5CMDA

Oligomer crystal structure of cc chemokine 5 (ccl5)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
64
structure length
64
Chain Sequence
b'SDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 5
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 12
structure length 64
sequence length 64
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cmdA00
4UAIA 1DONA 1U4PA 2KUMA 2CVRA 3FPUB 5CMDA 1B2TA 4IUUA 1F9SA 1CA5A 2K28A 5EQ0A 2VXWA 4XDXA 2D9UA 2L4NA 2MP1A 4HSVA 4XT1B 1J8IA 1ILPA 1WTRA 2JYOA 3LWEA 2EE1A 2HDMA 4IURA 1RHPA 1WTPA 1B53A 1JICA 5CBEE 1G2SA 2B2UA 1WTQA 5D65A 2RVLA 4OIJA 1WD0A 1RODA 1B4OA 1O7ZA 2RSNA 3GV3A 2B2YC 3MWYW 1M8AA 2FHTA 1RTOA 1MSGA 2HCIA 1HFNA 3IFDA 5EPLA 1EL0A 3FDTA 5EJWA 4ZLTF 1IKLA 1MGSA 2EOTA 2XIWA 4MHEA 1ICWA 2FJ2A 4R8IA 1ML0D 1B50A 1NR4A 1QNKA 2KVMA 2MGSA 5D14A 1EQTA 3G7LA 2L9HA 2MJ8A 1DOMA 3GV6A 5T1GA 4ZKCB 1C8CA 4CJ0B 1GUWA 2B2VA 2DY8A 1RJTA 1BO0A 5COYA 1DOKA 2K05A 1O7YA 3I90A 1DZ1A 4IUVA 1S4ZA 4IUPA 1HUMA 2B2TC 2K03A 2KEEA 2RA4A 4QUFA 3P7JA 3DM1A 2BDNA 1Q3LA 5E4WC 2X6GA 1EIGA 2B2WC 1BBXC 3KUPA 1X3PA 2L1BA 2N88A 4X3SA 3D6WA 4MN3A 1PDQA 1CM9A 4X3TA 2JP1A 3SVMA 2K01A 5CORA 4R9WA 1WTXA 1SDFA 1G91A 1LV9A 1AP0A 2RSOA 1F9QA 2H1EA 4HCSA 3ONAB 4NW2A 2HCCA 3Q6SA 1HFGA 3I3CA 2KEDA 1E0BA 4LMQD 5T1IA 3R93A 1NR2A 1WVLA 2HUGA 4X3KA 5JJZA 5CBAE 1XX8A 1HUNA 4X3UA 2N55A 4ZK9B 1X32A 4RWSC 2FINB 3I8ZA 1F9RA 1A15A 1TVXA 2X69A 1U4RA 4HAEA 2NZ1D 1AZPA 4RAUC 1X3QA 1EOTA 2SDFA 4U68A 1WTWA 2B2UC 1JE4A 2X6LA 4RA8A 3TN2A 1BF4A 2B2YA 4IUQA 3DEPA 3KBXA 4QUCA 1PFBA 2K1BA 3UI2A 1VMCA 1NCVA 1ILQA 4XT3B 5EPJA 1QG7A 2J7ZA 3IL8A 1EIHA 1HA6A 2FFKB 1O80A 1HHVA 3I91A 5EPKA 1F2LA 2FMMA 1IKMA 1G6ZA 1J9OA 4CJ1B 1HRJA 1B3AA 4DN4M 1MI2A 1U4LA 1ZXTA 4CJ2C 3F2UA 4IUTA 1WTVA 1KNEA 1DOLA 1IL8A 2Q8TA 1QE6A 2Q8RE 2NYZD 1RTNA 3DEOA 1F9PA 1KNAA 1MSHA 2L12A 2B2VC 2KOLA 2NWGA 4O42A 3TZDA 1AZQA 4OIKA 3MTSA 1VMPA 1U4MA 2B2TA 1PFMA 2EPBA 2K04A 2L11A 2M2LA 3H91A 4ZAIA 4ZKBB 2B2WA 1PFNA 2R3ZA 4HEDA 1G2TA 5DNFA 1XYIA 1CA6A 1ESRA 1SSOA 2MPMA 2HDLA 5E4XA 1NAPA 1SAPA 5AFWA 3QO2A 5EKIA 1BNZA 2DY7A 3N52A 1WD1A 2IL8A 3HP3A 1WTOA 1PLFA 2KECA
chains in the Genus database with same CATH superfamily
4JI1Q 3Q24A 1JT8A 4BWGB 3CKIB 3X3NA 5J22A 1IXRA 5M3MG 4J15A 3F2CA 1EWIA 1EY7A 3TP5A 1IYVA 1GUGA 4C2MH 3NUCA 2DJFC 1PH6A 1R9TB 3OW7A 3U50C 1O7ZA 4K2KA 3I56A 3S1NH 3PUWA 3F8TA 3HOXH 3GTLB 3W5OA 1UUPA 1VS0A 1TWAB 4A4IA 1X65A 3VR3A 3GO5A 1PYBA 1UWVA 4NXMQ 3CCSA 4MHEA 5JPNC 2K5WA 4N9PA 3SK5A 2AWOA 4E6IA 1K9MC 5J3BA 1WOCA 4IQZA 4BBSB 1HUMA 4QY7A 4IZ8A 1LABA 3S1MH 2EVBA 4C1NI 1BBXC 1VF7A 4OELB 1ICFB 3S16H 2D62A 4DV2L 1DJRD 5IYCH 3H0GB 2VQEQ 1C7YA 3VYRA 4AH6A 5IT9L 2NVXB 4FF2A 1RKNA 3CPFA 4N8X1 1I4PA 1LT3D 1FJGL 2FINB 2XSCA 5C5MA 3HOWB 4HAEA 2NZ1D 2O4XA 4A3MH 2UUCQ 1GUOA 2EY2A 4ZUIA 1EEID 3GTQB 1XJVA 3C46A 2C5CA 4IPHA 1U9RA 3PIOA 4GOPA 4I7ZC 4R4TA 3GTMH 1AE2A 4ZUJA 5LMUL 1IL8A 1WI5A 1SROA 3KLWA 1QE6A 4OX9L 2NVQH 1I6HH 1HTLD 3SGIA 3S14B 4ME3A 4QJFA 3H91A 4FXGC 4P73A 2RDGA 1EEFD 3VYSA 1XYIA 1YVCA 4DF7A 4DR5L 1GHKA 1Y1VG 3S2DB 1JC7A 2XGTA 5FO7B 4A93H 2KUMA 1DCZA 3MXGA 4IUUA 1TQOA 5G3LF 5EQ0A 3FEWX 5I9PA 2MHVA 1Q90A 2NUCA 1XXGA 2EE1A 4IPCA 3D4DA 5BN3A 5KNBA 3J7AF 1PZJD 1CUKA 2EXZA 2KHJA 3A8KE 4UP9A 1WTPA 3PO2H 2JEBI 2EXDA 1V1QA 4X62Q 2RVLA 1HR0Q 2RSNA 4B3SQ 3MEFA 5IGCA 2AKWB 3OIQA 2OXPA 3QOJA 1PH8A 2RBMA 1HH2P 2F0PA 4A3IB 3KDFB 1PV4A 2WP8J 4Y52H 1G291 1NUCA 1EQTA 3MAQA 2MJ8A 5KGUA 1LTLA 2EJMA 1TY2A 2VB2X 5COYA 5KEEA 1VCIA 1L2FA 1AH9A 4POFA 3LNNA 3S17B 1HNWQ 1PRTB 4LF5Q 1SYEA 3MFGA 2RCNA 1A8VA 1PFSA 1WTXA 5EKLA 3ONAB 1BXTA 2HCCA 3Q6SA 1HFGA 4OL7A 1PTOH 1E0BA 1NR2A 1WVLA 4DUYL 5JJZA 3H0GG 1NBWA 3RZOH 5M3FH 2PQAA 1JWUD 5FLXE 1TWHH 1MD2D 5IGEA 1JE4A 3BS1A 4LW1A 3MXPA 2B39A 3HOYH 3TS0A 3HKZB 4IUQA 2VQFL 4QUCA 3HOWG 3UI2A 4BBSH 3CCUA 5I9OA 5JJLA 1LTID 3WDNA 4K5VA 4P75A 2J7ZA 3HZXA 1YBYA 2Z6KC 2RCFA 4LJZC 3V2TA 2D0OA 3L9AX 5EBDA 4DXGA 2HHHL 1MI2A 1V8QA 2R93B 1PHJA 1PVOA 3C1FA 1BQQT 4JYAL 2E2IH 1KDAA 4KD4A 1RD9D 2ZT9C 3C1EA 2B29A 1L1OC 2OQ0A 1GJXA 1YNJC 1STAA 1IW7D 3JAME 2ZJQA 1ET6A 2PYKA 1T5XD 5CV5A 4DV2Q 1N36Q 3H3VI 2AWNA 2EYLA 3I72A 4X64L 2VL6A 3TSSA 4GKKL 4OONA 4JBMA 2L4NA 3UE1A 3GTQH 4HSVA 2K32A 3CD6A 1ASZA 2RHQB 2G5DA 1VF5C 1N33Q 2OF1A 3EA6A 4IURA 1ET9A 3J81E 1B53A 1YNJD 1JICA 5DM63 1C4QA 4X66L 4JC0A 2R7ZG 5E7NA 1HNXL 3S14H 3ZYYX 1T5EA 1HZAA 4M8AA 5IY0A 1FNWA 1HTPA 1HJPA 2VUMH 1BKBA 3X3MA 5HURA 3J80L 3S2DH 2YV5A 1M1KC 4YHHL 1GUSA 4KY7A 5FLXL 1YIJA 5EAYA 2KVMA 3LGJA 2E8GA 3HRZC 5L37A 4OX9Q 3OTOL 4A3IG 4KKSA 1QILA 4R8NA 1CHQD 3I70A 1IBLL 4IUPA 2JK8A 2K4KA 3TQYA 2QGQA 3BU2A 2B2WC 1HA5A 4P72A 1S3OA 2IX0A 4DR5Q 1TS4A 3DLLA 2ZXPA 2FXQA 2F0HA 3E5SA 4LF4L 3SE0A 1TWCH 4JG2A 5IODA 2NZOA 5T1IA 4GNXA 2QCPX 4IOCA 1Z7TA 1DGSA 1LLRD 1SNCA 1GUNA 3JC66 3K81C 1TS3A 1SE8A 3JAML 3PIP3 4HSPA 3R2IA 1JJGA 1I4GA 1S72A 5DAUA 1ZEQX 1JB7A 2WIIB 4JBKA 4DAYA 2IW3A 4XT3B 1W6JA 5IGBA 3D4RA 1CSPA 2KBNA 1ASYA 2F0VA 3K5OA 1W6KA 5C3EH 1IBML 1EQRA 2RQXA 4KTAA 2OEOA 2EYOA 3MVVA 3J81L 1B9MA 3KYHC 3L2PA 2XWJB 2Q8RE 2Z4HA 5CGKA 5AJ3Q 1SMYD 4A3GB 5CV4A 3NBIA 4DNRB 1HQRD 2R93G 4DR1L 3SHLA 5IYBG 3A55A 3E0EA 4C3IH 2QEXA 5EKIA 4OWWB 2F0KA 2K75A 3KJOA 4B3TL 4K5XA 4A3JB 4L5SA 1M90C 1TWFB 5M9OA 4I65A 1PRTF 2MP1A 2ZTDA 4DUYQ 1SYFA 4BBRH 2JYOA 1QWYA 2F0TA 2NVYH 1VQEA 3HKSA 3NHHA 3HOVB 3T51B 2E2HH 4OIJA 4EVOA 5IYBH 3G6EA 2XVSA 2JA8H 2VY3A 3DUZA 2VQFQ 2EJGC 3CP0A 4K6DA 4BY7B 1S5DD 3RUZA 3S15H 4KJNA 2EOTA 4QL5A 4X6AH 4GOPC 1YITA 1X3FA 3A8IE 1HZ9A 4LFBL 2L9HA 2PPBC 2CH4A 1LTRD 5T1GA 2PW7A 5CV9A 2ZXRA 4ZQ3A 2QW7A 3K8AA 1JCKB 3EIVA 3CF5A 4JVZA 5M5WB 4XTCS 1I4HA 2OCEA 1Q81C 3GD7A 2ENBA 3I4MH 5IGFA 3MHBA 1CFMA 4X64Q 3BDOA 4QF4A 3I3CA 5GADC 3PF4A 3PIPA 2BCOA 4X3KA 3CPWA 4A3BB 1XX8A 2IX1A 1G6PA 1BBUA 3ULLA 3HOUH 3I8ZA 4HJ7A 2Z8LA 2ASBA 2N8NA 4X66Q 1BUVT 1EY4A 2MO0A 4A3CG 1Q8KA 1HNXQ 4PG3A 2AQ1B 2E5LQ 1VMCA 2A19A 5JJKA 4V190 1KDCA 3GQBA 4C3HB 1B3AA 4YHHQ 5D3DA 1X54A 4G4KA 4IUTA 1A0IA 4LF7L 4DFAA 1VQOA 3OTOQ 1UEBA 5E3FA 3CHBD 3TREA 4GLXA 4FXDA 3BYYB 1IBLQ 1TWGB 2M2LA 1V1OA 1H9RA 1JJCB 3CCJA 4A3GG 1OXXK 1SSOA 4O2DA 1O7IA 1VQ6A 3T1HL 3GDEA 1WTOA 4LF4Q 3H3VC 2N3SA 1DONA 1F9SA 3EJIA 3K7UC 2PQAB 1LTTD 4F87A 4HIDA 3CU7A 4A3JG 5I2XA 1VQJA 4C2MB 5A35A 3AMUA 1U5KA 4DV3L 1HR0W 3PQIA 2PZTA 2B2UA 3HOXB 3M4QA 2JA5H 2WB1E 1BR9A 1FNVA 3E9HA 2KJXA 1PH3A 4LFCL 4C1NK 3HOVG 2E74C 3S2HH 1PH4A 1IBMQ 1YJWA 3BYTB 4BY7G 2FJ2A 2SOBA 1E2ZA 4HMJA 1TS2A 1TWFH 4HCEA 3S1MB 4OGQC 3GTPB 4OXPA 1LUZA 4JW0A 1KTKA 4QUFA 1O78A 2PNRC 4DR1Q 3GTOH 2B3GA 1Q3LA 3S16B 4KHPL 3OWFA 3KUPA 3OYYA 3VA7A 2PMZE 3Q22A 4DR3L 1CM9A 3V96A 1EUJA 4ZRZA 1S5FD 4B3TQ 3D8GA 2Z6KA 4P2CB 4JI5L 4H44C 5JJIA 5DM73 1X9NA 2F4VQ 1F2ZA 5CBAE 2AQ2B 4C3JG 4A3MB 3GTJH 2UXDL 1YHBA 2BH2A 1JB3A 5C4ZA 2DNCA 4RAUC 4A3BG 3KLRA 1BF4A 4HJ5A 4X65L 3DWQA 3S24A 4XXEA 1ENFA 2P5ZX 1HA6A 5EBCA 5M5WH 1XNQL 1G6ZA 1IKMA 1SFOH 2NVQB 4NPSA 1STGA 1JWSD 1SRUA 3A0JA 2O2LD 5ELCA 4LFBQ 1RCVD 4C3HG 2NBFA 2L12A 2F03A 4OIKA 1VQ7A 5JEAG 4A3BH 3J7ZC 2L11A 3VDYA 4FF4A 2ALYB 4KN4C 4HMIA 1G2TA 4KJOA 2BH8A 2MPMA 4A93B 1SMXA 2CWAA 4FF3A 5G3LD 1STHA 1EYCA 2DY7A 3R8BA 1Q46A 3UDFA 4LAAA 2N78A 1K8OA 3KLSA 1P8LA 3DXJC 4F7XA 3CCQA 1SNQA 1XPUA 1QVCA 4OO1H 1CHPD 4GNXC 3PO2B 3NTKA 4C3HH 3VR6A 2O5IC 3HKZE 5JEAJ 2A5HA 4GN4B 1IYUA 1QUQB 2Q8IB 3J7A5 4DAYB 3EROA 2PCFB 5D65A 2UXBL 1I3QH 2Z1CA 1I94L 1TWGH 4L8JA 3NWSA 1EU3A 1OXTA 1ESFA 3TP8A 1LACA 3HOXG 5FOBB 3K57A 3T16A 4OHJA 1XMQQ 1S5BD 4GN3B 1SJED 1D5MC 2QF7A 1MGSA 4DV5Q 4AQYL 2Q2UA 4LF7Q 1NR4A 1LTGD 3GV6A 2J0TD 2KENA 3E3XA 2VZAA 3I90A 4IUVA 2R61A 2ZTCA 3NELA 2KEEA 3HEJA 5E4WC 2N88A 5HGQA 5IGDA 1TU2B 4DK6C 1SBBB 1NSNS 3TS2A 2AUJD 3T1HQ 2K01A 3M4YA 4RCOA 3HOZB 1LT5D 1PTOB 4RMFA 2ID0A 3DHQA 5DEHA 5LMNL 5IYCG 4FO2A 4NW2A 3RZOB 2LSSA 3A5UA 2A69C 5M3FB 3AU7A 2EYFA 2JA7B 1HUNA 1PH2A 1BBWA 4PZ6A 4X3UA 2XTIA 1PTOC 1TWHB 4DV0L 2R7DA 4DV3Q 2L15A 3HOYB 3UDIA 5FK9C 4A3LH 3DWPA 3T1YL 2A8VA 2G9DA 3GTPH 2NVTB 4A3MG 4LFCQ 4JI6L 4ME5A 2EYMA 3IAYA 3G6JB 3WOEA 1DD2A 1FGUA 2A69D 1Z9FA 4GKJL 2J4XA 1ZXTA 3CCRA 2E75C 3D6CA 1PTOD 1S5ED 3F2UA 4HR7B 2E2IB 2K50A 4MTKA 3M85A 2F52A 1EWHA 2K04A 1U4MA 1GKHA 1YHQA 1E22A 5ELEA 1TXYA 2FMCA 2NTTA 1U0LA 3DMUA 2EDGA 3PUYA 1TY0A 5ELDA 4DR2L 1Y1WH 2C35B 1KL9A 2UXCL 5CMDA 4CKCA 4CKBA 4JI5Q 4A93G 2WB1B 4WFN3 2HIXA 3S9WA 5DLQE 1IZ6A 4LFAL 1B8AA 3S1RB 3CCMA 2UXDQ 3MZ5A 3AEVA 1Q8IA 4EQPA 2RF4A 3PO2G 4X65Q 5ELOA 2GVAA 2A68C 3FMCA 