5CM2Z

Insights into molecular plasticity in protein complexes from trm9-trm112 trna modifying enzyme crystal structure
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
184
Chain Sequence
TRYKPWPIVEKFLRDQKDHSVGVDIGCGNGKYMGVNNKVFIVGSDRSDELVKLAHDMDPSREVVVCDAIDNAHPEGRFDFAISIAVIHHFSTPERRREAVRAILNTLRPDGRALIYVWALEQDQDVMVPWVKKVDGVEEVRYRYYHLYREGEITSDVEASGGKVLETGYEKDNWWVVAKRGDDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into molecular plasticity in protein complexes from Trm9-Trm112 tRNA modifying enzyme crystal structure.
pubmed doi rcsb
source organism Yarrowia lipolytica clib122
molecule tags Transferase
molecule keywords TRNA METHYLTRANSFERASE
total genus 50
structure length 184
sequence length 195
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5cm2Z00
5DXAA 5GP1A 3I9FA 1R00A 3GCZA 3FUUA 2FK7A 4HGZA 4E70A 4ER5A 4RWZA 4KIGA 1R8XA 2Z6QA 3FUTA 4ER3A 2OBFA 3FPHA 1JTEA 4RVHA 5E1MA 5CCBA 4Z2YA 4PONA 5GIOE 3OU2A 2K4MA 3KQQA 1VPTA 5E8JA 3MAGA 1EG2A 4DF3A 3LSTA 2PGXA 5E9QA 3GXOA 4RTSA 4R05A 3M6UA 3OZTA 4HGYA 5EVJA 1AV6A 1JSXA 3UJBA 3CJTA 4FT4A 2IDKA 2PXAA 3I64A 5DM0A 4PYOA 2H1RA 1Y8CA 2H00A 3B7PA 4U7PB 2FCAA 2P35A 1YFLA 2PX8A 1Q0SA 4C08A 1RI4A 2QYOA 3PX3A 3AXSA 1QZZA 3M4XA 5CVEA 1NW7A 1XTPA 1RJFA 3B3GA 4QPPA 1R74A 3KQPA 1ZGJA 1WS6A 2B9EA 5FHRA 3SXJA 3FRHA 5DSXA 2ZZNA 3E8SA 3MERA 1JG1A 3S68A 2C7OA 2AOTA 3I53A 5K0GA 1BKYA 2BM9A 5EGSA 3LCCA 4X41A 3UA3A 3ME5A 5DPMA 2PY6A 3IV6A 1X1BA 1RI3A 1YZ3A 2PX4A 3Q87B 4QTTB 1L3CA 1XCLA 2DPMA 2O06A 3GO4A 1ORIA 4B17A 1P1CA 4CTJA 2BH2A 3ID6C 4ISCA 5K8VA 3JWHA 1YB2A 2QRVB 4KW7A 4FSXA 4IKPA 1IY9A 4ER6A 3THRA 5EZSA 3MGGA 4GF5A 3BWYA 4LECA 5LQRA 3A7EA 2P41A 4ER0A 4P7KA 4FP9A 1VE3A 4DQ0A 2P8JA 3NDJA 4FSDA 2UZ4A 5T67A 3KR9A 3OU7A 3HA7A 4P7JA 4DMGA 3UZUA 2OO3A 2AVNA 3LL7A 5FA8A 3OPNA 4RVFA 1G6Q1 2F8LA 1G38A 3HCBA 5LQJA 3LCVB 3UFBA 1HMYA 3NWBA 4PYKA 3P2EA 4KRGA 1F38A 4R8SA 5CVJA 2B25A 3BGIA 3IYLW 3ERCA 3PB3A 4CKCA 3DMHA 3P97A 3EEYA 2EJUA 2Z6UA 3LHDA 5EHGA 4EKGA 3KPJA 5FWDA 3GDHA 1XDSA 4AZWA 4DCMA 1SQFA 2HWKA 2PX5A 3A4TA 3PX2A 2ZBPA 5K0BA 4LG1A 2P3QA 1NE2A 1VBFA 3TKAA 4YUWA 9MHTA 2WA1A 3ER8A 3MTIA 5CCXA 3MCZA 5E9JA 3VC1A 3EMDA 3HCDA 5EMLA 3FPJA 3HCCA 3Q7EA 4OA5A 4OA8A 1VIDA 2ZWAA 4U7TB 4XUDA 2O07A 1XJ5A 2JH8A 3KPUA 5DM2A 2ADMA 5DX8A 5CVUA 4EK9A 3IHTA 4PYJA 1EQAA 1X1AA 2BZGA 2ZLBA 3DR5A 5G02A 2PT6A 1WXWA 4BLVA 1SUIA 3G5LA 4R6WA 1EJ6A 4BP1A 5CVVA 4PWYA 3VYWA 4RTNA 3FTFA 5JR3A 2IIPA 3GWZA 1BHJA 1NW3A 3BWBA 3M6VA 3R3HA 4A6EA 3I58A 5EZQA 4DM3A 1RJGA 2HTEA 1L3BA 5LQKA 4AZTA 5FWAA 3PVCA 4C4AA 3EVZA 3X0DA 5FTWA 4A6DA 3R24A 3HVJA 5EIFA 2P3LA 2AN4A 2GPYA 2OB1A 3UA4A 4ER7A 3P9IA 5KYGA 3EMBA 2WK1A 4RTJA 4MIKA 4YV0A 2B3TA 2YTZA 4K6MA 5HIJA 2EX4A 2VZ9A 1EJ0A 4F84A 4FGZA 1UIRA 3DOUA 2JJQA 3B89A 3DXYA 3OFJA 4PCLA 3RODA 5C1IA 2DULA 3F4KA 2G70A 5E2AA 4PCAA 1KXZA 2B2CA 2PV0A 2AR0A 2PKWA 4M37A 5EPEA 5F2NA 3FUXA 3FZGA 4L7VA 1KHHA 2LD4A 1T43A 3LBYA 4E2XA 4RTRA 3CBGA 1XDUA 1FP2A 5HILA 5FQNA 3EGVA 2ZZMA 5EC8A 5KQSA 3FPEA 2NXEA 1I9GA 5FULA 4AX8A 3THSA 4HG2A 2OZVA 4X60A 4KDCA 3BWMA 3GRYA 1X1DA 3DXXA 2GH1A 2ZULA 2Y1WA 3EVCA 2G71A 3BGDA 7MHTA 1DUSA 4RTMA 1XVAA 3SSNA 3KQTA 3TKYA 1AQIA 4GUAA 5EQJB 2QY6A 3GIWA 2FRXA 3PT9A 3HA5A 4PIPA 5HIKA 2PLWA 4CWAA 2CWWA 2GLUA 3GU3A 3MTEA 4PYNA 4R8RA 3HTXA 2BR5A 5GM2A 2YX1A 3HA3A 5HIMA 1I4WA 3TLJA 4CTKA 1UFKA 3LX6A 4GEKA 3UWPA 3L8DA 2VDWA 3KPVA 4V0QA 5FA5A 3CJQA 2EG5A 3CJRA 3O31A 1VQ1A 2P3OA 2C7QA 1RI1A 5LQAA 2I62A 5LSAA 2BR4A 3BGVA 3UJ7A 4BY9E 3UBTA 3SMQA 3CGGA 5EMMA 3NDIA 2PXXA 2PJDA 5K0NA 3KQYA 2BR3A 4IV0A 4DKJA 2NXCA 4WVLA 2JH9A 4G56A 2EFJA 4GOOD 2G72A 3C0KA 2ORED 2NXNA 5IKMA 4YMHA 1RJEA 5BW4A 5ICFA 4QVGA 1SG9A 1ZG3A 3G8AA 5E8RA 2HR1A 2IFTA 3UJDA 1P1BA 3AJDA 3G88A 1KPGA 2PX2A 2I7CA 2XYQA 2R6ZA 3DLCA 4X1OA 3KHKA 3HVIA 3FTCA 3P9KA 5U4XA 4ZTBA 1V39A 3EVAA 3P2IA 3QOXA 2NP7A 3ANXA 3LKDA 3DH0A 3KQMA 4QQKA 3NVKI 1NW6A 4FT2A 3A25A 2ZSUA 1SVUA 1FBNA 1SUSA 3SVZA 4C04A 1L3IA 5HFJA 1IXKA 4QVKA 1JG2A 1NT2A 2JHCA 4QTUB 2I9KA 2XYRA 3V97A 4HH4A 3DULA 2PVCA 3EGIA 4Y30A 4Y2HA 2VS1A 4AZSA 2R3SA 4YV2A 4FZVA 3SGLA 4JXJA 3G2QA 3RW9A 3KR1A 4RYLA 3T0IA 3T7SA 5CD1A 2HNKA 3CC8A 2PXCA 2V74B 4E31A 1RI2A 1N7JA 3HM2A 2PWPA 4F85A 1KIAA 4XCXA 2YXEA 2GS9A 2QRVA 5EKUA 5DXJA 3AXTA 2JG3A 1I1NA 4F86A 4E30A 4QDJA 1DCTA 3UJ9A 1NV8A 1ZHFA 2ZW9A 3QOWA 3SR4A 1JTFA 2OPBA 1ZGAA 1XXLA 1RJDA 3G2MA 3G8BA 2NXJA 2FPOA 1JR4A 3LPMA 5FCDA 5EMJA 1F3LA 1PRYA 2P40A 2XYVA 5GWXA 3BWCA 4RVGA 4POOA 4DA4A 1R18A 2BM8A 2NNWB 1JQDA 4YUVA 4YUZA 5LR6A 2IH5A 1AQJA 5P8WA 1MHTA 5DM1A 3KU1A 4H0NA 3JWGA 1TW3A 5ICEA 4O29A 5BXYA 5FQOA 2ZIEA 2GA9A 3HCFA 2GB4A 4V0RA 2N47A 3C6MA 4RSRA 5K0EA 4OBWA 3NTVA 4HRAA 2OYRA 2AOWA 2C7PA 3M70A 2ONYA 1P39A 4WXHA 3TQSA 3UJCA 2AOUB 3PFHA 5DTQA 3O7WA 4EVIA 3T7TA 1VL5A 1H1DA 1VP9A 3EVDA 1NBHA 5DT2A 4YUYA 5K05A 1D2HA 1EIZA 4OBXA 3LDUA 1NV9A 5B1SA 4E2YA 3PS9A 1KPIA 5GINE 2ZIGA 3LECA 1UWVA 2CMGA 1TPYA 2YR0A 2ZBQA 1WG8A 3MB5A 5E9WA 2G1PA 5T6BA 4FR0A 3P8ZA 5GOZA 3FTDA 3GRZA 1RI5A 4MHTA 1R8YA 1ZQ9A 4BLWA 1ORHA 5E1DA 1WXXA 2KW5A 1VLMA 3OU6A 5DTRA 1KYWA 4PYQA 5DX1A 4E2ZA 