5CMDA

Oligomer crystal structure of cc chemokine 5 (ccl5)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
64
structure length
64
Chain Sequence
SDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 5
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 12
structure length 64
sequence length 64
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cmdA00
5T1GA 3DEOA 4DN4M 1U4PA 2B2YC 4IUUA 5EKIA 3I3CA 2X6LA 2KOLA 3I8ZA 1EIGA 1O7ZA 2K01A 5JJZA 2KUMA 2FHTA 4ZLTF 4CJ1B 2B2VC 4UAIA 1GUWA 3I91A 2B2YA 3QO2A 2K05A 2RA4A 4IUQA 1U4MA 4X3KA 4HEDA 3SVMA 1WVLA 1J8IA 4OIKA 4R8IA 4ZAIA 2L11A 1B50A 1ESRA 3ONAB 3TN2A 1NR2A 2HCCA 1F2LA 4XDXA 3HP3A 5T1IA 1LV9A 2EPBA 2KEDA 2L1BA 3LWEA 2D9UA 4X3UA 1WTXA 3DM1A 1PFBA 3Q6SA 1F9QA 1RTNA 2NWGA 2FFKB 1AZPA 2HUGA 1G2SA 2B2TC 1JICA 2JP1A 2X6GA 1HUMA 3N52A 5D65A 1ILPA 3TZDA 1BO0A 2IL8A 1AP0A 1IKLA 1KNEA 5E4WC 4ZKCB 1M8AA 2KVMA 3R93A 2Q8RE 4X3SA 4CJ2C 1ICWA 1NCVA 1MGSA 2NZ1D 1RJTA 1RTOA 3IFDA 5CMDA 1XYIA 2RSNA 2HDMA 2DY7A 1WTOA 1C8CA 1EOTA 3D6WA 3DEPA 2N55A 1U4RA 2L12A 2KEEA 1AZQA 1BBXC 5CORA 1G6ZA 3UI2A 2KECA 2RVLA 4X3TA 2Q8TA 1EL0A 2B2VA 2X69A 2B2UC 2EE1A 4MHEA 5EPKA 4QUFA 1F9RA 1WTVA 1WTWA 3H91A 2K1BA 5E4XA 4HAEA 1U4LA 2J7ZA 1O80A 2B2WC 2BDNA 4QUCA 2R3ZA 4NW2A 4O42A 1X32A 1BF4A 2SDFA 4MN3A 3F2UA 4ZKBB 1MI2A 2HDLA 5COYA 1J9OA 1B4OA 1ZXTA 1TVXA 1CM9A 1X3PA 2K28A 1JE4A 1S4ZA 5AFWA 5EQ0A 1CA6A 3P7JA 1WTQA 1DOLA 2B2TA 1DONA 1O7YA 4RWSC 1CA5A 1MSGA 2FINB 1F9PA 1PFNA 3FDTA 3FPUB 1HFNA 3IL8A 1NR4A 1IKMA 4OIJA 1SSOA 4HCSA 5D14A 4IUVA 4CJ0B 1SAPA 3KUPA 2FMMA 2XIWA 3MTSA 1WTRA 5DNFA 4IURA 1B3AA 3I90A 2FJ2A 1WD1A 2L9HA 2NYZD 2MP1A 1DOKA 2VXWA 2DY8A 3GV6A 1QNKA 1Q3LA 4RA8A 3KBXA 4XT1B 1PFMA 1WD0A 1VMCA 5EJWA 2B2UA 2MJ8A 4HSVA 4R9WA 5EPJA 1RODA 1F9SA 5CBEE 1ML0D 2MPMA 1KNAA 2MGSA 1NAPA 3GV3A 1HRJA 2K04A 2B2WA 4IUTA 1ILQA 1HUNA 4IUPA 2HCIA 2EOTA 4ZK9B 1DZ1A 2L4NA 2N88A 1HA6A 1SDFA 1RHPA 2K03A 4XT3B 5EPLA 1PDQA 1VMPA 5CBAE 3MWYW 4LMQD 1HFGA 4RAUC 1PLFA 2CVRA 1QG7A 1MSHA 1XX8A 1E0BA 2M2LA 3G7LA 1A15A 1QE6A 1DOMA 2H1EA 1X3QA 2RSOA 1B53A 1EQTA 1G91A 1B2TA 4U68A 1G2TA 1HHVA 1EIHA 2JYOA 1WTPA 1BNZA 1IL8A
chains in the Genus database with same CATH superfamily
3CCEA 1U4PA 2B2YC 1KC8C 2H5XA 1PH1A 4A3EG 2MFIA 4GKJL 3U50C 4M8AA 1Q86C 4HMJA 1F2MA 1STBA 2A73B 2CQAA 4UHVA 3K6OA 1HZBA 4OX9L 3J81c 3W1GA 3UE1A 1B50A 4DR1Q 1DGSA 4B3SL 1SEBD 1KRTA 1TWGB 3K5OA 4RKBA 3M4YA 3SK6A 1SE2A 4ZUIA 3GTMB 2KENA 4YCWA 3VYUA 3NXWA 1MBYA 1JICA 4IPGA 3TZDA 3MAQA 3Q22A 3KF8B 1M8AA 4KLKA 2K5NA 4CJ2C 4HIDA 3GQBA 3T4AC 4A3MB 4FF1A 2Z0SA 4A3LH 3BS1A 1WJJA 1TWFH 2C5CA 4X66L 4G7ZC 3PO3B 1VQBA 1XNRQ 1Y1VH 1AZQA 2A74C 3OTOQ 5ELFA 1YEZA 2KJXA 2PQEA 5JAVA 2I46A 1Q12A 2JA6H 2JEAI 3TS0A 4P73A 4AYBB 3F2UA 2OT2A 5C44B 2E2IB 1MHWC 4L6TB 1IW7D 4O2DA 3HOUH 1ZXTA 1CM9A 1SE4A 4JI7Q 2I5LX 2R61A 5EQ0A 4K5XA 3CRLC 3P7JA 1S3OA 5AJ3Q 2EJMA 4XYOA 5IYDG 2XN9C 1PFNA 1FGBD 1QZHA 1SSOA 2R6GA 1SAPA 1SFOB 3SK4A 1L0WA 4DV3L 4JI2Q 2F0NA 3FKIB 5CR3A 2G9DA 3MTSA 4LF7Q 2JK8A 1SN8A 4CKEA 4YCVA 4JBKA 5M3MG 2PW5A 2YTXA 3RZOH 4TKOB 1HZ9A 4P74A 1VQFA 2YV5A 2ZXPA 2NVYH 5KYIA 2HCIA 4GZYC 3NK9A 1NNXA 2LS01 4ME5A 3U9SA 1D5MC 3IKJA 2JJQA 3VDYA 1SYDA 5IT9L 2NVXB 1CHQD 3CCJA 2GVAA 2HQEA 2K75A 4FP5D 4CDCC 3QIAA 4HIMA 3NBHB 2TMPA 2K5DA 4FXGC 3A54A 1LT4D 5C3XA 3EFXD 3ULJA 1LT3D 5LMNL 4DV5L 5JEAH 4POGA 1SLJA 4KKSA 5EKKA 3PIOA 3PSIA 4Q5VA 5EGTA 1GXDC 1X9NA 5J39A 2B2YA 2L55A 5EBCA 4O0AA 4JV5Q 1F77A 5KRUA 1AEXA 4X3KA 1TWFB 2B3GA 2F0TA 4GKKL 1VQJA 5IYBG 1MJCA 3ONAB 1Y1VB 4MNOA 2H4OA 2HCCA 1V1QA 2JXMB 4JI1L 3K7AH 2L1BA 2WKCA 3R2IA 2ZXOA 3VYSA 3TBIB 5ELOA 5TSSA 1FYCA 3Q6SA 4NXNL 2ES2A 5CV7A 3NTHA 1TQOA 2JA6B 5CV9A 1W6KA 2IL8A 1CHPD 3UDIA 1YBYA 4QQBX 1RTOA 2BCOA 5CMDA 3HOUB 1P8LA 3RLFA 1S5FD 2EIFA 2CKZB 4IFDJ 3UI2A 4YHHQ 1LYLA 1WTPA 3KLSA 3BU2A 2X69A 2R93G 2FMCA 2UXCQ 1NMFA 2EY1A 1O80A 4WJ3M 1L0XB 5FJ8H 1X55A 2A69C 4ZQ3A 3K7UC 2EYFA 2G5DA 3CCUA 2RHQB 3RZOB 1JE4A 1UEAB 2OF1A 4DR7L 1JT8A 1DOLA 1XXGA 1CA5A 3MEFA 3CU7A 4GN3B 5FO8B 2OWOA 2NVYB 4RFBA 3E5SA 3FDTA 1B70B 4DKAC 2QEJC 1X54A 1X3FA 5D3IB 2BDOA 3E9IA 5IWAQ 1PYBA 1HPCA 2UUBL 3S15H 3RMHA 2P5ZX 1K0SA 3P75A 1Q81C 2NVTH 1VQGA 1YNXA 1I3QH 3FRPB 4BXXG 1FD7D 1DZ1A 4PMBA 4BS9A 2K03A 4XT3B 1PH8A 3E3XA 3H94A 2PI2E 1SNPA 3N6RA 4LF9Q 1SNQA 3WOEA 5JVH3 2VQEL 1HHVA 3QWNA 4U68A 4DV6Q 4DF7A 1VQOA 1E3PA 1JE5A 1IL8A 3K7AB 1I50H 3DXJC 3C3LA 1C48A 1CSPA 3M85A 4K2LA 4JBJA 4R4CA 4LK1C 2PZTA 1CFMA 3I91A 1XNQL 1QUQA 4C56C 2B29A 4TRDA 5JPNC 5JPMC 1GUSA 3I73A 1HA5A 4A3IH 2A19A 2L11A 4I65A 5A35A 1JCKB 1D1IA 4XDXA 2VL6A 1KD1C 4L5SA 2JA8H 1LV9A 1YNND 2JA7H 3CRKC 3DM1A 4DXGA 2F0WA 1CKMA 1N32Q 2A6ED 1PH3A 1EY5A 4IQZA 2Q8RE 1SJHD 2DNCA 1STNA 1OXVA 1WTHA 2XTIA 3R8BA 4DV7L 4M1UB 2EYJA 2R7DA 1QWYA 3MFYA 3QR8A 4RCNA 4YIJA 5HGQA 3HOZH 1OTCA 1N34L 4C3IH 3R3OA 3J80i 1WTVA 2DJFC 2QGQA 3AFPA 1JR0D 1MKHA 5L37A 2YU9H 1XNRL 3SR1A 1SNMA 2XWJB 4O42A 3OTOL 1GKHA 4MN3A 4ZKBB 2V1CC 4DV2Q 3TQYA 4X64Q 3S15B 1SYBA 2UUAL 3DMUA 1M90C 4IFDI 2JSOA 4BBRH 1VQIA 1PYSB 2NVTB 3VYRA 4GLVB 2WP8J 3CPWA 1I3QB 1A3VA 1XWEA 1IKMA 1HCZA 5AJ3L 4RKLA 4B3MQ 3CCMA 3DHQA 2JA9A 2PNHA 2Z6KC 1U5KA 1GJXA 2CWPA 3CCQA 2Z1CA 2C35B 4YCUA 4LF7L 1I50B 3EJIA 1VQ5A 4C1NI 3GTPH 4YWKA 2GVBA 5JEAJ 4GLAC 3I4NG 4QB4A 4AIMA 1PDQA 2VUMH 3BVGA 5C4HA 2CVRA 5DAUA 1SRUA 1IYJB 4A3IB 1X3QA 4A3JH 4DAYA 3S1NH 4OWXB 3T1HQ 4NMZA 2JA8B 1EWCA 3E6ZX 2JA7B 3NPPA 3HKZE 1NSNS 1LT6D 5JJLA 1LTRD 4IPCA 2PPBC 2PQAA 2PNRC 3U9OA 1C9OA 1VDZA 4PZ8A 4F88A 2EJFC 4OEMB 3QO2A 2K05A 1I94Q 1IBKL 2E5LL 3TP5A 3EIVA 2BA0A 4WJ4A 3HKZG 1D5XC 5FKAC 3BVMA 4NDXA 4KD3A 2R7ZH 2IHEA 4JV5L 2QEXA 4C3IB 3SHLA 3PF4A 5C4XG 1SE8A 1G2SA 1EYCA 3OPOA 3CF5A 1ILPA 1AP0A 2YU9B 2KHJA 3M4OH 1YHAA 3UDFA 4L5QA 3J7AV 4X3SA 4OX9Q 1NCVA 2NN6H 2VY3A 5IGGA 2HD3A 1NE3A 2N8NA 4DAPA 1LTTD 5IGDA 1WTOA 4B3SQ 1B44D 3F8TA 4BBRB 1KLGD 3H3VC 3K0XA 4Q0FA 2WIIB 4PG3A 3OWFA 4IUNA 2EE1A 1YJNA 5IGEA 4A3CH 