2L5TA 3H6MA 3TRZA 2VUMB 1M8AA 4RGOS 4EQOA 2HCIA 1EY8A 1XNQQ 1V9PA 3CRLC 1LTSD 4BY1B 4OEMB 4V0BA 3I4NH 2PMZB 1I6VC 3PMFA 4LWCA 2R92H 4JI7L 3AQQA 2K05A 3KF6B 2A68D 2K5VA 1EIGA 2JN4A 3BZKA 3EN2A 1TWCB 3VYUA 5J39A 1Q82C 1B7YB 2R6GA 1WYDA 1GO3E 1CT1D 4IPGA 1K8AC 4IUNA 4A3DH 2IWHA 4DAVA 3HOZG 5ISRA 4ZK9B 1GOZA 5CV6A 4DV1Q 3PO3H 3QG1A 5J1ZA 4I7AA 5M3FG 1J6QA 2CQAA 2I46A 1KABA 2JA7G 1AZPA 5C3WA 2SDFA 2B2UC 1FNUA 1YZ6A 2EJFC 1JE5A 4KI0A 1XTCD 4XYQA 3HOYG 1BCPB 2HQEA 4CDCC 1BDOA 5C3EB 2D2CC 2K5HA 4BBSG 4JI0L 3P75A 3B6YA 5IOCA 2SEBD 1E2VA 1PRTC 4AQYQ 4B3RL 1BCPC 1OXSC 1WCMH 4P71A 3M3YH 3HOZH 1YEZA 1D2BA 1LO5D 2JA6B 4S3SA 3MEHA 5C44H 1FL0A 4JI4L 2NWGA 5I6YA 3J80E 2JQOA 4U673 1QNUA 4A3KH 2A6ED 2XNAC 2JA7H 1D7QA 5CBEE 1PMRA 4HJAA 4C3IB 4A3FB 4DXFA 4KK7A 2CFMA 1CKMA 5DNFA 2EYJA 2Z9HA 1CA6A 2F4IA 2ES2A 2IX3A 1PH7A 3HP3A 1PRTD 1EY6A 2NVTH 1IW7C 1BCPD 2CVRA 3OSOA 4LF8L 2K6AA 4BBRB 1CA5A 4TQUS 2NVYB 1SYGA 2E2DC 3A8JE 3MXNA 1SE3A 5KYLA 2E2HB 2WB1G 4OO1I 3K59A 1RHPA 1PTOF 3TP6A 2JA8B 4DR6L 1SE2A 1VQGA 3S1QH 1D6EC 1I4XA 1B4OA 3Q0AA 4JI6Q 3S15B 4K6LA 3CQZH 1NE3A 1JOKA 3VA5A 4A3EH 2VUMG 4GKJQ 1AEXA 3Q23A 4B08A 1ML0D 5JVH3 1QNKA 3G7LA 1N8RC 4RHRA 1FJGQ 4QMGA 1LTBD 3ULPA 3W1GA 4JK1C 3OW2A 4KY5A 3S1RH 1R4PB 2F0IA 2X6GA 2JJQA 3I4MB 4L63B 2QEJC 3P20A 3C3LA 1X55A 4DR2Q 2UXCQ 4R9WA 2XN9C 3P1HA 4JOIA 1LV9A 5CV7A 3NEMA 3ERSX 4TKOB 1KQSA 1PZID 3HOUB 4AYBE 4BXXH 1XPOA 4IFDH 5HY6A 3TEHB 5LMUQ 3J7YW 3U4VA 4BY1H 2K52A 1EYDA 3PUXA 2QA4A 3G71A 3QIAA 1VQ9A 2RHSB 5I6WA 4KLKA 3KK7A 2EQSA 1MHWC 3NXWA 4YWLA 3VR5A 2BE5D 3KF8B 5IP9H 4Z9CB 3I4OA 4HJ8A 5FJ8H 4XIGS 4YIJA 1YI2A 3W3AA 1VQMA 1N34L 4KHVA 2F0SA 5C3EG 4CBVA 3TZUA 4IOAA 3ND9A 4JI7Q 4O42A 1AZQA 2A73B 1PFMA 3HFZB 4ZAIA 1SMYC 1PFNA 4NP5A 5JVG3 5IE8A 1Y8NB 1QUQA 1SAPA 3I55A 4C3IG 2DUDA 5BR8L 4A3FG 1MKHA 4GZYC 1U4PA 3FKIH 3FPUB 1Q86C 3HKZG 4RH6A 3BVMA 4RGNA 4ABNA 2OT2A 4XT1B 3M7GA 4BBRG 2JA5B 3KBGA 1X3EA 1OO9B 2JA6H 1SYDA 4XQNA 2SNSA 3RLNA 3A7AB 3S2HB 2JA8G 1X56A 3RR5A 4YY3L 4A3FH 4IALA 4ALPA 1HFNA 4G57A 1EQQA 2PW5A 3FVQA 1E24A 4PMCA 4JI0Q 1EL0A 2KCTA 4ZLTF 4B3RQ 3AYHB 4KKTA 4M1UB 2QILA 1SJHD 4MIUA 5IYDH 3I2ZA 1B44D 1BCPF 5C6AA 4CJ0B 1A3UA 3K0XA 4O1NA 4JI4Q 3GTOB 1DOKA 3K7AH 5JPMC 4UPAA 5K36H 3N6RA 4O0AA 4JI3L 1CQFA 2VW9A 2B63B 1EIFA 1X3PA 2ZJPA 4H13C 1ONLA 2JP1A 2F0QA 2AHOB 1TR5A 1K73C 1SDFA 4PMBA 1HPCA 3I4MG 2RSOA 5LL6X 1J5EL 2H1EA 5KNDA 3F2DA 4JV5L 1SYBA 2HHHQ 3GTJB 1K3BC 2I5MX 3CMEA 5IT9c 1F9RA 1TVXA 4DR6Q 1IL2A 3HOUG 4JYAQ 2VS1A 3OOCA 4DR4L 3I73A 4QQBX 1EOTA 2YU9B 2OTJA 1JOQA 1Q7YC 4N9TA 2OQKA 4PMWA 1SFOB 1MBYA 1YNXA 2QDLA 1K8MA 3U58A 2OTLA 4GKKQ 1RL2A 4C56C 2Q8TA 5KNCA 2PO4A 2F3WA 3ULJA 1D5XC 1CKOA 1MIUA 2CW0D 2PNHA 3MC0B 5CV8A 1N32L 1QVGA 1F2YA 1H9JA 3K5NA 1C48A 4KHZA 3W1BA 1XMOL 5FLMG 1KRSA 1QCBD 4QB4A 3H15A 3NP8A 5C4XH 2CH4W 1X3GA 5M5XH 1FYCA 1H9SB 1UE5A 1ILPA 4CDDC 1JR0D 5EKKA 4HIKA 1JWMD 2DNEA 1QOHA 1YNNC 1I3QB 5C4HA 1A63A 2LKVA 1SNDA 2KQ3A 3RD4A 4ZCKA 4IO9A 2UUBL 5FLMH 2JA5G 1SEBD 3NTHA 1MSGA 3KF6A 1EY0A 3U9SA 1WFQA 2IJ0A 1N34Q 3CMAA 4EQNA 4R4IA 3NPPA 1YNND 1K0SA 3PUZA 1DOMA 3OMCA 1WJJA 4ZKCB 1OTCA 2E2JH 4GN5A 3CCEA 3RZDB 3CW2C 1GD7A 4UHVA 3T53B 1EOVA 2K33A 4AYBB 2OWOA 4X3SA 4K14A 1IHZA 1EQVA 5BR8Q 4CKEA 1RDPD 2ZXOA 2D5DA 4UP8A 4XQJA 1JOOA 2B63G 3UE0A 3MXNB 4K5WA 4KY6A 3VR2A 4H02A 3OHXC 4RHSA 2B8FA 3CCLA 1F77A 4DK1A 3PV0A 4IFDI 1O7LA 3DM3A 5D3IB 1A15A 3IFTA 1YJNA 1X3QA 4U68A 1B1ZA 3KBXA 3CC4A 4YY3Q 1G51A 1NMFA 1NCVA 2MFIA 1SNOA 3IL8A 4ILWA 5CYUA 4ULLA 2B63H 3G48A 1HHVA 1J9OA 3F2BA 1KHIA 4DN4M 5JOBA 4H7BA 1M4VA 1VQPA 3FPPA 1AFPA 1DOLA 4DNTB 1D1KA 1EWCA 1JJ2A 1EZ8A 1GUTA 2VNUD 4JI3Q 4FYDA 2M00A 4K8JA 5I2YA 5GAHC 3ND8A 1Y1WB 2MUYA 1ESRA 1S40A 1BNZA 1EYGA 3ICEA 3N52A 1G8ZD 2YU9H 1WD1A 4CJ2C 5C4JH 4JOIC 1J5EQ 4JV5Q 3NWTA 1LTAD 3PUVA 2EZVA 2K28A 3PCOB 4G7HC 4XYOA 5C0XH 1CQVA 4RGMA 5JAVA 4OO1G 1XTDA 2KHIA 2LY7A 2F1MA 2ZTEA 4DR4Q 1NTGA 1GVPA 1WTQA 2F0UA 2CKZB 4EGVA 2DJGC 2LXJA 2H4OA 5C5LA 2FHTA 4B9WA 1Y69U 2EIFA 4RGTA 4JPBW 3I4NB 2N49A 1OXVA 4NKLA 2XIWA 4DKAC 2R92B 1ICWA 2AMCB 2ZJRA 5IGGA 5D14A 1GHJA 3J80c 2B8GA 3R2TA 4L6TB 4J1MA 5FLXc 1EZ6A 2WKCA 2YTYA 3RLOA 3T4AC 3TDQA 3GTGH 2K5NA 2K03A 4IN3A 1N32Q 5GAEC 1HR0L 5KIXA 1SLJA 4CDFC 1HQMC 3M4OB 4POGA 1Q1EA 5FO9B 4GLAC 2PZWA 4AYBG 4A3DB 2GN5A 3KF8A 4GLVB 4K0KL 4KMUC 2MO1A 3PO3B 3H09A 4A76A 2KEDA 2NN6H 2VB3X 1UE6A 3CC2A 1X32A 2Y0SE 2KA7A 3V05A 3NE5B 2F3IA 4UY8C 3T56B 3TN2A 2UUBQ 2G9HD 4A3LG 3RZDH 3PF5A 2KCNA 3JAMc 2D0PA 2TMPA 1KAAA 1QG7A 1VQHA 1KRTA 1WCMB 3K5MA 3M3YB 2F0LA 4Y7NB 4FNFA 5C44B 4FF1A 4QCLA 2BA1A 4DNIA 4A3KB 3VR4A 1MSHA 1HZCA 3J81c 2JSOA 2F0MA 4LF9L 2EY1A 2AUKA 2EPBA 4ZKBB 2GA4B 2QDBA 2M9VA 1I50B 4HIMA 3BJUA 3DWAA 2HIVA 2I5LX 2HDLA 3OMGA 1NAPA 1IYJB 1KDBA 2LFNA 4FXKC 1S5CD 2NZHA 3MXUA 5EPLA 4A75A 4KV6A 4UAIA 1Y1WG 1B3QA 3SXHA 3E6ZX 4WORA 3K5LA 4XDXA 1EY5A 2WAQE 1WTRA 5M3MH 1HCZA 3S1QB 3SK4A 2HDMA 1A3VA 1V1PB 4RKLA 3G4SA 1XNRL 4KHPQ 2E76C 3CQZB 1FD7D 3FHWA 1SNMA 1UNSA 1EFID 1SXTA 3CRKC 4A3EB 1RTOA 1VQFA 4DR3Q 3TP7A 1N36L 1JMCA 2WFWA 3QOLA 3W2DA 4MNOA 3NQIA 3QWNA 2LS01 1KD1C 1QB5D 1B50A 3L0OA 3OIPA 3A5ZB 3I4NG 2YTXA 1N33L 1C8CA 2EYHA 4B3ML 1STBA 1GUWA 1YJ9A 1VQNA 4HTHA 2R92G 1BO0A 3J7AV 3QR8A 3J81j 1SYCA 3P7JA 1SE4A 3DM1A 3PGZA 4NB3A 4CGYB 1Z6HA 3D6WA 4MN3A 3K80C 5TSSA 3O13A 5BN4A 2F0GA 4DU9A 1G91A 2L55A 1KAWA 1AP0A 2I5HA 5IIFA 4L5RC 3SK8A 2HD3A 2JE6I 1GM5A 4A3DG 4DPGA 1K8GA 4DK0A 1BVSA 5M5YH 3PO3G 1E3PA 5CC4A 4JBJA 3IKJA 2CCZA 2ICIA 3J80i 2B2YA 4NDXA 3DEPA 3NTIA 1PH1A 5EPJA 3QB3A 1ZKOA 3OPOA 2ICEC 3D0FA 5H1SE 3M4OH 3ZJYC 1U4LA 2K5QA 2JXMB 5KYIA 2KHSA 1KNEA 3GTKB 1WCMG 2JEAI 2R7ZB 2LMCB 5E1FA 3DEOA 2NYZD 5NUCA 2XRSD 1KNAA 4YCWA 4BA1I 5C44G 1PH9A 1VMPA 2B2TA 2IHFA 4DAPA 1H9SA 4A3KG 4WJ4A 1NMGA 2UXBQ 1Y1VH 2A6EC 1KC8C 5E4XA 3FKIB 1I94Q 3QO2A 4R4OA 3JAMi 4K0KQ 3ER0A 5GROA 1E1OA 1H9KA 4EX5A 4QIWB 4Y7NH 5AJ3L 3HG9A 1KLUD 4DGZA 3ITPA 2WINB 5C0XI 3SDZA 1K0RA 4K2LA 1G2SA 1D1IA 3J81i 1RODA 2TSSA 2GVBA 3NSWA 5IP7G 1I50H 1R9TH 3IFDA 1A2TA 2CQOA 4GS3A 1I4RA 3GTLH 3FDTA 4YCUA 5LMNQ 1VQBA 1IKLA 4A3EG 1TWAH 2ZM6L 1V43A 2RDHA 1VQKA 4XQQA 2MGSA 4F88A 1F2MA 3TMEA 3K7AB 1HNZL 1VQAA 1E2WA 4WJ3M 1K83B 1LT6D 1RJTA 4DV0Q 4LF9Q 1EY9A 3BDCA 5KRUA 2A6HC 2BDNA 4DV7L 3T1YQ 3E0JA 1DM0B 3R3OA 2AQ3B 2WV6D 2Y0SB 5IP7H 3SVMA 5FKAC 1QJOA 2MQHA 3LX0A 2C9OA 3AFPA 4YWMA 4HN7A 3EQLC 5HGTA 5ELFA 1CK1A 1I5FA 3H0GH 1L1OB 1IBKL 2HUGA 2UU9L 4DR7L 4AIMA 4BXXG 4IFDG 2NN6I 3NBHA 2NVXH 3A56A 5IWAL 4NXNL 2A6HD 4BY1G 1EFWA 4RCNA 1UE7A 1XNRQ 2BDOA 4RA8A 4RKBA 4NMZA 4R4CA 3HOWH 1B70B 4B9XA 2BE5C 2HQLA 5IP9G 4JI2L 3D31A 3RN2A 1DYQA 4QGUA 2FMMA 5FJ8G 1JORA 4IFDJ 1C9OA 3L7ZC 4B3MQ 4P74A 2XWBB 1VQ5A 1RTNA 4LFAQ 3D3RA 3RNUA 1BOSA 2WACA 3MTSA 1Z47A 1STNA 1R4QB 1FVIA 1PYSB 2WAQB 1STYA 2E5LL 1L0YB 4G7ZC 2DN8A 2RDFA 2IT1A 5C4XB 3AB9A 4OWXB 5M5XB 3KLSX 3T13A 1TT2A 2WKDA 1HXYD 1CZGA 3FKIG 5K5PA 2RKSA 1J8IA 4IJHA 1VQCA 1QZHA 4LUOA 5ELBA 2PQEA 5LL6S 4TRDA 1E1TA 4JI8L 2K14A 1DXMA 2R7ZH 3GTKH 3M9BA 4N8FA 2JA6G 1N9WA 3EFXD 2IY5B 4FVMA 2EY6A 2Z0SA 1XWEA 5EJWA 1EIYB 2E2JB 1AN8A 4DAMA 3M7NA 4A3IH 4UP7A 4TVAB 4HJ9A 3TBIB 4IPDA 5IYDG 2B2VA 2DY8A 4DA2A 2DGYA 2KCCA 1DZ1A 1Q12A 3NK9A 2F0FA 5K36G 3A7LA 2V4DA 4DV6L 4DV4L 1VQLA 4PZ8A 3S17H 1H9MA 4G7OC 4OWTB 5CORA 3U9OA 4R4QA 4R1JA 1CKNA 2ATWA 1A2UA 4DUZL 1Y14B 2Y0SG 3EVQA 3UDXA 1ZYRC 2A1AA 3HGBA 4RFBA 2Q2IA 2LXKA 4RWSC 4PQXA 5EGTA 2X6LA 5I4DA 1PH5A 2Z6BA 1K83H 2F0DA 1ENAA 1NJIC 1PFBA 2K1BA 2FFKB 4K8IA 2UUAL 1ZYRD 2NB0A 4LF8Q 1SR3A 1D8LA 2F4VL 4EQ5A 1A3TA 2ZM6Q 1PYWD 1KIXA 3D4WA 2K5DA 4JCVE 4LK1C 1HNZQ 1L0XB 3BG3A 3TZDA 2KOLA 4CHTB 3AFQA 2R93H 3BDLA 3GP7A 2YYZA 4MZ9A 2IHEA 1LT4D 4DV7Q 2CW0C 3F1ZA 5C4JB 4CDEC 4GOPB 5AFWA 3NQTA 1V1PA 3NENA 3C2PA 4L5QA 3SK6A 1PLFA 2PZUA 2KECA 2WAQG 1B2TA 1W3SA 4PNYA 1VQDA 5C4XG 4J8QA 1IBKQ 1VQ8A 4ID6A 2UU9Q 4DR7Q 1KXLA 3BZDB 3LWEA 3CC7A 1MJCA 3E9IA 3KFUA 2H5XA 5IWAQ 4NXNQ 4PZ7A 3CAMA 5LHY1 1TIID 2BOSA 1WD0A 1LM0A 3HS0C 3GV3A 2B2YC 3WWVA 4LNQA 2V1CC 4JI2Q 3BVZA 4C3JB 3I4LA 1H95A 1Q1BA 4KD3A 2Q2TA 1FGBD 1Y8OB 3GTGB 3K58A 1RF2D 1C0AA 2SNMA 2F0NA 3RN5A 1A6XA 1B9NA 1ENCA 3KJPA 1Y8PB 1S4ZA 2PI2A 2B2TC 2RA4A 4WJWA 4Q5VA 4LF6L 1QVFA 3OWEB 1UAPA 1X6OA 4ZYSA 3A74A 4X3TA 2F0EA 1XMQL 1AW7A 1P16A 1F9QA 2L0CA 3MFYA 4JI1L 4DV5L 1YHAA 4HCSA 1TKWB 4JBWA 4LMQD 3R93A 1NNXA 3A54A 2QKIC 5F2DA 4ODGA 2F0JA 5BN5A 2JA9A 4JI8Q 4KN7C 1U4RA 4BS9A 4IJLA 4A3CH 1WTWA 1D5ZC 1T9HA 3STBC 3CXCA 1K3RA 3FRPB 1KLGD 1NY4A 1W2BA 1L0WA 5EPKA 1F2LA 4CJ1B 3URYA 4NXML 2MNAA 1HRJA 1VQ4A 4LUVA 4J6HA 1WTHA 4APVA 5FO8B 4Q0FA 3BZCA 3KDFA 4LUZA 1PA6A 1F9PA 1UEAB 3S1NB 1II3A 3STBD 2IPKD 2YTVA 4A3GH 4YCVA 4DV6Q 1STEA 4HEDA 2O5JC 1SN8A 4DV4Q 1TS5A 2PI2E 2IL8A 1K28A 3M4PA 3U4ZA 2VQEL 4DUZQ 3NBHB 5M3MB 1CTMA 2VXWA 4A3JH 2D9UA 3CCVA 5ELNA 3K6OA 4FP5D 5C0XG 3WOFA 3LWUA 2CWPA 2EYPA 3RLFA 1I4QA 3SEBA 4BA2I 2XRQD 3PSIA 2Z4IA 2UUCL 3HOVH 3MWYW 5A2QE 5LMNW 3VYTA 3MA2B 2UUAQ 4DK3C 2R7FA 4BY7H 1CSQA 4KKUA 5CR3A 5C0XJ 3UDGA 3BVGA 2A74C 4R8IA 2CHBD 1VQIA 2I0QA 1PXUA 1HZBA 2F3VA 1O7YA 1L1OA 1CZWA 4UDUC 3K0YA 4PV1C 1AE3A 3Q8DA 2F0OA 2NTSA 4HIOA 2L1BA 3I7FA 4TSSA 1OXUA 1PDQA 1SNPA 1A62A 3GTMB 3ERQA 3L3OC 4QIWE 3KOJA 1I6HB 5M5YB 1MJEA 2NN6G 3SR1A 1EYAA 2N55A 4C3JH 2I07B 2X69A 3IRBA 1EIHA 1UE1A 1EU4A 4X62L 3EBEA 2EY5A 2BA0A 3H94A 4FDBA 4B3SL 1XMOQ 1RIPA 1ILQA 1XPRA 4GNXB 1FR3A 1O80A 3I91A 2F0WA 1WTVA 4DV1L 4WRDA 4RG1A 3FP9A 2B2VC 1LYLA 5C3XA 5JEAH 2KCMA 1CI3M 4L5TA 5IT9E 1Y1VB 1JQYD 2Q2HA 4YWKA 5A2QL 3PIO3 4LF6Q 5GAGC 2B2WA 1CKNB 1GXDC 2R3ZA 2K7VA 4MTNA 5GQOA 2HT1A 4LF5L 1HNWL 4H0LC 3RMHA 3H3VH 3QJYA 1VDZA 4F8MA 1PZKD 1QZGA 1E7ZA