1EAMA 3ORHA 2IBTA 4E2WA 1QANA 4DCGA 1Q0TA 5BW5A 5K01A 5KVAA 4PYIA 4RTPA 2JHPA 3CVOA 5GM1A 2IH4A 3ELWA 4PNEA 2IPXA 5KQRA 5EKXA 4P58A 3SM3A 2NP6A 5EG5A 2UYHA 4M38A 3BT7A 3B3JA 4PYMA 4QDKA 1OR8A 2B78A 3BKXA 3K6RA 4NECA 5EOVA 3QV2A 4P7GA 4PIMA 1FJXA 3LCUA 2QE6A 4P7FA 3I5UA 3D2LA 3R6TA 3DLIA 2UYOA 3TM4A 1O9HA 2ONZA 1PJZA 4RX1A 1DL5A 2AZTA 3NJRA 3NMUF 1N2XA 3M6XA 3O4FA 1BOOA 2A14A 5C9ZA 3B5IA 3G89A 3B3FA 3RIEA 4EKIA 5HIIA 2OB2A 1QAQA 5H02A 2I6GA 3EVGA 4RTQA 4MTLA 1VP3A 3GRUA 3WSTA 3R9XB 3H2BA 3PTAA 4RV9A 3KR2A 4PGGA 3DTNA 2VDVE 5K0LA 3P9NA 3BUSA 3DXZA 2AOXA 3TM5A 5EEGA 5DX0A 4PINA 4XUCA 5K0FA 1NW5A 1BC5A 5K0JA 1YZHA 3EGEA 4C06A 2AOVA 3FUWA 4E32A 2UYQA 2XVAA 4EQZA 5EMKA 3FTEA 2O57A 3UJAA 2Q41A 2IDJA 3MCTA 4KWCA 3TOSA 5JUWA 3ELYA 5DWQA 1G60A 3TPZA 5MHTA 4LWOA 2ZTHA 5KS2A 3EVEA 4GC5A 3GNLA 1B42A 2E5WA 3REOA 5GIPE 4HSGA 2PSSA 2JHAA 2P7IA 2PWYA 3OFKA 4GBED 4R6XA 3KPWA 3UJ8A 2IBSA 4HTFB 3CKKA 1L1EA 5CM2Z 1M6YA 3FUVA 3LGAA 3TMAA 3E23A 3SSOA 3EVBA 1KPHA 3GRRA 2UYCA 4RTKA 5E2BA 3MHTA 3HVHA 5FHQA 4C05A 4BLUA 3HVKA 1JSZA 1M6EX 2NYUA 2AVDA 1TW2A 3AWIA 1XCJA 3HEMA 5DM4A 1FPQA 4DZRA 2YXLA 5BP7A 4GQBA 5K0CA 1QAMA 5EEHA 4CKBA 5HEKA 5HZMA 2XBMA 4X63A 3SX0A 3LKZA 3TR6A 2VP3A 3JWJA 4YV1A 2QM3A 2O0LA 4MWZA 1YUBA 1SQGA 3FPGA 3LBFA 3TRKA 4KVZA 2Z6AA 1D2GA 4AZVA 3LDGA 3NWEA 4KDRA 1L9KA 4RVDA 2FK8A 4RTLA 4OX9Y 4PYLA 2WA2A 5CIYA 1INLA 3IEIA 2AS0A 5DRTA 2OY0A 1KYZA 1IM8A 3CCFA 2H11A 3DMGA 4C07A 4YUXA 1NKVA 4MQ4A 2ZIFA 5EIWA 2YQZA 3G2PA 1D2CA 4AUKA 4OQDA 3HCEA 1AF7A 2ZVJA 5D1NA 3BZBA 3C3YA 3R0QA 4OQEA 2YXDA 2YVLA 4HTFA 2ZCJA 2FHPA 2ZFUA 4YMGA 1G55A 4IWNA 1X19A 1G8AA 4GOND 2CMHA 4X61A 5E1OA 5M5BA 1KP9A 2AN5A 2O05A 1WZNA 1JQEA 5ICGA 2EJTA 5DLYA 10MHA 1X1CA 4UOEA 5F2OA 4RTOA 3P2KA 5F2KA 3BKWA 5C0OE 3A7DA 2OKCA 3G5TA 4BP3A 3FPFA 1N7IA 2P7HA 2Y1XA 3DP7A 3GJYA 4ATNA 1XDZA 3DMFA 2ERCA 3GRVA 5HOQA 3A26A 5CVDA 1R6AA 4M36A 5LQUA 3BXOA 1WY7A 3K0BA 5E1BA 3EEOA 1JG3A 2ZBRA 5CUQA 4FS8A 2AOUA 5DRYA 3OZSA 3ER9A 3C6KA 4HC4A 1YFJA 3TFWA 2PT9A 3U81A 4CKEA 1NW8A 2HV9A 3M33A 4E33A 3VSEA 3PLAE 5LQNA 2FYTA 3ELUA 3HP7A 4QPNA 4GOMD 3KPYA 5FADA 4LWPA 1HNNA 1U2ZA 2IP2A 2YUIA 5DTMA 3T7RA 1QAOA 4KIFA 3SSMA 1ZKDA 4C03A 2G8NA 3P9CA 2IGTA 3HNRA 4QQNA 1NBIA 3VC2A 3KKZA 3A27A 2VDUE 5D1HA 2CL5A 1O54A 8MHTA 5K09A 2P1DA 1FP1D 2C7RA 3UJ6A 1G8SA 5ICCA 3C3PA 3HCAA 4GC9A 1Z3CA 2ZWVA 3JWIA 5ERGB 2IH2A 1O9GA 2OXTA 2V7EA 3KR0A 3E7PA 2ZZKA 1QYRA 2AN3A 3M6WA 3OZRA 4GOLD 3OE5A 3EVFA 4XUEA 5K03A 1SKMA 2AOTB 5IH3A 3GGDA 3V8VA 4M7RA 1MJFA 3KQOA 4CXMA 5T64A 1JQ3A 5EHIA 3P71T 5DSTA 3DUWA 3ELDA 1YF3A 3KQSA 3FYDA 2XVMA 3MQ2A 3FRIA 3NVMB 2CKDA 3FYCA 1M0EA 2HMYB 3OE4A 4EMSA 5FUBA 2GAFA 4PGHA 2PBFA 3EPPA 3PFGA 3KQVA 3LDFA 1JG4A 3G2OA 5LQCA 4IV8A 3KQWA 3AY0A 3OCJA 1KR5A 2ESRA 3G7UA 3NW9A 1P91A 3E05A
chains in the Genus database with same CATH superfamily
4YFVA 4ZVMA 1P81A 1R00A 1ZKMA 2KBEA 1V1MA 3N5CA 1A5ZA 5DK4A 3J81A 2AW5A 4C29A 5DN9A 2X3UA 4HPJB 3AZOA 1BQEA 1W35A 4MVCA 5F5LA 4Z1MD 3ESYA 5TGTA 1U5AA 1LPPA 2HJ9A 6LDHA 2XXJA 4OJNA 1FK8A 2AQIA 3CZQA 1GFWA 2HSDA 3F9IA 1II0A 4N0DA 1H0HA 1LBIA 4HB3A 1F4LA 2A0KA 4RDCA 4BX8A 1RC8A 5FAKA 5FLEX 2OQ2A 3CLRD 1HKHA 1PZHA 1P3JA 2PXAA 2IHUA 3D6NB 2PR7A 1P1RA 2O20A 3CRZA 1GA6A 4HWTA 3OZIA 4P93A 3B7PA 4XFDA 2NX2A 3VDQA 2IL1A 3QWAA 4XCQA 4B87A 5I8PA 1ZJ6A 2BFOA 4Z3OA 1E1MA 1RI4A 3DV0A 4BFUA 4KO3S 1OWPA 4Q4LA 3H18A 4OI0A 1NW7A 3P9YA 3B6JA 1H0KA 2RBEA 5BOVA 2B9EA 1IONA 1CUZA 4MCJA 5K3SA 4D6PA 5AVVA 1V5FA 3GFPA 2X0JA 4L3VA 5DCYA 3V1UA 4LE0A 4EHNA 3S68A 1I6WA 3VU0A 4JASB 1U8FO 1NN0A 2JATA 3AIOA 3KE9A 4EUEA 5HK8A 2JLQA 4B32A 1G20B 3ME5A 5JPDA 4P6VF 2WMOB 2WNHA 5F73A 3TQCA 1AV7A 1VKOA 5SYAA 1S4MA 3TSYA 3B1ZA 2EZ9A 4JL5A 2G76A 2WHRA 3HFSA 5LA6A 1RXUA 4LJLA 3SQMA 4HWKA 2CDBA 1T5OA 5AI8A 2C2HA 3R6DA 4KK3A 2NW6A 2VDPB 5D3QA 4HNAB 4BO2A 1XGKA 2YZ2A 4DIOA 3P7MA 3F96A 1O94D 2FR8C 5EZSA 4ESOA 3JZMA 2G5PA 4QJ4A 2VCHA 2Q8NA 1TQHA 3KV3O 1H9BA 3IP3A 4LCEA 2M1ZA 4P36A 4P7JA 4K46A 1TECE 2X77A 2J4CA 1K7XB 2C5BA 3IKTA 2AWNA 1YIAA 2GK4A 3AVQA 4MS1A 3TI9A 2EQ5A 1Z63A 2FX3A 1TMOA 1XTTA 3O90A 5A1JA 4BUCA 4EG3A 1R4AA 2XBUA 4DFDA 4UDYX 5AQEA 5C34B 1J39A 3PB3A 4EM6A 1MOSA 2VHWA 3EEYA 2Q45A 2Z6UA 4D2IA 3W1WA 5TB5A 1AKRA 2HHLA 2GFHA 2W11A 4QT0A 3LY8A 5LCXA 1E2HA 1USGA 3MFQA 4RKRA 3R4CA 1I2AA 1R6DA 1OTYA 2ZUBA 3UICA 1UJ4A 3V4VB 2DWOA 1XELA 2IEZA 2D2XA 2G63A 4XPIB 4EHBA 5JS7A 3EWSA 1V9SA 3T3HA 1OXUA 3LDAA 3ZCVA 3QLTA 3WYAA 5BSGA 2SKEA 3FOCA 1W0KA 3U7EB 3VTZA 2P5UA 1AKEA 3I23A 3MT8A 4N41A 4ND8B 5NULA 1KAGA 5BR8B 1Y98A 1ESNA 1T26A 1KTVA 2PTGA 3GLFB 4ALKA 2FMIA 1C9KA 1REQB 4CYMA 1J49A 3CIOA 2DY0A 2PT6A 4AY2A 3WIUA 1SCDA 2X6TA 3G0GA 3K72B 1BS1A 3NTQA 3WV5A 2CFTA 3MJCA 1J23A 1UBLS 4I6JA 3UAGA 2NTVA 3C6YA 2HIAA 1SH7A 3DYBA 4MVJG 2JIZD 3G82C 4DY6A 3FZNA 2VP6A 4INAA 2X9QA 5ENDA 3TGLA 1GSHA 3BA1A 3ND6A 2VA8A 4LDNA 3TEMA 4FMCB 2QUZA 1P6QA 3M6MD 1SHKA 2XOEA 2FOIA 1Z6TA 3RRYA 3FKSA 3TIIA 3BM5A 5A0TA 4BB0A 1L4MA 4RF5A 4L08A 5DGCA 5DHQA 3EIOA 5ALXA 1ZR2A 2PD4A 1G5HA 4UVGA 2Q8QA 1HNZB 3WFIA 1HRDA 1U4NA 3DQZA 3B89A 5AVSA 1ADYA 1TC2A 2FZ5A 1KI9A 2IODA 1BW9A 