1S5DD 4G7OC 5GAEC 2EY5A 4YHHL 1YZ6A 2PCFB 3W1BA 2EYMA 4A3DH 3QB3A 2HDLA 5C4JH 1Q82C 2UXCL 2IWHA 2Q2UA 3GTGH 5FOBB 1I4PA 2IHFA 1I5FA 2QKIC 4GOPC 3GTPB 1UWVA 1ZEQX 2CH4A 2HHHL 4OO1H 1SYCA 1NMGA 3S16H 4KHPL 2VUMB 4IALA 1TKWB 1D8LA 1EQVA 5I2YA 4DFAA 1PZKD 2BE5C 2F1MA 4A3JB 3S1NB 5C0XI 1SJED 1R9TH 1UE1A 1KNAA 2XGTA 1TY0A 4JBWA 2WV6D 4DV3Q 1E2WA 2K5QA 2J4XA 1Z9FA 4WORA 2MNAA 4UP8A 3SGIA 4LF5Q 4LW1A 4G7HC 3FVQA 1HR0Q 1SYGA 1I4QA 2R7ZB 1TS2A 1RF2D 4KY6A 5C3EH 1O7ZA 1D6EC 1TS5A 3I55A 5DLQE 3M4OB 3VA7A 1YIJA 2K4KA 2IX3A 1M1KC 5IY0A 3FHWA 3MZ5A 5FK9C 1PTOC 4I7AA 4OIKA 4C3HH 1KDAA 4KHZA 2WB1E 1BQQT 1DYQA 1PTOH 5GADC 5T1IA 1TWHH 1IZ6A 3C1FA 2B8GA 1C7YA 1RTNA 1G91A 3AQQA 1J6QA 4BA2I 2KVMA 4GKKQ 4A3DB 3NE5B 3RN2A 5C4JB 2RCFA 4JI1Q 1EOTA 4B9WA 1QZGA 5IT9c 1BCPB 3TRZA 3GTGB 4QIWE 5GQOA 1N32L 5G3LD 2K32A 4NXNQ 4JI4Q 2B63G 1PFSA 3MXUA 4GOPB 1MD2D 1F9RA 2D5DA 4BBSG 3QOJA 1Y8PB 5J3BA 4JYAL 2F0GA 4RCOA 4A3BH 3D31A 3J80L 1FR3A 1ESFA 5KEEA 3I2ZA 4CDEC 1PMRA 1I4RA 2UUCQ 2IX1A 2A69D 1R9TB 1SXTA 4RWSC 4PQXA 4A3KG 1ICFB 1JWUD 1QOHA 4L8JA 4DV2L 1VF7A 3BYTB 1SYEA 4TSSA 5ELDA 2WKDA 3LX0A 3NQTA 3CXCA 3JAMi 4JG2A 4RH6A 2R92G 4DR7Q 5M3FH 2O5JC 2EXZA 2MHVA 1VMCA 4HSVA 4IJLA 5IT9E 1GUOA 2DN8A 1F2ZA 5C3EB 4KHVA 1VQDA 3ZYYX 1OXTA 4N9PA 2K14A 1HFGA 2RF4A 4QGUA 1Q8IA 4OONA 1EU3A 2UUBQ 2M2LA 5IP9G 3G7LA 4FF4A 1DJRD 1QE6A 4C3HB 3HOWH 1PTOB 3K5NA 3MHBA 1TU2B 4X62L 1TWHB 2PW7A 3PCOB 1IBLQ 1PH9A 1LLRD 1YITA 4DR5L 2UU9Q 3MXGA 4HIOA 1HR0W 2YTVA 2FHTA 2RCNA 3MFGA 3T51B 4HIKA 2VQEQ 2O4XA 3SVMA 5FO7B 3FKIH 3D3RA 4KN7C 3TMEA 3AYHB 1K73C 3E0JA 3A5UA 2NBFA 2AUKA 3QG1A 1B3QA 1XNQQ 3KLWA 4P75A 1ONLA 3TZUA 4GNXA 4PZ6A 3R93A 3KOJA 3MXPA 5IIFA 3PUYA 3J81i 4A3BB 5ELEA 2RDGA 1WFQA 4RGTA 1C8CA 1XPRA 2NVXH 3D6WA 1VQ6A 1ENAA 5ELNA 4JPBW 1X65A 3RLOA 2IX0A 3ERSX 3NELA 1LTID 3CCLA 3H91A 4BY7H 2KHIA 1DD2A 2E8GA 4JOIA 4QF4A 2JA5H 3J7A5 2K33A 1Q46A 4DV7Q 3HZXA 1J5EQ 2UXBL 1O78A 5M3FB 2OEOA 2F0EA 1ENFA 3PUVA 3F2BA 1SNOA 5DM63 4DV0Q 1JJGA 1N34Q 4XQJA 2B2TA 4K8IA 4HN7A 1MSGA 1SR3A 4CDFC 1FJGL 1AE3A 4BY1G 2AKWB 3FPUB 3IL8A 2IY5B 5IP7H 1SBBB 1S5CD 5EBDA 1PA6A 5I9PA 2MUYA 2UUAQ 2LMCB 3BZDB 1Y69U 1K3BC 1VQAA 3HOWB 1VQCA 1YVCA 4IO9A 5IYCG 2MPMA 3Q23A 4JI3L 3KF8A 3HOXH 1HRJA 1V1PB 1JOOA 2K04A 1LACA 5CV4A 1UAPA 3W5OA 1KDCA 3OIQA 3GO5A 1E22A 2KCNA 1K0RA 4B08A 3QOLA 1YNJC 1STGA 2NUCA 4LUVA 4JI0Q 1JJCB 1EEID 3SDZA 3FEWX 5T1GA 3I7FA 4AH6A 5C0XH 4DN4M 1R4QB 2IW3A 4ALPA 4LF5L 1TS4A 3CC4A 3Q0AA 1HR0L 2F0OA 3K57A 3AMUA 1CTMA 1U4MA 3HEJA 4KJNA 4H44C 3ULPA 1P16A 5M5XH 1V43A 2F0LA 2A6HC 2K7VA 1Y8OB 2RKSA 4IZ8A 2JQOA 1D7QA 4BY7B 3PO2H 1IBKQ 2XWBB 2JA5B 3I56A 2E5LQ 1F2YA 1FNUA 3PUXA 5K36H 4I7ZC 4R4TA 2F0JA 4NXMQ 2NN6I 1KHIA 5HY6A 1JORA 4AQYL 1VF5C 5CORA 2VQFL 2KECA 3OHXC 4PNYA 3B6YA 4A3FH 4DR2L 3K0YA 3Q24A 3PGZA 2IJ0A 2WB1B 1AN8A 2D0PA 3H3VI 3NBHA 1TT2A 3MA2B 1NTGA 1BBUA 4BA1I 1X32A 4JI4L 3FMCA 4NP5A 1II3A 3NP8A 1LUZA 1BCPF 4RG1A 3K80C 4L5RC 1EQRA 1LTAD 2K5HA 2TSSA 3BDCA 2EJGC 1IXRA 5BN4A 3DWAA 4BBSB 3HOXB 1BCPD 2L15A 3KLRA 3L7ZC 1NR4A 4B3TL 4A3EH 3S1QH 1UEBA 4JI5Q 2UUCL 4OO1I 1WTRA 3GTLH 5M9OA 3I4OA 1RIPA 5KGUA 5CV5A 2I5HA 3EROA 3SXHA 2JN4A 3KBXA 2WINB 1J8IA 2MJ8A 3TS2A 3G4SA 5LMUL 1RODA 2QW7A 3K5MA 1GHKA 3JAML 2HHHQ 1NAPA 3I4MG 4BWGB 1S5ED 3DM3A 2HT1A 3ER0A 4KHPQ 5HGTA 1PH7A 1PZID 2ID0A 1QVCA 1PH6A 2CH4W 1WCMG 3D6CA 1XX8A 4LJZC 1AFPA 2I5MX 1VQMA 2C9OA 1IBML 1B2TA 3BZKA 5M5XB 1BNZA 3QJYA 3HOVG 5BN3A 3I8ZA 3S14H 4ZLTF 3PO2B 1QILA 2I07B 3PF5A 1Q8KA 3RUZA 1IBLL 4B9XA 4DV1L 4DR4L 2UU9L 3U58A 1PTOF 3LWUA 4J6HA 4WJWA 3TN2A 2NVQH 2KCCA 3STBC 2D9UA 4A3FB 1QNUA 1PTOD 1PRTC 5IYDH 4C3JG 4JCVE 2JP1A 3EA6A 2B39A 4DUZQ 4JC0A 4A93G 1KNEA 2PYKA 3NTIA 1T5XD 2EYPA 3W3AA 3P20A 1PXUA 1MGSA 1Y1WG 1BOSA 3KYHC 5M3MH 3GDEA 4KD4A 2N55A 1UE6A 3KF6B 3J81L 4DR3L 3S9WA 2VS1A 2XSCA 1VQ9A 4KKUA 4A3EB 3S1QB 4HAEA 2V4DA 3D4RA 4DAMA 4JVZA 1QCBD 3GTLB 4A3GG 1HNZQ 3M4PA 3MVVA 3UDXA 4DNTB 3ERQA 1S4ZA 5AFWA 1VQLA 5BR8L 1JOKA 3PUWA 5I4DA 3HOYG 4X6AH 1DONA 1O7YA 3CAMA 4EQ5A 2Y0SG 1W6JA 2A68C 4V0BA 1J5EL 4N8FA 2ZTDA 4KI0A 3K5LA 2DUDA 4DV0L 3CQZH 4JYAQ 1JC7A 2L0CA 4YY3L 1JB7A 4ZYSA 3ND9A 1WD1A 3H0GG 4H0LC 3V2TA 1QVFA 5IYBH 4XYQA 5IE8A 3UE0A 3NHHA 2JE6I 4FVMA 5EPJA 5CBEE 4DGZA 3K81C 3U4VA 1TS3A 3VR5A 3OWEB 3T56B 5C0XJ 2L4NA 3S14B 5ELBA 1RHPA 2KA7A 3GTJH 3D0FA 4XIGS 1YJ9A 3A74A 5FLMG 1CKNB 1CZGA 4ID6A 4LF8L 4DA2A 1GM5A 1A2UA 2NVQB 4OWTB 3MC0B 2A5HA 3J80c 5EKIA 2ZJQA 1EIFA 1PRTB 2R93H 4MTKA 1ET6A 5KNCA 4JI0L 4KK7A 5ISRA 4FO2A 2ZJPA 3I4LA 4JW0A 5M3MB 4ZAIA 4R8NA 4X62Q 3S1RB 2RQXA 3RD4A 3OIPA 4DR5Q 1FNWA 3D4WA 2R7FA 1RD9D 4HJAA 3P1HA 1S40A 3CCVA 3FPPA 2XRSD 3A7AB 2OXPA 4K14A 3EN2A 3F2CA 3VA5A 1UUPA 3AB9A 3OW2A 2CQOA 1VQKA 3WWVA 3KLSX 4NXML 5GAHC 2B2UC 1SMYC 4BXXH 4UY8C 1WTWA 3J80E 1EEFD 3CQZB 2CCZA 2B2WC 3OMGA 2KCMA 2F0MA 4POFA 1TIID 4RGOS 4KY5A 2DNEA 3ITPA 3UDGA 1LABA 4U673 1LTBD 3E9HA 1HNXQ 2Z8LA 4PMCA 1W2BA 1ZYRC 3GTJB 2FXQA 3M7NA 2XIWA 3H3VH 2UXBQ 3L3OC 2E2JH 5DNFA 4IURA 2AQ2B 1ZKOA 1DOKA 2VXWA 2DY8A 1VQPA 3GD7A 4JI5L 1PV4A 2PZWA 1FJGQ 5D3DA 2IPKD 2QDLA 3KFUA 2MGSA 3PUZA 4KTAA 4IUTA 1G6PA 1H9JA 4IUPA 2R93B 4H02A 2K52A 5EPLA 5JOBA 4KKTA 2K50A 4LF6L 1LT5D 1VMPA 5JVG3 4FYDA 4A3MG 4IFDG 1E0BA 2EVBA 4DV4L 1A15A 3BDLA 3F2DA 3PO3G 1G2TA 4JI3Q 1TWCH 3CHBD 1CKOA 1TR5A 4KV6A 2VB3X 4LFAL 3GTQH 4K8JA 1YNJD 5IGFA 2F0SA 2PO4A 1KLUD 2EY2A 2XRQD 1K9MC 3NUCA 1T5EA 4QJFA 2Z6KA 2B2VC 2SNSA 2NTTA 1B7YB 4AYBG 1HNWL 3KBGA 5C44G 3PMFA 4DUYL 4EQOA 4OWWB 2KEDA 1WTXA 1EY6A 5BN5A 1I4XA 2A1AA 1EY0A 5E7NA 1FGUA 2A6HD 2K5VA 4DXFA 3DWQA 1IHZA 4EQNA 4Y52H 1EYAA 3IFDA 1XPUA 2VW9A 1EZ8A 1QVGA 3M4QA 5C6AA 4DUZL 1EY4A 1PH5A 1G6ZA 3ND8A 2MQHA 2Q8TA 4V190 1JQYD 2GA4B 1B8AA 2CW0C 3I4NH 4IN3A 1U4LA 2E2JB 4F8MA 2O2LD 4AQYQ 1L1OC 1B4OA 1Q90A 2Z6BA 4UP9A 2VQFQ 4DR2Q 1I6HH 2WACA 1Y14B 1GD7A 3G6JB 1HNZL 2ZM6L 3VR3A 3S1MH 1B1ZA 4JI6Q 2PI2A 4UPAA 2F4VL 1ET9A 4A3LG 2M00A 4GLXA 3A56A 4A4IA 1XMOQ 