chains in the Genus database with same CATH topology
3Q24A 4BWGB 3CKIB 3X3NA 5J22A 1EY7A 3TP5A 1IYVA 1GUGA 3NUCA 1R9TB 3OW7A 1O7ZA 4K2KA 3PUWA 3GTLB 1UUPA 1TWAB 3VR3A 3GO5A 4MHEA 5JPNC 2K5WA 4N9PA 3SK5A 2AWOA 4E6IA 4IQZA 4BBSB 1HUMA 4IZ8A 1LABA 2EVBA 4C1NI 1BBXC 1VF7A 2D62A 1DJRD 3H0GB 3VYRA 5IT9L 2NVXB 4FF2A 1RKNA 1I4PA 1LT3D 2FINB 2XSCA 5C5MA 3HOWB 4HAEA 2NZ1D 2O4XA 1GUOA 2EY2A 4ZUIA 1EEID 3GTQB 3C46A 2C5CA 1U9RA 4I7ZC 4ZUJA 1IL8A 1QE6A 1HTLD 3S14B 3H91A 4FXGC 2RDGA 1EEFD 3VYSA 1XYIA 4DF7A 1GHKA 3S2DB 1JC7A 5FO7B 2KUMA 1DCZA 3MXGA 4IUUA 1TQOA 5G3LF 5EQ0A 3FEWX 5I9PA 2MHVA 1Q90A 2NUCA 1XXGA 2EE1A 3D4DA 5BN3A 5KNBA 3J7AF 1PZJD 2EXZA 3A8KE 1WTPA 2JEBI 2RVLA 2RSNA 5IGCA 3OIQA 2OXPA 3QOJA 2RBMA 2F0PA 4A3IB 2WP8J 1G291 1NUCA 1EQTA 3MAQA 2MJ8A 5KGUA 2EJMA 1TY2A 2VB2X 5COYA 5KEEA 1VCIA 3LNNA 3S17B 1PRTB 1SYEA 3MFGA 1WTXA 5EKLA 3ONAB 1BXTA 2HCCA 3Q6SA 1HFGA 4OL7A 1PTOH 1E0BA 1NR2A 1WVLA 5JJZA 1JWUD 5FLXE 1MD2D 5IGEA 1JE4A 3BS1A 3MXPA 2B39A 3HKZB 4IUQA 4QUCA 3UI2A 5I9OA 1LTID 3WDNA 4K5VA 2J7ZA 3HZXA 4LJZC 3V2TA 3L9AX 5EBDA 4DXGA 1MI2A 1V8QA 2R93B 3C1FA 1BQQT 1KDAA 4KD4A 1RD9D 2ZT9C 3C1EA 1GJXA 1YNJC 1STAA 1IW7D 3JAME 1ET6A 2PYKA 1T5XD 5CV5A 2AWNA 2EYLA 3I72A 3TSSA 2L4NA 4HSVA 2K32A 1VF5C 2OF1A 3EA6A 4IURA 1ET9A 3J81E 1B53A 1YNJD 1JICA 5DM63 1C4QA 3ZYYX 1T5EA 4M8AA 1FNWA 1HTPA 3X3MA 5HURA 3J80L 1GUSA 4KY7A 5FLXL 2KVMA 3HRZC 4KKSA 1QILA 4R8NA 1CHQD 3I70A 4IUPA 2B2WC 1HA5A 2IX0A 1TS4A 2ZXPA 2F0HA 3E5SA 3SE0A 5IODA 5T1IA 2QCPX 1Z7TA 1LLRD 1SNCA 1GUNA 1TS3A 3JAML 3PIP3 4HSPA 3R2IA 1I4GA 5DAUA 1ZEQX 2WIIB 4DAYA 2IW3A 4XT3B 1W6JA 5IGBA 3D4RA 2F0VA 3K5OA 1W6KA 2RQXA 4KTAA 2OEOA 2EYOA 3MVVA 3J81L 1B9MA 2XWJB 2Q8RE 2Z4HA 5CGKA 1SMYD 4A3GB 5CV4A 3NBIA 4DNRB 1HQRD 3SHLA 3A55A 5EKIA 2F0KA 4K5XA 4A3JB 1TWFB 5M9OA 4I65A 1PRTF 2MP1A 1SYFA 2JYOA 1QWYA 2F0TA 3NHHA 3HOVB 3T51B 4OIJA 4EVOA 2XVSA 3DUZA 2EJGC 4K6DA 4BY7B 1S5DD 3RUZA 4KJNA 2EOTA 3A8IE 2L9HA 2PPBC 1LTRD 5T1GA 2PW7A 5CV9A 2ZXRA 4ZQ3A 1JCKB 5M5WB 4XTCS 1I4HA 3GD7A 2ENBA 5IGFA 3MHBA 1CFMA 3BDOA 4QF4A 3I3CA 2BCOA 4X3KA 4A3BB 1XX8A 2IX1A 3I8ZA 2Z8LA 1BUVT 1EY4A 2AQ1B 1VMCA 4V190 1KDCA 3GQBA 4C3HB 1B3AA 5D3DA 4G4KA 4IUTA 4DFAA 5E3FA 3CHBD 4FXDA 3BYYB 1TWGB 2M2LA 1V1OA 1H9RA 1OXXK 1SSOA 1WTOA 3H3VC 1DONA 1F9SA 3EJIA 1LTTD 4F87A 3CU7A 5I2XA 4C2MB 5A35A 3AMUA 2PZTA 2B2UA 3HOXB 1BR9A 1FNVA 2KJXA 4C1NK 2E74C 3BYTB 2FJ2A 2SOBA 1E2ZA 4HMJA 1TS2A 4HCEA 3S1MB 4OGQC 3GTPB 1KTKA 4QUFA 1O78A 2PNRC 3S16B 1Q3LA 3OWFA 3KUPA 3VA7A 3Q22A 1CM9A 3V96A 4ZRZA 1S5FD 3D8GA 4P2CB 4H44C 5DM73 1F2ZA 5CBAE 2AQ2B 4C3JG 4A3MB 1JB3A 5C4ZA 2DNCA 4RAUC 3KLRA 1BF4A 3DWQA 4XXEA 1ENFA 1HA6A 5EBCA 1G6ZA 1IKMA 2NVQB 1STGA 1JWSD 5ELCA 2O2LD 1RCVD 4C3HG 2NBFA 2L12A 2F03A 4OIKA 5JEAG 4FF4A 2L11A 4KN4C 4HMIA 1G2TA 4KJOA 2MPMA 4A93B 4FF3A 5G3LD 1STHA 1EYCA 2DY7A 3R8BA 4LAAA 1K8OA 3KLSA 3DXJC 4F7XA 1SNQA 4OO1H 1CHPD 3PO2B 3NTKA 2O5IC 3VR6A 5JEAJ 2A5HA 1IYUA 2Q8IB 3EROA 2PCFB 5D65A 2Z1CA 4L8JA 3NWSA 1EU3A 1OXTA 1ESFA 3TP8A 1LACA 3K57A 5FOBB 3T16A 4OHJA 1S5BD 1SJED 1D5MC 2QF7A 1MGSA 1NR4A 1LTGD 3GV6A 2J0TD 3I90A 4IUVA 2R61A 2KEEA 3HEJA 5E4WC 2N88A 5IGDA 1TU2B 1SBBB 1NSNS 2AUJD 2K01A 3M4YA 4RCOA 3HOZB 1LT5D 1PTOB 5DEHA 2ID0A 3DHQA 4FO2A 4NW2A 3RZOB 2A69C 5M3FB 3AU7A 2EYFA 2JA7B 1HUNA 4X3UA 1PTOC 1TWHB 3HOYB 5FK9C 3DWPA 2G9DA 2NVTB 4ME5A 2EYMA 3IAYA 3G6JB 3WOEA 1DD2A 2A69D 2J4XA 1ZXTA 2E75C 3D6CA 1PTOD 1S5ED 3F2UA 4HR7B 2E2IB 3M85A 1EWHA 2K04A 1U4MA 5ELEA 2FMCA 2NTTA 3DMUA 2EDGA 3PUYA 1TY0A 5ELDA 5CMDA 4CKCA 4CKBA 2WB1B 4WFN3 3S9WA 3S1RB 3MZ5A 1Q8IA 4EQPA 2A68C 3FMCA 2L5TA 3H6MA 2VUMB 1M8AA 4RGOS 4EQOA 2HCIA 1EY8A 3CRLC 1LTSD 4BY1B 4V0BA 2PMZB 1I6VC 3PMFA 2K05A 2A68D 1EIGA 1TWCB 3VYUA 5J39A 2R6GA 1CT1D 4IUNA 2IWHA 4DAVA 5ISRA 4ZK9B 1GOZA 5CV6A 3QG1A 5J1ZA 2CQAA 2I46A 1KABA 1AZPA 5C3WA 2SDFA 2B2UC 1FNUA 2EJFC 4KI0A 1XTCD 4XYQA 1BCPB 2HQEA 1BDOA 5C3EB 2D2CC 3P75A 5IOCA 2SEBD 1E2VA 1PRTC 1BCPC 1OXSC 1D2BA 1LO5D 2JA6B 4S3SA 3MEHA 2NWGA 5I6YA 3J80E 4U673 1QNUA 2A6ED 2XNAC 5CBEE 1PMRA 4C3IB 4A3FB 4DXFA 4KK7A 5DNFA 2EYJA 1CA6A 2F4IA 2IX3A 3HP3A 1PRTD 1EY6A 1IW7C 1BCPD 2CVRA 3OSOA 2K6AA 4BBRB 1CA5A 4TQUS 2NVYB 1SYGA 2E2DC 3A8JE 3MXNA 1SE3A 5KYLA 2E2HB 4OO1I 3K59A 1RHPA 1PTOF 3TP6A 2JA8B 1SE2A 1D6EC 1I4XA 1B4OA 3Q0AA 3S15B 4K6LA 1JOKA 3VA5A 1AEXA 3Q23A 4B08A 1ML0D 5JVH3 1QNKA 3G7LA 4RHRA 4QMGA 1LTBD 4JK1C 4KY5A 1R4PB 2F0IA 2X6GA 3I4MB 4L63B 2QEJC 3P20A 3C3LA 4R9WA 2XN9C 3P1HA 1LV9A 5CV7A 4TKOB 1PZID 3HOUB 4IFDH 3J7YW 1EYDA 3PUXA 3QIAA 5I6WA 3KK7A 3NXWA 3VR5A 2BE5D 4Z9CB 4XIGS 4YIJA 3W3AA 4KHVA 2F0SA 4CBVA 3TZUA 3ND9A 4O42A 1AZQA 2A73B 1PFMA 4ZAIA 1SMYC 1PFNA 4NP5A 5JVG3 1Y8NB 1SAPA 4C3IG 4GZYC 1U4PA 3FPUB 4RH6A 3BVMA 4RGNA 4ABNA 2OT2A 4XT1B 3M7GA 2JA5B 3KBGA 1OO9B 1SYDA 4XQNA 2SNSA 3A7AB 3S2HB 4IALA 1HFNA 4G57A 2PW5A 3FVQA 4PMCA 1EL0A 4ZLTF 4KKTA 4M1UB 2QILA 1SJHD 4MIUA 1B44D 1BCPF 5C6AA 4CJ0B 1A3UA 4O1NA 3GTOB 1DOKA 5JPMC 5K36H 3N6RA 1CQFA 2B63B 1X3PA 4H13C 1ONLA 2JP1A 2F0QA 1TR5A 1SDFA 4PMBA 1HPCA 2RSOA 5LL6X 2H1EA 5KNDA 1SYBA 3GTJB 1F9RA 1TVXA 3OOCA 3I73A 1EOTA 2YU9B 1JOQA 4N9TA 4PMWA 1SFOB 1MBYA 1K8MA 4C56C 2Q8TA 5KNCA 2PO4A 2F3WA 1D5XC 2CW0D 3MC0B 5CV8A 1F2YA 1H9JA 3K5NA 1C48A 4KHZA 1QCBD 4QB4A 3NP8A 1FYCA 1H9SB 1ILPA 1JR0D 5EKKA 1JWMD 2DNEA 1QOHA 1YNNC 1I3QB 5C4HA 2LKVA 1SNDA 2KQ3A 3RD4A 1SEBD 3NTHA 1MSGA 1EY0A 3U9SA 2IJ0A 4EQNA 3NPPA 1YNND 3PUZA 1DOMA 3OMCA 4ZKCB 3RZDB 3T53B 2K33A 4AYBB 4X3SA 4K14A 1IHZA 1EQVA 4CKEA 1RDPD 2ZXOA 2D5DA 4XQJA 1JOOA 4K5WA 4KY6A 3VR2A 3OHXC 4RHSA 2B8FA 1F77A 4DK1A 3PV0A 4IFDI 1O7LA 5D3IB 1A15A 3IFTA 1X3QA 4U68A 1B1ZA 3KBXA 1NCVA 1SNOA 3IL8A 4ILWA 5CYUA 4ULLA 1HHVA 1J9OA 4DN4M 5JOBA 4H7BA 1M4VA 1AFPA 3FPPA 1DOLA 4DNTB 1D1KA 1EWCA 1EZ8A 1GUTA 2VNUD 4FYDA 2M00A 4K8JA 5I2YA 3ND8A 1Y1WB 2MUYA 1ESRA 1BNZA 3N52A 1G8ZD 1WD1A 4CJ2C 3NWTA 1LTAD 3PUVA 2EZVA 2K28A 4G7HC 4XYOA 5C0XH 1CQVA 4RGMA 5JAVA 4OO1G 2LY7A 2F1MA 1WTQA 2F0UA 4EGVA 5C5LA 2H4OA 2FHTA 4B9WA 1Y69U 4RGTA 3I4NB 1OXVA 4NKLA 2XIWA 2R92B 1ICWA 5IGGA 5D14A 1GHJA 2B8GA 3R2TA 4L6TB 4J1MA 1EZ6A 2WKCA 3TDQA 3T4AC 2K03A 4IN3A 5KIXA 3M4OB 1HQMC 1Q1EA 5FO9B 2PZWA 4A3DB 3KF8A 4KMUC 3PO3B 3H09A 2KEDA 2NN6H 2VB3X 1X32A 2KA7A 3V05A 3NE5B 3T56B 3TN2A 2G9HD 2KCNA 2TMPA 1KAAA 1QG7A 1WCMB 3K5MA 3M3YB 2F0LA 4Y7NB 4FNFA 5C44B 4FF1A 4QCLA 2BA1A 4A3KB 3VR4A 1MSHA 2JSOA 2F0MA 2EY1A 2AUKA 2EPBA 4ZKBB 2GA4B 2QDBA 2M9VA 1I50B 3DWAA 2HDLA 3OMGA 1NAPA 1KDBA 2LFNA 4FXKC 1S5CD 3MXUA 5EPLA 4KV6A 4UAIA 3SXHA 3E6ZX 4WORA 3K5LA 4XDXA 1EY5A 1WTRA 1HCZA 3S1QB 3SK4A 2HDMA 1A3VA 1V1PB 4RKLA 2E76C 3CQZB 1FD7D 1SNMA 1UNSA 1EFID 1SXTA 3CRKC 4A3EB 1RTOA 3TP7A 3QOLA 3W2DA 3NQIA 3QWNA 2LS01 1QB5D 1B50A 3OIPA 1C8CA 2EYHA 1STBA 1GUWA 4HTHA 1BO0A 3J7AV 1SYCA 3P7JA 1SE4A 3DM1A 4CGYB 1Z6HA 3D6WA 4MN3A 5TSSA 3O13A 5BN4A 2F0GA 4DU9A 1G91A 2L55A 1AP0A 5IIFA 3SK8A 2JE6I 4DK0A 5CC4A 3IKJA 2ICIA 2B2YA 4NDXA 3DEPA 3NTIA 5EPJA 3QB3A 1ZKOA 3OPOA 2ICEC 1U4LA 2K5QA 2JXMB 5KYIA 2KHSA 1KNEA 3GTKB 2JEAI 2R7ZB 2LMCB 5E1FA 3DEOA 2NYZD 5NUCA 2XRSD 1KNAA 4BA1I 1VMPA 2B2TA 4DAPA 1H9SA 2A6EC 5E4XA 3FKIB 3QO2A 1H9KA 4QIWB 3HG9A 1KLUD 4DGZA 3ITPA 2WINB 5C0XI 3SDZA 4K2LA 1G2SA 1D1IA 1RODA 2TSSA 3NSWA 3IFDA 1A2TA 1I4RA 3FDTA 1IKLA 1V43A 2RDHA 4XQQA 2MGSA 4F88A 1F2MA 3TMEA 3K7AB 1E2WA 1K83B 1LT6D 1RJTA 