 3AFBA 4P57A 3V79C 5D9MA 4N0CD 2X0YA 5DT1L 4C4KT 1NLBL 1CBVH 1E6XM 4N8VB 2A3CA 3TIDA 2JCCE 3MYJA 4KKCC 5DHYB 2PW2A 3GMQB 4AJ0A 4Y5XC 2H2SD 3MMWA 4JFSA 1K8IB 2E9BA 2EEXA 5HPCA 3GI8H 1FV1A 1A6WL 1J1XL 3TT3H 4Y19B 1MNUH 4NQCE 4RZCA 3IJYA 3UC0H 4PRHE 1ADQA 3FKUS 2YLAA 3A67H 4K8RD 1BAGA 2QV4A 4HWZB 2DQFA 4OFVA 1NDMA 4NZTL 1II4E 1OGAA 5ITFA 1CFSB 2A0LC 5IHRA 1KJ3L 2P44B 3GTNA 5JZ7C 3HC0A 1E73M 4Z7WA 2BFVH 5J6GB 5F1KC 5E2VH 3DC0A 4NZUH 3P3YA 4JFHE 1P53A 1BFNA 1R7AA 3QXVA 1K5NA 1QNZL 3QNZA 3ZE0E 1QPKA 2E40A 7FABL 5HI3C 3G5ZA 1DBKH 2BSRB 3E6HB 1UD6A 1E6PA 2G3IA 4TVUA 5L88L 1PX3A 1VGEL 5JXED 3M7SA 5D4QA 12E8L 3GB7A 1QFUL 3OG6B 4OCRL 2LFGA 4ZSOE 1GSMA 2YPVL 3JUGA 5TPWH 3QR2A 5DJ2B 1KXVC 4E0RA 5C07B 3DIFA 4TQEL 1UCTA 2C8NA 3MXVL 5ABHA 3VDAA 5IROA 1YNTA 4XXDB 3DWTA 4J3TA 2H1PH 4OZHB 1H0GA 1V0LA 1R5IA 5J1TC 1CK0L 3ARXA 1SM3L 3U7WL 4FLQA 3GXFA 4QRPA 3LKOA 4P46C 2KZWA 1MLCA 3PE9A 4NUGL 2JB5L 3CGTA 5DR5H 3KPLA 4HS6A 1YJDH 1B3JA 1KJMB 1RU9H 3DO7B 1D5MA 4Q9BA 1AGCA 2I5YH 5D96B 3KPNB 3MRGB 3ZDZF 1INQA 1NPUA 3CCHA 3ARZA 1GZQA 4GKNB 4KK9D 3HG3A 1M4KA 1H41A 5EBWB 1UQZA 1XF5B 4PJ9C 4Y2DB 5FYKL 3T08A 3FQRA 4X0KB 2IAMA 3EOTH 2CUIA 3CZEA 5EO9B 1Y18A 5JBDA 4MD5A 3LPOA 3EO1A 5ENWB 5FYJH 4PJFF 2XKNB 3BVTA 4H0IA 4ZFOB 2DT2A 1CECA 1ZEAH 3BP4A 3PZGA 1BM3L 1B4JH 3T4YA 4PY8I 3QXDA 1PZ2A 3JV4A 4AIOA 4V28A 3NCYS 5DHYA 3MRMB 3WH5A 5EA0H 1PSKL 5E95B 4PTUB 3S36H 4MA3A 4PJ7E 5M3WA 1CCZA 1PDKA 3QUKA 5D7IB 4QRQB 1QNSA 1YEEL 5J9PA 3AY4C 3U0TB 4H20L 4WUKH 2VXUH 1F42A 2I60L 3WFDH 2WIIB 1E6SM 4Q97A 2ZOKB 5IEKA 4TOYH 4MB3A 3CSYB 4PJFE 2NXYC 4X6DA 4EKJA 1V08A 1HHIA 3BAIA 1A0QL 2X4RA 3UTQA 2CLVA 3PWNA 4N8VG 3D51A 1N7MH 3DHMA 1BAFH 4HU8A 3S4SG 3F12A 1MJUH 3HG1E 3T77B 5C07D 4QLLA 4KXZI 4Y4HD 5D7LE 4YDJA 2DBJA 2GUYA 4X7TB 4P7NA 3GH4A 1KFAL 2GTWA 4YHMH 3VIIA 4MHHG 2UY2A 3PP3H 1DBMH 3RGVB 4WENB 2VKWA 3ISWA 3UEZA 2X44D 1LO0L 1HP5A 3GH5A 4GI6A 5JW3L 3VD9A 5IVXF 5IB3B 1ZHLB 3DX2A 1QSFE 3OGCA 2X4TA 2HH0H 2QPUA 1K2DA 5M03A 3FRUB 4MMXC 2IPUK 3OGOE 4ERSH 1NCNA 3FTGA 1NMAL 3MRLB 1PQZA 2D7TL 4ETYA 1E4XL 3HAEA 5EUOB 5HYEA 2VLKE 3OBAA 3QDMD 3VD7A 1XCWA 1XD0A 1DCLA 1CR9L 4QRSB 2DM3A 1FC2D 2NLJA 1GOWA 1MCQA 1QRKA 35C8L 1JZ6A 4OLEA 3BMVA 1B2WH 4NQEE 3LKPA 4PGDB 5FKAB 5DK3A 5A6SA 3ZT6A 1F6FB 1S9YA 2QQKL 2V2WB 5ISZA 3HNTL 4U2YA 3N1MC 3NABH 4X0KA 4EKXA 1MHHB 2B39A 4YHKL 1ZTXH 3SKJL 2DIJA 4M82A 3ARGD 1NOFA 1I7TA 1GUVA 4ZFFB 2VDRL 5GS0C 3S3SA 1WNOA 2C7FA 4HWBL 2E9MA 5DR5L 5EFFA 3B9KA 1QI3A 3G6MA 1HEZB 3K74B 2HVKA 1ZU8A 1U3YA 2L0DA 2C3HA 5SWZB 4P9HH 3TBYA 2VIRA 4HH9A 4LLQA 3U82B 1M03A 3NSNA 1GGTA 2Q8AL 2A1WH 4KI5D 4J8RB 1W3KA 4BQ3A 4PJIF 4BH8A 1TJHL 4ACYA 3BISA 3F8UB 3ALFA 1SQ2N 5E94A 1MCFA 3J7HA 4RRPG 4WFGD 4XP6L 4DAGH 3H9SA 1DEEA 1A6TA 5MENA 5BW7C 1YC8A 4NP4H 3TBSA 5CD5D 3E2HC 1NGYB 1ZOXA 2CQVA 2FGZA 4JN2B 3ZE2F 5BZDB 4X6CA 1ROWA 3WDIA 5DVNA 5ACMA 1A3RH 2HT4C 3WS6C 4PD4K 2ZE0A 3HZVA 2DQUL 3U79A 2F8OA 1MAJA 2YD3A 5DJ6A 4F9LC 4XTRC 4QXTB 2DIEA 4M93C 1FFPB 2ZXAA 2XPGB 1G7LB 4X5WA 5IOPB 3HR5A 4XRCB 4JKPH 3L3GA 4JZOA 1ZVSB 4Z0BH 2HLAB 3MLVH 2P47B 4M7JH 5I23A 4W88A 1JHLL 1MVUA 2RFXB 3MV7E 4M1RA 1U91B 4RFNB 3PWUB 1AO7D 1UH4A 5L8JB 5CD5C 1CF8L 5CQ1A 1WJ3A 1Z5LA 3OTTA 3WY1A 1QSEE 4XCNB 2PYED 2ESVD 3P9MA 4LLUA 3DX6B 3BO8B 3TO2A 2OWWA 4H25A 1F4XL 3WUWG 1E6RA 5E7BA 1JPTL 1BFOA 1CGYA 3GI8L 4MA1B 4PS4L 3ZQ9A 3OKYA 3QWOB 1X6LA 5H37G 4HUNB 3AB0B 2OTWA 1CD0A 5AUMB 4F7EB 3OR6A 4ZAKA 1BD2E 2HKFL 5GRJL 3EJUA 2F53B 3SKMB 4QF1A 4FHBD 3RX7A 3TJEL 4AH2A 5EU5B 3P4MA 4Q6IA 1TZHA 1IKNC 3VXUA 2YA1A 1L9NA 4JZJC 4LIQL 4OZIE 4D0DA 1P6WA 3PJSB 1R3KA 5DQJB 3IETA 4YHEA 1NCCL 4TNWF 4X6DE 5IQ7L 4LKXB 5AG8A 1HKFA 4OZGB 4DCQA 4ELME 4Z7QF 1A7NH 1HXYB 1T04B 3ZO0A 4DTGL 1K6AA 4PGBB 2C1OB 3CPLA 3CVIH 3MLWL 1ED3A 4KU1A 4N0UA 3G6JA 4ZDHA 1A7PH 1GL4B 1G01A 1XCTB 1FVDB 5DZOA 2VDQH 4X98A 2WMIB 5I16A 3UTSB 2PO6B 5FK9A 3CFDA 1RJYA 1IV8A 1ISYA 1EDGA 3WN5B 2VX7A 4PLJD 3K46A 4RISH 1KCVL 3ROOB 1K4CA 5HYJB 3JWDC 2XN9E 2ICWB 4I4WB 3LN4A 1TR1A 4HH9B 4LLQB 5ESQA 2OK0L 5IB1A 1G7QA 3TH2T 4JFFE 2BS9A 2JALA 1B90A 3ES6A 4E5XB 1YQVL 3VXTB 5ID0B 3LIZL 2EPNA 4PJ8C 3WE6A 4KRPD 4F7PB 3REWB 3PZIA 8CGTA 4Y7MA 1Z9MA 4OTXH 3UPCA 3ALGA 3EDKA 4E4PA 1U9KA 1D5XA 2HN7A 3QXUA 3UTOA 5EFDA 2NW0A 2ADGA 2YD1A 4XP4H 1R24A 2HFEA 3WQ8A 3TVMA 