1N3LA 2QLTA 3PVZA 4XJXA 3G17A 3UUFA 4REQA 1ZMOA 5B64A 5LC1A 3WDMA 6Q21A 1WXQA 2CHFA 2QAIA 5JQGB 2QTNA 2FW7A 3IRUA 2E82A 2X0NA 4GPZA 2X0EA 2JLUA 1K75A 3ABSB 3QU9A 3OMXA 5JHGB 5ULLA 4EH1A 1G6HA 2OZVA 4A8HA 3BWMA 4AIIA 5CDGA 2OHHA 4IIXA 3D8SA 1X7ZB 4LNUB 1E4YA 3MLBA 4A92A 4RSGA 1IQUA 2LXNA 4MV3A 5CDFE 1UMBA 3SI7A 3VR1A 1QSGA 4MUNA 4N1AA 4IEFB 2R0QC 4WESB 2ZTLA 2VHEA 4JWKA 4BN0A 4EZBA 2DR3A 2ZI9A 1KZYC 3BTOA 1GFIA 3KPVA 4V0QA 1ULBA 1GTL1 4XDZA 3WJ1A 5AK3A 4FGLA 2BFFB 4H6PA 3SC4A 3FLAA 2ASVA 2TS1A 1MVNA 4Z99A 4KZKA 3DVAA 2AN9A 4JI1B 4BO5A 4Y9TA 1RMYA 4S0ZA 4GXQA 1D3AA 4JUIA 5T4FA 3ADPA 3SBOA 3VYSB 3W2TA 3IHLA 3C0KA 5EKTA 5IKMA 1NVBA 1GGJA 2CN1A 4QXPA 2LCIA 3DCIA 4N5NA 3R3UA 4FU0A 4MUJA 3EWNA 5L40A 3B7GA 3KYDA 1QXSA 1LX7A 3QBTA 4NEGA 4URFA 3ZBUA 4K9NA 2I65A 2WU1A 4YMVA 2YBDA 2DGDA 2QRQA 3P0HA 5HGXA 3OQVA 4TV9F 1JGTA 3URMA 2A6PA 2OHGA 3BCSA 2CNLA 5JVDF 1NC3A 3HXPA 1SBCA 2C4TA 1Y48E 1J70A 3P9KA 5AVYA 4U7DA 1G5RA 1O4WA 2GOYA 3OCWA 2XMBA 3LKDA 3DH0A 1ODCA 2Q1UA 3NTLA 3EGOA 1EWRA 4QREA 3ZDBA 2I4OA 2J3EA 3W2HA 4AJNA 5HFJA 1W47A 4URUR 5EXSA 3I6QA 4KR2A 3W7BA 2X3YA 4ND2A 1CEEA 1M34E 2WFZA 4Y30A 2NVOA 3WL3A 2HBRA 3VPBA 1KAHA 5BYJA 5FFMA 2B6NA 2XADA 4E46A 4RJTA 1VB5A 1MZVA 4RYLA 4YJFB 4JUAA 4I81A 2Z2IA 3IAHA 4U8HA 4D4MA 5BSKA 4QL3A 3J7AC 1UBMS 1ADJA 1H6DA 3CZ9A 4YGXB 1JDPA 2FFQA 2TSYB 2R6GA 1IUOA 1DT3A 2NU7B 4MVJH 4HS4A 1Y6ZA 2HGZA 2HC9A 2XA9A 3L4SO 3PHIA 3H16A 4ZN6A 4B46A 2QGZA 4COKA 1J21A 1F3LA 2HIGA 3FHTA 3QUTA 2A88A 2H4ZA 1DLIA 3EZFA 1R18A 2XUKA 5K3FB 3ZWBA 4D92A 3NWJA 1K98A 3HN7A 1H0SA 4KO2S 1D4ZA 3KS9A 2Q6IA 4A91A 4H0NA 4D98A 3GAMA 1NG1A 3I9JA 2VKQA 3O95A 3L04A 3P0EA 5BXYA 1C4KA 4DQXA 5LJIA 3ZVKA 3D8UA 2ZIEA 1YL6A 4ZVUA 4NOLA 3TBFA 1Y8RB 4RNDB 2N47A 1X9HA 5ED4A 1ZICA 2WC1A 1Q3TA 2E49A 4GAEA 5H5JA 1FDSA 1TMGE 5DTQA 1AXEA 1NXSA 1VP9A 4P3PA 1KAQA 3VM6A 1T0BA 4YMLA 3T4EA 3RAJA 3RS0A 4YRBA 5AICA 1IDOA 1YJXA 4KNYA 5FNZA 3HV2A 2NUPB 4YAKA 3FWYA 3Q1LA 1DXYA 5HDQA 3L1KA 1CUAA 3DKPA 4B33A 4F45A 4MRSA 2CXUA 4WASA 1ATZA 3P2OA 1BVRA 1HE1C 1NJ5A 3G1TA 3SDBA 2QN9A 4YRPA 4CE6A 3OZGA 3TINA 5A4MS 1TAQA 3PXCX 4FI3F 4PYQA 5L6LB 4M49A 1FE8A 3ROKA 2RI1A 5JY1A 1WY5A 3HJGA 3U0BA 5KVAA 4KFTA 4F9GA 1TEZA 3GN2A 3QVTA 2J5XA 5EUQB 4ARZA 3KJNA 3UXHA 1JB9A 2HA0A 4P58A 3VI4B 4D6YA 2NP6A 5E0KB 3FKQA 5JWOA 1BA3A 1G7SA 3CUTA 1V1MB 4HK4A 4DDWA 4BNDA 2VHYA 3BF8A 5EXDA 5K8TA 1MX9A 4YMIA 2QPAA 1ZGGA 4WOJA 4BMPB 1IL0A 1JT2A 2J45A 5A9TA 3R9IA 3WLOA 2R97A 3E84A 3RUCA 3L8MA 2YFHA 5F5XA 1QZTA 4X7BA 2RD2A 1X2BA 1KFCB 3I05A 4MPTA 2DERA 1R6XA 1IZ7A 1Z3IX 2HV8A 1O96B 2Q28A 4GSKA 3B3FA 3M4JA 2H2DA 3DVSX 1M2NA 4JDPA 3K5PA 2HU8A 4LUCA 3DTNA 3EF0A 4AO7A 4XWKA 3QJYA 1OREA 2CDCA 2MIIA 2QTRA 2Z2YA 4R3WA 4AECA 2ZM5A 2Q4EA 4EA6A 2YWRA 4UTXA 3QIVA 3QVGB 2WNIA 2GX6A 1DAOA 3ABZA 1BGXT 4MPDA 3PFBA 4IQ8A 4TTVA 5KJ1A 1A9OA 2IDZA 3R5JA 4BAZA 5KTYA 2D2EA 3WQRA 2IVZA 3PQ5A 1JYFA 4GQIA 3L7LA 2A1TS 3FVTA 1YS6A 1L2TA 4AAYA 3MS7A 3MELA 3REOA 1UK8A 2QMZA 3ETHA 3GQBA 3KLMX 4H9GA 2Z5LA 4MGZR 2P7IA 4O02B 1Q1AA 3HPQA 2PFSA 5F1KA 5JZVA 2NYAA 1NVUQ 5FR1A 3OJCA 1XOIA 3S40A 1ECGA 1NYRA 1NMEA 1I7PA 3QJ5A 4QXOA 5EE1A 2A3NA 1ENOA 2AFIA 5E2BA 5F1PA 3DXFA 3RH0A 3BAFA 3RRMA 2J0UA 1ZPDA 3SC2B 2NUTA 3F1LA 4V1CA 3MOIA 3PE6A 4CODB 4Z8YA 4BO8A 2CFCA 4Y1RA 4DZRA 2UU9B 1COWD 4XJSA 2Z30A 5JSKA 2ZT8A 1Z6ZA 4OK3A 4XH9B 5FTJA 5ARCA 4G97A 3RRFA 4ZIRB 3UG6A 3U3MA 3FI9A 2ZAGA 1T4DA 3LBFA 2NAPA 4MW4A 1ISPA 3LDGA 3EULA 3LBAA 3OTQA 2CVZA 3RM3A 2FK8A 2WF6A 4LJ6A 4BJHB 5K2OA 4UJ3A 4KYVA 1K6MA 2I4MA 2QP4A 3ONVA 3ZHUA 4L6CA 4CI9A 4U5XA 4TKUA 2Y2UA 1QVVA 5EN4A 4RM2A 3HYRA 3LUDA 2W93A 1TC1A 2P30A 1Z2DA 3GJZA 5EWJA 4GZ5A 2OWEA 4EF6A 1V1JA 4XGRA 4FHFA 3PEYA 4R9SA 4ZI7B 2O8CB 4ZXPA 2P5SA 4KO1S 4LZJA 4BVAA 1U94A 1XZQA 2V55B 3FTNA 5BVHA 1TD1A 1JAHA 2ODAA 2P6UA 2X1MA 2WVGA 3B13B 2C3YA 2PZBA 4WNAB 5AM0A 5HCNA 3HPRA 4NJMA 1GCGA 3SICE 3L1JA 2O2JA 4HTFA 5JAPA 2PUGA 1C3EA 2AMLA 5DLQC 2W22A 2WAXA 5A7HA 4LOAA 4R8VA 4B2IA 1I2DA 3PPXA 2F3SA 4U9UA 1QG2A 1H05A 4IXWA 4JBWA 3UATA 4CPDA 1U9IA 4FVTA 4N65A 4ZIRA 1HNWB 2CHVA 5DEIA 1F6WA 4RF2A 4W7SA 3G5TA 2XQJA 1S1MA 3EIQA 4KX5A 5F4BA 4FMPA 2GEBA 1N7IA 3DFMA 3DFIA 3DWIA 2C4HA 2YZGA 5HOQA 2WSYB 1CZHA 2O0KA 2NQTA 3OG9A 1U0LA 2V5VA 4QAQA 3WWZA 5HRCA 1YU6A 1DEHA 2PQ6A 2YIJA 4X1KB 5E1BA 2ZUEA 4TZ6A 2YXPX 2R47A 3QPVA 1EIWA 2WIAA 2XMQA 2PT9A 5EGNA 4ZVNA 4G9BA 4RFVA 3CH6A 3CNQS 4DZTA 1KA9H 1IEVA 4HNVA 5L7TA 1OXXK 3G8YA 6ADHA 4GOMD 4BLPA 2AXEA 3E58A 3ORYA 5D87A 3PDUA 1LA2A 3Q7TA 3HBFA 1U2ZA 2QK4A 1U9JA 3F7TA 3UN1A 2J41A 2OEPA 2R79A 2XSZD 3T5CA 1V3QE 3PV0A 3I37X 1XAGA 2C9ZA 4B2LA 1KS9A 1J6UA 4EUHA 1RXVA 4Y2SA 2J6HA 2C7RA 3D2BA 1JI0A 2G88A 4JJZA 1PL6A 5HPYB 1QP7A 2DP4E 1CUUA 3IP8A 4OXQA 4K8RB 2ISQA 4U6NA 1FNNA 2GN6A 4IH4A 5DOZA 2W37A 3PQ2A 2C00A 2CJWA 4G1CA 4G5RA 1CUSA 3DEJA 4EJSA 3U60B 4FKBA 5A3SA 2BKUA 1X13A 2VTVA 2X7HA 2PH7A 3M49A 2E4VA 2ZJBA 5AFSA 1KGSA 1V3VA 3DPIA 5TVGA 4FK8A 4BU0A 1O9BA 4M7RA 3WLMA 3IJ5A 4AG5A 5CFZA 5HKKD 1Y1RA 1OW3B 4OK6A 1OZHA 3D8RA 2W9XA 2BJWA 3CS3A 3KQSA 1V5WA 1HH4A 4NULA 3OIFA 4BKOA 4REMA 3DHYA 4OL9A 1G63A 4NDAA 3D5QA 5FUBA 1GUAA 2HY7A 