1EY9A 3BDCA 5KRUA 2A6HC 2BDNA 3E0JA 1DM0B 3R3OA 2AQ3B 2WV6D 2Y0SB 3SVMA 5FKAC 1QJOA 3LX0A 2C9OA 4HN7A 3EQLC 5HGTA 5ELFA 1CK1A 2HUGA 4IFDG 2NN6I 3NBHA 3A56A 2A6HD 4RCNA 2BDOA 4RA8A 4RKBA 4NMZA 4B9XA 2BE5C 3D31A 1DYQA 2FMMA 1JORA 4IFDJ 3L7ZC 2XWBB 1RTNA 3D3RA 1BOSA 2WACA 3MTSA 1Z47A 1STNA 1R4QB 2WAQB 1STYA 1L0YB 4G7ZC 2DN8A 2RDFA 2IT1A 5C4XB 3AB9A 5M5XB 3KLSX 3T13A 1TT2A 2WKDA 1HXYD 1CZGA 5K5PA 2RKSA 1J8IA 5ELBA 2PQEA 5LL6S 4TRDA 1DXMA 3EFXD 4FVMA 2EY6A 1XWEA 5EJWA 2E2JB 1AN8A 3M7NA 3TBIB 2B2VA 2DY8A 4DA2A 2KCCA 1DZ1A 1Q12A 3NK9A 2F0FA 5K36G 3A7LA 2V4DA 1H9MA 4G7OC 5CORA 3U9OA 1A2UA 3EVQA 1ZYRC 3HGBA 4RFBA 4RWSC 4PQXA 5EGTA 2X6LA 5I4DA 2F0DA 1ENAA 1PFBA 2K1BA 2FFKB 4K8IA 1ZYRD 2NB0A 1A3TA 1PYWD 3D4WA 2K5DA 4LK1C 1L0XB 3BG3A 3TZDA 2KOLA 4CHTB 3BDLA 3GP7A 2YYZA 1LT4D 2CW0C 5C4JB 5AFWA 3NQTA 1V1PA 3C2PA 3SK6A 1PLFA 2PZUA 2KECA 1B2TA 4PNYA 4J8QA 4ID6A 3BZDB 3LWEA 5LHY1 1TIID 2BOSA 1WD0A 3HS0C 3GV3A 2B2YC 3BVZA 4C3JB 3I4LA 1Q1BA 4KD3A 1FGBD 1Y8OB 3GTGB 3K58A 1RF2D 2SNMA 2F0NA 1A6XA 1B9NA 1ENCA 1Y8PB 1S4ZA 4WJWA 2B2TC 2RA4A 4Q5VA 3OWEB 1UAPA 4ZYSA 4X3TA 2F0EA 1AW7A 1F9QA 2L0CA 3MFYA 4HCSA 1TKWB 4JBWA 4LMQD 3R93A 3A54A 2QKIC 5F2DA 4ODGA 2F0JA 5BN5A 4KN7C 1U4RA 4BS9A 1WTWA 1D5ZC 3FRPB 1KLGD 5EPKA 1F2LA 4CJ1B 3URYA 1HRJA 4J6HA 5FO8B 4Q0FA 1F9PA 1UEAB 3S1NB 1II3A 2IPKD 1STEA 4HEDA 2O5JC 1TS5A 2IL8A 5M3MB 1CTMA 2VXWA 2D9UA 3K6OA 4FP5D 5C0XG 3WOFA 3LWUA 2EYPA 3RLFA 1I4QA 3SEBA 4BA2I 2XRQD 2Z4IA 3MWYW 5A2QE 3VYTA 3MA2B 4KKUA 5CR3A 5C0XJ 3BVGA 2A74C 4R8IA 2CHBD 1PXUA 2F3VA 1O7YA 1CZWA 4UDUC 3K0YA 4PV1C 2F0OA 2NTSA 2L1BA 4TSSA 1OXUA 1PDQA 1SNPA 3GTMB 3ERQA 3L3OC 1I6HB 5M5YB 2NN6G 3SR1A 1EYAA 2N55A 2I07B 2X69A 1EIHA 1EU4A 2EY5A 2BA0A 3H94A 1ILQA 1FR3A 1O80A 3I91A 2F0WA 1WTVA 4WRDA 5JEAH 2B2VC 5C3XA 1CI3M 5IT9E 1Y1VB 1JQYD 5A2QL 3PIO3 2B2WA 2R3ZA 1GXDC 2K7VA 4H0LC 3RMHA 3QJYA 1VDZA 4F8MA 1PZKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UAI A;  1DON A;  1U4P A;  2KUM A;  2CVR A;  3FPU B;  5CMD A;  1B2T A;  4IUU A;  1F9S A;  1CA5 A;  2K28 A;  5EQ0 A;  2VXW A;  4XDX A;  2D9U A;  2L4N A;  2MP1 A;  4HSV A;  4XT1 B;  1J8I A;  1ILP A;  1WTR A;  2JYO A;  3LWE A;  2EE1 A;  2HDM A;  4IUR A;  1RHP A;  1WTP A;  1B53 A;  1JIC A;  5CBE E;  1G2S A;  2B2U A;  1WTQ A;  5D65 A;  2RVL A;  4OIJ A;  1WD0 A;  1ROD A;  1B4O A;  1O7Z A;  2RSN A;  3GV3 A;  2B2Y C;  3MWY W;  1M8A A;  2FHT A;  1RTO A;  1MSG A;  2HCI A;  1HFN A;  3IFD A;  5EPL A;  1EL0 A;  3FDT A;  5EJW A;  4ZLT F;  1IKL A;  1MGS A;  2EOT A;  2XIW A;  4MHE A;  1ICW A;  2FJ2 A;  4R8I A;  1ML0 D;  1B50 A;  1NR4 A;  1QNK A;  2KVM A;  2MGS A;  5D14 A;  1EQT A;  3G7L A;  2L9H A;  2MJ8 A;  1DOM A;  3GV6 A;  5T1G A;  4ZKC B;  1C8C A;  4CJ0 B;  1GUW A;  2B2V A;  2DY8 A;  1RJT A;  1BO0 A;  5COY A;  1DOK A;  2K05 A;  1O7Y A;  3I90 A;  1DZ1 A;  4IUV A;  1S4Z A;  4IUP A;  1HUM A;  2B2T C;  2K03 A;  2KEE A;  2RA4 A;  4QUF A;  3P7J A;  3DM1 A;  2BDN A;  1Q3L A;  5E4W C;  2X6G A;  1EIG A;  2B2W C;  1BBX C;  3KUP A;  1X3P A;  2L1B A;  2N88 A;  4X3S A;  3D6W A;  4MN3 A;  1PDQ A;  1CM9 A;  4X3T A;  2JP1 A;  3SVM A;  2K01 A;  5COR A;  4R9W A;  1WTX A;  1SDF A;  1G91 A;  1LV9 A;  1AP0 A;  2RSO A;  1F9Q A;  2H1E A;  4HCS A;  3ONA B;  4NW2 A;  2HCC A;  3Q6S A;  1HFG A;  3I3C A;  2KED A;  1E0B A;  4LMQ D;  5T1I A;  3R93 A;  1NR2 A;  1WVL A;  2HUG A;  4X3K A;  5JJZ A;  5CBA E;  1XX8 A;  1HUN A;  4X3U A;  2N55 A;  4ZK9 B;  1X32 A;  4RWS C;  2FIN B;  3I8Z A;  1F9R A;  1A15 A;  1TVX A;  2X69 A;  1U4R A;  4HAE A;  2NZ1 D;  1AZP A;  4RAU C;  1X3Q A;  1EOT A;  2SDF A;  4U68 A;  1WTW A;  2B2U C;  1JE4 A;  2X6L A;  4RA8 A;  3TN2 A;  1BF4 A;  2B2Y A;  4IUQ A;  3DEP A;  3KBX A;  4QUC A;  1PFB A;  2K1B A;  3UI2 A;  1VMC A;  1NCV A;  1ILQ A;  4XT3 B;  5EPJ A;  1QG7 A;  2J7Z A;  3IL8 A;  1EIH A;  1HA6 A;  2FFK B;  1O80 A;  1HHV A;  3I91 A;  5EPK A;  1F2L A;  2FMM A;  1IKM A;  1G6Z A;  1J9O A;  4CJ1 B;  1HRJ A;  1B3A A;  4DN4 M;  1MI2 A;  1U4L A;  1ZXT A;  4CJ2 C;  3F2U A;  4IUT A;  1WTV A;  1KNE A;  1DOL A;  1IL8 A;  2Q8T A;  1QE6 A;  2Q8R E;  2NYZ D;  1RTN A;  3DEO A;  1F9P A;  1KNA A;  1MSH A;  2L12 A;  2B2V C;  2KOL A;  2NWG A;  4O42 A;  3TZD A;  1AZQ A;  4OIK A;  3MTS A;  1VMP A;  1U4M A;  2B2T A;  1PFM A;  2EPB A;  2K04 A;  2L11 A;  2M2L A;  3H91 A;  4ZAI A;  4ZKB B;  2B2W A;  1PFN A;  2R3Z A;  4HED A;  1G2T A;  5DNF A;  1XYI A;  1CA6 A;  1ESR A;  1SSO A;  2MPM A;  2HDL A;  5E4X A;  1NAP A;  1SAP A;  5AFW A;  3QO2 A;  5EKI A;  1BNZ A;  2DY7 A;  3N52 A;  1WD1 A;  2IL8 A;  3HP3 A;  1WTO A;  1PLF A;  2KEC A; 
#chains in the Genus database with same CATH topology
 4JI1 Q;  3Q24 A;  1JT8 A;  4BWG B;  3CKI B;  3X3N A;  5J22 A;  1IXR A;  5M3M G;  4J15 A;  3F2C A;  1EWI A;  1EY7 A;  3TP5 A;  1IYV A;  1GUG A;  4C2M H;  3NUC A;  2DJF C;  1PH6 A;  1R9T B;  3OW7 A;  3U50 C;  1O7Z A;  4K2K A;  3I56 A;  3S1N H;  3PUW A;  3F8T A;  3HOX H;  3GTL B;  3W5O A;  1UUP A;  1VS0 A;  1TWA B;  4A4I A;  1X65 A;  3VR3 A;  3GO5 A;  1PYB A;  1UWV A;  4NXM Q;  3CCS A;  4MHE A;  5JPN C;  2K5W A;  4N9P A;  3SK5 A;  2AWO A;  4E6I A;  1K9M C;  5J3B A;  1WOC A;  4IQZ A;  4BBS B;  1HUM A;  4QY7 A;  4IZ8 A;  1LAB A;  3S1M H;  2EVB A;  4C1N I;  1BBX C;  1VF7 A;  4OEL B;  1ICF B;  3S16 H;  2D62 A;  4DV2 L;  1DJR D;  5IYC H;  3H0G B;  2VQE Q;  1C7Y A;  3VYR A;  4AH6 A;  5IT9 L;  2NVX B;  4FF2 A;  1RKN A;  3CPF A;  4N8X 1;  1I4P A;  1LT3 D;  1FJG L;  2FIN B;  2XSC A;  5C5M A;  3HOW B;  4HAE A;  2NZ1 D;  2O4X A;  4A3M H;  2UUC Q;  1GUO A;  2EY2 A;  4ZUI A;  1EEI D;  3GTQ B;  1XJV A;  3C46 A;  2C5C A;  4IPH A;  1U9R A;  3PIO A;  4GOP A;  4I7Z C;  4R4T A;  3GTM H;  1AE2 A;  4ZUJ A;  5LMU L;  1IL8 A;  1WI5 A;  1SRO A;  3KLW A;  1QE6 A;  4OX9 L;  2NVQ H;  1I6H H;  1HTL D;  3SGI A;  3S14 B;  4ME3 A;  4QJF A;  3H91 A;  4FXG C;  4P73 A;  2RDG A;  1EEF D;  3VYS A;  1XYI A;  1YVC A;  4DF7 A;  4DR5 L;  1GHK A;  1Y1V G;  3S2D B;  1JC7 A;  2XGT A;  5FO7 B;  4A93 H;  2KUM A;  1DCZ A;  3MXG A;  4IUU A;  1TQO A;  5G3L F;  5EQ0 A;  3FEW X;  5I9P A;  2MHV A;  1Q90 A;  2NUC A;  1XXG A;  2EE1 A;  4IPC A;  3D4D A;  5BN3 A;  5KNB A;  3J7A F;  1PZJ D;  1CUK A;  2EXZ A;  2KHJ A;  3A8K E;  4UP9 A;  1WTP A;  3PO2 H;  2JEB I;  2EXD A;  1V1Q A;  4X62 Q;  2RVL A;  1HR0 Q;  2RSN A;  4B3S Q;  3MEF A;  5IGC A;  2AKW B;  3OIQ A;  2OXP A;  3QOJ A;  1PH8 A;  2RBM A;  1HH2 P;  2F0P A;  4A3I B;  3KDF B;  1PV4 A;  2WP8 J;  4Y52 H;  1G29 1;  1NUC A;  1EQT A;  3MAQ A;  2MJ8 A;  5KGU A;  1LTL A;  2EJM A;  1TY2 A;  2VB2 X;  5COY A;  5KEE A;  1VCI A;  1L2F A;  1AH9 A;  4POF A;  3LNN A;  3S17 B;  1HNW Q;  1PRT B;  4LF5 Q;  1SYE A;  3MFG A;  2RCN A;  1A8V A;  1PFS A;  1WTX A;  5EKL A;  3ONA B;  1BXT A;  2HCC A;  3Q6S A;  1HFG A;  4OL7 A;  1PTO H;  1E0B A;  1NR2 A;  1WVL A;  4DUY L;  5JJZ A;  3H0G G;  1NBW A;  3RZO H;  5M3F H;  2PQA A;  1JWU D;  5FLX E;  1TWH H;  1MD2 D;  5IGE A;  1JE4 A;  3BS1 A;  4LW1 A;  3MXP A;  2B39 A;  3HOY H;  3TS0 A;  3HKZ B;  4IUQ A;  2VQF L;  4QUC A;  3HOW G;  3UI2 A;  4BBS H;  3CCU A;  5I9O A;  5JJL A;  1LTI D;  3WDN A;  4K5V A;  4P75 A;  2J7Z A;  3HZX A;  1YBY A;  2Z6K C;  2RCF A;  4LJZ C;  3V2T A;  2D0O A;  3L9A X;  5EBD A;  4DXG A;  2HHH L;  1MI2 A;  1V8Q A;  2R93 B;  1PHJ A;  1PVO A;  3C1F A;  1BQQ T;  4JYA L;  2E2I H;  1KDA A;  4KD4 A;  1RD9 D;  2ZT9 C;  3C1E A;  2B29 A;  1L1O C;  2OQ0 A;  1GJX A;  1YNJ C;  1STA A;  1IW7 D;  3JAM E;  2ZJQ A;  1ET6 A;  2PYK A;  1T5X D;  5CV5 A;  4DV2 Q;  1N36 Q;  3H3V I;  2AWN A;  2EYL A;  3I72 A;  4X64 L;  2VL6 A;  3TSS A;  4GKK L;  4OON A;  4JBM A;  2L4N A;  3UE1 A;  3GTQ H;  4HSV A;  2K32 A;  3CD6 A;  1ASZ A;  2RHQ B;  2G5D A;  1VF5 C;  1N33 Q;  2OF1 A;  3EA6 A;  4IUR A;  1ET9 A;  3J81 E;  1B53 A;  1YNJ D;  1JIC A;  5DM6 3;  1C4Q A;  4X66 L;  4JC0 A;  2R7Z G;  5E7N A;  1HNX L;  3S14 H;  3ZYY X;  1T5E A;  1HZA A;  4M8A A;  5IY0 A;  1FNW A;  1HTP A;  1HJP A;  2VUM H;  1BKB A;  3X3M A;  5HUR A;  3J80 L;  3S2D H;  2YV5 A;  1M1K C;  4YHH L;  1GUS A;  4KY7 A;  5FLX L;  1YIJ A;  5EAY A;  2KVM A;  3LGJ A;  2E8G A;  3HRZ C;  5L37 A;  4OX9 Q;  3OTO L;  4A3I G;  4KKS A;  1QIL A;  4R8N A;  1CHQ D;  3I70 A;  1IBL L;  4IUP A;  2JK8 A;  2K4K A;  3TQY A;  2QGQ A;  3BU2 A;  2B2W C;  1HA5 A;  4P72 A;  1S3O A;  2IX0 A;  4DR5 Q;  1TS4 A;  3DLL A;  2ZXP A;  2FXQ A;  2F0H A;  3E5S A;  4LF4 L;  3SE0 A;  1TWC