2OS7A 4LLWB 2Z9TA 1I3RB 1EH9A 5KOMC 4APQC 3FB6A 3MA9L 2HYMA 2Q76B 2LQRA 1H0IA 4R26L 1HWGB 2AW2A 4MQTB 1N59A 5J3HC 1TVBA 4U1LA 4OUUB 1YEKL 1IE5A 5EUKB 4XPTH 3WJLC 3QUYD 4LSDA 4UQ3B 1JFXA 3PP3K 1YPZB 1B3YA 2HLFD 4XI5D 4X8JB 3CLEL 4HPHA 1K9FA 2X7LB 4XPFH 1ODUA 2VISB 2WC3A 3CC5A 4CBPA 3W39B 4P9HC 4HUWA 4KVNH 2EXWC 4Z76A 4GZIA 2VABB 5DXWA 4ZNEE 4LF3B 4YHPB 2W9LA 5E0CA 5D7KD 3FB8A 3STBA 1CE1H 2W0PA 5I5RA 4KZDH 5BVPL 2J5LC 4ODXA 4PUBL 5J3HD 1S9VB 1ZS8A 4M7ZB 5B8CB 5GS1C 2V3GA 4Z7UB 1KYOJ 2B5IC 2VDOH 5HD8D 4CAGA 5J1AB 3VO0A 1BQCA 4GI8A 1LDSA 3FQNB 5F1IA 4LEOB 4Q0XH 1XMWA 2ITCA 4FQ1H 4DOHB 2JKXA 3W5MA 1GC1L 4JL1A 4LKXA 3MCLH 1LO0H 1MWAH 2FIRT 5C3LD 3K3QA 3MNWB 2B1HL 4ALAH 3HCVA 4TVPL 1LE9B 2YDSA 2BVOB 3G6JB 4JG0L 1KFAH 4ZDHB 4B16A 1HHGA 4N5EC 2J75A 4MDJB 2GK0A 4IOSD 2ZCLH 1LO2H 4K3DH 4WUUA 2O5XH 3CFKA 5BWFA 4IOFC 4KRPB 1XD1A 2J8HA 3X17A 1QR1A 4X4YB 2AEQL 4EI5B 1K5NB 3QNZB 3O2WL 1MQPA 1OTUD 1IC1A 2ZPKH 1NBYB 2H26A 3PWVA 3WS3B 3WUEA 1T7ZA 3RJYA 4NOFA 5IB1B 1OARH 4WFFD 2CJUH 1I8IB 1LP9B 3QFJD 2OMBA 2D31A 5BO1L 1C16B 4YXLL 2AJ3B 2FL5B 2DAVA 1GAFH 2HVJA 1HI6A 4YE4L 2EDWA 1ZANL 1ZWIB 3FFDB 1KIQB 3R06B 1BD2A 5ESVB 5T3XD 5JOFA 4HUUA 2EYTA 5E6IB 3MRBB 1TDQA 2EO1A 4FQ1L 3OIHA 1TVHA 3P0VL 1FRGH 5ECUA 3WMBA 2IAND 1YYML 4LSRH 3QUZB 2X2HA 1MXDA 1TVBB 3HZ3A 3KS0H 4C56A 1I1RA 4OGZA 1F3JA 5DURB 3KPTA 4UQ3A 1CU4H 4OLUH 4HS6B 3SE9L 3RILA 2R2CA 4XPHL 1TE1A 4OZIB 3G6JE 1BFVL 4TVPD 1AO7A 4WGVB 2XJ7A 3AZTA 4IUGA 1DL7H 3FQXA 5C8JB 5FD0A 7A3HA 1RV6X 4EZMA 3U1SH 3W39A 5ANMB 3PGDB 2EKSB 5I1GH 3SJVD 4LF3A 4XVJL 1AHWA 3ARTA 4KROD 3RWGA 4WWKC 3FAXA 4HFWB 2GHWB 2PTTB 3MRJB 3B9KC 1YC7A 3GXNA 5E8PA 1VERA 5GS3A 4RE2A 1ZXQA 5CUSL 3WFCL 4UT9H 3ULVF 2IANE 1NGQH 1ZA3B 4JFEE 5BOPA 2YUZA 1UCBL 1I3GH 3KLHC 5SWQA 5FYLD 5AAMA 3IB4A 1NC2A 5T3XE 1HJSA 2X9XA 5CPQA 5E9DB 4K7PY 2YD6A 4XMLH 4X9HA 4L8DB 2VZVA 1SMAA 4MX7B 5AD0A 2L7UA 5TF1H 4HDIB 5ALBL 3O2VL 5IFJA 1FSKB 5HJ3B 4R26H 4RFOL 2EPLX 1AD9B 1FIEA 1N3NB 5C0BA 4P46A 4FNRA 1TTUA 2NYYC 3VRIA 4U5KA 1DDHB 1UXWB 1G7HA 3WEXB 2WKLA 2WAGA 3QG7L 2F54D 1QFWM 3W81A 5J8OA 5HHVL 3WD5L 4JKKA 3F12B 1UR8A 1D5BA 2P8PA 4YHIA 2EDOA 2ATKB 4D9RD 3VXRB 4BYHA 3PGCA 2VDQL 1KV3A 3TT1H 1M7DB 4JEGB 3VSUA 2NXZD 3KGRA 5IM7A 2C4FT 1GJIA 4JJHA 4G6KH 4M6AA 4D9LH 2CR3A 5I1LB 5I6XC 5KANI 2AJ3A 1TZGL 1WVZA 5GJTH 2J7GA 3IFNL 1ZLWK 4PRPD 5I17B 3U46B 4KK8D 3ZTJH 4PRIE 4IEFB 1T7VA 5DMGD 1DLHA 4I2XE 2SEBA 2EDFA 4P2OA 3VD4A 1CG9A 1JTPA 3MRIA 1DBBH 5DFAA 5JXAH 4CVZB 3BHBA 1FBIH 4LASH 1S7UB 5IHZA 3IFLH 5H2BA 2WVSA 1J8HD 3GMMB 4Q7NA 4X0VA 3OKLA 1J0ZA 1H9VA 5CMAB 3TNMA 3AMCA 1K3IA 4PGDA 5E9AA 4GSDL 1MQQA 4I77L 5C8JA 2A9MH 4Y5VA 4NXSA 1JGUH 5JW4R 5BROA 1VKXB 3OLIA 3D4ZA 1QBML 1CLOL 1N6UA 1HH9B 1UOKA 4WHYH 1ZLUK 3JV4B 4DQOL 4MB5A 4U1SA 2JF7A 1CD9B 4X99B 3MRMA 4JM2B 3DLQR 1XCQA 3L3KB 4JRWA 4L3EA 1F4WH 1VCAA 2FB4L 3T0WA 1D5IL 3QUKB 5D7IA 1KCSH 1Z3GH 4WFHD 4C83B 4CGTA 5DO2D 1U8IA 4GUPB 1KSRA 2GITB 2MQCA 3GBLA 4V2XA 4RGMC 2PKDA 4WTZG 3TBYB 4N1HB 3U5UA 1JN6B 1QO3A 4OV5A 3P73B 4ORGA 2WM0A 3A22A 1TCMA 4HIXL 4HMEA 5F88A 3P40A 4F15B 1ZB5A 2P5EE 3MRNB 1IC4H 3SKUD 4M24A 5IHBA 3FO9A 4F57H 2QQNH 3BKYL 3WBDA 4RE3A 2PF6A 3DROB 3MRFB 2F15A 4XCYB 2RB8A 4FNPA 1IFHL 2B4CH 1R85A 5JDJA 1RAMA 3BLKA 1T2JA 2X1OA 3MJ9L 3L4XA 1CDGA 5FCUL 3S37L 5M5DA 1F4AA 1GQIA 4JM4L 5HTSA 4EI5C 3WL1A 5KG9A 4XC3L 1H49A 2C3VA 5KJRH 3GUTB 1AGBA 3GSQA 2YPLB 2QSTA 3CLFL 3O8XA 5I1HH 2IBZY 4D0CB 1EQPA 1A1MA 2I07B 3CJJA 2WNGA 3O9NA 3NCJL 2Z4QB 4AZ7A 3BSZL 4C57C 3TTQA 3HZMB 1KXHA 4JFYB 1E6OH 5I0DA 2VDRH 4KROB 1HJUA 4AD3A 2M1KA 2JB6A 3N17A 3OAZK 3QAZC 1I3GL 4D0BA 3AFLA 3NTCH 1U3HA 1NDGA 4O9HL 3SJVE 1G9HA 2QQKH 3VXQA 4KGJA 1GGBH 5H94B 5IP4A 3IXTB 3N85L 4HK3J 1VAHA 1O5DT 4QRSA 5IWLA 4KKNA 1X5ZA 5DEGA 5D7SL 3WEMA 3UERA 1FL3A 4Y2DC 5HDOA 1SJVA 2JJTC 1CTOA 2V5RA 1H5BB 2O61A 3S96A 1B30A 2NNAB 4HXBL 4OFYA 4F7EA 3OJDB 2R2HA 1ULVA 3WKZA 2A3EA 3H9SD 1HL8A 3IJ9A 1TVPA 2CIIA 3KHQA 4PJ5D 1QFOA 3CH1B 1CGSH 3C6SA 4FXKA 1VJZA 3VXUB 2WWDA 1HXJA 3V0WL 4E41E 3BEWA 1OQXA 4GG6F 4BSVA 2R0KH 3TFKC 2F5AL 1R5WA 2Y7QB 1E4NA 2X41A 3QNXB 5EO0A 5EU6B 1ES0B 4YHML 4U1SB 3AMKA 4ZNCD 5L8LB 2AXFA 1A64A 1UENA 3TNNA 2XA3A 2FSEA 1DUYB 2PYFB 1LDPH 4M7LH 4OOZA 3WQVA 2DKSA 2HH0L 5T1KA 2YMXH 3FT4B 3F7RA 3MV7A 4JO2H 5GSRB 2OCFD 