1T9AA 4JKYA 1NWCA 1ZGCA 4HWSA 3REQB 3HWRA 1N6HA 4TVOA 1FDRA 1XRLA 1OWMA 5JMTA 1KR5A 1HLFA 4A2CA 5AM2A 3WHKA 2LCFA 1QYIA 3HN2A 4V0KA 3KEFA 3ONDA 5GP1A 4LXTA 1PVOA 1U0NA 3IOBA 5DYTA 3S8YA 3IEKA 4AMYA 5AIBA 1HDZA 3JZAA 3FUTA 1AH2A 4JT8A 3SQNA 1TFRA 3O93A 2G4LA 2WYOA 1J5PA 2A4KA 4KI0A 4RLFA 3EPRA 2D0OB 2D4HA 5DWVA 2ZJ6A 2F59A 3C5HA 1NRJB 2EL7A 3M6UA 4EDHA 3VR3D 4ZCLA 3T0GA 4AUEA 3ZDXB 4Q9AA 2XMZA 1TIBA 2VYQA 1EWYA 1M73E 2IUEA 2PYZA 5AW2A 5DM0A 1VJTA 4BV3A 3IE1A 1ZDMA 2CMFA 2JGFA 2NM0A 3MJ4A 4G5OA 4PFQA 4DWWA 4A27A 1J90A 4HQOA 4HEJA 1UZMA 5AVZA 1SXQA 3DYVA 3PFCA 1G4UR 3PX3A 3TB6A 1X9GA 1G2QA 1RLJA 2P77A 4G1VA 2Q27A 4G4SO 1KH3A 5L4LA 1RJFA 3IP1A 3B3GA 4QPPA 4JYBA 3G0DA 1F0KA 1EEHA 4JBLA 4Q4DA 4NTZA 2WKWA 1DZIA 1FXSA 1QRAA 2AOTA 1BKYA 3AF0A 1GPBA 3T94A 3TRIA 5HJ7A 4JVOA 1A9RA 5F9HA 1GPYA 3GNQA 5JD6A 1PWEA 1Z5VA 4V2UA 1JU3A 2ZITA 4TT8A 4TXNA 4E5KA 3DLHA 2QM7A 2BTQB 1ORIA 3ZS8A 1SXIA 3DZBA 2BBOA 4MWGA 4FYWA 3JWHA 1QIGA 3DWFA 2HLDD 3L01A 5KTMA 4ND3A 2D1SA 2H1LA 2RK4A 5LQRA 1AZWA 3CPHA 4Y6RA 5BT8A 3GLGB 4OHMA 4EHJA 1RRCA 1KZ1A 4FSDA 3TUIC 3HXOA 2VR1A 4N40A 2HPZA 5E6SB 1UPUA 2BM0A 2MJLA 3AUJB 3C7CB 1QFSA 3HB5X 4JBGA 2XIJA 3H4MA 4RVSA 3D4PA 5A5FA 5JAMA 3OPNA 3U1BA 3B70A 2FWMX 2X7XA 4P5DA 3PYLA 3ZWVA 2M6KA 4OQQA 3IQEA 1P33A 1WABA 5L9AA 1QJ4A 3OF5A 3P0FA 5CVJA 1XVUA 4Q6BA 1ZC4A 2HXSA 3LTNC 4IZIA 1GZSA 3OSUA 1Q0PA 2H4WA 3D1LA 2O59A 3EC2A 1E6UA 1ONNA 1ZA2A 3SQDA 4DR7B 4G1MB 1RHUA 3CNHA 4RH1A 4EHDA 3HDTA 2HWKA 3A4TA 4CI0B 1L7BA 4PF1A 4MROA 1RM4A 1AZTA 3RYCB 3UFXB 1AXRA 3MTQA 4M98A 1WZIA 1SD2A 2ZTMA 3PUKA 4WKOA 5E9JA 3VC1A 1H1LB 3SHTA 3BMCA 3LT2A 4LCJA 1W4AA 2OPHA 3FI0A 1AGYA 3FGOA 4FCCA 7REQA 1N2EA 3DZIA 4KNVA 1N8NA 1U7PA 5FBKA 521PA 3ND8A 4AMVA 1K5GA 1KJ9A 2JZOA 5DM2A 1FYEA 3SYMA 2BYTA 4F56A 1LI7A 1NP7A 1U3TA 2MMGA 1S0UA 3H99A 3LWBA 2A5FA 1DKPA 2O1WA 4G26A 1KAEA 2PUDA 1RLMA 4EF5A 1L4FA 1DI0A 3PUXA 1ZVKA 3CGWA 2UUOA 4HX5A 1UK9A 4KN9S 3GWZA 3FTFA 2V97A 1CQIB 2BHLA 1P3DA 3JWEA 4OMUA 1ESCA 4A3SA 2PQMA 1CF9A 4JJGA 2QIPA 5ALRA 4KP7A 5EIBD 1R7RA 4UTNA 4UCWA 4WTOA 4WESA 2OB1A 1GO2A 3GEBA 3GELA 3H9JA 2DHQA 2GM4A 4PX2A 8ADHA 4LI3X 4WFIA 2NADA 4XWGA 2Z8YM 2IKSA 3E61A 3H0CA 1VI2A 2Q46A 1NQTA 1H6AA 2H0RA 4DRXA 2OFFA 1H4TA 1U63A 2BEJA 1A7JA 1S3IA 5JW6A 5JS6A 4X1IA 1NJ1A 1F7VA 2IHTA 3QX3A 1UKCA 2PJUA 3NIFB 3BFJA 1FFHA 4LE2A 5AK6A 5HRUA 1DAMA 1VXRA 3UWSA 4D41A 1EBFA 3A6LA 4CM8A 1FP2A 1WUJS 1KY2A 4X3CA 4YAEA 1G2PA 1KYIA 5JSFA 3UB3A 2C04A 1NPDA 2IZ7A 3DZKA 4D8VA 1JHUA 3M6IA 4V0LA 3JARB 5A02A 1DUSA 1B14A 4LJ7A 1IOLA 3FUCA 2QVYX 1GUYA 2ERYA 1T6YA 1E0DA 2J9FA 2QT1A 3KQTA 4F2WA 4GKAA 3PGKA 5EQJB 1TOAA 3HA5A 4K88A 3KP1A 3GU3A 4M8IA 4OQNA 4R8RA 3HK2A 1V5EA 5J2UA 2QN8A 4TTAA 4QQ8A 3G8CA 4YJ2F 5CLGA 3NVDA 3L0BA 121PA 2R60A 3KZKA 2PJZA 1EXNA 3A6KA 4NABA 4O8CA 4PLGA 3EW7A 1ZN7A 3LQQA 1MC5A 4J4TA 5K0NA 2Q5FA 3C5WP 5G3ZA 1SKYE 1L5OA 3PXAA 3UUWA 5KKCA 4DBLC 4EP1A 2W6ZA 1H23A 3LPCA 1F17A 1XYGA 4P54A 2D62A 4BV8A 5CFQA 1UP7A 2NXNA 2ORED 4G2NA 2ETVA 3TOXA 1NN3A 2OOSA 3O2QB 3I8OA 1S4QA 5CCDA 1YQ9A 2Q6VA 5KYNA 1ZIOA 4ZPJA 1MG5A 4CRWB 1CC1S 1YMVA 4WOCA 1JQLB 4YCCA 4WD3A 1P1BA 2ZI6A 3H2SA 1WUIS 1U3CA 3R0VA 2QLBA 4C7XA 2Q1TA 3BMOA 1OZGA 1U3VA 2I7DA 3AR5A 3MA0A 4PQYA 3F49S 2DLDA 2ATXA 3AETB 1WXIA 3M89A 5FNVA 2FP4A 3ZX5A 5KINB 2Q0HA 3CG4A 4WVFA 1P4SA 1L3IA 1E3JA 2CSXA 1N2HA 1N92A 2IYSA 4OQPA 1N2JA 2SBTA 3V97A 1ZNXA 2FQWA 3BRWA 3IPYA 3O21A 1GLVA 2QUKA 4TL6A 3VOAA 3R0IA 3HFJA 4RE6A 3KUUA 3WKEA 2YINC 4J9UE 3OQNA 4JXJA 4MDHA 3IR7A 1PZNA 3DHNA 4G24A 1QO9A 4CM9A 1QHHB 5B36A 1XDGA 1VTKA 1N7JA 4M1YA 4NH4A 4D1YA 1KWGA 2DF8A 1OV4A 3D6AA 5G1PA 4CM8B 3ZJTA 2C5LA 1QYXA 3E1GA 4MUHA 3W90A 2BI7A 5EL0A 3G8BA 5T5QA 4BFYA 3IV9A 1YRLA 4DN6A 1YVRA 2BTEA 4EIWA 3E3NA 4RVGA 4U2CA 1N0VC 1W9MA 5B3JC 3UJNA 4C0QC 4Y2JA 2H07A 1X70A 1P31A 1WMBA 3OJ0A 1MHTA 4GSYA 1TPZA 2B1RA 4LTNA 2J08A 4MLPA 3EFBA 5I7FA 4KPYA 3TTVA 2RHWA 4DKXA 1A82A 3CZ5A 2OHXA 4CT5A 3R0XA 2B4TO 3DVAB 1MQ8B 1Y4AE 1Y3CE 1WL8A 4BTLA 4TT3A 2VNAA 1P29A 2O1EA 4QBIA 2WUGA 1ZC3A 3NC1C 1X38A 4MUGA 4H1WA 4ENUA 1OZ0A 3T7TA 2GHRA 1V95A 3EVDA 3ZE9A 3CLSD 3ZJYA 2VP5A 2TMGA 3BWEA 5TPWA 4XD2A 3HRIA 4Q00A 4OIMA 1UWVA 3EG5A 5E9WA 4WFJA 4RD2A 4F72A 2D0IA 1TZ2A 4FR0A 3BMCB 2QJTA 1BDMA 3DBRA 2XLCA 4QATA 1VA4A 2FZKA 4YB8A 3VX3A 4BLWA 1G16A 3HDJA 3O83A 4KQ1A 4QWMA 1X7HA 1VLMA 1U1EA 1KYWA 5HM6A 4CQNA 1OX4B 2FSIA 1ORDA 3N2NA 2XTJA 2Y0BA 3AU8A 3V8EA 1IQPA 3WBKA 5SICE 4YJ3B 5C4IA 1YAHA 5LXTB 4N76A 4CQLA 1PIWA 1VHDA 4LNHA 3SJCA 3H97A 2WTEA 3SBDA 1NUSA 4YRGA 1JQ5A 1UOEA 5F7ZA 1X6VA 2FZCA 2BKVA 1JHYA 1EU1A 1TJ5A 3IIEA 2EW1A 3O26A 2QYHA 5IVKA 3KT6A 3NQ41 4MWSA 1TKAA 4JLPA 4RX1A 3ASZA 1UKYA 2UAGA 1IJFA 2A4MA 4M1SA 4UCXA 4EGFA 5HQ3B 2G06A 3K6KA 4C0LA 5TS3A 1W59A 1Z2PX 3I04M 5ALDA 1G19A 1PK9A 4YIKA 1ND6A 2AF4C 3LE8A 4R7TA 1U2GA 1VP3A 2PVSA 1UQRA 2H1SA 2OC9A 3H2BA 1O97D 2JZNA 3N76A 5B58T 1EVEA 3ZTWA 4PGGA 4AZ3B 2RGEA 4X90A 2XA2A 1HURA 2F3UA 2M32A 3I39X 3M34A 2NZYA 3VMFA 1YZLA 3BSFA 4WNCA 2RGWA 3K8YA 4JENA 1D4OA 3U49A 1IM2A 1BFUA 2OUKA 1BC5A 2ZDGA 1YHNA 5K0JA 1SCUB 1XN1A 1EFPB 1JA1A 2VDNB 3HCNA 3PDHA 3H9UA 4W9NC 