H;  4JG2 A;  5IOD A;  2NZO A;  5T1I A;  4GNX A;  2QCP X;  4IOC A;  1Z7T A;  1DGS A;  1LLR D;  1SNC A;  1GUN A;  3JC6 6;  3K81 C;  1TS3 A;  1SE8 A;  3JAM L;  3PIP 3;  4HSP A;  3R2I A;  1JJG A;  1I4G A;  1S72 A;  5DAU A;  1ZEQ X;  1JB7 A;  2WII B;  4JBK A;  4DAY A;  2IW3 A;  4XT3 B;  1W6J A;  5IGB A;  3D4R A;  1CSP A;  2KBN A;  1ASY A;  2F0V A;  3K5O A;  1W6K A;  5C3E H;  1IBM L;  1EQR A;  2RQX A;  4KTA A;  2OEO A;  2EYO A;  3MVV A;  3J81 L;  1B9M A;  3KYH C;  3L2P A;  2XWJ B;  2Q8R E;  2Z4H A;  5CGK A;  5AJ3 Q;  1SMY D;  4A3G B;  5CV4 A;  3NBI A;  4DNR B;  1HQR D;  2R93 G;  4DR1 L;  3SHL A;  5IYB G;  3A55 A;  3E0E A;  4C3I H;  2QEX A;  5EKI A;  4OWW B;  2F0K A;  2K75 A;  3KJO A;  4B3T L;  4K5X A;  4A3J B;  4L5S A;  1M90 C;  1TWF B;  5M9O A;  4I65 A;  1PRT F;  2MP1 A;  2ZTD A;  4DUY Q;  1SYF A;  4BBR H;  2JYO A;  1QWY A;  2F0T A;  2NVY H;  1VQE A;  3HKS A;  3NHH A;  3HOV B;  3T51 B;  2E2H H;  4OIJ A;  4EVO A;  5IYB H;  3G6E A;  2XVS A;  2JA8 H;  2VY3 A;  3DUZ A;  2VQF Q;  2EJG C;  3CP0 A;  4K6D A;  4BY7 B;  1S5D D;  3RUZ A;  3S15 H;  4KJN A;  2EOT A;  4QL5 A;  4X6A H;  4GOP C;  1YIT A;  1X3F A;  3A8I E;  1HZ9 A;  4LFB L;  2L9H A;  2PPB C;  2CH4 A;  1LTR D;  5T1G A;  2PW7 A;  5CV9 A;  2ZXR A;  4ZQ3 A;  2QW7 A;  3K8A A;  1JCK B;  3EIV A;  3CF5 A;  4JVZ A;  5M5W B;  4XTC S;  1I4H A;  2OCE A;  1Q81 C;  3GD7 A;  2ENB A;  3I4M H;  5IGF A;  3MHB A;  1CFM A;  4X64 Q;  3BDO A;  4QF4 A;  3I3C A;  5GAD C;  3PF4 A;  3PIP A;  2BCO A;  4X3K A;  3CPW A;  4A3B B;  1XX8 A;  2IX1 A;  1G6P A;  1BBU A;  3ULL A;  3HOU H;  3I8Z A;  4HJ7 A;  2Z8L A;  2ASB A;  2N8N A;  4X66 Q;  1BUV T;  1EY4 A;  2MO0 A;  4A3C G;  1Q8K A;  1HNX Q;  4PG3 A;  2AQ1 B;  2E5L Q;  1VMC A;  2A19 A;  5JJK A;  4V19 0;  1KDC A;  3GQB A;  4C3H B;  1B3A A;  4YHH Q;  5D3D A;  1X54 A;  4G4K A;  4IUT A;  1A0I A;  4LF7 L;  4DFA A;  1VQO A;  3OTO Q;  1UEB A;  5E3F A;  3CHB D;  3TRE A;  4GLX A;  4FXD A;  3BYY B;  1IBL Q;  1TWG B;  2M2L A;  1V1O A;  1H9R A;  1JJC B;  3CCJ A;  4A3G G;  1OXX K;  1SSO A;  4O2D A;  1O7I A;  1VQ6 A;  3T1H L;  3GDE A;  1WTO A;  4LF4 Q;  3H3V C;  2N3S A;  1DON A;  1F9S A;  3EJI A;  3K7U C;  2PQA B;  1LTT D;  4F87 A;  4HID A;  3CU7 A;  4A3J G;  5I2X A;  1VQJ A;  4C2M B;  5A35 A;  3AMU A;  1U5K A;  4DV3 L;  1HR0 W;  3PQI A;  2PZT A;  2B2U A;  3HOX B;  3M4Q A;  2JA5 H;  2WB1 E;  1BR9 A;  1FNV A;  3E9H A;  2KJX A;  1PH3 A;  4LFC L;  4C1N K;  3HOV G;  2E74 C;  3S2H H;  1PH4 A;  1IBM Q;  1YJW A;  3BYT B;  4BY7 G;  2FJ2 A;  2SOB A;  1E2Z A;  4HMJ A;  1TS2 A;  1TWF H;  4HCE A;  3S1M B;  4OGQ C;  3GTP B;  4OXP A;  1LUZ A;  4JW0 A;  1KTK A;  4QUF A;  1O78 A;  2PNR C;  4DR1 Q;  3GTO H;  2B3G A;  1Q3L A;  3S16 B;  4KHP L;  3OWF A;  3KUP A;  3OYY A;  3VA7 A;  2PMZ E;  3Q22 A;  4DR3 L;  1CM9 A;  3V96 A;  1EUJ A;  4ZRZ A;  1S5F D;  4B3T Q;  3D8G A;  2Z6K A;  4P2C B;  4JI5 L;  4H44 C;  5JJI A;  5DM7 3;  1X9N A;  2F4V Q;  1F2Z A;  5CBA E;  2AQ2 B;  4C3J G;  4A3M B;  3GTJ H;  2UXD L;  1YHB A;  2BH2 A;  1JB3 A;  5C4Z A;  2DNC A;  4RAU C;  4A3B G;  3KLR A;  1BF4 A;  4HJ5 A;  4X65 L;  3DWQ A;  3S24 A;  4XXE A;  1ENF A;  2P5Z X;  1HA6 A;  5EBC A;  5M5W H;  1XNQ L;  1G6Z A;  1IKM A;  1SFO H;  2NVQ B;  4NPS A;  1STG A;  1JWS D;  1SRU A;  3A0J A;  2O2L D;  5ELC A;  4LFB Q;  1RCV D;  4C3H G;  2NBF A;  2L12 A;  2F03 A;  4OIK A;  1VQ7 A;  5JEA G;  4A3B H;  3J7Z C;  2L11 A;  3VDY A;  4FF4 A;  2ALY B;  4KN4 C;  4HMI A;  1G2T A;  4KJO A;  2BH8 A;  2MPM A;  4A93 B;  1SMX A;  2CWA A;  4FF3 A;  5G3L D;  1STH A;  1EYC A;  2DY7 A;  3R8B A;  1Q46 A;  3UDF A;  4LAA A;  2N78 A;  1K8O A;  3KLS A;  1P8L A;  3DXJ C;  4F7X A;  3CCQ A;  1SNQ A;  1XPU A;  1QVC A;  4OO1 H;  1CHP D;  4GNX C;  3PO2 B;  3NTK A;  4C3H H;  3VR6 A;  2O5I C;  3HKZ E;  5JEA J;  2A5H A;  4GN4 B;  1IYU A;  1QUQ B;  2Q8I B;  3J7A 5;  4DAY B;  3ERO A;  2PCF B;  5D65 A;  2UXB L;  1I3Q H;  2Z1C A;  1I94 L;  1TWG H;  4L8J A;  3NWS A;  1EU3 A;  1OXT A;  1ESF A;  3TP8 A;  1LAC A;  3HOX G;  5FOB B;  3K57 A;  3T16 A;  4OHJ A;  1XMQ Q;  1S5B D;  4GN3 B;  1SJE D;  1D5M C;  2QF7 A;  1MGS A;  4DV5 Q;  4AQY L;  2Q2U A;  4LF7 Q;  1NR4 A;  1LTG D;  3GV6 A;  2J0T D;  2KEN A;  3E3X A;  2VZA A;  3I90 A;  4IUV A;  2R61 A;  2ZTC A;  3NEL A;  2KEE A;  3HEJ A;  5E4W C;  2N88 A;  5HGQ A;  5IGD A;  1TU2 B;  4DK6 C;  1SBB B;  1NSN S;  3TS2 A;  2AUJ D;  3T1H Q;  2K01 A;  3M4Y A;  4RCO A;  3HOZ B;  1LT5 D;  1PTO B;  4RMF A;  2ID0 A;  3DHQ A;  5DEH A;  5LMN L;  5IYC G;  4FO2 A;  4NW2 A;  3RZO B;  2LSS A;  3A5U A;  2A69 C;  5M3F B;  3AU7 A;  2EYF A;  2JA7 B;  1HUN A;  1PH2 A;  1BBW A;  4PZ6 A;  4X3U A;  2XTI A;  1PTO C;  1TWH B;  4DV0 L;  2R7D A;  4DV3 Q;  2L15 A;  3HOY B;  3UDI A;  5FK9 C;  4A3L H;  3DWP A;  3T1Y L;  2A8V A;  2G9D A;  3GTP H;  2NVT B;  4A3M G;  4LFC Q;  4JI6 L;  4ME5 A;  2EYM A;  3IAY A;  3G6J B;  3WOE A;  1DD2 A;  1FGU A;  2A69 D;  1Z9F A;  4GKJ L;  2J4X A;  1ZXT A;  3CCR A;  2E75 C;  3D6C A;  1PTO D;  1S5E D;  3F2U A;  4HR7 B;  2E2I B;  2K50 A;  4MTK A;  3M85 A;  2F52 A;  1EWH A;  2K04 A;  1U4M A;  1GKH A;  1YHQ A;  1E22 A;  5ELE A;  1TXY A;  2FMC A;  2NTT A;  1U0L A;  3DMU A;  2EDG A;  3PUY A;  1TY0 A;  5ELD A;  4DR2 L;  1Y1W H;  2C35 B;  1KL9 A;  2UXC L;  5CMD A;  4CKC A;  4CKB A;  4JI5 Q;  4A93 G;  2WB1 B;  4WFN 3;  2HIX A;  3S9W A;  5DLQ E;  1IZ6 A;  4LFA L;  1B8A A;  3S1R B;  3CCM A;  2UXD Q;  3MZ5 A;  3AEV A;  1Q8I A;  4EQP A;  2RF4 A;  3PO2 G;  4X65 Q;  5ELO A;  2GVA A;  2A68 C;  3FMC A;  2L5T A;  3H6M A;  3TRZ A;  2VUM B;  1M8A A;  4RGO S;  4EQO A;  2HCI A;  1EY8 A;  1XNQ Q;  1V9P A;  3CRL C;  1LTS D;  4BY1 B;  4OEM B;  4V0B A;  3I4N H;  2PMZ B;  1I6V C;  3PMF A;  4LWC A;  2R92 H;  4JI7 L;  3AQQ A;  2K05 A;  3KF6 B;  2A68 D;  2K5V A;  1EIG A;  2JN4 A;  3BZK A;  3EN2 A;  1TWC B;  3VYU A;  5J39 A;  1Q82 C;  1B7Y B;  2R6G A;  1WYD A;  1GO3 E;  1CT1 D;  4IPG A;  1K8A C;  4IUN A;  4A3D H;  2IWH A;  4DAV A;  3HOZ G;  5ISR A;  4ZK9 B;  1GOZ A;  5CV6 A;  4DV1 Q;  3PO3 H;  3QG1 A;  5J1Z A;  4I7A A;  5M3F G;  1J6Q A;  2CQA A;  2I46 A;  1KAB A;  2JA7 G;  1AZP A;  5C3W A;  2SDF A;  2B2U C;  1FNU A;  1YZ6 A;  2EJF C;  1JE5 A;  4KI0 A;  1XTC D;  4XYQ A;  3HOY G;  1BCP B;  2HQE A;  4CDC C;  1BDO A;  5C3E B;  2D2C C;  2K5H A;  4BBS G;  4JI0 L;  3P75 A;  3B6Y A;  5IOC A;  2SEB D;  1E2V A;  1PRT C;  4AQY Q;  4B3R L;  1BCP C;  1OXS C;  1WCM H;  4P71 A;  3M3Y H;  3HOZ H;  1YEZ A;  1D2B A;  1LO5 D;  2JA6 B;  4S3S A;  3MEH A;  5C44 H;  1FL0 A;  4JI4 L;  2NWG A;  5I6Y A;  3J80 E;  2JQO A;  4U67 3;  1QNU A;  4A3K H;  2A6E D;  2XNA C;  2JA7 H;  1D7Q A;  5CBE E;  1PMR A;  4HJA A;  4C3I B;  4A3F B;  4DXF A;  4KK7 A;  2CFM A;  1CKM A;  5DNF A;  2EYJ A;  2Z9H A;  1CA6 A;  2F4I A;  2ES2 A;  2IX3 A;  1PH7 A;  3HP3 A;  1PRT D;  1EY6 A;  2NVT H;  1IW7 C;  1BCP D;  2CVR A;  3OSO A;  4LF8 L;  2K6A A;  4BBR B;  1CA5 A;  4TQU S;  2NVY B;  1SYG A;  2E2D C;  3A8J E;  3MXN A;  1SE3 A;  5KYL A;  2E2H B;  2WB1 G;  4OO1 I;  3K59 A;  1RHP A;  1PTO F;  3TP6 A;  2JA8 B;  4DR6 L;  1SE2 A;  1VQG A;  3S1Q H;  1D6E C;  1I4X A;  1B4O A;  3Q0A A;  4JI6 Q;  3S15 B;  4K6L A;  3CQZ H;  1NE3 A;  1JOK A;  3VA5 A;  4A3E H;  2VUM G;  4GKJ Q;  1AEX A;  3Q23 A;  4B08 A;  1ML0 D;  5JVH 3;  1QNK A;  3G7L A;  1N8R C;  4RHR A;  1FJG Q;  4QMG A;  1LTB D;  3ULP A;  3W1G A;  4JK1 C;  3OW2 A;  4KY5 A;  3S1R H;  1R4P B;  2F0I A;  2X6G A;  2JJQ A;  3I4M B;  4L63 B;  2QEJ C;  3P20 A;  3C3L A;  1X55 A;  4DR2 Q;  2UXC Q;  4R9W A;  2XN9 C;  3P1H A;  4JOI A;  1LV9 A;  5CV7 A;  3NEM A;  3ERS X;  4TKO B;  1KQS A;  1PZI D;  3HOU B;  4AYB E;  4BXX H;  1XPO A;  4IFD H;  5HY6 A;  3TEH B;  5LMU Q;  3J7Y W;  3U4V A;  4BY1 H;  2K52 A;  1EYD A;  3PUX A;  2QA4 A;  3G71 A;  3QIA A;  1VQ9 A;  2RHS B;  5I6W A;  4KLK A;  3KK7 A;  2EQS A;  1MHW C;  3NXW A;  4YWL A;  3VR5 A;  2BE5 D;  3KF8 B;  5IP9 H;  4Z9C B;  3I4O A;  4HJ8 A;  5FJ8 H;  4XIG S;  4YIJ A;  1YI2 A;  3W3A A;  1VQM A;  1N34 L;  4KHV A;  2F0S A;  5C3E G;  4CBV A;  3TZU A;  4IOA A;  3ND9 A;  4JI7 Q;  4O42 A;  1AZQ A;  2A73 B;  1PFM A;  3HFZ B;  4ZAI A;  1SMY C;  1PFN A;  4NP5 A;  5JVG 3;  5IE8 A;  1Y8N B;  1QUQ A;  1SAP A;  3I55 A;  4C3I G;  2DUD A;  5BR8 L;  4A3F G;  1MKH A;  4GZY C;  1U4P A;  3FKI H;  3FPU B;  1Q86 C;  3HKZ G;  4RH6 A;  3BVM A;  4RGN A;  4ABN A;  2OT2 A;  4XT1 B;  3M7G A;  4BBR