4EVNA 3T2QA 2E7MA 3TLRA 1VPOH 5F3HB 1DQDH 1MHCB 1XR9B 1A6AA 1WAAA 4JJ5B 4ZTPH 4R4BA 1SY6A 3B2VL 3ES6B 4E5XA 5ID0A 4Q6YA 3BP5A 5CZXD 5D71H 1QA9B 1FFPA 4YZFF 2CK2A 3L4TA 2WVVB 3GNRA 4EN3D 1F4YL 4NT6A 1E0VA 2VDKH 4XV0A 1FYHB 4JZOB 1OD0A 4J6RH 2RCSL 1Q72H 4O00A 4F80A 1F11B 4PJ7A 2JIXD 2VITA 3ZT5A 2ARWA 4W93A 4LCWE 3D18A 5IK3A 2J8UB 5KS9E 3A4WA 3N18A 3I6LE 2FJGA 3RY6C 3TTOA 4F7MA 1ZEAL 1JYNA 1C5DA 2EDQA 3ETBF 3WLBA 1P1ZB 4YXHL 4KDVA 3DPBA 1JZ7A 5CIPA 2Z93A 2JJVA 1IC4L 3QWOA 5FCZA 2X4NA 1FIGH 4Q0XL 2OTWB 1ZBCA 2VZTA 3TIDB 3VXQB 1KEGL 3QOKA 4JKWA 1Q9OB 1I7RB 4XHQA 4G8GE 1UHVA 2W65B 1WBZB 3C08L 1SFSA 1K8IA 5I1IL 1A1OB 2A73A 3VW3H 4Z2LA 2IFFL 5A6KA 4PSPA 1FNLA 2B4CC 2RBLA 3LDBB 1X6NA 1WIUA 1ZA6A 1JI1A 3S88H 3K2UL 3RWDA 1XF3B 1EJOH 1W72B 5ACZA 2Z31C 4XNZB 5GGSB 5I73B 3DVIA 1QI4A 4JAMB 4G80A 4F9DA 1EQCA 3B43A 4L5FH 1MI5D 5FGCB 1IGCH 2AJUH 2FJHB 3VXOB 1YY9C 3CFDB 3SCRA 1JPST 1L7TL 3OF6D 3QI9A 2NZ9C 4BSWB 4OCRH 4NQDD 1KTLB 4HJJH 1YEKH 2XZCL 2YDRA 3KJ4B 2O9PA 4G8GD 3QIUB 3LXBA 2NTSP 5DURD 2H1PL 2J7CA 4PJXF 4ODUA 5EWIL 3VIKA 4Y4HA 4CN6A 3NPZB 1INEH 1T03L 1UEMA 3M17B 1KIRB 3LEYH 1J9YA 1CZ8H 5HPOA 4WI9A 1Z0NA 2VDPL 1S3KH 4OGAD 4ZD3H 1XR9A 3D0LB 4N8CL 3WH7A 5A6AA 5C2UB 1TITA 1MAMH 3RUGF 4OF6A 1OTSD 4MYWB 2VOTA 5FGBA 3MSPA 3QCUH 1EHLL 3GMNA 3WELA 4YUEH 4Z8FH 1CFQA 4Z7VF 3S3JA 5IHUH 3VGFA 2ZUMA 2D22A 3IGAB 2EYSA 1YEJH 1UR9A 3IAGC 3NFPA 3WIHL 3AGVA 4WFFE 5C6TL 1XZ0B 4HA4A 4G9FD 3DVNA 1IL1A 1T1WA 4S11A 2XFXB 4HS8L 4R5EA 3MBEA 4DQOH 3VXSB 5GRUH 5IXEA 1WAAE 5D8ZA 2P42B 2YBRB 3FOLB 3IDNA 4D3CH 3O3BB 4K3GA 3M45A 5C92A 1C12B 2D7NA 5CIPB 5I18L 4E8CA 3HR6A 4WTZA 2X4NB 3RIFK 2VR5A 3GMPB 3RPKA 3QXDB 5J1AA 3CUIA 2G75B 1QLEH 1E4JA 1P4LA 3PWPA 4NBXB 1GPFA 3SCNA 3V0VA 4ONHA 3ZO9A 3E2HB 2AJSL 4GI9A 5MERA 4CN4A 2BVQA 5BQ7B 4OCSL 3A6BH 4HBCH 3BD4A 3F58L 4R2GB 4JDVA 4Y4KA 3FO2B 3GRWA 4M5YL 3UEQA 4ONFH 5T5FH 4Z5RB 5CXPA 5HGBA 3PGFH 2ZOLA 2V5SA 4EANA 4LP4A 5IMLA 4XX6A 4XVTL 3VFGL 1HE7A 2R2BA 2YKLL 4MQXC 3TPUB 5H35A 3JSSA 1UM6L 5JIKA 2ZSVA 1I1AC 2NY0B 3SDCB 3Q6GH 3ARFA 4LVHC 4YQXL 3UR8A 1CD8A 1ZSDB 1ND0A 1R3JB 1BVKB 2NY2D 3L3HB 8A3HA 5I74B 3FQUB 3ULUC 2V7HB 1KC5H 1OTTC 3UO1L 4F7CA 2W62A 5DJZB 3QQ3B 5T1LD 2RGSA 1SYSB 1MREH 2QR0B 4J3VA 2HFFA 1P84K 3X3FH 3GKWH 1XGUB 3LD8B 2A77L 4JN1L 5JLZB 2DQUH 4MLSA 4EUPA 2DRUA 3IRZA 4OFDA 4WW2C 3O2VH 4K8RC 4ZPVA 4G7VL 5IGXL 5SX4I 2VZ3A 4P7RA 4HPYH 2GJ6B 2B2XH 4Z2KA 1TNNA 4JFTA 3SUUA 3OZ9L 3F62A 3VXRA 2ZCHH 3G5ZB 3QXWA 3S6CA 4DUWA 3RY5A 1A2YA 4RQQA 5E09A 3LQZB 3QIBD 4M03A 4CVXB 1PY9A 5I1LA 4Y0GA 3C5JB 4P4KC 1I9JL 4P0DA 3L2MA 4AEIL 4C56B 1CFQB 3KPPB 1JNHA 3OKMA 4TOQA 3CTTA 4JO2L 3T1FB 5F7DA 4M6OL 1JMXA 4CDHA 4YWGH 3S7GA 3LN5A 5I30H 4YHKH 3A3HA 5D5MF 3HB3C 1MFEL 3NACL 4KFZC 5IW6A 5DJDA 4MJIB 5CMAA 1FGVH 2VAJA 3DI3B 2JJSA 1Q6GA 1F90L 3IJ8A 3GRWH 1INQB 3CCHB 4L4JA 5E8DH 1C93A 4LRIA 2PWGA 1U8NA 2FEDC 4YBHA 3DUUB 4JPIB 3UP1A 2EDEA 4X6BA 3GK8H 3I2CH 4XAKE 3O3EA 1BVNP 2PWFA 1YEDB 3FB5A 5JORB 1LNUB 2PW2B 5I30L 4JM2A 5AWNH 2G9HA 2CIPA 4F15C 3D0VB 2ZX9A 2EC9U 4OCXL 3QNYA 1J1PL 1S8DA 2WQ8A 4QRTB 1VADA 5CP7A 3JWDL 2QBWA 3EYPA 4O4YL 3OSKA 4FMFA 1OIMA 1VDGA 3WFEL 1KG0A 1HINL 3O6FA 3L7EA 3CK0H 3HB3D 4HFUH 3DRTA 3FL7A 3AROA 1GAFL 3O6ML 1EOMA 5DEFA 2WQRA 3KPRD 2G3JA 3KNBA 1OGTB 3GZAA 5BV7B 1A7QL 4XPGH 3NTCL 1US2A 3P73A 4AMKH 2A6IB 3NN8B 2Y6SC 1ACZA 1E55A 4LPWA 1INDH 4LFHG 4ZS6D 2FEDD 4R7NA 3CLEH 3SUVA 3L1OH 1E6OL 5JUEH 2Y8KA 4Z7WB 5J6GA 1KWKA 2DQHH 4KUZL 3AMDA 4N9OB 4AMWA 1NEZB 2ARJB 3RWCA 4BA0A 1Q6CA 4WKAA 2FR4B 1ZJAA 4LSPL 4PRPE 3THDA 3VDHA 1E0XA 1BWWA 3QHTC 1DSFH 3K81A 2FX9L 3PZ9A 3AIRA 1RZIA 2IMNA 1B1YA 4PJ9B 1EUTA 1BPVA 3DMMA 2P5WD 5TH2B 4LCCB 2BXZA 2CK0L 1DQTA 2EH8H 4WWKA 2R4RL 1T5XA 4L8SB 2B4CL 1I1WA 4WO4C 1T83C 2R29L 2OP4H 1KCRL 4PRWA 4K2UH 1JYXA 4PGCA 4AMXA 3Q6GL 4XZUA 1NFDE 1V3KA 3AU1B 3GFUA 3HMWH 4GRWH 4X7TA 4B41A 4Q2ZA 2OSXA 3DHJA 5D7IE 4MNHA 3GMMA 5LCVH 3ARPA 4U3AA 4ZS7H 4UINH 4M5YH 1AC6A 5IQ9A 5HVFB 3F5KA 5T3ZE 2CHNA 2W0FA 4NZRH 1P7QB 1NFDA 3G04A 1EPFA 3PHQA 3U83A 3QP3A 5D7LA 2WXDM 1UWRA 1QRNE 1W1YA 3BWUC 5FYLE 4AL8H 3P4NB 4AK1A 5DHVH 3CVIL 3ZKMD 1CNVA 5HDBF 1EGJA 3MBEC 4GFTB 4PJIB 3S34H 1KACB 4ZODA 2I9TB 1JI2A 3ZT7A 2WUCL 1NCCH 1S46A 2BK8A 5FK9B 5BS0D 5I8KL 3TBWA 3RRQA 4CMHC 1QSFD 5AYUL 3OXRB 3ECQA 