1FNVA 1K3RA 3GV6A 2BH8A 3H09A 1BVSA 1Y1VG 1TWCB 3H6MA 3TP8A 1ML0D 3GTQB 4GN4B 4B3TQ 2I0QA 1ILQA 2EOTA 1TXYA 5C4XH 1YNNC 2JA6G 3C1EA 3K59A 3IFTA 4PMWA 3CCRA 2BH2A 2SOBA 3HOUG 2GN5A 2H1EA 1DOMA 4OGQC 5LMUQ 4GOPA 4G4KA 4ILWA 1B9MA 4OXPA 4PV1C 2HIXA 1YHQA 4S3SA 4RHSA 3IAYA 1EYDA 4CHTB 5JJZA 5FO9B 4JK1C 5IGBA 1EFID 1ASYA 1IBMQ 4EVOA 1JOQA 3F1ZA 3CMEA 1NR2A 1XJVA 3V05A 3LWEA 2EXDA 3J7AF 1D1KA 1PRTF 2Q2IA 4LFCQ 3M7GA 4DNRB 5CC4A 3WDNA 1Z7TA 1XMQL 3TP6A 3I4NB 2X6GA 3STBD 3PIP3 1HTLD 5A2QL 1IKLA 1PRTD 2OCEA 4C1NK 4DV1Q 4DR4Q 4MIUA 4DK6C 2ICEC 4P71A 3ULLA 2NZ1D 3L2PA 1XYIA 3W2DA 2DY7A 3S24A 1L1OB 2QDBA 3DEPA 4RHRA 3OOCA 1E24A 1I6HB 1EOVA 5JEAG 2F4IA 1WYDA 3BDOA 3A0JA 4TVAB 1BR9A 4DK1A 4MHEA 4DK0A 3GP7A 2K6AA 1OO9B 3J7ZC 3CKIB 3S1MB 1GOZA 2E75C 4H13C 1MI2A 3A55A 5COYA 1J9OA 3Q8DA 2AHOB 1KQSA 4DR3Q 4GS3A 3HKZB 3T1YL 1YHBA 3HFZB 4LNQA 1TWAH 3NWSA 4C2MH 1W3SA 1HFNA 4FF2A 3D8GA 5C4XB 3IRBA 4IUVA 1CSQA 1HZAA 1RL2A 3NTKA 1Q1BA 2A68D 1SROA 1HNXL 4HJ9A 3TEHB 3AEVA 3JAME 4K6LA 5BR8Q 1CQVA 4RA8A 4DR6L 2BOSA 5M5YH 2KHSA 4WFN3 1VQNA 2D62A 5J1ZA 1NY4A 3A8KE 5C4ZA 1KXLA 5E1FA 4LUOA 5KIXA 4YY3Q 5C5LA 4XTCS 1EU4A 4LMQD 1KABA 5FJ8G 4G57A 4K5VA 1MSHA 1VQ4A 1BDOA 4B3RQ 4LFBQ 2RSOA 1B53A 1EQTA 2PMZE 1XTCD 1K8AC 1GHJA 4R4QA 2E2DC 1EFWA 2B63H 1KAAA 4CKCA 2B8FA 2EZVA 5FLXL 5C3WA 2D0OA 2F52A 1EIGA 2K01A 4BBSH 2KUMA 3C46A 3GTOH 5LL6X 2RA4A 4IUQA 4LF8Q 2XVSA 4OELB 1F2LA 1GUNA 3G48A 4X3UA 1Z47A 4A3KH 1CI3M 1HXYD 1KAWA 2K5WA 4WRDA 2FFKB 2HUGA 2RHSB 1T9HA 2RDFA 3CCSA 3EBEA 4ZKCB 3AFQA 4F7XA 5DM73 4MTNA 4HMIA 1ICWA 3E0EA 3NBIA 3J81E 1RJTA 1N9WA 5GROA 1SE3A 2R92H 1V1PA 3PIPA 1TWAB 3HRZC 3NEMA 4C2MB 2F0PA 2QILA 3SEBA 3BVZA 5NUCA 1K83H 3TP7A 3VR4A 4QUFA 2K1BA 3PQIA 1SNCA 1EWIA 4NW2A 1BF4A 1SMYD 3OSOA 1A2TA 3LGJA 4A3IG 1D5ZC 5IP9H 4UP7A 5M5YB 1N33L 3BYYB 5I6YA 4DAVA 3SK8A 2JA8G 2ALYB 2JA7G 1CK1A 1WTQA 4IPHA 4CKBA 4X65Q 1SYFA 1DCZA 2ASBA 4RMFA 2FMMA 1JJ2A 3JC66 2WAQE 1LTSD 1B3AA 3I90A 2FJ2A 2QA4A 5JJKA 2HQLA 1ZYRD 4R4IA 1QNKA 1K28A 3I72A 1K8GA 5ELCA 5EJWA 1FVIA 1STHA 1F9SA 4JI6L 3HOZG 2B63B 3S2HH 5LL6S 1CZWA 3LNNA 4HSPA 5F2DA 4C3IG 5H1SE 1XMOL 4FF3A 2WAQG 4APVA 3BZCA 3GTOB 3FP9A 5KNDA 2ZTEA 4QIWB 2QCPX 1FL0A 3OYYA 3X3NA 1G291 4BBRG 4CDDC 2A8VA 4HJ7A 2NTSA 3RLNA 2F3VA 2F0VA 4N8X1 4A3KB 1E2ZA 1OXUA 4QL5A 4IUUA 1VQ7A 3S17H 2F0QA 4LF6Q 3NSWA 4R4OA 5KYLA 2BE5D 3T53B 3DWPA 1Q7YC 1GUWA 1LTLA 4DV4Q 4JI8Q 4IOCA 1D2BA 3KJPA 2UXDQ 2R92B 1WVLA 1AW7A 4LFAQ 2F3WA 4ULLA 2EPBA 3A7LA 3KJOA 1H9RA 1PFBA 1K83B 1PVOA 2EQSA 1A3TA 1VQ8A 2NWGA 4KY7A 4BY1H 1NJIC 1HNWQ 5D65A 3N52A 2VUMG 1IYVA 4J15A 1WI5A 4DUYQ 2YTYA 4LFCL 4ABNA 3T16A 4A3JG 2AMCB 2NZOA 5I2XA 2L12A 1N36L 1EL0A 5IYCH 1SMXA 2CWAA 1NUCA 2ICIA 2E76C 2CHBD 2R3ZA 1LTGD 2SDFA 2CW0D 4A75A 1GUGA 1STAA 1JMCA 4KMUC 5IGCA 2AWNA 4QMGA 1QUQB 1CA6A 2N78A 2R7ZG 3S2HB 2M9VA 3KK7A 3OW7A 1PZJD 3S1RH 1GUTA 1O7LA 4R1JA 4CBVA 3K58A 2DJGC 3KUPA 4RGNA 2N3SA 1A0IA 1HJPA 2NN6G 4QY7A 5JJIA 2Y0SE 3U4ZA 5GAGC 2CFMA 1Q3LA 3NENA 2ATWA 2F0IA 4HR7B 3EVQA 1EQQA 3GV3A 2ZM6Q 3S17B 4N9TA 3T13A 4A3CG 4LF4Q 2Z4HA 4Y7NH 2F4VQ 5M5WH 1EYGA 2ZJRA 4HTHA 1L0YB 1QG7A 4A3DG 3KF6A 1KDBA 2OTLA 1Q1EA 1E7ZA 1LO5D 2N49A 3L9AX 3OMCA 1VQEA 2BA1A 4DU9A 4K0KQ 2LXJA 4DR1L 1AH9A 1H9KA 3CPFA 2X6LA 4BY1B 4B3RL 4OO1G 4LFBL 4HJ5A 2F03A 3R2TA 4GN5A 4HCEA 4YWMA 1X56A 4ODGA 1DXMA 2Z9HA 4NB3A 1NBWA 1KIXA 3CMAA 1HZCA 1ESRA 3ICEA 3EQLC 1WOCA 2Q2HA 1PH4A 4MZ9A 1EY7A 4K5WA 3V96A 3BG3A 5LHY1 2PMZB 3MEHA 1HUMA 1STEA 4F87A 2EYHA 2HDMA 1X3EA 2ZXRA 1XMQQ 4JI7L 3C2PA 3I4MH 1ASZA 2ZTCA 5I9OA 4DAYB 4JBMA 1U9RA 5C3EG 1BKBA 1CKNA 1IW7C 1HTPA 1PH2A 3CP0A 4KN4C 2BDNA 3M9BA 2SEBD 1EWHA 1A8VA 1WCMH 2D2CC 4JI2L 1XTDA 2VZAA 2PQAB 5CV8A 1JB3A 4C3HG 1X3PA 2K28A 3CD6A 5EAYA 1TY2A 2FINB 4FXKC 3HOVH 1C0AA 3URYA 4OIJA 4Y7NB 1A3UA 4FDBA 1SNDA 1H9SB 5M5WB 3RR5A 5K5PA 1KL9A 4EX5A 4LUZA 4X65L 1JWSD 2RBMA 3DLLA 3T1YQ 4K6DA 3L0OA 4UDUC 2E74C 3TDQA 4K2KA 1K8OA 4R9WA 3H15A 1IYUA 1H95A 1N8RC 3MXNB 3NQIA 1PYWD 4L5TA 4ZK9B 2N88A 4XXEA 4ZRZA 4C3JH 1HA6A 1A62A 1MIUA 5HURA 4A93H 4RAUC 1PLFA 1CQFA 4A3BG 4DPGA 4IJHA 4DR6Q 1H9SA 1UE5A 1Y1WH 3HOZB 1QJOA 1EIHA 2JYOA 4GKJQ 1E2VA 1GO3E 2WAQB 4A76A 3CC7A 1RDPD 2KOLA 2F3IA 4OL7A 3MXNA 4CJ1B 4UAIA 4H7BA 1A6XA 3A5ZB 1VS0A 5M3FG 2QF7A 4A3GH 4R8IA 4QCLA 3HP3A 3NWTA 5A2QE 4JI8L 3HOYH 2MO0A 4AYBE 3DUZA 2AWOA 2RDHA 2L5TA 4ZUJA 3I4MB 2O5IC 2UXDL 1YI2A 4X66Q 1RCVD 1U0LA 4J8QA 2EY6A 2ZT9C 4P2CB 4O1NA 1BCPC 5E4WC 1Y8NB 1WCMB 4FXDA 1L2FA 3H0GH 3HOWG 3HKSA 1C4QA 1A63A 1X3GA 1BBXC 4X3TA 2OQKA 2NB0A 3HOVB 1BBWA 4P72A 3RN5A 4OHJA 1S72A 2F0FA 5E4XA 1S5BD 4NPSA 3VR6A 3SK5A 4QUCA 4ZCKA 1M4VA 1KTKA 5FLXc 5FLMH 3FKIG 4EGVA 1TVXA 1OXXK 5IWAL 2HIVA 1G8ZD 3PV0A 1V9PA 2YYZA 4NKLA 5J22A 3VYTA 3GTKH 3G71A 2NZHA 2F0DA 5D14A 4HCSA 3X3MA 4C3JB 2IT1A 3TSSA 1EZ6A 2XNAC 5CYUA 2LKVA 2E2HH 4A93B 1VCIA 1OXSC 4XQNA 2KCTA 1VQHA 1STYA 1BUVT 2L9HA 2NYZD 1N33Q 2MP1A 3TREA 1Y1WB 4EQPA 2VNUD 4LF9L 4XT1B 1PFMA 1G51A 1IL2A 2B2UA 4DV6L 5DEHA 3HS0C 2B2WA 2OQ0A 1EIYB 1HUNA 5I6WA 3KDFB 2AQ3B 1SDFA 4TQUS 4BY7G 2DGYA 2J0TD 5CBAE 1I4GA 2JA5G 5C5MA 5LMNQ 4DV5Q 4IPDA 1EY8A 1YJWA 4HJ8A 4A3GB 4LF4L 3M3YH 4GNXC 5FLXE 1ENCA 2EYLA 2Q2TA 2F0UA 3S2DH 1QB5D 2KEEA 3HG9A 1AE2A 3HOYB 3DEOA 3AU7A 2Y0SB 1I4HA 3I3CA 4LWCA 3ZJYC 2WB1G 5IP7G 5G3LF 3RZDH 1UE7A 4K0KL 2VB2X 3J7YW 1H9MA 3KDFA 3H0GB 1KRSA 4HEDA 2OTJA 4JOIC 1I6VC 1EY9A 2LXKA 3HOXG 4RGMA 3S16B 2A6EC 1XPOA 1F9QA 1CT1D 1AZPA 4E6IA 2B2TC 1R4PB 1BO0A 3RNUA 4J1MA 1V8QA 5IOCA 2Q8IB 2SNMA 3VR2A 4LAAA 2EDGA 4L63B 3J81j 2RSNA 1E1OA 1CUKA 1U4RA 4KJOA 5KNBA 4X64L 1PHJA 1HQRD 5C0XG 3GTKB 2RVLA 1TWGH 5EKLA 2B2VA 2ENBA 1E1TA 3D4DA 2LY7A 1HQMC 5EPKA 4YWLA 3GTMH 4IOAA 3BJUA 2WFWA 3I70A 2E2HB 2J7ZA 1HH2P 3G6EA 5CV6A 1V1OA 2F0KA 4CGYB 4A3MH 4PZ7A 1LM0A 3O13A 4IFDH 4B3ML 1N36Q 3JAMc 3PO3H 2G9HD 3K8AA 2Z4IA 2F0HA 3WOFA 1BXTA 4XQQA 2LFNA 1F9PA 1MJEA 4ME3A 4CJ0B 5E3FA 3PO2G 3SE0A 1GVPA 3HGBA 4DNIA 5K36G 1B9NA 5C44H 2EYOA 2E2IH 1Z6HA 3M3YB 2AQ1B 1EUJA 3S2DB 3A8JE 4GNXB 1WD0A 4DK3C 5IODA 1RKNA 1X6OA 2LSSA 4A3FG 3T1HL 3CW2C 1O7IA 3A8IE 3RZDB 2KQ3A 1SFOH 1L1OA 1UNSA 3MWYW 1K8MA 4Z9CB 2KBNA 5CGKA 1JWMD 2MO1A 3PIO3 2PZUA 1I94L 2AUJD 3CC2A 1DM0B 4FNFA 5LMNW 2JEBI