4KMSA 5AOBA 3WZMA 3UJAA 2XUFA 5F12A 2YWEA 1U0EA 5H59A 3W4JA 4ZRDA 1G60A 2YMPA 1E2LA 4D4IA 4YV7A 2MYTA 2ODQA 1NSTA 3SX2A 1YGYA 1A9SA 1EK2A 2FWBA 1T3HA 1YR7A 2H54A 2J5RA 3DCNA 4ARVA 5IHXA 3DJFA 2VIIA 4DEVA 2ZRMA 1O3YA 2O1XA 3ECCA 3AJAA 1QV7A 2PHZA 2R1TB 3CUUA 1YS1X 4Q7MB 4HNSA 1TVEA 4ZO6A 5IDYA 4YNBA 2DJ5A 5L3ZA 1NQVA 4KE9A 3NDRA 1Y1KE 4FFRA 1R66A 4FFWA 4JL6A 2YNMA 2EBFX 2W2VA 3NNDA 4ZQBA 3UWMA 4CIDA 1XWFA 3KKKA 2FPRA 3OWHA 4HKTA 3GPBA 3PYXA 5A9SA 4MS1B 4TRJA 4XVUA 1V35A 3QE3A 2C5HA 1RSZA 4XWAA 3A9RA 4HDCA 3TQRA 3HA2A 4CCYA 1LC3A 1E3WB 3OEED 1X8KA 3NASA 1D2GA 3OZBA 1ZNWA 3Q5GA 4NX2A 5KYUA 3IDQA 2PD3A 3BCUA 1WB9A 1WBDA 3BMNA 1PQYA 4OMDA 2A58A 2GK3A 2TRSB 5HCIA 3WL6A 4DDUA 2ISSD 2RHLA 1TA0A 2AS0A 1U0FA 3PHBE 3TLGA 2YASA 1WDKA 4I1YA 3P9ZA 4DMUB 4GEGA 2ON6A 4BMVA 4EJ2A 4RW0A 3C7TA 1UODA 1UT5A 2J85A 4RFSB 2XYGA 3W8RA 2VO1A 4DHWA 2FZGA 3STHA 2C0PA 1ICIA 1ZZGA 4G63A 1I5RA 2ZSKA 3ENKA 2VLBA 5KNDD 2ZVJA 3BCRA 1OE0A 1P8JA 1ZGBA 1E18A 5EP2A 1FY2A 1AA6A 4UE3S 4U7JA 2PRYA 3WISA 4RD4A 4TXMA 3N8GA 1X19A 3A10A 1TDJA 4HEA6 4ZI3A 5KJCA 3RVLA 4TWIA 3AZPA 3L4BC 2AN5A 3HXMA 4EABA 1A95A 1OBFO 3BK7A 3S1LA 2QLLA 4YO8A 4F4UA 5SZJA 3QX9A 4YAWA 4ZD6A 4QOGA 3DM9B 1TZCA 3OA2A 3NIDB 3KOUA 2QL5A 3K4HA 4NWIA 3RUIA 2VNSA 4NCXA 1ODKA 3RFXA 1JP7A 1UZLA 1N5RA 5TF4A 3G2HA 3QX8A 2GHQA 3Q2KA 1SWWA 1MAWA 3DMTA 4N18A 3DA8A 3NLLA 5IAAA 4JYAB 1MO6A 1PGNA 3WMGA 2RDMA 1DS6A 2EEZA 2EGHA 1E63A 2W98A 3GMTA 1XE3A 3JD2A 4HWGA 4U4AA 1YFJA 2BGWA 5EHZA 3EX7C 1TEVA 3SQXA 4QELA 3CH4B 1QQTA 1VL6A 2Z3ZA 3QBJA 1DEOA 4HZIA 3DAYA 3DV2A 3K31A 2ZRBA 2HPVA 3QVSA 5C5IA 3QG1A 3RKUA 2B83A 1Y6RA 4JQCA 2EZ8A 4JIMA 4MAMA 4LOKA 1FMJA 3E18A 4ZFNA 3EG9A 2Z6VA 1FIUA 2WYIA 1P44A 4TTTS 5CHEA 3A3PA 2A1UB 1FX0A 4EHHA 4ZDJA 3LMKA 2P1DA 3VV3A 1DEKA 3EXEB 5DW0A 4LHXA 1RLIA 4MW5A 5FWYA 4QA9A 1RRKA 2ZWVA 2KS6A 4TT3D 4L9WA 2ZSBA 1XNGA 3UMMA 4GDFA 2E0IA 4LJ4A 2J31A 5CITA 1OH7A 2VNHA 4F3KA 2BMJA 3PFKA 4AKTA 1E69A 1KARA 3TXAA 3VPAA 4MB2A 3GGDA 4D9CA 4ZQIA 4IS3A 3U7QB 1ESZA 1Q1QA 5CB0A 2OD2A 3D54D 4M1EA 2XGGA 3ETEA 4R9UC 1TF7A 3BK2A 3WZLA 3KUKA 2JIBA 2HK9A 4LGVA 4E4YA 2Q7DA 4C88A 5LBIA 3B1YA 3AY3A 4R1TA 3SF8B 1PX2A 3I42A 4DLTA 1K7SN 3RNLA 1P0IA 1XZEA 1QOQB 3D4IA 4J0DA 3GLIA 3K09C 4M2LA 4YJDA 3RYIB 2P9BA 5JHHB 2XQIA 4RJIA 3EZXA 2FPMA 1ZJJA 1U0BB 1T8PA 2BMAA 1GL9B 2AE1A 2XVXA 3IPRA 2FSVC 2PQ2A 3OQHA 5B3KA 5ALUA 1BE0A 4ZU3A 5I7AA 3Q9NA 3AG5A 2AC2A 2RGXA 2L0XA 2OMEA 4LC9A 4ALLA 2GAOA 2Q3FA 1W4RA 3ODPA 4D9FA 1KZ6A 1EG2A 2PNJA 4Z7NB 5CB4F 3GNTA 4BXOA 3T5TA 3FOFC 4K6GA 2V0GA 1G6KA 1UEIA 4G23A 4R05A 1QRRA 3MTJA 5LNK1 1RCFA 1KS2A 4ZOLA 1AV6A 1QCDA 1XKLA 1ZXBA 4R98A 2DFPA 5JYBA 1W4ZA 3Q10A 5DLEA 4K9MA 4B3FX 2FWNA 4IQGA 3U56A 1X2EA 1DBVO 2ZKIA 1D4AA 4MQEB 5AK5A 1Z7GA 2YVQA 2Z3VA 2ZRKA 4CEJB 3A4YA 2FFHA 1HETA 2QS9A 1IXSB 1ZSNA 3C48A 2BUCA 4B8WA 4ZMSA 2B8JA 3FHJA 3KTFA 4L8LA 4CMEA 4UM5A 1RM5A 2H8KA 3JZDA 4LNAA 4ILEA 3ZZNA 4DNXA 1RVDA 1MW8X 1QE0A 4GRDA 5CDUA 2EIXA 1MA3A 1LJ8A 2L42A 3K9QO 4JCOA 3D0QA 4XM0A 3LCCA 3PXBA 1Q84A 4AC9A 3EW9A 1PEDA 2EFDB 3ASVA 2XZTA 4KXYA 3EA5A 3WGGA 1JIQA 1GNPA 3ZN2A 3AWDA 1FYDA 1Z2NX 2C2BA 5H82A 4E09A 5KQPA 1XCLA 1TYZA 4X92A 5D5PA 1STOA 2NU9A 5I7OA 1VPEA 2PO7A 5K8VA 4KW7A 3TMKA 4FSXA 4AUMA 1IY9A 4KSYA 3PJEA 5JI2E 1XMQB 2I6XA 5TEVA 1E9RA 1O77A 2OK7A 1LPBB 1FDOA 2IPAB 5FI0B 1I3MA 2P8JA 4J7AA 4TMFA 2ZRJA 3S0JA 3NFRA 3OU7A 3W2GA 4DAEA 3BREA 4Q3BA 4JKOA 3VJKA 3KWLA 4YQZA 3BD6A 3JX9A 3ECAA 3O73A 4GZ3A 4NLLA 3DOFA 4HNGA 1XDBA 1SVOA 4KPUB 4B7ZA 4F3RA 1WBBA 4KH0A 1WO8A 4LK2A 1JLKA 2R11A 1IM5A 3TK1A 4AJ4A 3QLJA 1PI3A 4W1RA 3UW3A 1VKRA 3U4DA 2HGSA 4MP3A 2BONA 2XKJE 3LHDA 4MULA 1D5CA 5SY4A 3W4KA 2W42A 1R0LA 1XT6A 3GDHA 1MBZA 4TV8A 5HOEA 2XKKA 1R9NA 1ORWA 3H9BA 1GRRA 1SQFA 1Z4MA 2Z9DA 1MRZA 1TO2E 2AR7A 3PRJA 3ZQ4A 2ZJ5A 5KI6A 3VNBA 5LU9A 1YCHA 3TI7A 1F2UB 3PKIA 5EXEA 4ID9A 1IWPB 3D1VA 5FD8A 3WLLA 5ADWA 4FFBA 4JEMA 3RS5A 4XM2A 5EMLA 1GKKA 2DB3A 1SAYA 2DWQA 1JV2B 3DSRA 4WLEA 4BMZA 1E2JA 4TM8A 1ZD5A 1U8ZA 2HK6A 3Q7EA 3CVUA 4OX9B 4RPJA 2Q62A 4EB0A 2G9RA 4RPCA 3FDXA 4MUAA 1YQQA 1LWNA 1Z35A 4UQPA 3QE9Y 3AUFA 3MM4A 1L8XA 4QOIA 1Z0IA 2WQ6A 3HLYA 3LA6A 4PYJA 4EATA 3QVLA 3UJHA 2ZSHA 2OP1A 3UV3A 4I3GA 4BP1A 1HNXB 3SBEA 3LRPA 4Q3EA 4RTNA 2LTAA 1V26A 1DBRA 1SUPA 3DHVA 1K2VN 3D7NA 3L6OO 4HQNA 4TKLA 5BRNA 2RCYA 4QTYA 5KBYA 1GJRA 2KQUA 3N2GB 3FSGD 5M2QA 2CCJA 2H5IA 4R4JA 4HV4A 5DNCA 5KWIA 1E2QA 2HJSA 1E2EA 2Y68A 4AY3A 2BGLA 2Q6OA 5B1DA 5LQMA 2OQIA 4B6EA 4EO4A 4DOMA 3TD6A 1E77A 4YEDA 2GMWA 3P9IA 1UFVA 4UNPA 2WD7A 3I9MA 2P2LA 3T4UA 4RTJA 3HRKA 3VX4A 1WOMA 2HTFA 2B3TA 4BQSA 3AEQB 4KN8A 4M3NA 4BVJA 4DL9A 3DZJA 1OLUA 3QVJA 4O4LB 1UBHS 3IV7A 1KMHA 3DXYA 3KFLA 5BSHA 3V5NA 3AB7A 5J40A 3RODA 3U40A 4DPKA 1DJMA 4D8XA 4PCAA 4D3XA 2XVYA 2R1ZA 1ISGA 1CF2O 1YMQA 2D8AA 1LXCA 2AR0A 2BFMA 2X8BA 3RQSA 3UMGA 5ICMA 1N9GA 5F9MA 1L7NA 1GL3A 1R1DA 2TYSB 4PU0A 2V9ZA 2WMNB 3GFVA 4BTEA 5U9CA 2NXEA 1I9GA 5HW0A 4AUNA 2JCSA 4HDNB 1OGIA 1F6DA 4Q0MA 2EATA 5JDCA 3GVIA 4DV4B 3WRXA 3DNMA 4OXXA 3M4ZA 3BEDA 4B3SB 4L0MA 4AXXA 4BASA 1K5PA 3K15A 5AIAA 2Z9CA 1AQIA 4J3NA 1ODSA 3GJQA 5LM3A 3JR3A 4MCAA 