2JIXB 2Z92B 3DUUA 1K4CB 2XM2A 3BAKA 4JFDD 3ROLB 3H42L 4JO1H 3RL1A 2HKFH 4ZOEA 2ICWA 4NM4L 5JXAL 1RUML 2DF3A 4YAQB 3EHBD 5EOQL 5A2KH 5IBUB 4K9EH 3AHXA 2BMKA 4PJXB 4Y8AA 2E8YA 3PHSA 1E0OB 2UYLB 2E9IA 2OTPA 4J3OC 3UTSD 5BVJB 4YUEL 5BRZE 2YPVH 5DA0B 4PYSA 4HK0B 2X10A 2CKSA 3VXNA 5KANG 5BYWA 4ZXBD 4TUKL 5GZNC 2R0WH 3NGBB 5A2AA 1NCDL 4ZO8A 1VFBA 1OW0A 1HHIB 4ZD3L 4UV7L 4LHJB 3CAFA 2WWMD 4QXGL 1JZ2A 4WW2B 3RL2B 5EUKA 3GSRA 2X4SB 3SKOA 2BSSA 2J47A 4ACPA 1VSCA 3HZMA 1YZZA 4UQDA 2MSPA 4KI5C 4XP9H 4NSKA 2XWTA 4X9GA 3LPWA 5LWYL 3F7VB 1JJUA 3LV3B 2J7LA 4GQQA 1GW1A 2NTFB 2BNQA 4QY8A 1Q9KB 1WT5A 4X4XA 4YDJB 3Q3GA 3MJ9A 1T20B 3ARVA 1JPSH 4P4RA 5LXGL 4ZXOA 3H9SE 1HXMB 2FJFA 1HXKA 1IQDB 3FB8B 2NX5A 4YK4C 1J1OH 4PJAF 5INDA 4AD1A 4CD8A 5D2LA 1K8DA 2ALWA 2GUOB 4NUJA 2RFXA 2YKKA 4N1CA 3F7QA 4ODSL 2DQDL 5F1SA 3CX5K 2ZNWA 4HLZH 1QPXA 1KBBA 5FYJE 5C6WH 1XGRB 1JDAA 4PMXA 1HSAB 4H04A 4LYQA 3K1KC 1HHJB 2WAHA 1LEKA 3IT8D 5T3ZH 1JPTH 3DETD 3DBXB 3MLRL 3DGGA 2A6JA 4TUOB 3KPSA 1VFMA 1ONQA 1KT2A 2IGFL 3GJEB 1XC6A 4LPXA 2FDBP 5C08D 4NKMB 3HNTH 4LLDA 2ED9A 3MO1B 5IB5B 1OM3H 1HTYA 4TVDA 3DVGA 5GGVY 4M1DH 3P11H 1MHPL 4HMDA 5F1NB 3VXOA 1CBGA 1VRXA 4ODWA 3MV7B 2R4RH 4G8FB 5IF0A 3AYSA 5GSRA 3MX0A 3KYNB 4X4YA 4B50A 5LYRA 1X9QA 3EYUH 1U3ZA 4ACZB 4KKLC 2VIRB 3ILQD 2HVMA 4ZE4A 2DLIA 3H0TB 3GIZL 4R8WL 1FRGL 2Y8VA 1I1XA 2P5WE 3D3VB 4N1EA 3FOMB 5ESAA 3C8HA 4L4VA 2QADD 1FHLA 5L6YH 4HULB 1DBML 1NWTA 2W60A 4MNQA 4UB0H 4KKBC 4N0UE 4RMSA 1E4IA 2BSRA 2WMHA 3S6TA 3UTPE 2VXTL 5T5NF 3PV7A 4XCCH 1OM0A 5T1MB 4PD4J 2ZPKL 3QI9D 5IKCA 1L0PA 3U6RA 3S35H 2BP3A 2OQJA 2XQBH 2AJZB 1MJUL 5IOPA 1F3JB 3GSRB 2HKHH 1GC1C 2F7PA 5D1XC 1UZ6E 3JWDH 4PTTB 1I9RL 3KJ4C 4PG9B 3Q6FA 3O6FC 1R46A 2DD8H 3MRQA 4FQXC 2GJXA 5AWNL 2F54A 1KEMH 2BNUA 3VCLA 4AMKL 1CFNA 3H3KA 3V4UL 3CMGA 3QFDB 4K7PL 4UDTB 2VXUL 1N5YL 4YIQA 4K71C 1HHHA 1IAKB 3P9MB 4DFIA 3UJIL 2NYYD 2NX5B 1QSEB 2E7HA 5JW4N 3OG2A 4PRNB 4NUJB 3OLEA 4I18C 3ZZ1A 4WHDA 3QXAB 4Z95L 5AUMA 1NL0H 1WIOA 3O9WA 1XGTA 4M4PA 1QVOB 2NY3D 3IGUA 1I3VA 4HW6A 4XNMB 4AH2B 3CDYA 1DVFB 3HNVL 1OW0C 3OHXA 1SZNA 1NQ6A 4UQAA 2AVGA 4FMKA 5HVHB 3OX8A 4OZGA 4G8IA 3B8SA 2HA1A 2VDNH 3SUSA 4K7PH 4GAYA 4P9MH 3K4ZA 4U1IA 1CDUA 4W89A 4KMQA 4QHNA 2R2BB 4NOBA 2OZ4L 4QYOA 1RHHB 1TG7A 1FNHA 1EVTC 4I9WE 2CXGA 1SEQH 2JJUA 4XCFH 5I1AA 5EIIB 3ZYZA 1BVKA 2WBJC 5J13C 2YWZA 1OSEA 5K59F 4JREB 1FFRA 1D5BB 2P8PB 4TTGA 2C3XA 4AZ8A 3ZHKA 1PAMA 4K94L 5TGBA 2VRAA 4JM4H 1LK2A 4XP4L 4C7DA 4TQEH 4PJCA 1QR1B 1XR8A 1MFVA 4H20H 4HZLB 3C5ZB 2O9TA 4X6CF 2ZG3A 4R90H 3PWPD 3WQ6A 2R69H 3MV9A 4KRUA 1A6VH 3MV01 2NY6C 3POHA 1AXTH 4DK3A 4WI8A 4Z9KB 5T3XH 3TF7C 3N9GL 4J7RA 5T1MA 1RUPH 1G0YR 2XNAB 3C5JA 3EYUL 5IFAH 2MTPA 4QHKI 3LKOB 2Y72A 3PGFL 4AZBA 3QDJE 1BM3H 3L3DB 4NQED 2F7OA 1NGPH 1NFKA 1E27B 1E4KA 5I9QC 2DM7A 1N64L 2Z31B 3IDGB 1UVQA 2J7BA 1J0JA 1MI5B 4JLRA 4CADA 3VWJB 3CUHA 2AJSH 3H54A 4TNVK 3QEQB 5E2JA 2NZIA 4NO3B 4XBGA 4JB9L 1FE8L 3SGEH 3W0KA 1V7NL 3I6LD 1UM6H 4UU9B 3RVTC 1FN4B 2P45B 1RSFA 4UDTA 5DEZA 1HWHB 2X70B 2FYVA 5JO5A 3QOMA 3UC0L 3D9AL 4L4OA 4OZHF 2O5ZL 1OGSA 4K71B 5T5FL 1DN0B 2GQHA 1MXGA 4KK6C 4UILH 4FNQA 3EZ8A 3FQXB 2PCPB 4LGSB 1U3HD 1V05A 1JDCA 3JWOC 7TAAA 2W1NA 3MACL 3O3EB 5AZ2H 3O9WB 3PQYE 2ZWLT 1T7YA 4MDIB 4TYUA 1QO3B 1A3LL 1JNNH 3FQNA 4GBXD 3IDMB 3GSOA 3QUMB 3W6MA 4HJ0D 1A6UH 1HSBA 1YY8A 5GHWL 3WXVH 1ZSDA 4K3JL 1TMCB 2P49B 2CKNA 3DRTB 3DVFA 5A16A 3OLDA 4UFJA 3BYYA 1PIFA 3HZKB 2QSQA 2VAAB 4U1IB 5IB2B 3CUJA 3BKCH 1QQDB 2E7CA 6FABL 2WW8A 4PN2A 3S98A 3MUGA 1GGIL 4MDJA 4LQ1A 5A2CA 3HUJE 1RZJH 1HKIA 5C71A 3ARED 3QEQE 4QCIA 4PJEA 4P3CH 2W61A 4XH2B 5I6SA 5JDSA 1BBDL 3HRPA 3FN9A 3RTQA 1MLBA 5FUOL 4NPYA 1U93B 5GS2H 3KLHD 4A4AA 2BXYA 1ZLSH 3PWVB 4EIGB 2WNWA 1MAML 1ZHBA 4PV8B 1QSED 4GO6B 2BNRD 4ORZC 1VHPA 5TDPB 2G8ZA 5ALBH 1N4XH 4MJ5B 4R9HA 4AIZB 5FDWB 2NY2B 3O0RL 2B1AH 5L7XL 1JPFB 4MAYB 2AJVL 4G8EA 5KVFH 3EIFA 2F1BA 2PBOA 2WCAA 2XACC 1ZL1A 3R8QA 2VRQA 3ZOAA 5DRNB 2EECA 2WIMA 4M6NH 4PLOB 4NQTA 3FTGB 3MRLA 3RGVC 4LSQH 3OJDA 5HGDA 1W3LA 1W0VA 3NVQA 3WF3A 3H42H 5GGQL 5HGGS 4AENB 5MENE 1A5FL 1MY5A 1C08B 1H8SA 5F3BA 3N1FC 4JG1L 2YRPA 4MJIA 3DUSB 3D2UA 3C6LD 1VFUA 1RZGA 4NQDB 2ICES 1RJZB 4NCC1 1PPIA 4DO6A 1ESWA 1O7AA 3W4RA 2FIKB 4Z18A 4P4KA 2BV9A 1X5AA 5E5RB 1VACB 2F53A 3SKMA 