chains in the Genus database with same CATH topology
1U4PA 2B2YC 4M8AA 4HMJA 1F2MA 1STBA 2A73B 2CQAA 3K6OA 1B50A 1SEBD 1TWGB 3K5OA 4RKBA 3M4YA 3SK6A 1SE2A 4ZUIA 3GTMB 3VYUA 3NXWA 1MBYA 1JICA 3MAQA 3TZDA 3Q22A 1M8AA 4CJ2C 3GQBA 3T4AC 4A3MB 4FF1A 3BS1A 2C5CA 4G7ZC 3PO3B 1AZQA 2A74C 5ELFA 2PQEA 2KJXA 5JAVA 2I46A 1Q12A 2JEAI 4AYBB 3F2UA 2OT2A 5C44B 2E2IB 4L6TB 1IW7D 1ZXTA 1CM9A 1SE4A 2R61A 5EQ0A 4K5XA 3CRLC 3P7JA 2EJMA 4XYOA 2XN9C 1PFNA 1FGBD 1SSOA 2R6GA 1SAPA 1SFOB 3SK4A 2F0NA 3FKIB 5CR3A 2G9DA 3MTSA 4CKEA 2PW5A 4TKOB 2ZXPA 5KYIA 2HCIA 4GZYC 3NK9A 2LS01 4ME5A 3U9SA 1D5MC 3IKJA 1SYDA 5IT9L 2NVXB 1CHQD 2HQEA 4FP5D 3QIAA 2TMPA 2K5DA 4FXGC 3A54A 1LT4D 5C3XA 3EFXD 1LT3D 5JEAH 4KKSA 5EKKA 4Q5VA 5EGTA 1GXDC 5J39A 2B2YA 2L55A 5EBCA 1F77A 5KRUA 1AEXA 4X3KA 1TWFB 2F0TA 3ONAB 1Y1VB 2H4OA 2HCCA 2JXMB 2L1BA 2WKCA 3R2IA 2ZXOA 3VYSA 3TBIB 5TSSA 1FYCA 3Q6SA 5CV7A 3NTHA 1TQOA 2JA6B 5CV9A 1W6KA 2IL8A 1CHPD 1RTOA 2BCOA 5CMDA 3HOUB 3RLFA 1S5FD 4IFDJ 3UI2A 3KLSA 2X69A 2FMCA 2EY1A 1O80A 1L0XB 4ZQ3A 2A69C 2EYFA 3RZOB 1JE4A 1UEAB 2OF1A 1DOLA 1XXGA 1CA5A 3CU7A 5FO8B 2NVYB 4RFBA 3E5SA 3FDTA 2QEJC 5D3IB 2BDOA 1HPCA 3RMHA 3P75A 3FRPB 1DZ1A 1FD7D 4PMBA 4BS9A 2K03A 4XT3B 3H94A 1SNPA 3N6RA 1SNQA 3WOEA 5JVH3 1HHVA 3QWNA 4U68A 4DF7A 1IL8A 3K7AB 3DXJC 3C3LA 1C48A 3M85A 4K2LA 4LK1C 2PZTA 1CFMA 3I91A 4C56C 4TRDA 5JPNC 5JPMC 1GUSA 3I73A 1HA5A 2L11A 4I65A 5A35A 1JCKB 1D1IA 4XDXA 1LV9A 1YNND 3CRKC 3DM1A 4DXGA 2F0WA 2A6ED 1EY5A 4IQZA 2Q8RE 1SJHD 2DNCA 1STNA 1OXVA 3R8BA 4M1UB 2EYJA 1QWYA 3MFYA 4RCNA 4YIJA 3R3OA 1WTVA 1JR0D 3SR1A 1SNMA 2XWJB 4O42A 4MN3A 4ZKBB 3S15B 1SYBA 3DMUA 4IFDI 2JSOA 2NVTB 3VYRA 2WP8J 1I3QB 1A3VA 1XWEA 1IKMA 1HCZA 4RKLA 3DHQA 1GJXA 2Z1CA 1I50B 3EJIA 4C1NI 5JEAJ 4QB4A 1PDQA 3BVGA 5C4HA 2CVRA 5DAUA 4A3IB 1X3QA 4DAYA 4NMZA 2JA8B 1EWCA 3E6ZX 2JA7B 3NPPA 1NSNS 1LT6D 1LTRD 2PPBC 2PNRC 3U9OA 1VDZA 4F88A 2EJFC 3QO2A 2K05A 3TP5A 2BA0A 1D5XC 5FKAC 3BVMA 4NDXA 4KD3A 4C3IB 3SHLA 1G2SA 1EYCA 3OPOA 1ILPA 1AP0A 2YU9B 3J7AV 4X3SA 1NCVA 2NN6H 5IGGA 4DAPA 1LTTD 5IGDA 1WTOA 1B44D 4BBRB 1KLGD 3H3VC 4Q0FA 2WIIB 3OWFA 4IUNA 2EE1A 5IGEA 1S5DD 4G7OC 2EY5A 2PCFB 2EYMA 3QB3A 2HDLA 2IWHA 5FOBB 1I4PA 2QKIC 3GTPB 1ZEQX 4OO1H 1SYCA 2VUMB 4IALA 1TKWB 1EQVA 5I2YA 4DFAA 1PZKD 2BE5C 2F1MA 4A3JB 3S1NB 5C0XI 1SJED 1KNAA 1TY0A 4JBWA 2WV6D 1E2WA 2K5QA 2J4XA 4WORA 4G7HC 3FVQA 1SYGA 1I4QA 2R7ZB 1TS2A 1RF2D 4KY6A 1O7ZA 1D6EC 1TS5A 3M4OB 3VA7A 2IX3A 5FK9C 3MZ5A 1PTOC 4OIKA 1KDAA 4KHZA 1BQQT 1DYQA 1PTOH 5T1IA 3C1FA 2B8GA 1RTNA 1G91A 4BA2I 2KVMA 4A3DB 3NE5B 5C4JB 1EOTA 4B9WA 1BCPB 3GTGB 5G3LD 2K32A 3MXUA 1MD2D 1F9RA 2D5DA 3QOJA 1Y8PB 2F0GA 4RCOA 3D31A 3J80L 1FR3A 1ESFA 5KEEA 1PMRA 1I4RA 2IX1A 2A69D 1R9TB 1SXTA 4RWSC 4PQXA 1JWUD 1QOHA 4L8JA 1VF7A 3BYTB 1SYEA 4TSSA 5ELDA 2WKDA 3LX0A 3NQTA 4RH6A 2O5JC 2EXZA 2MHVA 1VMCA 4HSVA 5IT9E 1GUOA 2DN8A 1F2ZA 5C3EB 4KHVA 3ZYYX 1OXTA 4N9PA 1HFGA 1Q8IA 1EU3A 2M2LA 3G7LA 4FF4A 1DJRD 1QE6A 4C3HB 1PTOB 3K5NA 3MHBA 1TU2B 1TWHB 2PW7A 1LLRD 3MXGA 2FHTA 3MFGA 3T51B 2O4XA 3SVMA 5FO7B 3D3RA 4KN7C 3TMEA 3E0JA 2NBFA 2AUKA 3QG1A 1ONLA 3TZUA 3R93A 5IIFA 3MXPA 3PUYA 4A3BB 5ELEA 2RDGA 4RGTA 1C8CA 3D6WA 1ENAA 2IX0A 1LTID 3H91A 1DD2A 4QF4A 2K33A 3HZXA 1O78A 5M3FB 2OEOA 2F0EA 1ENFA 3PUVA 1SNOA 5DM63 4XQJA 2B2TA 4K8IA 4HN7A 1MSGA 3FPUB 3IL8A 1SBBB 1S5CD 5EBDA 5I9PA 2MUYA 2LMCB 3BZDB 1Y69U 3HOWB 2MPMA 3Q23A 3KF8A 1HRJA 1V1PB 1JOOA 2K04A 1LACA 5CV4A 1UAPA 1KDCA 3OIQA 3GO5A 2KCNA 4B08A 3QOLA 1YNJC 1STGA 2NUCA 1EEID 3SDZA 3FEWX 5T1GA 5C0XH 4DN4M 1R4QB 2IW3A 1TS4A 3Q0AA 2F0OA 3K57A 3AMUA 1CTMA 1U4MA 3HEJA 4KJNA 4H44C 1V43A 2F0LA 2A6HC 2K7VA 1Y8OB 2RKSA 4IZ8A 4BY7B 2XWBB 2JA5B 1F2YA 1FNUA 3PUXA 5K36H 4I7ZC 2F0JA 2NN6I 1JORA 1VF5C 5CORA 2KECA 3OHXC 4PNYA 3K0YA 3Q24A 2IJ0A 2WB1B 1AN8A 1TT2A 3MA2B 3NBHA 4BA1I 1X32A 3FMCA 4NP5A 1II3A 3NP8A 1BCPF 1LTAD 2TSSA 3BDCA 2EJGC 5BN4A 3DWAA 4BBSB 3HOXB 1BCPD 3KLRA 3L7ZC 1NR4A 4OO1I 1WTRA 5M9OA 5KGUA 5CV5A 3EROA 3SXHA 3KBXA 2WINB 1J8IA 2MJ8A 1GHKA 1RODA 3K5MA 3JAML 1NAPA 4BWGB 1S5ED 5HGTA 1PZID 2ID0A 3D6CA 1XX8A 4LJZC 1AFPA 2C9OA 1B2TA 5M5XB 1BNZA 3QJYA 5BN3A 3I8ZA 4ZLTF 3PO2B 1QILA 2I07B 3RUZA 4B9XA 1PTOF 3LWUA 4J6HA 4WJWA 3TN2A 2KCCA 2D9UA 4A3FB 1QNUA 1PTOD 1PRTC 4C3JG 2JP1A 3EA6A 2B39A 1KNEA 2PYKA 3NTIA 1T5XD 2EYPA 3W3AA 3P20A 1PXUA 1MGSA 1BOSA 4KD4A 2N55A 3J81L 3S9WA 2XSCA 4KKUA 4A3EB 3S1QB 4HAEA 2V4DA 3D4RA 1QCBD 3GTLB 3MVVA 4DNTB 3ERQA 1S4ZA 5AFWA 1JOKA 3PUWA 5I4DA 1DONA 1O7YA 1W6JA 2A68C 4V0BA 4KI0A 3K5LA 1JC7A 2L0CA 4ZYSA 3ND9A 1WD1A 4H0LC 3V2TA 4XYQA 3NHHA 2JE6I 4FVMA 5EPJA 5CBEE 4DGZA 1TS3A 3VR5A 3OWEB 3T56B 5C0XJ 2L4NA 3S14B 5ELBA 1RHPA 2KA7A 4XIGS 1CZGA 4ID6A 4DA2A 1A2UA 2NVQB 3MC0B 2A5HA 5EKIA 1PRTB 1ET6A 5KNCA 4KK7A 5ISRA 4FO2A 3I4LA 5M3MB 4ZAIA 4R8NA 3S1RB 2RQXA 3RD4A 3OIPA 1FNWA 3D4WA 1RD9D 3P1HA 3FPPA 2XRSD 3A7AB 2OXPA 4K14A 3VA5A 1UUPA 3AB9A 3KLSX 2B2UC 1SMYC 1WTWA 3J80E 1EEFD 3CQZB 2B2WC 3OMGA 2F0MA 1TIID 4RGOS 4KY5A 2DNEA 3ITPA 1LABA 4U673 1LTBD 2Z8LA 4PMCA 1ZYRC 3GTJB 3M7NA 2XIWA 3L3OC 5DNFA 4IURA 2AQ2B 1ZKOA 1DOKA 2VXWA 2DY8A 3GD7A 2PZWA 5D3DA 2IPKD 2MGSA 3PUZA 4KTAA 4IUTA 1H9JA 4IUPA 2R93B 5EPLA 5JOBA 4KKTA 1LT5D 1VMPA 5JVG3 4FYDA 4IFDG 1E0BA 2EVBA 1A15A 3BDLA 1G2TA 3CHBD 1TR5A 4KV6A 2VB3X 4K8JA 1YNJD 5IGFA 2F0SA 2PO4A 1KLUD 2EY2A 2XRQD 3NUCA 1T5EA 2B2VC 2SNSA 2NTTA 3KBGA 3PMFA 4EQOA 2KEDA 1WTXA 1EY6A 5BN5A 1I4XA 1EY0A 2A6HD 4DXFA 3DWQA 1IHZA 4EQNA 1EYAA 3IFDA 1EZ8A 5C6AA 1EY4A 1G6ZA 3ND8A 2Q8TA 4V190 1JQYD 2GA4B 2CW0C 4IN3A 1U4LA 2E2JB 4F8MA 2O2LD 1B4OA 1Q90A 2WACA 3G6JB 3VR3A 1B1ZA 1ET9A 2M00A 3A56A 1FNVA 3GV6A 3H09A 1TWCB 3H6MA 3TP8A 1ML0D 3GTQB 1ILQA 2EOTA 1YNNC 3C1EA 3K59A 