G;  2JA5 B;  3KBG A;  1X3E A;  1OO9 B;  2JA6 H;  1SYD A;  4XQN A;  2SNS A;  3RLN A;  3A7A B;  3S2H B;  2JA8 G;  1X56 A;  3RR5 A;  4YY3 L;  4A3F H;  4IAL A;  4ALP A;  1HFN A;  4G57 A;  1EQQ A;  2PW5 A;  3FVQ A;  1E24 A;  4PMC A;  4JI0 Q;  1EL0 A;  2KCT A;  4ZLT F;  4B3R Q;  3AYH B;  4KKT A;  4M1U B;  2QIL A;  1SJH D;  4MIU A;  5IYD H;  3I2Z A;  1B44 D;  1BCP F;  5C6A A;  4CJ0 B;  1A3U A;  3K0X A;  4O1N A;  4JI4 Q;  3GTO B;  1DOK A;  3K7A H;  5JPM C;  4UPA A;  5K36 H;  3N6R A;  4O0A A;  4JI3 L;  1CQF A;  2VW9 A;  2B63 B;  1EIF A;  1X3P A;  2ZJP A;  4H13 C;  1ONL A;  2JP1 A;  2F0Q A;  2AHO B;  1TR5 A;  1K73 C;  1SDF A;  4PMB A;  1HPC A;  3I4M G;  2RSO A;  5LL6 X;  1J5E L;  2H1E A;  5KND A;  3F2D A;  4JV5 L;  1SYB A;  2HHH Q;  3GTJ B;  1K3B C;  2I5M X;  3CME A;  5IT9 c;  1F9R A;  1TVX A;  4DR6 Q;  1IL2 A;  3HOU G;  4JYA Q;  2VS1 A;  3OOC A;  4DR4 L;  3I73 A;  4QQB X;  1EOT A;  2YU9 B;  2OTJ A;  1JOQ A;  1Q7Y C;  4N9T A;  2OQK A;  4PMW A;  1SFO B;  1MBY A;  1YNX A;  2QDL A;  1K8M A;  3U58 A;  2OTL A;  4GKK Q;  1RL2 A;  4C56 C;  2Q8T A;  5KNC A;  2PO4 A;  2F3W A;  3ULJ A;  1D5X C;  1CKO A;  1MIU A;  2CW0 D;  2PNH A;  3MC0 B;  5CV8 A;  1N32 L;  1QVG A;  1F2Y A;  1H9J A;  3K5N A;  1C48 A;  4KHZ A;  3W1B A;  1XMO L;  5FLM G;  1KRS A;  1QCB D;  4QB4 A;  3H15 A;  3NP8 A;  5C4X H;  2CH4 W;  1X3G A;  5M5X H;  1FYC A;  1H9S B;  1UE5 A;  1ILP A;  4CDD C;  1JR0 D;  5EKK A;  4HIK A;  1JWM D;  2DNE A;  1QOH A;  1YNN C;  1I3Q B;  5C4H A;  1A63 A;  2LKV A;  1SND A;  2KQ3 A;  3RD4 A;  4ZCK A;  4IO9 A;  2UUB L;  5FLM H;  2JA5 G;  1SEB D;  3NTH A;  1MSG A;  3KF6 A;  1EY0 A;  3U9S A;  1WFQ A;  2IJ0 A;  1N34 Q;  3CMA A;  4EQN A;  4R4I A;  3NPP A;  1YNN D;  1K0S A;  3PUZ A;  1DOM A;  3OMC A;  1WJJ A;  4ZKC B;  1OTC A;  2E2J H;  4GN5 A;  3CCE A;  3RZD B;  3CW2 C;  1GD7 A;  4UHV A;  3T53 B;  1EOV A;  2K33 A;  4AYB B;  2OWO A;  4X3S A;  4K14 A;  1IHZ A;  1EQV A;  5BR8 Q;  4CKE A;  1RDP D;  2ZXO A;  2D5D A;  4UP8 A;  4XQJ A;  1JOO A;  2B63 G;  3UE0 A;  3MXN B;  4K5W A;  4KY6 A;  3VR2 A;  4H02 A;  3OHX C;  4RHS A;  2B8F A;  3CCL A;  1F77 A;  4DK1 A;  3PV0 A;  4IFD I;  1O7L A;  3DM3 A;  5D3I B;  1A15 A;  3IFT A;  1YJN A;  1X3Q A;  4U68 A;  1B1Z A;  3KBX A;  3CC4 A;  4YY3 Q;  1G51 A;  1NMF A;  1NCV A;  2MFI A;  1SNO A;  3IL8 A;  4ILW A;  5CYU A;  4ULL A;  2B63 H;  3G48 A;  1HHV A;  1J9O A;  3F2B A;  1KHI A;  4DN4 M;  5JOB A;  4H7B A;  1M4V A;  1VQP A;  3FPP A;  1AFP A;  1DOL A;  4DNT B;  1D1K A;  1EWC A;  1JJ2 A;  1EZ8 A;  1GUT A;  2VNU D;  4JI3 Q;  4FYD A;  2M00 A;  4K8J A;  5I2Y A;  5GAH C;  3ND8 A;  1Y1W B;  2MUY A;  1ESR A;  1S40 A;  1BNZ A;  1EYG A;  3ICE A;  3N52 A;  1G8Z D;  2YU9 H;  1WD1 A;  4CJ2 C;  5C4J H;  4JOI C;  1J5E Q;  4JV5 Q;  3NWT A;  1LTA D;  3PUV A;  2EZV A;  2K28 A;  3PCO B;  4G7H C;  4XYO A;  5C0X H;  1CQV A;  4RGM A;  5JAV A;  4OO1 G;  1XTD A;  2KHI A;  2LY7 A;  2F1M A;  2ZTE A;  4DR4 Q;  1NTG A;  1GVP A;  1WTQ A;  2F0U A;  2CKZ B;  4EGV A;  2DJG C;  2LXJ A;  2H4O A;  5C5L A;  2FHT A;  4B9W A;  1Y69 U;  2EIF A;  4RGT A;  4JPB W;  3I4N B;  2N49 A;  1OXV A;  4NKL A;  2XIW A;  4DKA C;  2R92 B;  1ICW A;  2AMC B;  2ZJR A;  5IGG A;  5D14 A;  1GHJ A;  3J80 c;  2B8G A;  3R2T A;  4L6T B;  4J1M A;  5FLX c;  1EZ6 A;  2WKC A;  2YTY A;  3RLO A;  3T4A C;  3TDQ A;  3GTG H;  2K5N A;  2K03 A;  4IN3 A;  1N32 Q;  5GAE C;  1HR0 L;  5KIX A;  1SLJ A;  4CDF C;  1HQM C;  3M4O B;  4POG A;  1Q1E A;  5FO9 B;  4GLA C;  2PZW A;  4AYB G;  4A3D B;  2GN5 A;  3KF8 A;  4GLV B;  4K0K L;  4KMU C;  2MO1 A;  3PO3 B;  3H09 A;  4A76 A;  2KED A;  2NN6 H;  2VB3 X;  1UE6 A;  3CC2 A;  1X32 A;  2Y0S E;  2KA7 A;  3V05 A;  3NE5 B;  2F3I A;  4UY8 C;  3T56 B;  3TN2 A;  2UUB Q;  2G9H D;  4A3L G;  3RZD H;  3PF5 A;  2KCN A;  3JAM c;  2D0P A;  2TMP A;  1KAA A;  1QG7 A;  1VQH A;  1KRT A;  1WCM B;  3K5M A;  3M3Y B;  2F0L A;  4Y7N B;  4FNF A;  5C44 B;  4FF1 A;  4QCL A;  2BA1 A;  4DNI A;  4A3K B;  3VR4 A;  1MSH A;  1HZC A;  3J81 c;  2JSO A;  2F0M A;  4LF9 L;  2EY1 A;  2AUK A;  2EPB A;  4ZKB B;  2GA4 B;  2QDB A;  2M9V A;  1I50 B;  4HIM A;  3BJU A;  3DWA A;  2HIV A;  2I5L X;  2HDL A;  3OMG A;  1NAP A;  1IYJ B;  1KDB A;  2LFN A;  4FXK C;  1S5C D;  2NZH A;  3MXU A;  5EPL A;  4A75 A;  4KV6 A;  4UAI A;  1Y1W G;  1B3Q A;  3SXH A;  3E6Z X;  4WOR A;  3K5L A;  4XDX A;  1EY5 A;  2WAQ E;  1WTR A;  5M3M H;  1HCZ A;  3S1Q B;  3SK4 A;  2HDM A;  1A3V A;  1V1P B;  4RKL A;  3G4S A;  1XNR L;  4KHP Q;  2E76 C;  3CQZ B;  1FD7 D;  3FHW A;  1SNM A;  1UNS A;  1EFI D;  1SXT A;  3CRK C;  4A3E B;  1RTO A;  1VQF A;  4DR3 Q;  3TP7 A;  1N36 L;  1JMC A;  2WFW A;  3QOL A;  3W2D A;  4MNO A;  3NQI A;  3QWN A;  2LS0 1;  1KD1 C;  1QB5 D;  1B50 A;  3L0O A;  3OIP A;  3A5Z B;  3I4N G;  2YTX A;  1N33 L;  1C8C A;  2EYH A;  4B3M L;  1STB A;  1GUW A;  1YJ9 A;  1VQN A;  4HTH A;  2R92 G;  1BO0 A;  3J7A V;  3QR8 A;  3J81 j;  1SYC A;  3P7J A;  1SE4 A;  3DM1 A;  3PGZ A;  4NB3 A;  4CGY B;  1Z6H A;  3D6W A;  4MN3 A;  3K80 C;  5TSS A;  3O13 A;  5BN4 A;  2F0G A;  4DU9 A;  1G91 A;  2L55 A;  1KAW A;  1AP0 A;  2I5H A;  5IIF A;  4L5R C;  3SK8 A;  2HD3 A;  2JE6 I;  1GM5 A;  4A3D G;  4DPG A;  1K8G A;  4DK0 A;  1BVS A;  5M5Y H;  3PO3 G;  1E3P A;  5CC4 A;  4JBJ A;  3IKJ A;  2CCZ A;  2ICI A;  3J80 i;  2B2Y A;  4NDX A;  3DEP A;  3NTI A;  1PH1 A;  5EPJ A;  3QB3 A;  1ZKO A;  3OPO A;  2ICE C;  3D0F A;  5H1S E;  3M4O H;  3ZJY C;  1U4L A;  2K5Q A;  2JXM B;  5KYI A;  2KHS A;  1KNE A;  3GTK B;  1WCM G;  2JEA I;  2R7Z B;  2LMC B;  5E1F A;  3DEO A;  2NYZ D;  5NUC A;  2XRS D;  1KNA A;  4YCW A;  4BA1 I;  5C44 G;  1PH9 A;  1VMP A;  2B2T A;  2IHF A;  4DAP A;  1H9S A;  4A3K G;  4WJ4 A;  1NMG A;  2UXB Q;  1Y1V H;  2A6E C;  1KC8 C;  5E4X A;  3FKI B;  1I94 Q;  3QO2 A;  4R4O A;  3JAM i;  4K0K Q;  3ER0 A;  5GRO A;  1E1O A;  1H9K A;  4EX5 A;  4QIW B;  4Y7N H;  5AJ3 L;  3HG9 A;  1KLU D;  4DGZ A;  3ITP A;  2WIN B;  5C0X I;  3SDZ A;  1K0R A;  4K2L A;  1G2S A;  1D1I A;  3J81 i;  1ROD A;  2TSS A;  2GVB A;  3NSW A;  5IP7 G;  1I50 H;  1R9T H;  3IFD A;  1A2T A;  2CQO A;  4GS3 A;  1I4R A;  3GTL H;  3FDT A;  4YCU A;  5LMN Q;  1VQB A;  1IKL A;  4A3E G;  1TWA H;  2ZM6 L;  1V43 A;  2RDH A;  1VQK A;  4XQQ A;  2MGS A;  4F88 A;  1F2M A;  3TME A;  3K7A B;  1HNZ L;  1VQA A;  1E2W A;  4WJ3 M;  1K83 B;  1LT6 D;  1RJT A;  4DV0 Q;  4LF9 Q;  1EY9 A;  3BDC A;  5KRU A;  2A6H C;  2BDN A;  4DV7 L;  3T1Y Q;  3E0J A;  1DM0 B;  3R3O A;  2AQ3 B;  2WV6 D;  2Y0S B;  5IP7 H;  3SVM A;  5FKA C;  1QJO A;  2MQH A;  3LX0 A;  2C9O A;  3AFP A;  4YWM A;  4HN7 A;  3EQL C;  5HGT A;  5ELF A;  1CK1 A;  1I5F A;  3H0G H;  1L1O B;  1IBK L;  2HUG A;  2UU9 L;  4DR7 L;  4AIM A;  4BXX G;  4IFD G;  2NN6 I;  3NBH A;  2NVX H;  3A56 A;  5IWA L;  4NXN L;  2A6H D;  4BY1 G;  1EFW A;  4RCN A;  1UE7 A;  1XNR Q;  2BDO A;  4RA8 A;  4RKB A;  4NMZ A;  4R4C A;  3HOW H;  1B70 B;  4B9X A;  2BE5 C;  2HQL A;  5IP9 G;  4JI2 L;  3D31 A;  3RN2 A;  1DYQ A;  4QGU A;  2FMM A;  5FJ8 G;  1JOR A;  4IFD J;  1C9O A;  3L7Z C;  4B3M Q;  4P74 A;  2XWB B;  1VQ5 A;  1RTN A;  4LFA Q;  3D3R A;  3RNU A;  1BOS A;  2WAC A;  3MTS A;  1Z47 A;  1STN A;  1R4Q B;  1FVI A;  1PYS B;  2WAQ B;  1STY A;  2E5L L;  1L0Y B;  4G7Z C;  2DN8 A;  2RDF A;  2IT1 A;  5C4X B;  3AB9 A;  4OWX B;  5M5X B;  3KLS X;  3T13 A;  1TT2 A;  2WKD A;  1HXY D;  1CZG A;  3FKI G;  5K5P A;  2RKS A;  1J8I A;  4IJH A;  1VQC A;  1QZH A;  4LUO A;  5ELB A;  2PQE A;  5LL6 S;  4TRD A;  1E1T A;  4JI8 L;  2K14 A;  1DXM A;  2R7Z H;  3GTK H;  3M9B A;  4N8F A;  2JA6 G;  1N9W A;  3EFX D;  2IY5 B;  4FVM A;  2EY6 A;  2Z0S A;  1XWE A;  5EJW A;  1EIY B;  2E2J B;  1AN8 A;  4DAM A;  3M7N A;  4A3I H;  4UP7 A;  4TVA B;  4HJ9 A;  3TBI B;  4IPD A;  5IYD G;  2B2V A;  2DY8 A;  4DA2 A;  2DGY A;  2KCC A;  1DZ1 A;  1Q12 A;  3NK9 A;  2F0F A;  5K36 G;  3A7L A;  2V4D A;  4DV6 L;  4DV4 L;  1VQL A;  4PZ8 A;  3S17 H;  1H9M A;  4G7O C;  4OWT B;  5COR A;  3U9O A;  4R4Q A;  4R1J A;  1CKN A;  2ATW A;  1A2U A;  4DUZ L;  1Y14 B;  2Y0S G;  3EVQ A;  3UDX A;  1ZYR C;  2A1A A;  3HGB A;  4RFB A;  2Q2I A;  2LXK A;  4RWS C;  4PQX A;  5EGT A;  2X6L A;  5I4D A;  1PH5 A;  2Z6B A;  1K83 H;  2F0D A;  1ENA A;  1NJI C;  1PFB A;  2K1B A;  2FFK B;  4K8I A;  2UUA L;  1ZYR D;  2NB0 A;  4LF8 Q;  1SR3 A;  1D8L A;  2F4V L;  4EQ5 A;  1A3T A;  2ZM6 Q;  1PYW D;  1KIX A;  3D4W A;  2K5D A;  4JCV E;  