3MV9E 3WF1A 1X5KA 2FHBA 5MHSD 1Q94A 5I1JH 2FH6A 2H9GA 5EPMB 1X3DA 4WI4A 3O6KH 2XXMB 3S88L 3TNMB 2GW5A 1LLOA 3X3GL 3H3PH 3VUPA 4FQJL 4POZD 4XVUD 5D7KE 4X4ME 3BYTA 2XYLA 2PR4L 1Y6NR 1FCGA 4S1QH 5E99H 2UWEF 1XF4A 3KL3A 4UOZA 3NZHH 2ZJSL 1UR4A 1S7VB 3WQ4A 2OL3H 3O4LD 4GRLA 2H8PB 1T66C 3N9GH 3LEVH 2DH3A 4ZPTB 2HRPL 2IQ9H 4N5ED 4LKCB 1IM3A 4PMQA 4NO0D 3F5WB 2FEEL 3GBDA 4HKJB 5IEHB 1R0AH 1J8HA 1JPGA 3LHPH 5K93A 1FL6A 3A6CL 1NGWB 1X5YA 2WK2A 1TJGL 1WK0A 1W1PA 4L4TD 3B83A 2D7QA 2VITB 1UXWA 1U0QA 1P69B 1LO4L 3NCBB 1F2QA 4JFQA 5GGRA 5IK3B 4MD0A 3OL2A 43CAA 5D72H 3WXWH 4WUUE 4NFBA 3HC3H 5DDHB 1TFHA 1WGOA 4QHLA 3D1MC 3EOBA 2FZ3A 1LO2L 2ATKA 1Q9LB 2I24N 2UY4A 2N1KA 4KKLD 1QYGL 3RWIB 5GGTH 3UYOD 1D6VL 1E4XI 1U8JB 4MGXA 5DRWB 3VMPA 5ERWA 1FFOA 3NABL 3MTRA 1HKLH 4XMKL 3OGSA 3BOVA 4CMMA 2WKGA 4F58L 1JUFB 5CP3A 2R39A 3CDGB 3LHPL 2YA0A 1OLZA 1E6QM 1RZ7H 4JFYA 3CFEB 3ZKQD 5AEAA 5C0DB 1YNLL 4R4FL 4GMSH 4C54A 5EFIB 3KLLA 4I3SL 5HPMA 2JB6B 3F7YB 1XGQB 5DC0A 1EGZA 3PHOB 3ARDA 5D6CA 4D0BB 4PJ8A 3HG5A 3E0GA 1XF3A 4D9QD 2QHAA 4KKCD 3G08A 4BQ4A 5HYSA 5KOVC 4M61B 4QF1B 1MJJB 2VDOL 3VA6A 1HSAA 2D7TH 5BRZA 4BSJA 3QUYC 2FGWH 3P4MB 1ZAGA 2P43B 4Q6IB 4C56E 4FQJH 1ZT1B 2VQ1A 5E8DL 3L4ZA 1S7SB 1MRFH 4F33B 4KMLB 5DK0A 5EG6C 1JYVA 1EAPA 4Y4KC 5EO1A 2ZUVA 5BRZD 4S2SA 2OJEA 5IVNA 5I24A 1FPTL 4RMUA 5D2LE 4KUCF 3DX7B 2A3BA 1P9MC 3ZIZA 2AV1B 2ICEA 4LAQH 2OSYA 2CITA 1U95B 1LEIA 5GRVL 4P23D 2DBLL 2BRRH 4YHZL 4OF3A 2BMKB 1U8LA 4YC2B 4JO3L 3WEZA 2X4UB 4QTHB 2UYLA 2LAGB 2KL6A 4M62L 4LARH 5C0CA 1PZ3A 5ALCH 2BJML 2OBGA 4R97B 3DARA 1X7QA 4JQIL 4RBPK 1IKNA 2WBWB 2AXFB 1W9XA 1VFAA 1UXSB 1JN6A 2V2XB 4GKZA 2EDDA 4KJYA 5FL1A 4U6TA 4AZHA 1BPLB 1CGTA 4GQRA 4ESKA 1VFBB 3LQAL 3T0EE 2XHYA 3JWOL 3OAYH 4HAGA 5D96C 2B2XL 3ULUL 1OAQL 3OPZL 4JFWA 5IGXH 2NQCA 2YN5A 2H32A 4PJDB 1BMGA 2VSDA 1AHWC 1U2YA 2NTFA 2A77H 4O51B 1P7QD 3O8XD 2VDLH 4ZOCA 1LK3L 5EA0L 1CN4A 1H8NA 2XFXA 2P5ED 3BKML 5HI4D 4TNWK 2V3DA 2FL5A 3PABA 4U1LB 3MBEB 1A1MB 5C0BE 1N8ZB 5F6HI 3MXWL 1KIQA 5CBEA 1S7TA 3MJ9H 3NIGE 5IFHH 1LL6A 2UVEA 1UWUA 1IQDA 1NAMH 5J11C 4KQ4L 1NSNL 3H3PL 3RVVD 4KTEL 4QXUL 1HCFX 3Q5YA 2JIWA 3MRKA 4OIFA 4CDGC 2XN0A 5D6DA 3FFCD 3TA3B 5IR1B 3BKCL 4XVSH 2MCPH 4EN3C 4W8AA 1TIUA 2W9DL 1G7MA 5F9OL 3DV6A 4FQHB 5I76A 3GXTA 3BAJA 3VIOA 2X4OB 5B38A 1AGFA 4GLRI 2BRQA 2GTZB 4OZIA 1QSEA 4H8HA 3CMJA 4GSDH 2B31A 4PRNA 4U3XA 2FB4H 4OZGF 2CKRA 1S9VA 3PHOA 3NA9L 1UJ3C 5HGBB 5F97E 1YNKL 2P8MA 1ZE3C 4IRJD 5HYSB 4BQ8A 4PUEA 2VI0A 2D7PA 4L29A 3KPSD 4QHUA 5KS9A 3BJ91 1CLOH 2I27N 1KELL 3G5XA 2ITCB 5C08A 2D3VA 1GCFA 4P4KD 1F4XH 4HIEB 3UTTE 2CDEB 3LAFA 5HHOA 3TBTA 2P8LB 2W9EH 1IRAY 4JREC 4U6XA 2KQMA 1EERB 4KY1H 3KR3L 4FQLH 4IRZL 4NC2B 4YBQC 5F9OH 5DGRA 1I8KB 3ZHDA 4LRNL 4MLIA 4RWYL 5I75C 3QHFL 5JA9A 5I19L 4NQXB 1RH9A 2E6JA 4QTHA 4B15A 2Z31D 3QRFM 2DTSA 4EBQL 1NGPL 4D9RE 1HVQA 4F37K 3MREB 3LRGA 5DQDH 4QXGH 2AXGA 1IGFL 4MTVA 1M05A 3PQYB 2VL5B 4MB4A 5F3HA 1RUPL 1YY9D 3QIUA 4X5LA 2VDLL 4GBXC 2X1XR 4KRPC 5CZVH 3BIKA 5DI8A 4GRWB 5B21A 5F96H 4N8CH 2WBKA 4MXWL 4NCDA 3TC9A 5I2UA 1A8JH 3NPSC 4ONOA 5TE7L 4GT7A 5ITBH 3VFOA 1LJYA 4RCAA 3ZJKA 5F8QC 4W81A 5SV4A 3ULSB 4S1RL 2IH3A 1CWYA 4NSBA 4AZCB 1F11A 3WFHA 2F54B 4D9QE 3W28A 3OAZH 2JJTA 4LHUB 2CKBL 5AZ2L 5M94B 3AMLA 3D18B 3TOPA 4KV5F 3V52H 1W3HA 1OPGL 2APVA 1BYBA 3VXSE 4WNQA 4JRXD 5D7JD 1J05A 5J11B 4JFPA 3N50A 4JY6A 3DHUA 1VEPA 4HKBA 3WN6A 5C2BH 2EH7H 1Q6EA 4HT1L 1MRDL 5C09E 1FVEB 3OB0K 2UY6A 3C2SA 4BQ6A 4JRXA 5D5MB 4L4PA 1SJHB 1SY6H 1W0WB 2VDNL 3GSVB 4X9FA 5EZLA 3AOFA 3WD0A 2F9BT 1DN0A 5GS0D 4OCWH 2Y5TB 1YMHB 1N64H 5IIEA 3MSGA 3AJ7A 3W0WD 2W91A 4P5KB 2NY1D 4QRPD 4YH6A 3LS4H 2VE6A 2Z1KA 3WBAA 5DJ8A 2WBGA 2X89D 2CRZA 2NY4C 1KOAA 2AK4D 4NRRA 4JZ5A 1EJ6A 2OP4L 3NCOA 4OD1H 4F66A 5JW3H 3NCCB 4HCRL 3WSQH 1IKFH 4JFUA 3UETA 5D9PA 3WUFA 1I3UA 1ZBWA 2BY2A 2C9AA 4QRUB 5I8CA 1JGEA 1FNAA 4ELMF 1P5UA 4PJEF 5J12B 3VJ6B 4GW4A 5BO1H 5H35B 3GSUA 3TPUA 5F71A 3ZMRA 3IKCB 3V5HA 4B3LA 1FA2A 3A23A 4I0PB 4AWEA 3IDIA 5SWSB 4NQXA 3VXSD 2FYYA 1KR0A 3QSKB 1EDQA 4HQQH 1I9RH 4BKLA 3NFSH 1XT5A 5I6XB 1OAYH 1MJ8L 4TX8A 2CBIA 4APQA 4M4RA 2ZWZA 5E5MB 4C7FA 1DQQA 3OKOB 3E3QC 3D39E 4QHMA 2R23A 3NIDF 2NX5D 3B2VH 2P48B 3MGOB 3B4NA 1FOBA 2NY2C 2IALB 3V5KA 3I85A 3MBXL 4ZFZA 4XGZB 3VGHA 4XB7A 5I77A 