3IFTA 4PMWA 2SOBA 2H1EA 1DOMA 4OGQC 4G4KA 4ILWA 1B9MA 4PV1C 4S3SA 4RHSA 3IAYA 1EYDA 4CHTB 5JJZA 5FO9B 4JK1C 5IGBA 1EFID 4EVOA 1JOQA 1NR2A 3V05A 3LWEA 3J7AF 1D1KA 1PRTF 4DNRB 3M7GA 5CC4A 3WDNA 1Z7TA 3TP6A 3I4NB 2X6GA 3PIP3 1HTLD 5A2QL 1IKLA 1PRTD 4C1NK 4MIUA 2ICEC 2NZ1D 1XYIA 3W2DA 2DY7A 2QDBA 3DEPA 4RHRA 3OOCA 1I6HB 5JEAG 2F4IA 3BDOA 1BR9A 4DK1A 4MHEA 4DK0A 2K6AA 1OO9B 3GP7A 3CKIB 3S1MB 1GOZA 2E75C 4H13C 1MI2A 3A55A 5COYA 1J9OA 3HKZB 3NWSA 1HFNA 4FF2A 3D8GA 5C4XB 4IUVA 3NTKA 1Q1BA 2A68D 3JAME 4K6LA 1CQVA 4RA8A 2BOSA 2KHSA 4WFN3 2D62A 5J1ZA 3A8KE 5C4ZA 5E1FA 5KIXA 5C5LA 4XTCS 1EU4A 4LMQD 1KABA 4G57A 4K5VA 1MSHA 1BDOA 2RSOA 1B53A 1EQTA 1XTCD 1GHJA 2E2DC 1KAAA 4CKCA 2B8FA 2EZVA 5FLXL 5C3WA 1EIGA 2K01A 2KUMA 3C46A 5LL6X 2RA4A 4IUQA 2XVSA 1F2LA 1GUNA 4X3UA 1Z47A 1CI3M 1HXYD 2K5WA 4WRDA 2FFKB 2HUGA 2RDFA 4ZKCB 4F7XA 5DM73 4HMIA 1ICWA 3NBIA 3J81E 1RJTA 1SE3A 1V1PA 1TWAB 3HRZC 4C2MB 2F0PA 2QILA 3SEBA 3BVZA 5NUCA 3TP7A 3VR4A 4QUFA 2K1BA 1SNCA 4NW2A 1BF4A 1SMYD 3OSOA 1A2TA 1D5ZC 5M5YB 3BYYB 5I6YA 4DAVA 3SK8A 1CK1A 1WTQA 4CKBA 1SYFA 1DCZA 2FMMA 1LTSD 1B3AA 3I90A 2FJ2A 1ZYRD 1QNKA 3I72A 5ELCA 5EJWA 1STHA 1F9SA 2B63B 5LL6S 1CZWA 3LNNA 4HSPA 5F2DA 4C3IG 4FF3A 3GTOB 5KNDA 4QIWB 2QCPX 3X3NA 1G291 2NTSA 2F3VA 2F0VA 4A3KB 1E2ZA 1OXUA 4IUUA 2F0QA 3NSWA 5KYLA 2BE5D 3T53B 3DWPA 1GUWA 1D2BA 2R92B 1WVLA 1AW7A 2F3WA 4ULLA 2EPBA 3A7LA 1H9RA 1PFBA 1K83B 1A3TA 2NWGA 4KY7A 5D65A 3N52A 1IYVA 4ABNA 3T16A 5I2XA 2L12A 1EL0A 1NUCA 2ICIA 2E76C 2CHBD 2R3ZA 1LTGD 2SDFA 2CW0D 1GUGA 1STAA 4KMUC 5IGCA 2AWNA 4QMGA 1CA6A 3S2HB 2M9VA 3KK7A 3OW7A 1PZJD 1GUTA 1O7LA 4CBVA 3K58A 3KUPA 4RGNA 2NN6G 1Q3LA 2F0IA 4HR7B 3EVQA 3GV3A 3S17B 4N9TA 3T13A 2Z4HA 4HTHA 1L0YB 1QG7A 1KDBA 1Q1EA 1LO5D 3L9AX 3OMCA 2BA1A 4DU9A 1H9KA 2X6LA 4BY1B 4OO1G 2F03A 3R2TA 4HCEA 4ODGA 1DXMA 1ESRA 3EQLC 1EY7A 4K5WA 3V96A 3BG3A 5LHY1 2PMZB 3MEHA 1HUMA 1STEA 4F87A 2EYHA 2HDMA 2ZXRA 3C2PA 5I9OA 1U9RA 1IW7C 1HTPA 4KN4C 2BDNA 2SEBD 1EWHA 2D2CC 5CV8A 1JB3A 4C3HG 1X3PA 2K28A 1TY2A 2FINB 4FXKC 3URYA 4OIJA 4Y7NB 1A3UA 1SNDA 1H9SB 5M5WB 5K5PA 1JWSD 2RBMA 4K6DA 4UDUC 2E74C 3TDQA 4K2KA 1K8OA 4R9WA 1IYUA 3NQIA 1PYWD 4ZK9B 2N88A 4XXEA 4ZRZA 1HA6A 5HURA 4RAUC 1PLFA 1CQFA 1H9SA 3HOZB 1QJOA 1EIHA 2JYOA 1E2VA 2WAQB 1RDPD 2KOLA 4OL7A 3MXNA 4CJ1B 4UAIA 4H7BA 1A6XA 2QF7A 4R8IA 4QCLA 3HP3A 3NWTA 5A2QE 3DUZA 2AWOA 2RDHA 2L5TA 4ZUJA 3I4MB 2O5IC 1RCVD 4J8QA 2EY6A 2ZT9C 4P2CB 4O1NA 1BCPC 5E4WC 1Y8NB 1WCMB 4FXDA 1C4QA 1BBXC 4X3TA 2NB0A 3HOVB 4OHJA 2F0FA 5E4XA 1S5BD 3VR6A 3SK5A 4QUCA 1M4VA 1KTKA 4EGVA 1TVXA 1OXXK 1G8ZD 3PV0A 2YYZA 4NKLA 5J22A 3VYTA 2F0DA 5D14A 4HCSA 3X3MA 4C3JB 2IT1A 3TSSA 1EZ6A 2XNAC 5CYUA 2LKVA 4A93B 1VCIA 1OXSC 4XQNA 1STYA 1BUVT 2L9HA 2NYZD 2MP1A 1Y1WB 4EQPA 2VNUD 4XT1B 1PFMA 2B2UA 5DEHA 3HS0C 2B2WA 1HUNA 5I6WA 2AQ3B 1SDFA 4TQUS 2J0TD 5CBAE 1I4GA 5C5MA 1EY8A 4A3GB 5FLXE 1ENCA 2EYLA 2F0UA 1QB5D 2KEEA 3HG9A 3HOYB 3DEOA 3AU7A 2Y0SB 1I4HA 3I3CA 5G3LF 2VB2X 3J7YW 1H9MA 3H0GB 4HEDA 1I6VC 1EY9A 4RGMA 3S16B 2A6EC 1F9QA 1CT1D 1AZPA 4E6IA 2B2TC 1R4PB 1BO0A 4J1MA 5IOCA 1V8QA 2Q8IB 2SNMA 3VR2A 4LAAA 2EDGA 4L63B 2RSNA 1U4RA 4KJOA 5KNBA 1HQRD 5C0XG 3GTKB 2RVLA 5EKLA 2B2VA 2ENBA 3D4DA 2LY7A 1HQMC 5EPKA 3I70A 2E2HB 2J7ZA 5CV6A 1V1OA 2F0KA 4CGYB 3O13A 4IFDH 2G9HD 2Z4IA 2F0HA 3WOFA 1BXTA 4XQQA 2LFNA 1F9PA 4CJ0B 5E3FA 3SE0A 3HGBA 5K36G 1B9NA 2EYOA 1Z6HA 3M3YB 2AQ1B 3S2DB 3A8JE 1WD0A 5IODA 1RKNA 3A8IE 3RZDB 2KQ3A 1UNSA 3MWYW 1K8MA 4Z9CB 5CGKA 1JWMD 3PIO3 2PZUA 2AUJD 1DM0B 4FNFA 1WTPA 2JEBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T1G A;  3DEO A;  4DN4 M;  1U4P A;  2B2Y C;  4IUU A;  5EKI A;  3I3C A;  2X6L A;  2KOL A;  3I8Z A;  1EIG A;  1O7Z A;  2K01 A;  5JJZ A;  2KUM A;  2FHT A;  4ZLT F;  4CJ1 B;  2B2V C;  4UAI A;  1GUW A;  3I91 A;  2B2Y A;  3QO2 A;  2K05 A;  2RA4 A;  4IUQ A;  1U4M A;  4X3K A;  4HED A;  3SVM A;  1WVL A;  1J8I A;  4OIK A;  4R8I A;  4ZAI A;  2L11 A;  1B50 A;  1ESR A;  3ONA B;  3TN2 A;  1NR2 A;  2HCC A;  1F2L A;  4XDX A;  3HP3 A;  5T1I A;  1LV9 A;  2EPB A;  2KED A;  2L1B A;  3LWE A;  2D9U A;  4X3U A;  1WTX A;  3DM1 A;  1PFB A;  3Q6S A;  1F9Q A;  1RTN A;  2NWG A;  2FFK B;  1AZP A;  2HUG A;  1G2S A;  2B2T C;  1JIC A;  2JP1 A;  2X6G A;  1HUM A;  3N52 A;  5D65 A;  1ILP A;  3TZD A;  1BO0 A;  2IL8 A;  1AP0 A;  1IKL A;  1KNE A;  5E4W C;  4ZKC B;  1M8A A;  2KVM A;  3R93 A;  2Q8R E;  4X3S A;  4CJ2 C;  1ICW A;  1NCV A;  1MGS A;  2NZ1 D;  1RJT A;  1RTO A;  3IFD A;  5CMD A;  1XYI A;  2RSN A;  2HDM A;  2DY7 A;  1WTO A;  1C8C A;  1EOT A;  3D6W A;  3DEP A;  2N55 A;  1U4R A;  2L12 A;  2KEE A;  1AZQ A;  1BBX C;  5COR A;  1G6Z A;  3UI2 A;  2KEC A;  2RVL A;  4X3T A;  2Q8T A;  1EL0 A;  2B2V A;  2X69 A;  2B2U C;  2EE1 A;  4MHE A;  5EPK A;  4QUF A;  1F9R A;  1WTV A;  1WTW A;  3H91 A;  2K1B A;  5E4X A;  4HAE A;  1U4L A;  2J7Z A;  1O80 A;  2B2W C;  2BDN A;  4QUC A;  2R3Z A;  4NW2 A;  4O42 A;  1X32 A;  1BF4 A;  2SDF A;  4MN3 A;  3F2U A;  4ZKB B;  1MI2 A;  2HDL A;  5COY A;  1J9O A;  1B4O A;  1ZXT A;  1TVX A;  1CM9 A;  1X3P A;  2K28 A;  1JE4 A;  1S4Z A;  5AFW A;  5EQ0 A;  1CA6 A;  3P7J A;  1WTQ A;  1DOL A;  2B2T A;  1DON A;  1O7Y A;  4RWS C;  1CA5 A;  1MSG A;  2FIN B;  1F9P A;  1PFN A;  3FDT A;  3FPU B;  1HFN A;  3IL8 A;  1NR4 A;  1IKM A;  4OIJ A;  1SSO A;  4HCS A;  5D14 A;  4IUV A;  4CJ0 B;  1SAP A;  3KUP A;  2FMM A;  2XIW A;  3MTS A;  1WTR A;  5DNF A;  4IUR A;  1B3A A;  3I90 A;  2FJ2 A;  1WD1 A;  2L9H A;  2NYZ D;  2MP1 A;  1DOK A;  2VXW A;  2DY8 A;  3GV6 A;  1QNK A;  1Q3L A;  4RA8 A;  3KBX A;  4XT1 B;  1PFM A;  1WD0 A;  1VMC A;  5EJW A;  2B2U A;  2MJ8 A;  4HSV A;  4R9W A;  5EPJ A;  1ROD A;  1F9S A;  5CBE E;  1ML0 D;  2MPM A;  1KNA A;  2MGS A;  1NAP A;  3GV3 A;  1HRJ A;  2K04 A;  2B2W A;  4IUT A;  1ILQ A;  1HUN A;  4IUP A;  2HCI A;  2EOT A;  4ZK9 B;  1DZ1 A;  2L4N A;  2N88 A;  1HA6 A;  1SDF A;  1RHP A;  2K03 A;  4XT3 B;  5EPL A;  1PDQ A;  1VMP A;  5CBA E;  3MWY W;  4LMQ D;  1HFG A;  4RAU C;  1PLF A;  2CVR A;  1QG7 A;  1MSH A;  1XX8 A;  1E0B A;  2M2L A;  3G7L A;  1A15 A;  1QE6 A;  1DOM A;  2H1E A;  1X3Q A;  2RSO A;  1B53 A;  1EQT A;  1G91 A;  1B2T A;  4U68 A;  1G2T A;  1HHV A;  1EIH A;  2JYO A;  1WTP A;  1BNZ A;  1IL8 A; 