4LK1 C;  1HNZ Q;  1L0X B;  3BG3 A;  3TZD A;  2KOL A;  4CHT B;  3AFQ A;  2R93 H;  3BDL A;  3GP7 A;  2YYZ A;  4MZ9 A;  2IHE A;  1LT4 D;  4DV7 Q;  2CW0 C;  3F1Z A;  5C4J B;  4CDE C;  4GOP B;  5AFW A;  3NQT A;  1V1P A;  3NEN A;  3C2P A;  4L5Q A;  3SK6 A;  1PLF A;  2PZU A;  2KEC A;  2WAQ G;  1B2T A;  1W3S A;  4PNY A;  1VQD A;  5C4X G;  4J8Q A;  1IBK Q;  1VQ8 A;  4ID6 A;  2UU9 Q;  4DR7 Q;  1KXL A;  3BZD B;  3LWE A;  3CC7 A;  1MJC A;  3E9I A;  3KFU A;  2H5X A;  5IWA Q;  4NXN Q;  4PZ7 A;  3CAM A;  5LHY 1;  1TII D;  2BOS A;  1WD0 A;  1LM0 A;  3HS0 C;  3GV3 A;  2B2Y C;  3WWV A;  4LNQ A;  2V1C C;  4JI2 Q;  3BVZ A;  4C3J B;  3I4L A;  1H95 A;  1Q1B A;  4KD3 A;  2Q2T A;  1FGB D;  1Y8O B;  3GTG B;  3K58 A;  1RF2 D;  1C0A A;  2SNM A;  2F0N A;  3RN5 A;  1A6X A;  1B9N A;  1ENC A;  3KJP A;  1Y8P B;  1S4Z A;  2PI2 A;  2B2T C;  2RA4 A;  4WJW A;  4Q5V A;  4LF6 L;  1QVF A;  3OWE B;  1UAP A;  1X6O A;  4ZYS A;  3A74 A;  4X3T A;  2F0E A;  1XMQ L;  1AW7 A;  1P16 A;  1F9Q A;  2L0C A;  3MFY A;  4JI1 L;  4DV5 L;  1YHA A;  4HCS A;  1TKW B;  4JBW A;  4LMQ D;  3R93 A;  1NNX A;  3A54 A;  2QKI C;  5F2D A;  4ODG A;  2F0J A;  5BN5 A;  2JA9 A;  4JI8 Q;  4KN7 C;  1U4R A;  4BS9 A;  4IJL A;  4A3C H;  1WTW A;  1D5Z C;  1T9H A;  3STB C;  3CXC A;  1K3R A;  3FRP B;  1KLG D;  1NY4 A;  1W2B A;  1L0W A;  5EPK A;  1F2L A;  4CJ1 B;  3URY A;  4NXM L;  2MNA A;  1HRJ A;  1VQ4 A;  4LUV A;  4J6H A;  1WTH A;  4APV A;  5FO8 B;  4Q0F A;  3BZC A;  3KDF A;  4LUZ A;  1PA6 A;  1F9P A;  1UEA B;  3S1N B;  1II3 A;  3STB D;  2IPK D;  2YTV A;  4A3G H;  4YCV A;  4DV6 Q;  1STE A;  4HED A;  2O5J C;  1SN8 A;  4DV4 Q;  1TS5 A;  2PI2 E;  2IL8 A;  1K28 A;  3M4P A;  3U4Z A;  2VQE L;  4DUZ Q;  3NBH B;  5M3M B;  1CTM A;  2VXW A;  4A3J H;  2D9U A;  3CCV A;  5ELN A;  3K6O A;  4FP5 D;  5C0X G;  3WOF A;  3LWU A;  2CWP A;  2EYP A;  3RLF A;  1I4Q A;  3SEB A;  4BA2 I;  2XRQ D;  3PSI A;  2Z4I A;  2UUC L;  3HOV H;  3MWY W;  5A2Q E;  5LMN W;  3VYT A;  3MA2 B;  2UUA Q;  4DK3 C;  2R7F A;  4BY7 H;  1CSQ A;  4KKU A;  5CR3 A;  5C0X J;  3UDG A;  3BVG A;  2A74 C;  4R8I A;  2CHB D;  1VQI A;  2I0Q A;  1PXU A;  1HZB A;  2F3V A;  1O7Y A;  1L1O A;  1CZW A;  4UDU C;  3K0Y A;  4PV1 C;  1AE3 A;  3Q8D A;  2F0O A;  2NTS A;  4HIO A;  2L1B A;  3I7F A;  4TSS A;  1OXU A;  1PDQ A;  1SNP A;  1A62 A;  3GTM B;  3ERQ A;  3L3O C;  4QIW E;  3KOJ A;  1I6H B;  5M5Y B;  1MJE A;  2NN6 G;  3SR1 A;  1EYA A;  2N55 A;  4C3J H;  2I07 B;  2X69 A;  3IRB A;  1EIH A;  1UE1 A;  1EU4 A;  4X62 L;  3EBE A;  2EY5 A;  2BA0 A;  3H94 A;  4FDB A;  4B3S L;  1XMO Q;  1RIP A;  1ILQ A;  1XPR A;  4GNX B;  1FR3 A;  1O80 A;  3I91 A;  2F0W A;  1WTV A;  4DV1 L;  4WRD A;  4RG1 A;  3FP9 A;  2B2V C;  1LYL A;  5C3X A;  5JEA H;  2KCM A;  1CI3 M;  4L5T A;  5IT9 E;  1Y1V B;  1JQY D;  2Q2H A;  4YWK A;  5A2Q L;  3PIO 3;  4LF6 Q;  5GAG C;  2B2W A;  1CKN B;  1GXD C;  2R3Z A;  2K7V A;  4MTN A;  5GQO A;  2HT1 A;  4LF5 L;  1HNW L;  4H0L C;  3RMH A;  3H3V H;  3QJY A;  1VDZ A;  4F8M A;  1PZK D;  1QZG A;  1E7Z A; 
#chains in the Genus database with same CATH homology
 3Q24 A;  4BWG B;  3CKI B;  3X3N A;  5J22 A;  1EY7 A;  3TP5 A;  1IYV A;  1GUG A;  3NUC A;  1R9T B;  3OW7 A;  1O7Z A;  4K2K A;  3PUW A;  3GTL B;  1UUP A;  1TWA B;  3VR3 A;  3GO5 A;  4MHE A;  5JPN C;  2K5W A;  4N9P A;  3SK5 A;  2AWO A;  4E6I A;  4IQZ A;  4BBS B;  1HUM A;  4IZ8 A;  1LAB A;  2EVB A;  4C1N I;  1BBX C;  1VF7 A;  2D62 A;  1DJR D;  3H0G B;  3VYR A;  5IT9 L;  2NVX B;  4FF2 A;  1RKN A;  1I4P A;  1LT3 D;  2FIN B;  2XSC A;  5C5M A;  3HOW B;  4HAE A;  2NZ1 D;  2O4X A;  1GUO A;  2EY2 A;  4ZUI A;  1EEI D;  3GTQ B;  3C46 A;  2C5C A;  1U9R A;  4I7Z C;  4ZUJ A;  1IL8 A;  1QE6 A;  1HTL D;  3S14 B;  3H91 A;  4FXG C;  2RDG A;  1EEF D;  3VYS A;  1XYI A;  4DF7 A;  1GHK A;  3S2D B;  1JC7 A;  5FO7 B;  2KUM A;  1DCZ A;  3MXG A;  4IUU A;  1TQO A;  5G3L F;  5EQ0 A;  3FEW X;  5I9P A;  2MHV A;  1Q90 A;  2NUC A;  1XXG A;  2EE1 A;  3D4D A;  5BN3 A;  5KNB A;  3J7A F;  1PZJ D;  2EXZ A;  3A8K E;  1WTP A;  2JEB I;  2RVL A;  2RSN A;  5IGC A;  3OIQ A;  2OXP A;  3QOJ A;  2RBM A;  2F0P A;  4A3I B;  2WP8 J;  1G29 1;  1NUC A;  1EQT A;  3MAQ A;  2MJ8 A;  5KGU A;  2EJM A;  1TY2 A;  2VB2 X;  5COY A;  5KEE A;  1VCI A;  3LNN A;  3S17 B;  1PRT B;  1SYE A;  3MFG A;  1WTX A;  5EKL A;  3ONA B;  1BXT A;  2HCC A;  3Q6S A;  1HFG A;  4OL7 A;  1PTO H;  1E0B A;  1NR2 A;  1WVL A;  5JJZ A;  1JWU D;  5FLX E;  1MD2 D;  5IGE A;  1JE4 A;  3BS1 A;  3MXP A;  2B39 A;  3HKZ B;  4IUQ A;  4QUC A;  3UI2 A;  5I9O A;  1LTI D;  3WDN A;  4K5V A;  2J7Z A;  3HZX A;  4LJZ C;  3V2T A;  3L9A X;  5EBD A;  4DXG A;  1MI2 A;  1V8Q A;  2R93 B;  3C1F A;  1BQQ T;  1KDA A;  4KD4 A;  1RD9 D;  2ZT9 C;  3C1E A;  1GJX A;  1YNJ C;  1STA A;  1IW7 D;  3JAM E;  1ET6 A;  2PYK A;  1T5X D;  5CV5 A;  2AWN A;  2EYL A;  3I72 A;  3TSS A;  2L4N A;  4HSV A;  2K32 A;  1VF5 C;  2OF1 A;  3EA6 A;  4IUR A;  1ET9 A;  3J81 E;  1B53 A;  1YNJ D;  1JIC A;  5DM6 3;  1C4Q A;  3ZYY X;  1T5E A;  4M8A A;  1FNW A;  1HTP A;  3X3M A;  5HUR A;  3J80 L;  1GUS A;  4KY7 A;  5FLX L;  2KVM A;  3HRZ C;  4KKS A;  1QIL A;  4R8N A;  1CHQ D;  3I70 A;  4IUP A;  2B2W C;  1HA5 A;  2IX0 A;  1TS4 A;  2ZXP A;  2F0H A;  3E5S A;  3SE0 A;  5IOD A;  5T1I A;  2QCP X;  1Z7T A;  1LLR D;  1SNC A;  1GUN A;  1TS3 A;  3JAM L;  3PIP 3;  4HSP A;  3R2I A;  1I4G A;  5DAU A;  1ZEQ X;  2WII B;  4DAY A;  2IW3 A;  4XT3 B;  1W6J A;  5IGB A;  3D4R A;  2F0V A;  3K5O A;  1W6K A;  2RQX A;  4KTA A;  2OEO A;  2EYO A;  3MVV A;  3J81 L;  1B9M A;  2XWJ B;  2Q8R E;  2Z4H A;  5CGK A;  1SMY D;  4A3G B;  5CV4 A;  3NBI A;  4DNR B;  1HQR D;  3SHL A;  3A55 A;  5EKI A;  2F0K A;  4K5X A;  4A3J B;  1TWF B;  5M9O A;  4I65 A;  1PRT F;  2MP1 A;  1SYF A;  2JYO A;  1QWY A;  2F0T A;  3NHH A;  3HOV B;  3T51 B;  4OIJ A;  4EVO A;  2XVS A;  3DUZ A;  2EJG C;  4K6D A;  4BY7 B;  1S5D D;  3RUZ A;  4KJN A;  2EOT A;  3A8I E;  2L9H A;  2PPB C;  1LTR D;  5T1G A;  2PW7 A;  5CV9 A;  2ZXR A;  4ZQ3 A;  1JCK B;  5M5W B;  4XTC S;  1I4H A;  3GD7 A;  2ENB A;  5IGF A;  3MHB A;  1CFM A;  3BDO A;  4QF4 A;  3I3C A;  2BCO A;  4X3K A;  4A3B B;  1XX8 A;  2IX1 A;  3I8Z A;  2Z8L A;  1BUV T;  1EY4 A;  2AQ1 B;  1VMC A;  4V19 0;  1KDC A;  3GQB A;  4C3H B;  1B3A A;  5D3D A;  4G4K A;  4IUT A;  4DFA A;  5E3F A;  3CHB D;  4FXD A;  3BYY B;  1TWG B;  2M2L A;  1V1O A;  1H9R A;  1OXX K;  1SSO A;  1WTO A;  3H3V C;  1DON A;  1F9S A;  3EJI A;  1LTT D;  4F87 A;  3CU7 A;  5I2X A;  4C2M B;  5A35 A;  3AMU A;  2PZT A;  2B2U A;  3HOX B;  1BR9 A;  1FNV A;  2KJX A;  4C1N K;  2E74 C;  3BYT B;  2FJ2 A;  2SOB A;  1E2Z A;  4HMJ A;  1TS2 A;  4HCE A;  3S1M B;  4OGQ C;  3GTP B;  1KTK A;  4QUF A;  1O78 A;  2PNR C;  3S16 B;  1Q3L A;  3OWF A;  3KUP A;  3VA7 A;  3Q22 A;  1CM9 A;  3V96 A;  4ZRZ A;  1S5F D;  3D8G A;  4P2C B;  4H44 C;  5DM7 3;  1F2Z A;  5CBA E;  2AQ2 B;  4C3J G;  4A3M B;  1JB3 A;  5C4Z A;  2DNC A;  4RAU C;  3KLR A;  1BF4 A;  3DWQ A;  4XXE A;  1ENF A;  1HA6 A;  5EBC A;  1G6Z A;  1IKM A;  2NVQ B;  1STG A;  1JWS D;  5ELC A;  2O2L D;  1RCV D;  4C3H G;  2NBF A;  2L12 A;  2F03 A;  4OIK A;  5JEA G;  4FF4 A;  2L11 A;  4KN4 C;  4HMI A;  1G2T A;  4KJO A;  2MPM A;  4A93 B;  4FF3 A;  5G3L D;  1STH A;  1EYC A;  2DY7 A;  3R8B A;  4LAA A;  1K8O A;  3KLS A;  3DXJ C;  4F7X A;  1SNQ A;  4OO1 H;  1CHP D;  3PO2 B;  3NTK A;  2O5I C;  3VR6 A;  5JEA J;  2A5H A;  1IYU A;  2Q8I B;  3ERO A;  2PCF B;  5D65 A;  2Z1C A;  4L8J A;  3NWS A;  1EU3 A;  1OXT A;  1ESF A;  3TP8 A;  1LAC A;  3K57 A;  5FOB B;  3T16 A;  4OHJ A;  1S5B D;  1SJE D;  1D5M C;  2QF7 A;  1MGS A;  1NR4 A;  1LTG D;  3GV6 A;  2J0T D;  3I90 A;  4IUV A;  2R61 A;  2KEE A;  3HEJ A;  5E4W C;  2N88 A;  5IGD A;  1TU2 B;  1SBB B;  1NSN S;  2AUJ D;  2K01 A;  3M4Y A;  4RCO A;  3HOZ B;  1LT5 D;  1PTO B;  5DEH A;  2ID0 A;  3DHQ A;  4FO2 A;  4NW2 A;  3RZO B;  2A69 C;  5M3F B;  3AU7 A;  2EYF A;  2JA7 B;  1HUN A;  4X3U A;  1PTO C;  1TWH B;  3HOY B;  5FK9 C;  3DWP A;  2G9D A;  2NVT B;  4ME5 A;  2EYM A;  3IAY A;  3G6J B;  3WOE A;  1DD2 A;  2A69 D;  2J4X A;  1ZXT A;  2E75 C;  3D6C A;  1PTO D;  1S5E D;  3F2U A;  4HR7 B;  2E2I B;  3M85 A;  1EWH A;  2K04 A;  1U4M A;  5ELE A;  2FMC A;  2NTT A;  3DMU A;  2EDG A;  3PUY A;  1TY0 A;  5ELD A;  5CMD A;  4CKC A;  4CKB A;  2WB1 B;  4WFN 3;  3S9W A;  3S1R B;  3MZ5 A;  1Q8I A;  4EQP A;  2A68 C;  3FMC A;  2L5T A;  3H6M