4UB0L 3BQUA 3WFBH 4QAWA 4Z7UE 4PV9A 1RPKA 3SCMC 1BIHA 4G8EB 1CDCA 2Y06L 3EYVA 3I3DA 5B38G 5DA4A 1BQHA 3AM8C 3KYOB 1FSKC 3LRSA 3H7LA 4PJGE 5KZ6A 2Q1EA 5IVXA 4IJ3C 3IF1B 3WMCA 1UWXK 1PSKH 4OLZH 5IJKC 2WMKA 1CE6A 4NQVA 5HHOE 5D8WA 3D85B 2G60H 3VI4F 5E8OA 3V6ZA 2F5AH 4LOUD 4A2LA 1KJMA 5JO5B 4HGWB 1FG9C 1MUJA 4PP1D 5DFTA 2DJUA 2XYCA 5T1LB 3D87B 5JXEA 2YN3A 5F44A 4N9GA 4XP1H 4YHYB 3LRKA 2IC2A 4X80H 4YGVA 6A3HA 1BEYH 3WDHA 4Z7VA 4W6WB 4XBPA 5IMMB 2DEPA 1TJIH 1VJSA 3F6IA 3DV4B 4RA0C 2QSVA 1W3JA 2I5YL 3ARWA 5MERB 3SO5A 1CTNA 3BEWB 4C83A 2F18A 2JIEA 1BGGA 3QEQD 1CE1L 5DC9B 2XGIA 2W66A 3VGEA 1TA3A 3T4YB 5CCKL 3O6AA 3IU4H 1W72H 4YFEA 1IAIL 2OSLB 3U0WH 1RFDL 4LQFH 1OGAB 3BI9X 4PY7B 3MC0A 3SDCA 2EE3A 4EJ1C 1UACL 2XKUA 1CDHA 3DRQB 4HWEH 2XPKA 5HI3D 4H1LG 3M8OL 4P59L 2PI6A 2XTJD 4WFED 1ZHNB 1JD7A 2R9HD 3QDJB 3F5JA 2B1AL 4PRAB 2HTLD 4EOWL 1FAIH 5M95B 1NGWA 3MFGB 3NN8A 5D2NC 5TE4H 5DJCB 1C92A 5INCB 3NDZA 5D70H 3L3OB 3L3JA 3C6LA 2FYYB 4PMUA 3IDXL 1XF2B 4POYA 5FOJA 4D0CA 1OWQA 3DX9A 3IS1X 4MJ5A 2AV7B 2EO7A 5FHBL 5FCUH 4NT6B 2WLZA 4PJBF 4JKMA 4BH7A 2ZXDA 4WEMB 4YK4B 3RCNA 2ICCA 3CUPA 4QOKA 3U7AA 4R97C 1K8DB 3QDGD 2OL3A 5I19H 1MHPH 4E2OA 1A2YB 4WFGE 1SEBB 4ZXBB 3QHOA 5BW7A 1R7OA 5IB4A 3UBXI 1E43A 4UCFA 2VMFA 3RWFA 1WLHA 1OAUH 4HHAB 4QOKE 3BSHA 3II1A 2WHJA 5C0DA 4L9LB 2CETA 1MVFA 1KCSL 1Z3GL 4DW2H 2EDHA 3WNOA 3SE8L 2WHKA 2XT1B 2MKWA 2Q6WA 4DN4H 5EOQH 1V6YA 1ONQB 3S5ZA 4MNHB 1OT1A 2C26A 3AXHA 3BPCB 4Q6IC 3WNNA 2CSPA 3QHMA 3UR7A 3IS0X 1HOCB 1S7WA 4JDTL 5HHQA 3CH1A 1OAZH 5ICZB 1B31A 3F6LA 4ISVA 1ECEA 3EO1B 1U58B 1CGXA 3D25A 5I18H 1B3WA 3AIEA 5EU3B 2C1PB 2EIDA 1H0DB 2F7RA 3QDMB 4LHQB 1UB5A 5HYQB 4H0GA 3ZTNH 3OAUL 3ARFC 4JDTH 4JFVA 4DM2A 1UQSB 1DQLH 5C7XL 4JAMA 2ESVE 3KYMB 2HP4A 4HUMB 2Q86B 3O2LA 4XBPB 1CDJA 4RFEB 2BOCA 2Y07H 1T7XA 3MV8D 1IQWL 2G9HB 1F6AB 1AGDB 3WY2A 4PTWA 3W27A 1JHLH 2FEEI 3D3VA 5AY7A 1U6AH 1NSNH 3UG3A 3BXWA 1BZ9A 1J0IA 4CJ0A 2ERJC 3NCEB 3P30L 5IFHL 1JZ5A 3N06B 4O5LH 1MCOL 1T6VN 2GJ6E 4OIAA 2CUMA 1HEZA 5DRXB 2XY2A 5BXFA 5E8EB 5SWZA 3T04D 3HA0A 3MNZA 5E4EB 4I0PD 32C2A 3O81A 2V3EA 4ZEPA 2GFTA 3M6DA 4FXLA 3G6DL 1J9CT 3ECBA 1U30A 3AIVA 4PJBA 3L95B 4CW1A 5JXEC 1JP5A 3T65A 1IMHC 1U8KA 4NDMB 5E70A 2CK0H 4MJ6A 2R56L 4G9DA 4K8RL 1G9ML 1UACH 5DJCA 2FNBA 1IGTB 2AKRA 1BQHG 4C59B 2Q8AH 5EIQA 2GJXB 3L3OA 1IM9A 3SDAA 1AE6H 3EYSH 5TQ2H 2Z1SA 2EICA 4DGYL 3EYQD 3V4VL 3QUML 3TYGH 3GYCA 1UA3A 4NP4L 1C5DB 4HWBH 4L4TE 1T5XB 1ZT7A 1SHMA 5GIRA 4PJ5B 4KPHL 4P8UA 2DQEH 2MQ0A 4HGKC 2Q20A 3OGCB 1U91A 2FBJL 1T2XA 1U8MA 1YYLL 3L5JA 4RIRA 5F7MC 3GH7A 3BVVA 1E0WA 4YFLF 5KVDL 5FL0A 2F61A 4X80L 3KPOB 4KK9C 3EJZC 3AISA 2D3LA 4JDZA 3UJTH 2ZUTA 4HK3N 2WC4A 3HI5L 1R8LA 5EO1B 1TETL 4ZAKB 2G75A 2FECI 2XUCA 5ISZB 5LGKA 5KTEH 3JTTB 4IRSC 1MHHA 2ITDB 3OG4B 4KJWC 3U1SL 3LKNA 4PSRA 2DI9A 1XAUA 5JR1L 2YS4A 2ZSWA 2AJXL 1WC7B 3HRZA 2H3NB 2VLJE 2BHZA 3IVKA 2XIDA 5FF6A 5IG7B 1Z9SA 4NHUA 1Q1JH 4NKMA 2LVEA 3IJHA 4ZYKA 4G6ML 1YEFL 5DGQA 3AXXA 2BOCB 5EB8A 2PYEB 5L9DL 4HPGA 1QYGH 4UNUA 2W63A 4FABL 5J1SC 2DQGH 4XHJD 1H09A 5IFPA 2OYMA 4NN7C 5EC1B 4P23B 4OV6F 3M17A 1TQBC 2CRMA 1IC7L 1DVFC 1UM5H 1SJXA 4GBXA 2Q7YA 1LO4H 1T0NA 2MJWA 5DD5L 3PWPE 5A94A 4DKEL 3LN4B 2YFOA 1UZ4A 1INDL 3B8YA 4QLJA 4UOQA 4M9OA 2F19H 3VRLF 1DQDL 2Z91B 4Y4HC 5DMIH 3UG5A 5CZKA 3U4EA 5KEZA 2Y24A 3O6LH 1AIFA 3TVMC 1AFVL 1OD8A 2EYSB 2YMXL 4Y7EA 3ULSA 3RWHA 1BX2B 3BUDA 4OCXH 1H1NA 1RUQH 2BNQB 1F13A 4LDEB 1MFCH 3MO4A 3TH4T 4BQ9A 3CZSA 2EDXA 4OUUA 3AICA 2MQ3A 1G7MB 2XZQH 1OLLA 2X4OA 2PR4H 4MD4B 5I75B 2DDQH 4MNGE 4PMYA 3ZKNC 4XWGL 1YEEH 3C87A 3JWNC 4KRLB 2AJXH 4NQCD 2PW1A 1J11A 1SJEA 1UJ3A 3CFBB 5SX5H 4OOUA 2BZDA 1L9MA 3EOYG 2Y2WA 3IFPB 3NZ8B 4OM1L 3UX9B 5TQ0L 3BN3B 3VFPB 4WHCA 3T0EC 5C2BL 2IAMC 4FQ2H 3MUAA 1L0XA 2XKNA 3NUKA 4UFIA 1UT9A 1NAKL 4QWWD 1YJDL 1U8NB 3OKEB 1QOKA 4ZO6A 2DS4A 1X5GA 3SDCC 1REIA 1QLEL 1I8KA 1SM3H 3FQWA 2CKBA 1ACYH 5GGUB 3MKKA 3WUGA 1AI1L 5GISH 4LOUC 1VBRA 1LHZA 3BVWA 3HC0B 1P4IH 5TPWL 3F5LA 3MUZ1 5C0IB 3O0RH 4N90D 5CGMA 5IJVB 1OGTA 4NHUB 4NUGH 3QUMH 5D8JH 2V2TA 2A6IA 4WI5A 1FHGA 5TQ2L 4M7LT 1C7SA 4YFDB 3BH9B 2OW7A 3RBGA 1ZHBB 2BFGA 2E7BA 4XP9L 5JTWA 1BQUA 5CP3H 5ELIA 4M48L 4PMOA 1R87A 3VIGA 2BHYA 4KI1A 1HYRC 5C0RL 1UG6A 5B3JF 1V0MA 3DIFB 2XRAL 4MXVF 2ZUNA 4FTVD 1E5JA 