#chains in the Genus database with same CATH topology
 3CCE A;  1U4P A;  2B2Y C;  1KC8 C;  2H5X A;  1PH1 A;  4A3E G;  2MFI A;  4GKJ L;  3U50 C;  4M8A A;  1Q86 C;  4HMJ A;  1F2M A;  1STB A;  2A73 B;  2CQA A;  4UHV A;  3K6O A;  1HZB A;  4OX9 L;  3J81 c;  3W1G A;  3UE1 A;  1B50 A;  4DR1 Q;  1DGS A;  4B3S L;  1SEB D;  1KRT A;  1TWG B;  3K5O A;  4RKB A;  3M4Y A;  3SK6 A;  1SE2 A;  4ZUI A;  3GTM B;  2KEN A;  4YCW A;  3VYU A;  3NXW A;  1MBY A;  1JIC A;  4IPG A;  3TZD A;  3MAQ A;  3Q22 A;  3KF8 B;  1M8A A;  4KLK A;  2K5N A;  4CJ2 C;  4HID A;  3GQB A;  3T4A C;  4A3M B;  4FF1 A;  2Z0S A;  4A3L H;  3BS1 A;  1WJJ A;  1TWF H;  2C5C A;  4X66 L;  4G7Z C;  3PO3 B;  1VQB A;  1XNR Q;  1Y1V H;  1AZQ A;  2A74 C;  3OTO Q;  5ELF A;  1YEZ A;  2KJX A;  2PQE A;  5JAV A;  2I46 A;  1Q12 A;  2JA6 H;  2JEA I;  3TS0 A;  4P73 A;  4AYB B;  3F2U A;  2OT2 A;  5C44 B;  2E2I B;  1MHW C;  4L6T B;  1IW7 D;  4O2D A;  3HOU H;  1ZXT A;  1CM9 A;  1SE4 A;  4JI7 Q;  2I5L X;  2R61 A;  5EQ0 A;  4K5X A;  3CRL C;  3P7J A;  1S3O A;  5AJ3 Q;  2EJM A;  4XYO A;  5IYD G;  2XN9 C;  1PFN A;  1FGB D;  1QZH A;  1SSO A;  2R6G A;  1SAP A;  1SFO B;  3SK4 A;  1L0W A;  4DV3 L;  4JI2 Q;  2F0N A;  3FKI B;  5CR3 A;  2G9D A;  3MTS A;  4LF7 Q;  2JK8 A;  1SN8 A;  4CKE A;  4YCV A;  4JBK A;  5M3M G;  2PW5 A;  2YTX A;  3RZO H;  4TKO B;  1HZ9 A;  4P74 A;  1VQF A;  2YV5 A;  2ZXP A;  2NVY H;  5KYI A;  2HCI A;  4GZY C;  3NK9 A;  1NNX A;  2LS0 1;  4ME5 A;  3U9S A;  1D5M C;  3IKJ A;  2JJQ A;  3VDY A;  1SYD A;  5IT9 L;  2NVX B;  1CHQ D;  3CCJ A;  2GVA A;  2HQE A;  2K75 A;  4FP5 D;  4CDC C;  3QIA A;  4HIM A;  3NBH B;  2TMP A;  2K5D A;  4FXG C;  3A54 A;  1LT4 D;  5C3X A;  3EFX D;  3ULJ A;  1LT3 D;  5LMN L;  4DV5 L;  5JEA H;  4POG A;  1SLJ A;  4KKS A;  5EKK A;  3PIO A;  3PSI A;  4Q5V A;  5EGT A;  1GXD C;  1X9N A;  5J39 A;  2B2Y A;  2L55 A;  5EBC A;  4O0A A;  4JV5 Q;  1F77 A;  5KRU A;  1AEX A;  4X3K A;  1TWF B;  2B3G A;  2F0T A;  4GKK L;  1VQJ A;  5IYB G;  1MJC A;  3ONA B;  1Y1V B;  4MNO A;  2H4O A;  2HCC A;  1V1Q A;  2JXM B;  4JI1 L;  3K7A H;  2L1B A;  2WKC A;  3R2I A;  2ZXO A;  3VYS A;  3TBI B;  5ELO A;  5TSS A;  1FYC A;  3Q6S A;  4NXN L;  2ES2 A;  5CV7 A;  3NTH A;  1TQO A;  2JA6 B;  5CV9 A;  1W6K A;  2IL8 A;  1CHP D;  3UDI A;  1YBY A;  4QQB X;  1RTO A;  2BCO A;  5CMD A;  3HOU B;  1P8L A;  3RLF A;  1S5F D;  2EIF A;  2CKZ B;  4IFD J;  3UI2 A;  4YHH Q;  1LYL A;  1WTP A;  3KLS A;  3BU2 A;  2X69 A;  2R93 G;  2FMC A;  2UXC Q;  1NMF A;  2EY1 A;  1O80 A;  4WJ3 M;  1L0X B;  5FJ8 H;  1X55 A;  2A69 C;  4ZQ3 A;  3K7U C;  2EYF A;  2G5D A;  3CCU A;  2RHQ B;  3RZO B;  1JE4 A;  1UEA B;  2OF1 A;  4DR7 L;  1JT8 A;  1DOL A;  1XXG A;  1CA5 A;  3MEF A;  3CU7 A;  4GN3 B;  5FO8 B;  2OWO A;  2NVY B;  4RFB A;  3E5S A;  3FDT A;  1B70 B;  4DKA C;  2QEJ C;  1X54 A;  1X3F A;  5D3I B;  2BDO A;  3E9I A;  5IWA Q;  1PYB A;  1HPC A;  2UUB L;  3S15 H;  3RMH A;  2P5Z X;  1K0S A;  3P75 A;  1Q81 C;  2NVT H;  1VQG A;  1YNX A;  1I3Q H;  3FRP B;  4BXX G;  1FD7 D;  1DZ1 A;  4PMB A;  4BS9 A;  2K03 A;  4XT3 B;  1PH8 A;  3E3X A;  3H94 A;  2PI2 E;  1SNP A;  3N6R A;  4LF9 Q;  1SNQ A;  3WOE A;  5JVH 3;  2VQE L;  1HHV A;  3QWN A;  4U68 A;  4DV6 Q;  4DF7 A;  1VQO A;  1E3P A;  1JE5 A;  1IL8 A;  3K7A B;  1I50 H;  3DXJ C;  3C3L A;  1C48 A;  1CSP A;  3M85 A;  4K2L A;  4JBJ A;  4R4C A;  4LK1 C;  2PZT A;  1CFM A;  3I91 A;  1XNQ L;  1QUQ A;  4C56 C;  2B29 A;  4TRD A;  5JPN C;  5JPM C;  1GUS A;  3I73 A;  1HA5 A;  4A3I H;  2A19 A;  2L11 A;  4I65 A;  5A35 A;  1JCK B;  1D1I A;  4XDX A;  2VL6 A;  1KD1 C;  4L5S A;  2JA8 H;  1LV9 A;  1YNN D;  2JA7 H;  3CRK C;  3DM1 A;  4DXG A;  2F0W A;  1CKM A;  1N32 Q;  2A6E D;  1PH3 A;  1EY5 A;  4IQZ A;  2Q8R E;  1SJH D;  2DNC A;  1STN A;  1OXV A;  1WTH A;  2XTI A;  3R8B A;  4DV7 L;  4M1U B;  2EYJ A;  2R7D A;  1QWY A;  3MFY A;  3QR8 A;  4RCN A;  4YIJ A;  5HGQ A;  3HOZ H;  1OTC A;  1N34 L;  4C3I H;  3R3O A;  3J80 i;  1WTV A;  2DJF C;  2QGQ A;  3AFP A;  1JR0 D;  1MKH A;  5L37 A;  2YU9 H;  1XNR L;  3SR1 A;  1SNM A;  2XWJ B;  4O42 A;  3OTO L;  1GKH A;  4MN3 A;  4ZKB B;  2V1C C;  4DV2 Q;  3TQY A;  4X64 Q;  3S15 B;  1SYB A;  2UUA L;  3DMU A;  1M90 C;  4IFD I;  2JSO A;  4BBR H;  1VQI A;  1PYS B;  2NVT B;  3VYR A;  4GLV B;  2WP8 J;  3CPW A;  1I3Q B;  1A3V A;  1XWE A;  1IKM A;  1HCZ A;  5AJ3 L;  4RKL A;  4B3M Q;  3CCM A;  3DHQ A;  2JA9 A;  2PNH A;  2Z6K C;  1U5K A;  1GJX A;  2CWP A;  3CCQ A;  2Z1C A;  2C35 B;  4YCU A;  4LF7 L;  1I50 B;  3EJI A;  1VQ5 A;  4C1N I;  3GTP H;  4YWK A;  2GVB A;  5JEA J;  4GLA C;  3I4N G;  4QB4 A;  4AIM A;  1PDQ A;  2VUM H;  3BVG A;  5C4H A;  2CVR A;  5DAU A;  1SRU A;  1IYJ B;  4A3I B;  1X3Q A;  4A3J H;  4DAY A;  3S1N H;  4OWX B;  3T1H Q;  4NMZ A;  2JA8 B;  1EWC A;  3E6Z X;  2JA7 B;  3NPP A;  3HKZ E;  1NSN S;  1LT6 D;  5JJL A;  1LTR D;  4IPC A;  2PPB C;  2PQA A;  2PNR C;  3U9O A;  1C9O A;  1VDZ A;  4PZ8 A;  4F88 A;  2EJF C;  4OEM B;  3QO2 A;  2K05 A;  1I94 Q;  1IBK L;  2E5L L;  3TP5 A;  3EIV A;  2BA0 A;  4WJ4 A;  3HKZ G;  1D5X C;  5FKA C;  3BVM A;  4NDX A;  4KD3 A;  2R7Z H;  2IHE A;  4JV5 L;  2QEX A;  4C3I B;  3SHL A;  3PF4 A;  5C4X G;  1SE8 A;  1G2S A;  1EYC A;  3OPO A;  3CF5 A;  1ILP A;  1AP0 A;  2YU9 B;  2KHJ A;  3M4O H;  1YHA A;  3UDF A;  4L5Q A;  3J7A V;  4X3S A;  4OX9 Q;  1NCV A;  2NN6 H;  2VY3 A;  5IGG A;  2HD3 A;  1NE3 A;  2N8N A;  4DAP A;  1LTT D;  5IGD A;  1WTO A;  4B3S Q;  1B44 D;  3F8T A;  4BBR B;  1KLG D;  3H3V C;  3K0X A;  4Q0F A;  2WII B;  4PG3 A;  3OWF A;  4IUN A;  2EE1 A;  1YJN A;  5IGE