5C51B 2ECQA 1WE2A 1Y5IA 2DMRA 4O59O 1GTSA 3E27A 2EBWA 4MLDA 3N2KB 2BR5A 4CTKA 1NR5A 3DEAA 2A59A 3DAGA 4UFNA 3LX6A 2CV0A 3T4PA 4XOUA 2V4UA 1IB6A 3O31A 4QNRA 4XZ3A 3V33A 1OF1A 3FRJA 8GPBA 3FZEA 5JSYA 3VVMA 3SJBA 3BGVA 4IHJB 4LQDA 3WKCA 1EGMB 3CR3C 4CR6A 3REFA 4PO3X 1P9LA 1VIAA 2BR3A 2ASEA 3QWHA 4RETA 4YLEA 621PA 2EFJA 5JCOA 4BQEA 1LZLA 2H2IA 3O38A 4CEHB 4JB2A 1CUJA 1SOAA 3A6JA 3BHIA 3FWPA 3IELA 3KDPA 4QOFA 5C1PA 1L7XA 4QVGA 1GZUA 2C99A 1KO5A 2C2WA 4G1FA 1NW4A 2IHYA 4J7XA 1XV5A 3WBJA 2AEJA 1KL7A 1CULC 2EU8A 3H1EA 5E95A 2XYQA 3SYTA 4BKUA 1OC2A 2CL6X 3ZIDA 1W76A 3D4BA 3DM5A 1IUNA 1N34B 4MW6A 1C9NA 1MFPA 3GYBA 3LO5A 4K6KA 4QQKA 4RSMA 3ZE0B 1QF9A 3FOAA 1MLDA 1R4NB 1NBOA 5KQGA 2O8EA 3ZY5A 5EWMA 1AGXA 1Z73A 2PVCA 2N3ZA 1JHVA 2GJSA 4RL6A 4UHEA 4EY4A 5IJ9A 5KNCD 5G0TA 1KVTA 2BEVA 3F3MA 4XDHA 4LI0A 3SZMA 3GI1A 3G2QA 2HJGA 1T2NA 1A2KC 5LUAA 2V6GA 4F7WA 3F3SA 2JDIA 4F85A 2HDOA 1ZD9A 4EBBA 4DMMA 2P4SA 1EHIA 2POCA 4F6CA 4TSFA 2XRFA 1OWLA 3LUCA 1DCTA 5KX5B 1ZL2A 1PS8A 4MRMA 3Q6MA 3PGJA 4DBLE 1L4YA 5HTOA 1RJDA 1E58A 2MR5A 4NF2A 1KEEB 4JLBA 5GWXA 1T6ZA 3NP7A 1GNLA 1GT6A 3M1YA 3I3SR 4XIJA 2GVDC 3ASYA 4W1QA 4MMZB 1AQJA 1JWLA 3CW8X 2BF7A 5DM1A 3GGCA 1ULAA 4DSOA 2ZB8A 2I2WA 4WK4B 4BX2A 3VOBA 5INTA 3LBNA 3CTMA 3QYPA 4I9FA 3TYXA 1VYTA 4CL2A 1N3BA 1X7XA 4YVFA 4ARAA 1C8LA 3TAHA 4GYWA 4ZVKA 1OZAA 1PL0A 1PZFA 1PJCA 1RHJA 2FMUA 3HVUA 3MEQA 4HLUC 1R2QA 4RF4A 3UW1A 4E1BA 2X58A 3ICWA 5HF5A 3P9QA 4AT1A 4Z51A 2VZ8A 1XZIA 2A92A 2Y6VA 5J1TB 5D3ZA 1NTRA 1FYVA 1A5AB 3OLWA 4X65B 2VCEA 3SQLA 2HCBA 4IFTA 1W5SA 3C3AA 1GR0A 2VUIB 4ZCPA 2IYEA 3GVCA 5EMMA 3SYRA 4YRIA 3LD9A 3PNSA 5AVXA 3RVJA 3K70D 2WIBA 5COQA 5EFZA 5EE9A 3WIOA 4ZRMA 2DPGA 3D64A 5FXMA 3WNCA 3BE5A 1KKUA 4G6ZA 4PX3A 4YPFA 3NBQA 4Y3UA 4D8UA 1WETA 5TMEA 1JHDA 4R2XA 1YRQA 3U2QA 3I45A 2HEIA 2ZIZA 1KIFA 3RIYA 5GZ1A 3DL7A 4TXJA 1V0JA 4F38A 2IPXA 1E3WA 3MTBA 1MOQA 1N2SA 1ZVQA 5JNWA 2C95A 3C6BA 5IKXA 3I5AA 1MXFA 4N8DA 5DVZA 2ZSIA 4BMDA 4CHGA 3ZYZA 1R0WA 5C5EA 2RH8A 1FJXA 3FYTA 2ZR8A 2JGDA 2J3IA 2TECE 3OE7A 3C8HA 4HI0E 4KHPB 2C31A 2W2MA 5BSMA 2PMKA 3IULA 1YBHA 1W5BA 2IPOA 5IUKC 1IVSA 4TWBA 4NXNB 1ZYUA 3NMUF 3FBTA 1BOOA 2I1QA 1B73A 2NUPA 1PFGA 1NQOA 2P68A 2Y0CA 4P98A 4DCOA 5IBCA 4DMFA 5E3JA 4KU4A 5EERA 4BWVA 5AWFC 2HDWA 5BOSA 3NC0C 3KKQA 3N0WA 4PX9A 2AD5A 3WL7A 2C94A 4GU5A 4RDHA 4RDXA 3JD4A 5DX0A 1C7FA 1DFHA 1NW5A 1Y8RA 2PMCA 2R8ZA 1NFQA 4O4JA 4BQPA 2V7UA 2GZ1A 4P31A 2HJRA 4N0EA 1A8IA 1SMKA 4PPQA 1ZIYA 2ZVQX 4LJKA 3CNEA 1HEYA 3LSYA 4NNOA 4PR0A 1VE9A 3JYPA 3ISTA 3TPZA 1G2IA 1N77A 3M6LA 3SVLA 1XVTA 1CY1A 1VJ0A 4OKSA 2VNKA 3WK5A 1T1JA 4BX3A 4GMGA 2PWYA 4X85A 2DHCA 3L49A 1FVXA 4J2HA 4XEUA 3K3PA 4ALNA 3FNIA 5HF6A 1GADO 3AEUA 5F9FA 1EH5A 5EP1A 3SSOA 3ZU3A 5L3SA 1JE1A 3L8FA 5TGDA 1HT2E 1Z0ZA 3THWA 4R0MA 1PJAA 3DE7X 2GEFA 3DV0B 1X7ZA 3KM0A 4L75A 4O0MA 2VK8A 4U3JA 1ABBA 2J9FB 4HSEA 4Y2TA 4AN1A 1HOTA 4KQHA 1K68A 1A69A 3SDSA 4OPMA 2ZETA 3UQYS 3QHPA 2ZUCA 4EKGA 4Q1VA 1J09A 1FRQA 1Y6JA 2XRMA 1M6VA 5B57C 1EWVA 5E3IA 5HZMA 3G9XA 4J2TA 3KUDA 2ONJA 1GRNA 5F4ZA 4DQKA 1U7UA 4ZTUB 2EXXA 3VU9A 4P5EA 4KVZA 3WLQA 3DGFC 2VHUA 1OLSB 1NI4B 4D82A 1W49A 2VXYA 1B8PA 1QG4A 2J46A 2WT4A 4WKCA 3ZR4B 3EIWA 3TOZA 3QVWA 1CP2A 1KMQA 2GYWA 4FWBA 1J5EB 4Q9NA 4JSRA 5G3YA 1QDUA 2HMWA 3TLAA 1T1EA 1V4NA 1S8FA 2M1XA 1Z8HA 1GZ6A 1GTG1 3T15A 4YUXA 2A94A 4KQMA 3RTGA 2C9BA 4FYHA 2C84A 3OIDA 4HP8A 4MIOA 4I5GA 3WP1B 3WVNA 1AF7A 2XUIA 3L5OA 1S96A 3OOJA 4Q02A 5FPHA 2ONKA 4YR9A 3LYUA 4JAVC 1U8AA 4L8WB 4RWEA 3RARA 3WB9A 4Z4FA 4H77A 4DA9A 3OPYB 1KI8A 4AS2A 3NEJA 2ZB4A 4PGFA 2MU1A 4PLPA 1REQA 1JJAA 1TK9A 3PPWA 3IDSA 5L7WA 2ARKA 1BDJA 4G2TA 4TZ0A 2GJ4A 3K09A 1Z22A 5FPTA 5JBIA 2X40A 4ZU6X 4ATNA 4W5NA 4DG9A 5JAQA 4UZFA 3M5CA 5EI5A 1TYAE 5CLIA 1M6WA 4WCFA 2XX3A 4MDFA 4D45A 1QYCA 2PWBA 1OLSA 3PSAA 1AMNA 4LBWA 1DT5A 4IPTA 2D1QA 4CETA 16PKA 1U90A 4TYYA 4RXMA 4XOIA 4ZOCA 1X1RA 2APJA 2P75A 1DJOA 5JRJA 1XQ6A 1P8AA 3BAZA 5CTAA 1D03A 3MS2A 4AMUA 1ZKDA 4C03A 2HX1A 3VC2A 2WEKA 4HADA 2GGSA 3C3MA 2C0QA 4MKFA 1NN1A 3OMLA 3EODA 5DYNA 4OKNA 3NEPX 4PFJA 5K09A 5I51A 2YN0A 1I0ZA 1KQPA 3O6VA 4Q34A 1W1UA 1XZGA 3NGLA 1GQRA 4GC9A 4TMZA 3UMJA 4Z4CA 4C14A 2XRZA 1RCTE 3F2IA 3EXFB 3S99A 2IHVA 4DV3B 1ISRA 4G3XA 4KOAA 1O95A 2XXBA 3KR0A 4B0PA 3FH0A 1SU6A 5EUCA 1QYRA 2HT6A 1QTNA 4MS3B 4E03A 1P7ZA 2HWUA 4MGEA 4Y98A 5GV7A 3VR3A 1EUYA 5A06A 3CR8A 3M6FA 3OLQA 5MN4A 1BHQ1 4W5TA 1U28A 5H68A 3WHLA 3CLTD 1T5SA 4CLOB 2G1AA 4OHUA 3PGA1 3CA8A 4JODA 4P5PA 4IUDS 2XVMA 2WPDA 3FRIA 9ABPA 3T5BA 1PDWA 3EYWA 4P4NA 2IV7A 1EB9A 3DP9A 4PQFA 4HZUA 3OX3A 3OCUA 4A8JA 3QX7A 2XAUA 2NSJA 3I8SA 2JK1A 4XIFA 3MMPA 2E89A 4QARA 4DLVA 3OCJA 5KTNA 4H60A 1XKTA 4H7JA 3ZLVA 2HLHA 1YWGO 4F91B 5DXAA 4JX9A 1YXMA 2P2YA 1GPUA 4FE3A 1GTMA 4OATA 4P3OA 4P9NA 4Q1CA 4W6QA 3IQHX 2Y6UA 2IV3A 1JDUA 1U7DA 3C8DA 1EZZA 1EVKA 3EGWA 1NOIA 4NR0A 4R8KA 5AKHA 2PZAA 5CB4A 3R0JA 4LXUA 2PU5A 4CKEB 2H3HA 4ZOQI 4ZCQA 1GV0A 2V96A 2WB4A 1NXPA 2AI2A 5E9QA 3GOQA 3RUDA 3QPDA 4PW0A 2PRSA 3BL5A 3K0KA 2X42A 3AEXA 3HB4X 3ER6A 3IVRA 1AO3A 2WYVA 2ZQZA 5TJ9A 1X15A 3D0KA 2B8TA 4BC0A 4FE4A 3D7RA 3PD7A 3IEUA 2LNDA 