1GH7A 3B2UD 1TVDA 1LP9A 4IRSD 4Z78A 2Y6SD 1I3RA 1WDPA 1TQBB 3WDQA 2XRAH 4GW5B 2XWBA 5DQDL 3VXPA 1WV7T 3RA7L 4WWKB 4OF8A 5CEZE 4QCEA 2YL6A 3E6FB 1KCVH 3EYVB 3FN0L 2J7DA 4BELD 4HMCA 1SBSH 4MQSB 3KYOA 1MCIA 3H53A 1H11A 4RMWA 1IILE 3BCDA 3OXSA 5CJQH 4JRXB 5D5MA 2F8QA 3QDJD 5D8JL 2AGJH 4DTGH 3KS0J 5DJDB 5IBUG 1NLDL 4OCYH 1CXIA 1PD6A 4MNGB 4DO4A 1ZMYA 4N9GB 5D9OA 5B8CA 2PXYB 5ADOL 4HV8A 4RMQA 1RIHL 3RIFF 2RR3A 4HTYA 3FMGH 3IFLL 1MCSA 2XIBA 5IMMA 2P24A 1H5BC 4PJGA 1GGCL 1EJOL 3K8MA 1EO8L 2WVTA 4NQSA 2VDML 1U92B 4H88H 4OZ4A 5ID1B 3VM7A 4AC1X 4Y16D 1A3HA 1PKQA 3O2DH 3MMEA 4L9DA 1VADB 1BOGB 1EA9C 4WWID 4NHCH 4K7FA 3VXUE 4JFOB 1W32A 2QV2A 4RAVA 3C08H 1PG7X 1BYAA 4Y1AB 5CFHA 3CH8A 4HH8A 4N8VA 4QRUA 2X1WL 1CI5A 1F58L 2Y9RT 1UUQA 4GW4B 4Y2OA 5DC4B 4QYOB 3V5HB 1R5VA 4J8RA 3BDBA 1H5VA 1EUUA 3ULUD 1C91A 3AXLB 4RA3A 4ML4A 1VENA 1DUZB 4WUUB 2CLVB 1DEEB 3PWNB 2EC9T 3MOAL 3HI1B 4AEEA 3HZYA 1TVNA 4NO0B 2YSSA 3JWOH 3THMH 3QA3A 5J56B 4FNTA 5JHLL 1EO7A 4KH2A 3JUYA 1QQDA 3UPRA 3VXNB 4YHGA 3SCOA 5I0ZA 3AREA 3KYKL 5C0EB 3T3MF 3A5VA 5E2UH 1DDHA 5FYKE 3T2OA 3WEXA 1EGJL 1HJVA 3DX9B 4LSPH 1FAIL 2QQQA 3BSGA 5A6BD 4U1MA 1JUFA 3I6GB 3C5ZA 3RI5F 4PV9B 2QEJA 1L6XA 3SDCD 1FH5H 2DSZA 3E6HA 2ADJA 3HPLA 2YHGA 3WYRA 1UCBH 4V2BA 5ISZE 5IDIA 2AK1L 4LMQI 15C8H 3UYRL 4OGYL 4X7EC 3VXMD 2VXSH 2X4PB 3REVA 3HAEB 3BEVA 5EUOA 3GNML 1UWGL 3C8DA 5CCKH 3AHYA 5ALCL 1K6QL 1IT9L 1XH3B 2MFNA 3CD4A 4L8CB 2YZ8A 4JQXA 3WNKA 4ZTOL 5KSAC 2VLRD 4OKVB 5C0AA 4BZYA 1LDPL 5T1LA 2Q6WB 1ZT4B 2EPOA 3ZKXC 3CXDL 4IDJH 3VMNA 4FZ8L 3BHBB 4LAQL 2HAZA 2EKSA 1VIWA 3ARGA 3QEUB 4P48A 1LEIB 3QDHA 2PTTA 3GRWL 1DL7L 3VDCA 1D6EA 4D0DB 3TO4D 4JQVC 4L8BA 5HVGB 1HQRB 5J6HB 4H41A 2J4WL 5C09D 2OR7A 1NCBH 4DWSB 1EHAA 2FO4A 5ETUB 1UKSA 1S7RB 2APWA 4KK5C 3TM6A 3TCLB 5MEQA 2H9GB 5HDRA 3L6FA 1NGXB 3F7PC 3Q48A 4OLYL 1JAEA 2OWXA 1KCUL 4Y88A 1MFCL 4WHYG 5F1NA 4YWGL 1PEWA 1NMAH 2PXYD 1FVCA 1A6ZB 2DL9A 1E9LA 1ZGLM 4LYPA 5D7JB 1WAWA 4EXKA 1OINA 3QQNA 4Y1AA 3CLWA 5BVJA 2VLLA 3O6LL 5HYJA 1IJ9A 5E8EA 4OQTA 4S0SD 3HZKA 3DTXB 4PRAA 5GGRY 3PTKA 5KVDH 4MJID 1RVFL 3KPMA 2VXVL 2WUBL 5EOCL 1D6VH 4Y4FB 2CJUL 4XVUC 5GGTL 1OTSC 4QXTA 5ABFA 3RWJA 5J13B 2N7AA 1RK1B 2DWDB 3DURA 2PWHA 3GXDA 2G3NA 4Z0XB 3FY1A 2XPGA 2WCSA 3GSNL 3ZE2E 3GMLB 1AGEA 1KPUA 3LKSA 3G6JF 3RBSA 1FNEB 1R0AL 4JCMA 2X5PA 4EIZC 1BJ1H 5DLML 3CZNA 3FRPA 4LCYB 2X2IA 2EE2A 1MCWM 2P4AB 1SVZA 1IM9B 3SDAB 5C0EA 1V7MH 1TJGH 1SEBA 1H8OA 1OSZB 4P2CG 4KUCD 5HDQH 4XX1E 5JHDE 3SO3B 2BNRA 1MREL 4JG0H 1MCWW 1DEDA 1FLRL 1RJCA 3THML 1OCWL 3MFFA 3RWFB 5EBAA 4WUKL 1JPFA 4NKIH 3T77A 3U46A 4NNXB 3VE0A 3UROR 5A3ID 3VFSA 3X3GH 5FO8A 3ZLQC 2X7LA 1BLIA 2DMKA 1NUFA 5FB8A 3IDYC 3H55A 2YFNA 5E00B 5FO9A 3MRCA 2D4FA 3BE1H 1UH3A 1QSVA 5DJYB 4V1DB 4HG4J 5HHME 2EE6A 4PYGA 1B0GB 2UWEA 4M8UA 2J88L 4OQTH 3W26A 1P6AB 4P2QB 5CPSA 2D1ZA 1NC2D 4QHUB 3CFEA 2IUZA 1KXTA 1L7IL 5IVXE 4UBDD 2IBBA 2VX5A 1WUNT 2BVEA 3DUSA 4G3YL 5D1XD 1GZJA 1MEXL 3G5YA 1U6AL 4OKVA 5BVPH 1JG9A 3DGGB 4UTBH 5D7SH 4PRID 2LAAA 3KPSB 4YHYC 2IADA 1XH2A 4M43H 4XZBA 1GGBL 1YMMD 5AC4A 4PGBA 4PJBE 4LLDB 2AP2A 3ARGB 1WWAX 4ODSH 2CRIA 4FQIL 1JHKL 2P1YA 4TPRL 4X98B 2YC1A 2WMIA 1TQVA 1GZPB 5BS0B 4KTDL 4NKOB 2ENYA 4ETQA 4ZSOA 4LDOB 3BKJL 4HX1A 2GCYB 5T33L 1XEDA 4HKXA 1AQKH 3PTQA 1PBYA 5EC2A 1Y0LB 4GXUM 4MJ2A 3FCTA 1RZKH 4PJHA 3H9ZA 3KVQA 5IV2B 1DQJA 5KS9F 1FBIL 4LASL 3MANA 1T1ZA 5AYBA 3MNVA 1Q0XL 5I1HL 4X7DC 1HHKA 5FEBA 1A02N 2ZCKH 4S1RH 1DANT 3KXFE 3PZUA 3QCVL 2UY5A 2B0SH 3N13A 4CN1A 2NY7L 2R0LH 1Q0YH 3ECBB 1TCRA 4L4VB 3F5WA 2FATH 2HT4D 2HVKB 5E1AB 3QRGL 3MR9B 2HN7B 5EUOE 4MNQB 4OGXL 3WJJC 1N4XL 4ENEC 2HFEB 3ZKSD 3LOWA 1KLUA 1NCDH 5FGBC 2HG5B 3BP7A 3I9GL 3DSFL 1GYAA 3S2CA 1P7HL 2H32H 1R3IH 1QBAA 1ITCA 4MA8L 4OD3L 2C4FU 4GW1B 2QJDA 2CHOA 3AS3A 2IH1B 1KXQA 3CZLA 1P2CA 2L4OA 3L3IA 4Y5XA 1NKOA 2R0LL 4U1JA 3MRBA 1E28A 1MCJA 4QRRE 3SN6N 1RZJL 1EEUA 3BZ4A 1BOYA 3NCFB 1KTKE 5CGYC 4HGMA 4PJ7F 1WCGA 2LTQB 2M2DA 8FABB 4NZTH 2J7FA 1SJHA 2J8UA 5TFSL 5ABDE 3CSGA 3HR5B 4UFLA 1MW2A 5EZLB 3OGRA 3L3GB 3CFCH 5T33H 1HHHB 4PCTA 3L5IA 2ZXQA 2W5FA 4GZEA 2Y25A 1MQRA 5A6BA 1JHKH 1V8HA 2NNAA 3ZE0F 43C9A 4Z7OE 1E72M 3WFLA 2BOBA 4RE4A 1YMMB 2XTJE 2FD6H 4WFEE 3SGKC 4Z7NF 4FA8A 5B38B 3IU4L 4UT7L 1JYWA 3QDAA 3NPSB 2GTZA 2UV3A 4L1HA 5BRZB 1CGUA 