A;  2VUM B;  1M8A A;  4RGO S;  4EQO A;  2HCI A;  1EY8 A;  3CRL C;  1LTS D;  4BY1 B;  4V0B A;  2PMZ B;  1I6V C;  3PMF A;  2K05 A;  2A68 D;  1EIG A;  1TWC B;  3VYU A;  5J39 A;  2R6G A;  1CT1 D;  4IUN A;  2IWH A;  4DAV A;  5ISR A;  4ZK9 B;  1GOZ A;  5CV6 A;  3QG1 A;  5J1Z A;  2CQA A;  2I46 A;  1KAB A;  1AZP A;  5C3W A;  2SDF A;  2B2U C;  1FNU A;  2EJF C;  4KI0 A;  1XTC D;  4XYQ A;  1BCP B;  2HQE A;  1BDO A;  5C3E B;  2D2C C;  3P75 A;  5IOC A;  2SEB D;  1E2V A;  1PRT C;  1BCP C;  1OXS C;  1D2B A;  1LO5 D;  2JA6 B;  4S3S A;  3MEH A;  2NWG A;  5I6Y A;  3J80 E;  4U67 3;  1QNU A;  2A6E D;  2XNA C;  5CBE E;  1PMR A;  4C3I B;  4A3F B;  4DXF A;  4KK7 A;  5DNF A;  2EYJ A;  1CA6 A;  2F4I A;  2IX3 A;  3HP3 A;  1PRT D;  1EY6 A;  1IW7 C;  1BCP D;  2CVR A;  3OSO A;  2K6A A;  4BBR B;  1CA5 A;  4TQU S;  2NVY B;  1SYG A;  2E2D C;  3A8J E;  3MXN A;  1SE3 A;  5KYL A;  2E2H B;  4OO1 I;  3K59 A;  1RHP A;  1PTO F;  3TP6 A;  2JA8 B;  1SE2 A;  1D6E C;  1I4X A;  1B4O A;  3Q0A A;  3S15 B;  4K6L A;  1JOK A;  3VA5 A;  1AEX A;  3Q23 A;  4B08 A;  1ML0 D;  5JVH 3;  1QNK A;  3G7L A;  4RHR A;  4QMG A;  1LTB D;  4JK1 C;  4KY5 A;  1R4P B;  2F0I A;  2X6G A;  3I4M B;  4L63 B;  2QEJ C;  3P20 A;  3C3L A;  4R9W A;  2XN9 C;  3P1H A;  1LV9 A;  5CV7 A;  4TKO B;  1PZI D;  3HOU B;  4IFD H;  3J7Y W;  1EYD A;  3PUX A;  3QIA A;  5I6W A;  3KK7 A;  3NXW A;  3VR5 A;  2BE5 D;  4Z9C B;  4XIG S;  4YIJ A;  3W3A A;  4KHV A;  2F0S A;  4CBV A;  3TZU A;  3ND9 A;  4O42 A;  1AZQ A;  2A73 B;  1PFM A;  4ZAI A;  1SMY C;  1PFN A;  4NP5 A;  5JVG 3;  1Y8N B;  1SAP A;  4C3I G;  4GZY C;  1U4P A;  3FPU B;  4RH6 A;  3BVM A;  4RGN A;  4ABN A;  2OT2 A;  4XT1 B;  3M7G A;  2JA5 B;  3KBG A;  1OO9 B;  1SYD A;  4XQN A;  2SNS A;  3A7A B;  3S2H B;  4IAL A;  1HFN A;  4G57 A;  2PW5 A;  3FVQ A;  4PMC A;  1EL0 A;  4ZLT F;  4KKT A;  4M1U B;  2QIL A;  1SJH D;  4MIU A;  1B44 D;  1BCP F;  5C6A A;  4CJ0 B;  1A3U A;  4O1N A;  3GTO B;  1DOK A;  5JPM C;  5K36 H;  3N6R A;  1CQF A;  2B63 B;  1X3P A;  4H13 C;  1ONL A;  2JP1 A;  2F0Q A;  1TR5 A;  1SDF A;  4PMB A;  1HPC A;  2RSO A;  5LL6 X;  2H1E A;  5KND A;  1SYB A;  3GTJ B;  1F9R A;  1TVX A;  3OOC A;  3I73 A;  1EOT A;  2YU9 B;  1JOQ A;  4N9T A;  4PMW A;  1SFO B;  1MBY A;  1K8M A;  4C56 C;  2Q8T A;  5KNC A;  2PO4 A;  2F3W A;  1D5X C;  2CW0 D;  3MC0 B;  5CV8 A;  1F2Y A;  1H9J A;  3K5N A;  1C48 A;  4KHZ A;  1QCB D;  4QB4 A;  3NP8 A;  1FYC A;  1H9S B;  1ILP A;  1JR0 D;  5EKK A;  1JWM D;  2DNE A;  1QOH A;  1YNN C;  1I3Q B;  5C4H A;  2LKV A;  1SND A;  2KQ3 A;  3RD4 A;  1SEB D;  3NTH A;  1MSG A;  1EY0 A;  3U9S A;  2IJ0 A;  4EQN A;  3NPP A;  1YNN D;  3PUZ A;  1DOM A;  3OMC A;  4ZKC B;  3RZD B;  3T53 B;  2K33 A;  4AYB B;  4X3S A;  4K14 A;  1IHZ A;  1EQV A;  4CKE A;  1RDP D;  2ZXO A;  2D5D A;  4XQJ A;  1JOO A;  4K5W A;  4KY6 A;  3VR2 A;  3OHX C;  4RHS A;  2B8F A;  1F77 A;  4DK1 A;  3PV0 A;  4IFD I;  1O7L A;  5D3I B;  1A15 A;  3IFT A;  1X3Q A;  4U68 A;  1B1Z A;  3KBX A;  1NCV A;  1SNO A;  3IL8 A;  4ILW A;  5CYU A;  4ULL A;  1HHV A;  1J9O A;  4DN4 M;  5JOB A;  4H7B A;  1M4V A;  1AFP A;  3FPP A;  1DOL A;  4DNT B;  1D1K A;  1EWC A;  1EZ8 A;  1GUT A;  2VNU D;  4FYD A;  2M00 A;  4K8J A;  5I2Y A;  3ND8 A;  1Y1W B;  2MUY A;  1ESR A;  1BNZ A;  3N52 A;  1G8Z D;  1WD1 A;  4CJ2 C;  3NWT A;  1LTA D;  3PUV A;  2EZV A;  2K28 A;  4G7H C;  4XYO A;  5C0X H;  1CQV A;  4RGM A;  5JAV A;  4OO1 G;  2LY7 A;  2F1M A;  1WTQ A;  2F0U A;  4EGV A;  5C5L A;  2H4O A;  2FHT A;  4B9W A;  1Y69 U;  4RGT A;  3I4N B;  1OXV A;  4NKL A;  2XIW A;  2R92 B;  1ICW A;  5IGG A;  5D14 A;  1GHJ A;  2B8G A;  3R2T A;  4L6T B;  4J1M A;  1EZ6 A;  2WKC A;  3TDQ A;  3T4A C;  2K03 A;  4IN3 A;  5KIX A;  3M4O B;  1HQM C;  1Q1E A;  5FO9 B;  2PZW A;  4A3D B;  3KF8 A;  4KMU C;  3PO3 B;  3H09 A;  2KED A;  2NN6 H;  2VB3 X;  1X32 A;  2KA7 A;  3V05 A;  3NE5 B;  3T56 B;  3TN2 A;  2G9H D;  2KCN A;  2TMP A;  1KAA A;  1QG7 A;  1WCM B;  3K5M A;  3M3Y B;  2F0L A;  4Y7N B;  4FNF A;  5C44 B;  4FF1 A;  4QCL A;  2BA1 A;  4A3K B;  3VR4 A;  1MSH A;  2JSO A;  2F0M A;  2EY1 A;  2AUK A;  2EPB A;  4ZKB B;  2GA4 B;  2QDB A;  2M9V A;  1I50 B;  3DWA A;  2HDL A;  3OMG A;  1NAP A;  1KDB A;  2LFN A;  4FXK C;  1S5C D;  3MXU A;  5EPL A;  4KV6 A;  4UAI A;  3SXH A;  3E6Z X;  4WOR A;  3K5L A;  4XDX A;  1EY5 A;  1WTR A;  1HCZ A;  3S1Q B;  3SK4 A;  2HDM A;  1A3V A;  1V1P B;  4RKL A;  2E76 C;  3CQZ B;  1FD7 D;  1SNM A;  1UNS A;  1EFI D;  1SXT A;  3CRK C;  4A3E B;  1RTO A;  3TP7 A;  3QOL A;  3W2D A;  3NQI A;  3QWN A;  2LS0 1;  1QB5 D;  1B50 A;  3OIP A;  1C8C A;  2EYH A;  1STB A;  1GUW A;  4HTH A;  1BO0 A;  3J7A V;  1SYC A;  3P7J A;  1SE4 A;  3DM1 A;  4CGY B;  1Z6H A;  3D6W A;  4MN3 A;  5TSS A;  3O13 A;  5BN4 A;  2F0G A;  4DU9 A;  1G91 A;  2L55 A;  1AP0 A;  5IIF A;  3SK8 A;  2JE6 I;  4DK0 A;  5CC4 A;  3IKJ A;  2ICI A;  2B2Y A;  4NDX A;  3DEP A;  3NTI A;  5EPJ A;  3QB3 A;  1ZKO A;  3OPO A;  2ICE C;  1U4L A;  2K5Q A;  2JXM B;  5KYI A;  2KHS A;  1KNE A;  3GTK B;  2JEA I;  2R7Z B;  2LMC B;  5E1F A;  3DEO A;  2NYZ D;  5NUC A;  2XRS D;  1KNA A;  4BA1 I;  1VMP A;  2B2T A;  4DAP A;  1H9S A;  2A6E C;  5E4X A;  3FKI B;  3QO2 A;  1H9K A;  4QIW B;  3HG9 A;  1KLU D;  4DGZ A;  3ITP A;  2WIN B;  5C0X I;  3SDZ A;  4K2L A;  1G2S A;  1D1I A;  1ROD A;  2TSS A;  3NSW A;  3IFD A;  1A2T A;  1I4R A;  3FDT A;  1IKL A;  1V43 A;  2RDH A;  4XQQ A;  2MGS A;  4F88 A;  1F2M A;  3TME A;  3K7A B;  1E2W A;  1K83 B;  1LT6 D;  1RJT A;  1EY9 A;  3BDC A;  5KRU A;  2A6H C;  2BDN A;  3E0J A;  1DM0 B;  3R3O A;  2AQ3 B;  2WV6 D;  2Y0S B;  3SVM A;  5FKA C;  1QJO A;  3LX0 A;  2C9O A;  4HN7 A;  3EQL C;  5HGT A;  5ELF A;  1CK1 A;  2HUG A;  4IFD G;  2NN6 I;  3NBH A;  3A56 A;  2A6H D;  4RCN A;  2BDO A;  4RA8 A;  4RKB A;  4NMZ A;  4B9X A;  2BE5 C;  3D31 A;  1DYQ A;  2FMM A;  1JOR A;  4IFD J;  3L7Z C;  2XWB B;  1RTN A;  3D3R A;  1BOS A;  2WAC A;  3MTS A;  1Z47 A;  1STN A;  1R4Q B;  2WAQ B;  1STY A;  1L0Y B;  4G7Z C;  2DN8 A;  2RDF A;  2IT1 A;  5C4X B;  3AB9 A;  5M5X B;  3KLS X;  3T13 A;  1TT2 A;  2WKD A;  1HXY D;  1CZG A;  5K5P A;  2RKS A;  1J8I A;  5ELB A;  2PQE A;  5LL6 S;  4TRD A;  1DXM A;  3EFX D;  4FVM A;  2EY6 A;  1XWE A;  5EJW A;  2E2J B;  1AN8 A;  3M7N A;  3TBI B;  2B2V A;  2DY8 A;  4DA2 A;  2KCC A;  1DZ1 A;  1Q12 A;  3NK9 A;  2F0F A;  5K36 G;  3A7L A;  2V4D A;  1H9M A;  4G7O C;  5COR A;  3U9O A;  1A2U A;  3EVQ A;  1ZYR C;  3HGB A;  4RFB A;  4RWS C;  4PQX A;  5EGT A;  2X6L A;  5I4D A;  2F0D A;  1ENA A;  1PFB A;  2K1B A;  2FFK B;  4K8I A;  1ZYR D;  2NB0 A;  1A3T A;  1PYW D;  3D4W A;  2K5D A;  4LK1 C;  1L0X B;  3BG3 A;  3TZD A;  2KOL A;  4CHT B;  3BDL A;  3GP7 A;  2YYZ A;  1LT4 D;  2CW0 C;  5C4J B;  5AFW A;  3NQT A;  1V1P A;  3C2P A;  3SK6 A;  1PLF A;  2PZU A;  2KEC A;  1B2T A;  4PNY A;  4J8Q A;  4ID6 A;  3BZD B;  3LWE A;  5LHY 1;  1TII D;  2BOS A;  1WD0 A;  3HS0 C;  3GV3 A;  2B2Y C;  3BVZ A;  4C3J B;  3I4L A;  1Q1B A;  4KD3 A;  1FGB D;  1Y8O B;  3GTG B;  3K58 A;  1RF2 D;  2SNM A;  2F0N A;  1A6X A;  1B9N A;  1ENC A;  1Y8P B;  1S4Z A;  4WJW A;  2B2T C;  2RA4 A;  4Q5V A;  3OWE B;  1UAP A;  4ZYS A;  4X3T A;  2F0E A;  1AW7 A;  1F9Q A;  2L0C A;  3MFY A;  4HCS A;  1TKW B;  4JBW A;  4LMQ D;  3R93 A;  3A54 A;  2QKI C;  5F2D A;  4ODG A;  2F0J A;  5BN5 A;  4KN7 C;  1U4R A;  4BS9 A;  1WTW A;  1D5Z C;  3FRP B;  1KLG D;  5EPK A;  1F2L A;  4CJ1 B;  3URY A;  1HRJ A;  4J6H A;  5FO8 B;  4Q0F A;  1F9P A;  1UEA B;  3S1N B;  1II3 A;  2IPK D;  1STE A;  4HED A;  2O5J C;  1TS5 A;  2IL8 A;  5M3M B;  1CTM A;  2VXW A;  2D9U A;  3K6O A;  4FP5 D;  5C0X G;  3WOF A;  3LWU A;  2EYP A;  3RLF A;  1I4Q A;  3SEB A;  4BA2 I;  2XRQ D;  2Z4I A;  3MWY W;  5A2Q E;  3VYT A;  3MA2 B;  4KKU A;  5CR3 A;  5C0X J;  3BVG A;  2A74 C;  4R8I A;  2CHB D;  1PXU A;  2F3V A;  1O7Y A;  1CZW A;  4UDU C;  3K0Y A;  4PV1 C;  2F0O A;  2NTS A;  2L1B A;  4TSS A;  1OXU A;  1PDQ A;  1SNP A;  3GTM B;  3ERQ A;  3L3O C;  1I6H B;  5M5Y B;  2NN6 G;  3SR1 A;  1EYA A;  2N55 A;  2I07 B;  2X69 A;  1EIH A;  1EU4 A;  2EY5 A;  2BA0 A;  3H94 A;  1ILQ A;  1FR3 A;  1O80 A;  3I91 A;  2F0W A;  1WTV A;  4WRD A;  5JEA H;  2B2V C;  5C3X A;  1CI3 M;  5IT9 E;  1Y1V B;  1JQY D;  5A2Q L;  3PIO 3;  2B2W A;  2R3Z A;  1GXD C;  2K7V A;  4H0L C;  3RMH A;  3QJY A;  1VDZ A;  4F8M A;  1PZK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...