2G9UA 4OJTA 5EJGA 3WNVA 2P35A 2W8BB 3QTBA 1LQUA 1WZCA 2SCUA 3Q88A 3R5XA 4RZ2A 2ZJYA 1C80A 4K6FA 4BIIA 5ES3A 3NBKA 4RELA 1QGYA 1JDNA 1CNFA 2AG6A 2R6FA 1ZSVA 2D6FA 2PCJA 2NNLD 3BB4A 3GDGA 3Q8WA 5AKLA 4AKSA 4TQUS 1SCBA 2J4DA 1WV1A 3ZCTA 3FRHA 5BSVA 1G3MA 2J8ZA 5C32A 4KR9A 1W6RA 2QW8A 3BXGA 5EKDA 2BM9A 3WBFA 3QG5A 2ZUSA 3MGKA 2YRXA 4LZZA 4R7GA 5BYKA 5KYXA 3MYRA 2ZM6B 4PHGA 5MGNA 4YJGA 1DUVG 3PPVA 4ML3A 5AXBA 5KDLA 1GEEA 1YZ3A 2QVGA 3PGXA 4XUGB 4ZVLA 1CY6A 1DJNA 1D8AA 1K86A 3GO4A 1KJ8A 2VA9A 1G4AE 1FJ2A 3HDHA 3MJTA 4AL4A 4KYUA 4ISCA 3PCTA 1VL0A 1U6IA 5IPFA 3L18A 3L7JA 4P08A 1QH8B 3E3MA 5TE9A 3ZV4A 4ER0A 3CUWA 5HVNA 2J48A 2I4RA 2QTWB 3KR9A 1KE2A 3TDNA 4OQZA 1WVIA 1SVMA 1ODFA 1XEWX 5GQSA 4DLZA 2OO3A 4LSGA 1XYYA 4IH9A 4MLCA 2ZVDA 4A26A 4W9NA 1HMYA 2QVLA 2GYYA 3IOYA 4IMJB 3DMRA 1N57A 1GYQA 3OO0A 1C4WA 1OFVA 4YHHB 3CINA 1V5IA 5JC8A 1A5BB 1D2EA 5H9VA 1GCUA 1Z39A 3LGXA 4KYTA 4LXXA 3BZWA 2RG7A 3F6CA 2VRCD 3ZUGA 1PGOA 2ACKA 1E2GA 4J7UA 2YL2A 2OV3A 2E3JA 1AK2A 2A2ZA 1RXSA 2RSLA 2J30A 1B2RA 2BRUC 5EINA 1MXHA 2WA1A 4OP3A 3AI1A 3MTIA 2DKNA 3NXSA 4B4WA 4D4HA 1H9AA 2RIRA 3NFYA 4DYVA 2ZE7A 2DHEA 4JT2A 4RH0A 4IHAA 4V0SA 5IC4A 1GZDA 5H80A 4Q3AA 1MDBA 1AU9A 3JWPA 3K9CA 2O54A 1MB2A 2HRQA 4IQ0A 2Q1WA 4XUDA 2O07A 2ZJ8A 3KPUA 4IEEA 4MTCA 5E6SA 3PWZA 4YQFA 2VQEB 3K1AA 3OECA 3JYLA 3TTUA 1JPJA 1EM6A 1LQTA 3ADOA 1M33A 3I76A 3P5BA 4ZVTA 3GW8A 3RUHA 3V4LA 4LDJA 3DOEA 4D3ZA 5K6AC 3T5AA 3ZLJA 4FW9A 3QXCA 1VLLA 1YQXA 2MSKA 4IG4A 5BWLA 4NBRA 4Q3NA 4OV6B 5IWAB 1YC5A 2IYVA 3OZEA 3UGKA 2BTQA 1PFQA 2GM5A 4AZTA 2C2ZA 1IOWA 3IQGX 5FWAA 1TQ4A 4UD2A 3IIMA 2ZK7A 5IFLA 3R24A 2DU8A 3HVJA 3HWWA 5FBLB 4EZEA 2I54A 5D01A 4BRUA 3N70A 3PQDA 1YQGA 3V9PA 4JP1A 3AL0C 3QF7A 3EQ7A 1F8GA 1PG2A 2A8YA 4H6WA 4Q05A 4S04A 3GEDA 1HDOA 2HCRA 2CLIB 2YRWA 3PUVA 3GFBA 3OFJA 2CNBA 2YMQA 1O58A 1RQ7A 4NSNA 4BZWA 2R87A 4BBZA 4CCWA 1O96A 4L4ZA 1OV6A 2HQBA 4M99A 4WZAB 4G86A 1G20E 3CBGA 3STTA 4J49A 1DQZA 3AVPA 1W6UA 4QPJC 4UQLA 5EC8A 4DR4B 2IHBA 1T1IA 3E5MA 3IERA 3TLZA 5ALOA 4IJQA 4J90A 4NS1A 3KETA 3GRYA 1GZ4A 4Y1RB 3IBYA 4I7EA 2AK3A 4Z4QA 4NOKA 1G7RA 1GZ3A 4TKVA 3SSNA 2NUTB 2ZYWX 3NAGA 3BIXA 4MIEA 4RCZA 2AR9A 1BE8A 3LWZA 4MRAA 4RO0A 4KWHA 3WLTA 5DN6A 4N3AA 3H2GA 4MQMA 5D3KA 5FUMA 2QU7A 1QV6A 2H1IA 5HHTA 1T6NA 3PICA 2FRDA 1IXZA 3OQ6A 1EZ4A 1YHZA 2REXB 1EP1B 4LPSA 1TTHA 2P3OA 3F7MA 3H1AA 3DEHA 5HQJA 4GW3A 4I50B 2BMWA 4PX5A 5CK4A 3SIXA 3GF4A 2HFJA 4LJ9A 3UJ7A 1POWA 1S6YA 2VHXA 3KKLA 4Z7OB 1RYZA 4L78A 1MO3A 5TT0A 3H9EO 5ENZA 1PJ3A 2OBBA 3E22A 4RKYA 5AJZA 4G56A 4B3DA 2GJKA 3QVKA 3V1TC 1JH9A 1PGJA 1YOVA 4U6SA 1AQNA 3UGJA 1NVMB 2NZ2A 5IK2A 4DY4A 2VRCA 3C4VA 1L5SA 1I51A 4YI3A 1TM7E 1UKEA 2YWGA 2HR1A 5DGDA 4KHZA 2WUFA 4J6FA 4UQOA 4ZZ2A 4E0BA 5JO9A 4G65A 3WSVA 1G291 4ZZ3A 2DQ4A 3PXUA 4M88A 3E2MA 5PNTA 5HF8A 3TNDA 3D7LA 1HDGO 5BYAA 3COVA 3JYOA 1QH1A 4EELA 3I9KA 4O33A 1OWNA 1J2YA 2Q9UA 4JVSB 2ZYGA 3OZDA 3PUYA 3NHZA 1Q50A 4MWCA 1W0JD 1NT2A 1UDRA 4QTUB 3JQFA 1T35A 4E7OA 1MTOA 2XE7A 3H3JA 2PX6A 4HH4A 9LDTA 2PYIA 1Y80A 4EVQA 3GA7A 3LUFA 4Y2PA 1YMUA 3G2IA 1RZ3A 3ESAA 2IIVA 3V00A 2WJWA 2H6EA 3X44A 4DRYA 5JVDA 2H1OA 2W8BA 2W90A 3HM2A 1JJ7A 4U63A 2QENA 4HLDA 4JLDA 4DYHA 1TEHA 4JCCA 1RADA 4X1KA 3T1YB 2DCUA 5EKUA 3FPLA 2JG3A 4KR7A 2VSOA 3I9LA 4NHEA 5DNWA 2R5WA 4MWBA 4RIIA 5FCDA 2QM0A 1YI0A 1E1DA 5ITWA 4UHKA 2NU8B 3VA7A 2FZLA 2HA4A 2XYVA 3BWCA 3UHOA 1F60A 4LBVA 2YV4A 2XWJI 1TCVA 1DIGA 3C24A 2GWRA 4DQLA 2IH5A 2BBSA 2OK8A 3RV3A 1JS1X 2PA3A 4QDXA 1L5YA 1P61B 4X1YB 5AVJA 3G2KA 3W4IA 4Q18A 1YI1A 1EXDA 3O1HB 2QRNA 4F60A 1CF4A 4AMBA 5AXDA 2INGX 1RXYA 4RSRA 2E48A 1C7EA 4O4IF 4PXAA 5CG1A 4GI7A 4UUAA 1KFJB 4GWLA 1XPJA 3DZ8A 3HB1A 3O7WA 2G36A 2PJRA 5EJ9A 1XMPA 2ABWA 3TPFA 1XZBA 1G3IA 1CVIA 5CAEA 4J4BA 1MEJA 1V6SA 3OJFA 4NYMQ 2IEDA 1VM6A 4E2YA 3PS9A 1KYYA 2RHJA 5GINE 3L92A 1TPYA 2OD9A 3AKYA 3DF9A 5I7EA 1Z08A 1GRCA 2CYBA 3BTUA 3EBOA 3WKBA 1TO6A 1P5JA 1U1FA 2QD2A 4J4HA 2VUHB 1CRZA 2HBQA 2C78A 3WNQA 3ZE6A 3VJMA 5BW5A 2X1HA 1UPTA 5FL7D 1XEAA 4OAOA 4IW3B 2FJUA 1CUHA 1YS4A 4P84A 1WKBA 2UVQA 3WQBA 4FPXA 4FNMA 4M38A 2P9GA 1Z13A 4YJFA 5HA5A 4EJMA 3OY2A 3U6BA 4YTEA 3SIPA 3PEEA 1DG1G 3F73A 1JDJA 1W2HA 2IELA 2XE6A 2ZRGA 4J94A 4O1HA 2HRBA 5JFGA 1ZNQO 3OY7A 2GAIA 5JALA 3DMTC 2YWDA 1D0VA 3ETGA 4V1CB 1N36B 2PM8A 1YRWA 1RZVA 1GPWB 1FSSA 1ML4A 1O6GA 2MYNA 3A3KA 4GKKB 4M4SA 4DSZA 1Y3FE 4FYXA 3BEOA 4EHFA 3L0IB 4EKIA 1WZUA 3EVGA 2LWIA 3W5DA 1EMDA 4MTLA 1TTTA 3HEBA 3CNLA 2QN1A 1YNOA 3KO8A 5LMNB 3KR2A 4HAWA 5KTSA 3A4MA 4QAJA 1DHRA 1HUQA 3BUSA 3LYLA 4FB5A 1PZEA 4TTSA 3TM5A 2GZ2A 4B7AA 2FMFA 3BFVA 5LL6P 1P4JA 4PE5B 1NY5A 1CEXA 2XB6A 4Q3DA 3ZS9A 4CV0A 4EMUA 4X8MA 2D1YA 4BBPA 4QHTA 5JJIA 1Z17A 3L8GA 4BP9A 1ONSA 4Y67A 2QORA 3STWA 2KSQA 3BRWD 3VKGA 1J9GA 1M9NA 4P3KA 3OQPA 3B8EA 1XNHA 3LZ6A 2XNDD 3Q6IA 4QPCA 5ALNA 4ZI7F 2XNCA 4YMTA 4PBTA 1XLWA 1G3UA 5GIPE 2E4ZA 2XQGA 2JHAA 2B21A 4L0DA 4NDZA 2COEA 4R6XA 1RHKA 4DM4A 1MOPA 2FFAA 3KSBC 2ZBFA 3SR3A 3EIFA 3ROTA 2WP8J 4LX8A 4ZAWA 3ZXSA 3KNZA 5EP3A 2QRHA 3BMQA 5D6NA 3IAEA 4MJ7A 1F2TB 4YWHA 1X7DA 3LUHA 3O8DA 4AIRA 3UG7A 3IPXA 3QXGA 2WAOA 5EIAA 2H17A 4PLWA 3WSWA 