1MSPA 4FG6C 1HJWA 5C0AD 4JPKH 5K9JH 4W7WA 3DXAD 1FNSL 3MLZL 1RIVL 1RQ5A 3EDEA 4M3KB 3LRMA 2GVYA 3IFNH 5CEZH 3RWDB 3K7UA 3IVKB 1LG1A 2IADB 5ACZB 2IQAA 4EE9A 4GAYB 3TZVB 5JMOC 1S9WA 3VJ6A 1LWHA 2CKBB 3GMQA 4PR5B 1HHGB 3WQWA 1QNPA 3ZJ8A 1U95A 2X09A 4LFHD 2YD5A 5I1AB 4H1LB 1YHTA 1A6VL 4LLYB 1C5CL 5D9NA 3SCWA 1F8TL 5LGHH 4M7JL 4Z7OF 2YPKB 4IRJC 2LV4A 1DN2A 2XN9D 5GQBA 2W0LA 1BGAA 1CU4L 1EXUB 4OLUL 3VNYA 4RL3A 5I79A 3U2SB 3P4OA 5IB2A 2E27H 1DQJB 1T1ZB 2XWJA 1EAJA 3BH9A 4KXZH 3RY6A 1LK2B 1KIRA 2LU4A 2R69L 3IYLW 4PJCF 1BGXH 3JV6A 4UTFA 1J8KA 4WRLA 1OAQH 3OPZH 4WO4D 4YXKH 3VG0L 1J10A 1WE5A 4G9FE 4XPBH 3SCQA 4JRYE 1BD2B 4MA7H 1E6JL 5F9JB 3WENA 3ZDXF 1I9IH 2APXA 2OXGA 3V95A 3ZYIA 3CBWA 1SEQL 2VWEC 4UOW0 5GPRA 5BMFL 3W2DL 4AIEA 4EI6A 1WBXA 1MVYA 3N11A 1KPRB 2VQTA 4P5MB 2XTKA 1LQSR 4OLWH 4LBEA 1VPOL 3RAJH 1B4RA 3VXPB 3PWLA 3OKNB 4U0QB 3GGWB 2WMPA 4PRBA 2HLFC 4XI5C 4AT6B 3EZJB 1KB5A 1R34A 4UFMA 4D1JA 4BFBD 3E6FA 5E9DD 4Y5XB 2D20A 1NP2A 4K3DL 4YR6A 1DLHB 1D5ZB 1R3HA 4GRWF 4DO5A 4Y2DD 3VXRE 5KVEH 3MV8A 1KCUH 4IRJB 5CILH 4CVZA 2BSED 1QI5A 1UA7A 1W0VB 4JFEA 4Y4FC 4LK4A 1D9KD 3AI0A 4N68A 5I8OL 4JFDE 1BFTA 2Q8BL 3DV6B 5I76B 3EYOB 3KPLB 4ALAL 1LP9E 4NZFA 2X70A 4CCDA 3IDNB 4JY5H 4JZNB 1DP0A 3MCLL 4X8JA 4S1SH 4UZGA 4D6FA 2EAEA 4HOZA 4W84A 3VRLE 3EOAB 2D3NA 4PB0L 3LMJH 2CCRA 4S0TD 2G3MA 2OR8A 1U8OB 1LMKA 2A6KA 1KEML 3QEGH 2FWOB 3EHBC 1DANU 1JF5A 1KWGA 4M5ZH 4ONHB 1KXVA 2K3TA 2QLYA 2HJFA 5I8EA 2X1QA 1NAMA 1BOGA 1BIIA 3WDPP 4Y4FD 3FO2A 3C6LC 1ZGLP 3VFNB 4ZOAA 3WHXA 4JY5L 1FH7A 4Y8DC 4XBEH 5C0IA 3DECA 1EHXA 2ZUQC 2YD8A 1AKJD 5IFJB 2VO5A 1OSPL 4M56A 3W2DH 3MRPB 3EJJX 5EBMB 4NZDA 4GS7C 4JM2D 3O3DA 3OZ9H 3O2WH 2XTLA 3OJMB 4OIIL 1S5IL 3HE7B 4MAYD 4QTIL 3B9DA 5JW4M 5C6PB 5ACLA 4JPVH 2PB1A 3MUIA 3IFOA 2O9RA 1U93A 1DWGM 2NY4D 3GSUB 3LCYA 4YHOL 1NKRA 3EYSL 2IGTA 3SDXE 3QIWD 5CWSB 1FNFA 2UZXB 4YNYB 5JLZA 4JHAL 1JTOA 4PV8A 1GQJA 4RAUA 4BKLB 5KSBE 2X1IA 2I07A 1BFSA 5TE7H 4WDIB 2AABH 4E42B 5LQBL 4LLAA 3ARDD 4HHAA 5ABGA 4EI5A 5EOTB 5TDOB 4HEPG 2H6PB 1E4KC 4TNVF 2YK1H 3AIQA 3TN0D 1G9MC 1MF2H 1B0WA 4CCEA 5A1AA 3RVVC 1GOHA 3DVNB 3S36L 3U36B 1B3XA 2VRKA 1HILA 1F02I 2AEIT 1D2KA 3MS8A 5GS2D 4HUKB 1MCOH 5E0QA 1XH3A 4YHNA 2XZAL 4OCNC 5FA3A 3WUWA 5J57B 1BQHB 3A6BL 1D5IH 1D3CA 5EFIA 1TTFA 3RVWC 1FORL 5FOBB 5HPMB 5EU3A 4C55A 2BC4B 1WTGT 1RZGB 4NQDA 4LVOC 5D6CB 3EJRA 3AZRA 1ZT4A 4KKAC 4XXCA 4PTMA 3SJVB 1DE4A 2FIKA 4KQ3H 1IBGL 4KMTL 1IGMH 5FYKH 4M93B 3MOBH 5EPMA 1T4KA 1OP3H 3GXMA 3GM0A 1MRDH 3MRDB 4PJXE 4LGXA 4G6JL 4R3SA 1NARA 1CLVA 4MD5B 3LKPB 1MELA 3UTTA 1EEYB 1FNSH 1WZLA 3HC4H 4RNRB 2XFRA 3BVUA 1FZKA 1I9EA 3SCTA 3SHSA 1KELH 4Z5RA 4OI9A 3KHOA 4IMKA 1WEJL 2VLRE 3AAZB 4YPGA 5CJ8A 2ICEB 4LU5H 3WKMH 4F7TA 3KZSA 2VX4A 2DWEB 4NM8L 3T2PA 4FFZL 4KKAD 3WD1A 1JL8A 2X4UA 4UBDC 3AIWA 3GHEH 4PGJA 2KH2B 3EJZD 2DSVA 3POCA 4OD3H 1OP5K 1ZA3A 1JCKA 4PIRF 4MJ6B 3N1GC 1MHCA 3CSYA 3CSBA 1A6AB 4HD9A 4OFIA 5C9KA 2AQ2A 1NC2B 3OR7A 4UIMB 3BUPA 4EUPB 3MRHA 3ZR5A 2WHMA 1QX1A 3MLSL 3D85D 3MV8E 4G43B 2CLZB 3SE3C 5C0JB 2X6MA 3X14A 3VG9C 5TJWK 1J18A 5FDYA 5ANME 3CFJA 2YD9A 3RIKA 3HE7D 5CWSA 3TN0B 4KRNA 4M6ML 3C6LB 4KDTC 1GGIH 2DMBA 4PJ7B 6FABH 4OJFH 4HKZB 2BNRB 4EOWH 4HZ6A 1KXQE 4H8UA 5J0BA 3KR3H 4LGPB 5CEYA 4XNQA 3B9AA 3QWRA 5LBSH 1QFHA 4KWUA 1YN6A 3MMUA 4AQ1B 5IVXB 4TTDD 4NM8H 4DN3H 1JHTA 2VLMD 3BD5A 1QSZA 3RMEA 4PGZA 4P9HL 5GRJH 2XGBA 5I2IB 1UD5A 1CT8A 2NMSA 2VSCA 4EEEA 5HOSA 4JM2F 3WFCH 5DT1H 4YHNB 1UWQA 5IT2H 1NAKH 3EDDA 2D2OA 5JNYB 1GPOH 2W0FB 3G5YB 1M71B 3VW3L 2LU3A 1FDLL 2Q87A 3RTQD 3MA7A 3VIHA 1OP5H 1UD3A 1HZHL 1X5JA 3OR6B 4S2SB 1X4YA 4EUPH 1K3ZA 4UFKA 3V6OC 1SBBA 4X6BB 3P4NA 5F1OB 4ZYKB 3MODH 2DTML 3VMOA 1URLA 2PYEA 3DV4A 1GJUA 1PVHA 2RGMA 4OKDA 1MY7A 4WV1A 4JHWH 1MRFL 2J25A 2ZICA 3X11A 3BPNB 5C86A 4J2XA 1TQUA 4X6EB 4FTVB 1KLGA 2DPEA 3C09C 3EUUA 2G60L 2IFGA 3BPOB 3VFRB 5LCVL 1T66D 3UAJC 5DEFB 3BUQA 2J5LB 4MAVA 1ZVYA 4UOJA 1NMBL 4RFEA 2V6HA 5HDQL 4OZFG 3IDXH 3P4LA 5K9QI 1XGZA 4D8PA 4YFLI 3HI6L 1F6AA 4D6HA 1HHKB 5CEZD 4GO8A 2ORBH 4Y4FA 1HJQA 1RZ8A 5TE4L 5B39G 5FFLA 1VEMA 1KGCE 4A2MA 2FCBA 2R29H 2OWCA 3LQAC 1U8IB 2JCCA 1RZ7L 4I0KA 2NW3A 1W9BM 1KPUB 2KBGA 3V2AR 3VSVA 2DI8A 2KPNA 4NGHL 1TQWA 4RWHA 4UQEA 4I4WA 3ZHLA 2AXJA 4ZFOL 5E24E 4NZJA 3L5WB 3B5TA 4K94H 4AISA