A;  4A3C H;  1S5D D;  4G7O C;  5GAE C;  2EY5 A;  4YHH L;  1YZ6 A;  2PCF B;  3W1B A;  2EYM A;  4A3D H;  3QB3 A;  2HDL A;  5C4J H;  1Q82 C;  2UXC L;  2IWH A;  2Q2U A;  3GTG H;  5FOB B;  1I4P A;  2IHF A;  1I5F A;  2QKI C;  4GOP C;  3GTP B;  1UWV A;  1ZEQ X;  2CH4 A;  2HHH L;  4OO1 H;  1SYC A;  1NMG A;  3S16 H;  4KHP L;  2VUM B;  4IAL A;  1TKW B;  1D8L A;  1EQV A;  5I2Y A;  4DFA A;  1PZK D;  2BE5 C;  2F1M A;  4A3J B;  3S1N B;  5C0X I;  1SJE D;  1R9T H;  1UE1 A;  1KNA A;  2XGT A;  1TY0 A;  4JBW A;  2WV6 D;  4DV3 Q;  1E2W A;  2K5Q A;  2J4X A;  1Z9F A;  4WOR A;  2MNA A;  4UP8 A;  3SGI A;  4LF5 Q;  4LW1 A;  4G7H C;  3FVQ A;  1HR0 Q;  1SYG A;  1I4Q A;  2R7Z B;  1TS2 A;  1RF2 D;  4KY6 A;  5C3E H;  1O7Z A;  1D6E C;  1TS5 A;  3I55 A;  5DLQ E;  3M4O B;  3VA7 A;  1YIJ A;  2K4K A;  2IX3 A;  1M1K C;  5IY0 A;  3FHW A;  3MZ5 A;  5FK9 C;  1PTO C;  4I7A A;  4OIK A;  4C3H H;  1KDA A;  4KHZ A;  2WB1 E;  1BQQ T;  1DYQ A;  1PTO H;  5GAD C;  5T1I A;  1TWH H;  1IZ6 A;  3C1F A;  2B8G A;  1C7Y A;  1RTN A;  1G91 A;  3AQQ A;  1J6Q A;  4BA2 I;  2KVM A;  4GKK Q;  4A3D B;  3NE5 B;  3RN2 A;  5C4J B;  2RCF A;  4JI1 Q;  1EOT A;  4B9W A;  1QZG A;  5IT9 c;  1BCP B;  3TRZ A;  3GTG B;  4QIW E;  5GQO A;  1N32 L;  5G3L D;  2K32 A;  4NXN Q;  4JI4 Q;  2B63 G;  1PFS A;  3MXU A;  4GOP B;  1MD2 D;  1F9R A;  2D5D A;  4BBS G;  3QOJ A;  1Y8P B;  5J3B A;  4JYA L;  2F0G A;  4RCO A;  4A3B H;  3D31 A;  3J80 L;  1FR3 A;  1ESF A;  5KEE A;  3I2Z A;  4CDE C;  1PMR A;  1I4R A;  2UUC Q;  2IX1 A;  2A69 D;  1R9T B;  1SXT A;  4RWS C;  4PQX A;  4A3K G;  1ICF B;  1JWU D;  1QOH A;  4L8J A;  4DV2 L;  1VF7 A;  3BYT B;  1SYE A;  4TSS A;  5ELD A;  2WKD A;  3LX0 A;  3NQT A;  3CXC A;  3JAM i;  4JG2 A;  4RH6 A;  2R92 G;  4DR7 Q;  5M3F H;  2O5J C;  2EXZ A;  2MHV A;  1VMC A;  4HSV A;  4IJL A;  5IT9 E;  1GUO A;  2DN8 A;  1F2Z A;  5C3E B;  4KHV A;  1VQD A;  3ZYY X;  1OXT A;  4N9P A;  2K14 A;  1HFG A;  2RF4 A;  4QGU A;  1Q8I A;  4OON A;  1EU3 A;  2UUB Q;  2M2L A;  5IP9 G;  3G7L A;  4FF4 A;  1DJR D;  1QE6 A;  4C3H B;  3HOW H;  1PTO B;  3K5N A;  3MHB A;  1TU2 B;  4X62 L;  1TWH B;  2PW7 A;  3PCO B;  1IBL Q;  1PH9 A;  1LLR D;  1YIT A;  4DR5 L;  2UU9 Q;  3MXG A;  4HIO A;  1HR0 W;  2YTV A;  2FHT A;  2RCN A;  3MFG A;  3T51 B;  4HIK A;  2VQE Q;  2O4X A;  3SVM A;  5FO7 B;  3FKI H;  3D3R A;  4KN7 C;  3TME A;  3AYH B;  1K73 C;  3E0J A;  3A5U A;  2NBF A;  2AUK A;  3QG1 A;  1B3Q A;  1XNQ Q;  3KLW A;  4P75 A;  1ONL A;  3TZU A;  4GNX A;  4PZ6 A;  3R93 A;  3KOJ A;  3MXP A;  5IIF A;  3PUY A;  3J81 i;  4A3B B;  5ELE A;  2RDG A;  1WFQ A;  4RGT A;  1C8C A;  1XPR A;  2NVX H;  3D6W A;  1VQ6 A;  1ENA A;  5ELN A;  4JPB W;  1X65 A;  3RLO A;  2IX0 A;  3ERS X;  3NEL A;  1LTI D;  3CCL A;  3H91 A;  4BY7 H;  2KHI A;  1DD2 A;  2E8G A;  4JOI A;  4QF4 A;  2JA5 H;  3J7A 5;  2K33 A;  1Q46 A;  4DV7 Q;  3HZX A;  1J5E Q;  2UXB L;  1O78 A;  5M3F B;  2OEO A;  2F0E A;  1ENF A;  3PUV A;  3F2B A;  1SNO A;  5DM6 3;  4DV0 Q;  1JJG A;  1N34 Q;  4XQJ A;  2B2T A;  4K8I A;  4HN7 A;  1MSG A;  1SR3 A;  4CDF C;  1FJG L;  1AE3 A;  4BY1 G;  2AKW B;  3FPU B;  3IL8 A;  2IY5 B;  5IP7 H;  1SBB B;  1S5C D;  5EBD A;  1PA6 A;  5I9P A;  2MUY A;  2UUA Q;  2LMC B;  3BZD B;  1Y69 U;  1K3B C;  1VQA A;  3HOW B;  1VQC A;  1YVC A;  4IO9 A;  5IYC G;  2MPM A;  3Q23 A;  4JI3 L;  3KF8 A;  3HOX H;  1HRJ A;  1V1P B;  1JOO A;  2K04 A;  1LAC A;  5CV4 A;  1UAP A;  3W5O A;  1KDC A;  3OIQ A;  3GO5 A;  1E22 A;  2KCN A;  1K0R A;  4B08 A;  3QOL A;  1YNJ C;  1STG A;  2NUC A;  4LUV A;  4JI0 Q;  1JJC B;  1EEI D;  3SDZ A;  3FEW X;  5T1G A;  3I7F A;  4AH6 A;  5C0X H;  4DN4 M;  1R4Q B;  2IW3 A;  4ALP A;  4LF5 L;  1TS4 A;  3CC4 A;  3Q0A A;  1HR0 L;  2F0O A;  3K57 A;  3AMU A;  1CTM A;  1U4M A;  3HEJ A;  4KJN A;  4H44 C;  3ULP A;  1P16 A;  5M5X H;  1V43 A;  2F0L A;  2A6H C;  2K7V A;  1Y8O B;  2RKS A;  4IZ8 A;  2JQO A;  1D7Q A;  4BY7 B;  3PO2 H;  1IBK Q;  2XWB B;  2JA5 B;  3I56 A;  2E5L Q;  1F2Y A;  1FNU A;  3PUX A;  5K36 H;  4I7Z C;  4R4T A;  2F0J A;  4NXM Q;  2NN6 I;  1KHI A;  5HY6 A;  1JOR A;  4AQY L;  1VF5 C;  5COR A;  2VQF L;  2KEC A;  3OHX C;  4PNY A;  3B6Y A;  4A3F H;  4DR2 L;  3K0Y A;  3Q24 A;  3PGZ A;  2IJ0 A;  2WB1 B;  1AN8 A;  2D0P A;  3H3V I;  3NBH A;  1TT2 A;  3MA2 B;  1NTG A;  1BBU A;  4BA1 I;  1X32 A;  4JI4 L;  3FMC A;  4NP5 A;  1II3 A;  3NP8 A;  1LUZ A;  1BCP F;  4RG1 A;  3K80 C;  4L5R C;  1EQR A;  1LTA D;  2K5H A;  2TSS A;  3BDC A;  2EJG C;  1IXR A;  5BN4 A;  3DWA A;  4BBS B;  3HOX B;  1BCP D;  2L15 A;  3KLR A;  3L7Z C;  1NR4 A;  4B3T L;  4A3E H;  3S1Q H;  1UEB A;  4JI5 Q;  2UUC L;  4OO1 I;  1WTR A;  3GTL H;  5M9O A;  3I4O A;  1RIP A;  5KGU A;  5CV5 A;  2I5H A;  3ERO A;  3SXH A;  2JN4 A;  3KBX A;  2WIN B;  1J8I A;  2MJ8 A;  3TS2 A;  3G4S A;  5LMU L;  1ROD A;  2QW7 A;  3K5M A;  1GHK A;  3JAM L;  2HHH Q;  1NAP A;  3I4M G;  4BWG B;  1S5E D;  3DM3 A;  2HT1 A;  3ER0 A;  4KHP Q;  5HGT A;  1PH7 A;  1PZI D;  2ID0 A;  1QVC A;  1PH6 A;  2CH4 W;  1WCM G;  3D6C A;  1XX8 A;  4LJZ C;  1AFP A;  2I5M X;  1VQM A;  2C9O A;  1IBM L;  1B2T A;  3BZK A;  5M5X B;  1BNZ A;  3QJY A;  3HOV G;  5BN3 A;  3I8Z A;  3S14 H;  4ZLT F;  3PO2 B;  1QIL A;  2I07 B;  3PF5 A;  1Q8K A;  3RUZ A;  1IBL L;  4B9X A;  4DV1 L;  4DR4 L;  2UU9 L;  3U58 A;  1PTO F;  3LWU A;  4J6H A;  4WJW A;  3TN2 A;  2NVQ H;  2KCC A;  3STB C;  2D9U A;  4A3F B;  1QNU A;  1PTO D;  1PRT C;  5IYD H;  4C3J G;  4JCV E;  2JP1 A;  3EA6 A;  2B39 A;  4DUZ Q;  4JC0 A;  4A93 G;  1KNE A;  2PYK A;  3NTI A;  1T5X D;  2EYP A;  3W3A A;  3P20 A;  1PXU A;  1MGS A;  1Y1W G;  1BOS A;  3KYH C;  5M3M H;  3GDE A;  4KD4 A;  2N55 A;  1UE6 A;  3KF6 B;  3J81 L;  4DR3 L;  3S9W A;  2VS1 A;  2XSC A;  1VQ9 A;  4KKU A;  4A3E B;  3S1Q B;  4HAE A;  2V4D A;  3D4R A;  4DAM A;  4JVZ A;  1QCB D;  3GTL B;  4A3G G;  1HNZ Q;  3M4P A;  3MVV A;  3UDX A;  4DNT B;  3ERQ A;  