5A9RA 4WMLA 1U9CA 2AL7A 1B6GA 4X63A 3TR6A 3V42A 1DBIA 4AY5A 5C1OA 1RQXA 3WMXA 4JJ6A 5CXUA 4CGYA 4Z8XA 1MT3A 2GD0A 1NUHA 3MWEA 1LBHA 1L9KA 4CMBA 1E4EB 4MGYR 4R1OA 4R1PA 3WKAA 1NXQA 3VKWA 1QDEA 3D5TA 1CDEA 3LS2A 3SS8A 5FV4A 1DG9A 2CLEB 4Z1MA 4H0CA 4BJ5A 4BNFA 1JMKC 1CIJA 2PLAA 2BRUA 2WU3A 4X00A 1DJQA 4JSTA 1WCYA 3DCYA 4MW9A 2O8NA 2X5XA 2YJ5A 1TVKA 2JFQA 1E32A 5B3AA 3KYCB 4L9AA 4Q1BA 1N9KA 4BNUA 4J9VA 1YKFA 1QRDA 2QRMA 4C7BA 4EUFA 1RYHA 2I0FA 1KERA 1QKKA 4QFCA 2GBPA 1WZNA 4NVRA 3AF4A 5C8ZA 5HSGA 2Q5CA 2H1CA 4U39A 2LKCA 1NNUA 4ZYTA 4X71A 5ELMA 3A1VA 2W6JD 2DYKA 2BKAA 3MWYW 5T8KC 2Q4TA 3OAAD 3BDIA 3EAFA 1DJLA 4QJBA 1RAGA 5H81A 2P7HA 1YR6A 4XWOA 4JXKA 4M54A 5IHPA 1DX9A 2R6AA 2VHVA 3RT9A 5ELXA 3GRVA 4UU7A 3ZDQA 1P2UA 5FUWA 1KEZA 4ZEXA 2CV2A 1A8HA 3F3YA 4QU5A 1QV9A 5TQJA 1MD9A 2C5GA 4FS8A 3V6MA 4WUVA 3ENVA 3W3AD 2FF5A 4KJXA 4INJA 3BTVA 2VQ3A 2DH5A 2BZ1A 3A04A 3RS8A 1ZFNA 4RH3A 1C3VA 2FR0A 4MICA 4F8YA 2W70A 4ZMRA 2JB9A 1N25A 1B6RA 2GAAA 3AHFA 1D1TA 2QQFA 3BWXA 3Q4GA 4ZHSA 3SEFA 4KREA 1B8UA 3A4NA 3N39C 3H6KA 4FMBB 4WJZA 3UXEA 1SUDA 2WJAA 5JDIA 3U09A 1X0VA 1NBIA 3MWEB 1XZDA 4A4DA 5KNCA 2ECKA 2NO9A 4MR8B 4F0JA 3HXKA 1R0BA 3CLUC 4HDOB 5FPPA 1SXJD 3WV4A 4UEQA 1KY5A 3JATA 1Y89A 4YJ3A 1ZZEA 3JWIA 3QITA 1OPRA 3TE7A 1WCXA 1YL5A 4WLUA 5LXTA 3E9EA 4DRXB 5SZHB 4U6QA 5B5SA 3RPEA 1YDWA 3E7PA 3RLIA 3O9MA 3HJUA 2WT9A 3R7SA 4EJ6A 4Z6KA 1NUPA 4BLOA 4TS1A 1FUKA 3JTEA 3RHSA 4LYGA 5B1IA 2CF5A 4OFWA 2IS4A 4I4IA 4PSAA 2B7BA 1G3QA 1NZJA 3DLAA 3MQ2A 1V4BA 3PWKA 2CKDA 3SS9X 1ZGHA 2BJVA 1C0LA 3L4KA 1JDBC 4HTAA 2OAGA 2F3QA 3N0RA 1TTPB 4IJKA 1IFXA 4P82A 1KMMA 2IS6A 2Q5QA 4D9JA 2O8FA 4WZAE 1Z5UA 3G9UA 4P0TA 3JR7A 2DM6A 2QGNA 3EWAA 5JJCA 4HDSB 4JBHA 1TGVA 2HHAA 4PVDA 1ST3A 2GCGA 1A76A 2AKAB 2FEAA 2O2HA 3BE4A 3HKBA 1CY2A 2X0FA 3ZXUB 2GHIA 4CQJA 5H9WA 3UKDA 3OQIA 4HB2A 1X14A 1NLYA 1BA2A 2N9UA 2GPBA 3TD9A 4E70A 1OGJA 4CKZA 2HZ7A 3MVEA 3ZGNA 2A1TR 1ILWA 4GO1A 4GIBA 2GBLC 4WGFA 3B6EA 3KJXA 4UFPA 1Y5MA 3MJEA 2FDRA 3ICVA 3QE2A 1TCBA 2FE4A 5DO9A 5CB6A 2V6BA 2EEPA 4HFJA 2CK3D 1RYMA 2QP9X 1NP3A 1NW9B 3KYJB 2ZBVA 4OU5A 1DRUA 3RYCA 3GVPA 1ZRNA 4RK4A 2GHTA 3MJSA 4E22A 5JECA 1FYFA 5KEIA 4W5QA 5EVJA 3EPHA 4YAIA 3EXHB 4M7OA 3CJTA 3S6JA 3PNKA 2OLJA 1ZM3A 3F74A 3WYEA 1H5NA 1Q6YA 1E1NA 1SBQA 5JZOA 1EX9A 1D0SA 3L7IA 4PNZA 2JFBA 1T3GA 5J9FA 1NIJA 2XSZA 4L5BA 2IX3A 1Q7GA 3AH8A 3IODA 3NBUA 2IP1A 5IXSA 1KP3A 2IEAA 4GS5A 4IIDA 2A0FA 4Z54A 2NIPA 5CVEA 1AKYA 5AMXA 2BMDA 1A2QA 4JVNA 4QYSA 4IWYA 3KQPA 3GPIA 1D1QA 1FTQA 1SVWA 3OKPA 1J2EA 2K2WA 4WX2B 2B8WA 3O8QA 3OQBA 3U9SA 4KI7A 1ONPA 4D7AA 1E7MA 1SHZA 3QUSA 4TYPA 4FOLA 2G08A 4ZREA 3DKKA 4GLFA 2FP3A 4FWIB 4R1LA 4TKMA 3SHOA 5HBRA 1XKXA 4YDRA 3E53A 4TSRA 3EARA 1D6SA 1DAFA 1PJ8A 4V2IA 2HL6A 5I6DA 1FVHA 3VR5D 1GLNA 4JA2A 2OCYC 1YVDA 3FF4A 4WBNF 5AM3A 4NZMA 4ARBA 1W0KD 5DHSA 2PANA 3IA7A 2GR9A 1NSYA 1XJQA 2PUTA 4Q7EA 4R54A 3RC3A 4Y9SA 3V32A 3BQ9A 4J0IA 2V7QD 2UZ4A 4PCUA 4V03A 3GLFA 1ZOOA 3UZUA 1XEXB 3K4QA 4JC5A 2YWJA 1HSOA 1U2DA 2GSDA 3PQEA 3PQ8A 5K6TA 3T12A 3MRSA 1SG0A 3DFKA 4RVFA 2NSDA 3E0QA 1BJKA 4Q4CA 2RGUA 1FNDA 1JE0A 1P4AA 1LH0A 3O4RA 4HYEA 4GYYA 4H1VA 1BGWA 2NO5A 3BGIA 3M1AA 2CSUA 4X0EA 3C39A 4CKCA 1YJ8A 2M2IA 5IM5A 3KD2A 3RWOA 4I9HA 3ZDZB 4R9NA 5EIEA 3H6GA 3TCXB 4Q48A 4HDNA 4WZBA 4Z49A 1J2TA 1EFVB 3FDZA 1VJGA 1Z88A 4XLTA 4UNRA 2W0SA 4BN4A 1E5QA 2PUJA 3KEMA 4XGKA 1NE2A 2HK7A 3OTGA 2DSNA 4YUYA 1G5PA 3ZHSA 1U0TA 1EKXA 5CCXA 4NU8X 4Q12A 5F5NA 2ZIAA 4OAQA 2EHJA 4JJEA 1XAJA 5C4MA 4CGZA 1PVDA 1RJ9B 4G07A 3ED1A 3TVDA 1JG7A 2QAGC 1AC5A 4D79A 2XUDA 4NYMR 1BGVA 4JBXA 3DE2X 3K4PA 1KAOA 1JL3A 2X15A 4JI2B 3BWVA 2D1TA 1UXOA 3DTVD 3FCYA 4HNAA 4NONA 2P78A 3RJMA 5C5DA 2HREA 3GBPA 2BZGA 1WXWA 3RT1A 4M21A 2ZJ1A 4Q4HB 1L8AA 5ILOA 1GZVA 5JR3A 4KFSA 2XUJA 4LGYA 1K8QA 2VBFA 5G0VA 3DKVA 3VVBA 4IKEA 3WLPA 1SFRA 3LFHA 2G09A 2I80A 3BJZA 1A71A 1EVQA 1CB7A 3GLHB 1IVYA 2AN4A 2GPYA 2Z08A 3KHSA 3SZLA 2JFWA 2ORWA 3EMBA 3Q3HA 1KYQA 2VJPA 3ZQKA 4R3UC 4JI7B 2PCLA 2XE8A 1EK6A 4K6MA 4HDMB 5HIJA 3GMSA 4M8NE 3FJYA 3DW1X 2N1BA 2WU8A 4K9SA 3QPWA 3GDOA 1E8MA 3FBGA 3ESQA 3BJMA 3NKVA 4F3NA 2XXAB 1KXZA 2PV0A 5BN3A 1GAJA 3H87A 3D8BA 4M37A 5J63A 3QW4B 3LVRE 4ICIA 5F21A 1XLTA 4XYLA 5HQTA 3EEIA 5FV7A 4QM6A 3DLPX 4R2LA 4UU8A 3N86A 4MV7A 2VJAA 3IDOA 2ZULA 4OHZA 1VYVA 1ZD4A 1C14A 4LY6A 3WK7A 3A6GA 3ZBPA 5IZCC 2IIBA 3NHRA 2FRXA 4MR7A 4RVNA 1US8B 3LUGA 2WDZA 3NAQA 3RS7A 3VC3A 4OJQA 1PL7A 4GEKA 3AUUA 3L8DA 4KQJA 2H7CA 4MQBA 3AB8A 4HEHA 2EG5A 3K9GA 5CW2A 1DU4A 1VQ1A 4TGLA 5GMOA 1TX4B 1IOVA 1C3XA 1CUFA 2ZWPA 4CM6A 4J0GA 4KXMA 5KC8A 1JHPA 2QNBA 3IT0A 4N7RA 3KQYA 4IV0A 2IU4A 5DNEA 4N7JA 2W6JA 5SY6A 3O82A 5I45A 2PIDA 1PHRA 3VZSA 5K8UA 1IATA 1BCSB 1ESDA 4BFTA 1FYWA 3KTDA 1EGQA 2CCGA 2UUPA 4LWQA 5ICFA 1WLYA 2PU7A 4QVIA 3TGWA 1SG9A 2GKSA 4PHCA 1IN8A 1W581 4PZCA 4NATA 1VFNA 4QLBA 2LDXA 2JASA 4PG8A 1NVEA 3DLCA 4GQAA 1ZN2A 3GG2A 3PJDA 1TJ4A 4JROA 2O8DA 5H3HA 1M2WA 3KAJA 1DUIA 3GGJA 1QP0A 1PW7A 3OJXA 2GJ8A 4NV3A 3RV4A 2FHSA 4C04A 4AJJA 3ICCA 2JHCA 2CMDA 3L0ZA 3U1TA 3WOHA 3ZHRA 4JI8B 1NQWA 3OM1A 2CD7A 1IBLB 3BF7A 1E2DA 1II9A 1USIA 1W29A 3AF3A