1S4Z A;  5AFW A;  1VQL A;  5BR8 L;  1JOK A;  3PUW A;  5I4D A;  3HOY G;  4X6A H;  1DON A;  1O7Y A;  3CAM A;  4EQ5 A;  2Y0S G;  1W6J A;  2A68 C;  4V0B A;  1J5E L;  4N8F A;  2ZTD A;  4KI0 A;  3K5L A;  2DUD A;  4DV0 L;  3CQZ H;  4JYA Q;  1JC7 A;  2L0C A;  4YY3 L;  1JB7 A;  4ZYS A;  3ND9 A;  1WD1 A;  3H0G G;  4H0L C;  3V2T A;  1QVF A;  5IYB H;  4XYQ A;  5IE8 A;  3UE0 A;  3NHH A;  2JE6 I;  4FVM A;  5EPJ A;  5CBE E;  4DGZ A;  3K81 C;  3U4V A;  1TS3 A;  3VR5 A;  3OWE B;  3T56 B;  5C0X J;  2L4N A;  3S14 B;  5ELB A;  1RHP A;  2KA7 A;  3GTJ H;  3D0F A;  4XIG S;  1YJ9 A;  3A74 A;  5FLM G;  1CKN B;  1CZG A;  4ID6 A;  4LF8 L;  4DA2 A;  1GM5 A;  1A2U A;  2NVQ B;  4OWT B;  3MC0 B;  2A5H A;  3J80 c;  5EKI A;  2ZJQ A;  1EIF A;  1PRT B;  2R93 H;  4MTK A;  1ET6 A;  5KNC A;  4JI0 L;  4KK7 A;  5ISR A;  4FO2 A;  2ZJP A;  3I4L A;  4JW0 A;  5M3M B;  4ZAI A;  4R8N A;  4X62 Q;  3S1R B;  2RQX A;  3RD4 A;  3OIP A;  4DR5 Q;  1FNW A;  3D4W A;  2R7F A;  1RD9 D;  4HJA A;  3P1H A;  1S40 A;  3CCV A;  3FPP A;  2XRS D;  3A7A B;  2OXP A;  4K14 A;  3EN2 A;  3F2C A;  3VA5 A;  1UUP A;  3AB9 A;  3OW2 A;  2CQO A;  1VQK A;  3WWV A;  3KLS X;  4NXM L;  5GAH C;  2B2U C;  1SMY C;  4BXX H;  4UY8 C;  1WTW A;  3J80 E;  1EEF D;  3CQZ B;  2CCZ A;  2B2W C;  3OMG A;  2KCM A;  2F0M A;  4POF A;  1TII D;  4RGO S;  4KY5 A;  2DNE A;  3ITP A;  3UDG A;  1LAB A;  4U67 3;  1LTB D;  3E9H A;  1HNX Q;  2Z8L A;  4PMC A;  1W2B A;  1ZYR C;  3GTJ B;  2FXQ A;  3M7N A;  2XIW A;  3H3V H;  2UXB Q;  3L3O C;  2E2J H;  5DNF A;  4IUR A;  2AQ2 B;  1ZKO A;  1DOK A;  2VXW A;  2DY8 A;  1VQP A;  3GD7 A;  4JI5 L;  1PV4 A;  2PZW A;  1FJG Q;  5D3D A;  2IPK D;  2QDL A;  3KFU A;  2MGS A;  3PUZ A;  4KTA A;  4IUT A;  1G6P A;  1H9J A;  4IUP A;  2R93 B;  4H02 A;  2K52 A;  5EPL A;  5JOB A;  4KKT A;  2K50 A;  4LF6 L;  1LT5 D;  1VMP A;  5JVG 3;  4FYD A;  4A3M G;  4IFD G;  1E0B A;  2EVB A;  4DV4 L;  1A15 A;  3BDL A;  3F2D A;  3PO3 G;  1G2T A;  4JI3 Q;  1TWC H;  3CHB D;  1CKO A;  1TR5 A;  4KV6 A;  2VB3 X;  4LFA L;  3GTQ H;  4K8J A;  1YNJ D;  5IGF A;  2F0S A;  2PO4 A;  1KLU D;  2EY2 A;  2XRQ D;  1K9M C;  3NUC A;  1T5E A;  4QJF A;  2Z6K A;  2B2V C;  2SNS A;  2NTT A;  1B7Y B;  4AYB G;  1HNW L;  3KBG A;  5C44 G;  3PMF A;  4DUY L;  4EQO A;  4OWW B;  2KED A;  1WTX A;  1EY6 A;  5BN5 A;  1I4X A;  2A1A A;  1EY0 A;  5E7N A;  1FGU A;  2A6H D;  2K5V A;  4DXF A;  3DWQ A;  1IHZ A;  4EQN A;  4Y52 H;  1EYA A;  3IFD A;  1XPU A;  2VW9 A;  1EZ8 A;  1QVG A;  3M4Q A;  5C6A A;  4DUZ L;  1EY4 A;  1PH5 A;  1G6Z A;  3ND8 A;  2MQH A;  2Q8T A;  4V19 0;  1JQY D;  2GA4 B;  1B8A A;  2CW0 C;  3I4N H;  4IN3 A;  1U4L A;  2E2J B;  4F8M A;  2O2L D;  4AQY Q;  1L1O C;  1B4O A;  1Q90 A;  2Z6B A;  4UP9 A;  2VQF Q;  4DR2 Q;  1I6H H;  2WAC A;  1Y14 B;  1GD7 A;  3G6J B;  1HNZ L;  2ZM6 L;  3VR3 A;  3S1M H;  1B1Z A;  4JI6 Q;  2PI2 A;  4UPA A;  2F4V L;  1ET9 A;  4A3L G;  2M00 A;  4GLX A;  3A56 A;  4A4I A;  1XMO Q;  1FNV A;  1K3R A;  3GV6 A;  2BH8 A;  3H09 A;  1BVS A;  1Y1V G;  1TWC B;  3H6M A;  3TP8 A;  1ML0 D;  3GTQ B;  4GN4 B;  4B3T Q;  2I0Q A;  1ILQ A;  2EOT A;  1TXY A;  5C4X H;  1YNN C;  2JA6 G;  3C1E A;  3K59 A;  3IFT A;  4PMW A;  3CCR A;  2BH2 A;  2SOB A;  3HOU G;  2GN5 A;  2H1E A;  1DOM A;  4OGQ C;  5LMU Q;  4GOP A;  4G4K A;  4ILW A;  1B9M A;  4OXP A;  4PV1 C;  2HIX A;  1YHQ A;  4S3S A;  4RHS A;  3IAY A;  1EYD A;  4CHT B;  5JJZ A;  5FO9 B;  4JK1 C;  5IGB A;  1EFI D;  1ASY A;  1IBM Q;  4EVO A;  1JOQ A;  3F1Z A;  3CME A;  1NR2 A;  1XJV A;  3V05 A;  3LWE A;  2EXD A;  3J7A F;  1D1K A;  1PRT F;  2Q2I A;  4LFC Q;  3M7G A;  4DNR B;  5CC4 A;  3WDN A;  1Z7T A;  1XMQ L;  3TP6 A;  3I4N B;  2X6G A;  3STB D;  3PIP 3;  1HTL D;  5A2Q L;  1IKL A;  1PRT D;  2OCE A;  4C1N K;  4DV1 Q;  4DR4 Q;  4MIU A;  4DK6 C;  2ICE C;  4P71 A;  3ULL A;  2NZ1 D;  3L2P A;  1XYI A;  3W2D A;  2DY7 A;  3S24 A;  1L1O B;  2QDB A;  3DEP A;  4RHR A;  3OOC A;  1E24 A;  1I6H B;  1EOV A;  5JEA G;  2F4I A;  1WYD A;  3BDO A;  3A0J A;  4TVA B;  1BR9 A;  4DK1 A;  4MHE A;  4DK0 A;  3GP7 A;  2K6A A;  1OO9 B;  3J7Z C;  3CKI B;  3S1M B;  1GOZ A;  2E75 C;  4H13 C;  1MI2 A;  3A55 A;  5COY A;  1J9O A;  3Q8D A;  2AHO B;  1KQS A;  4DR3 Q;  4GS3 A;  3HKZ B;  3T1Y L;  1YHB A;  3HFZ B;  4LNQ A;  1TWA H;  3NWS A;  4C2M H;  1W3S A;  1HFN A;  4FF2 A;  3D8G A;  5C4X B;  3IRB A;  4IUV A;  1CSQ A;  1HZA A;  1RL2 A;  3NTK A;  1Q1B A;  2A68 D;  1SRO A;  1HNX L;  4HJ9 A;  3TEH B;  3AEV A;  3JAM E;  4K6L A;  5BR8 Q;  1CQV A;  4RA8 A;  4DR6 L;  2BOS A;  5M5Y H;  2KHS A;  4WFN 3;  1VQN A;  2D62 A;  5J1Z A;  1NY4 A;  3A8K E;  5C4Z A;  1KXL A;  5E1F A;  4LUO A;  5KIX A;  4YY3 Q;  5C5L A;  4XTC S;  1EU4 A;  4LMQ D;  1KAB A;  5FJ8 G;  4G57 A;  4K5V A;  1MSH A;  1VQ4 A;  1BDO A;  4B3R Q;  4LFB Q;  2RSO A;  1B53 A;  1EQT A;  2PMZ E;  1XTC D;  1K8A C;  1GHJ A;  4R4Q A;  2E2D C;  1EFW A;  2B63 H;  1KAA A;  4CKC A;  2B8F A;  2EZV A;  5FLX L;  5C3W A;  2D0O A;  2F52 A;  1EIG A;  2K01 A;  4BBS H;  2KUM A;  3C46 A;  3GTO H;  5LL6 X;  2RA4 A;  4IUQ A;  4LF8 Q;  2XVS A;  4OEL B;  1F2L A;  1GUN A;  3G48 A;  4X3U A;  1Z47 A;  4A3K H;  1CI3 M;  1HXY D;  1KAW A;  2K5W A;  4WRD A;  2FFK B;  2HUG A;  2RHS B;  1T9H A;  2RDF A;  3CCS A;  3EBE A;  4ZKC B;  3AFQ A;  4F7X A;  5DM7 3;  4MTN A;  4HMI A;  1ICW A;  3E0E A;  3NBI A;  3J81 E;  1RJT A;  1N9W A;  5GRO A;  1SE3 A;  2R92 H;  1V1P A;  3PIP A;  1TWA B;  3HRZ C;  3NEM A;  4C2M B;  2F0P A;  2QIL A;  3SEB A;  3BVZ A;  5NUC A;  1K83 H;  3TP7 A;  3VR4 A;  4QUF A;  2K1B A;  3PQI A;  1SNC A;  1EWI A;  4NW2 A;  1BF4 A;  1SMY D;  3OSO A;  1A2T A;  3LGJ A;  4A3I G;  1D5Z C;  5IP9 H;  4UP7 A;  5M5Y B;  1N33 L;  3BYY B;  5I6Y A;  4DAV A;  3SK8 A;  2JA8 G;  2ALY B;  2JA7 G;  1CK1 A;  1WTQ A;  4IPH A;  4CKB A;  4X65 Q;  1SYF A;  1DCZ A;  2ASB A;  4RMF A;  2FMM A;  1JJ2 A;  3JC6 6;  2WAQ E;  1LTS D;  1B3A A;  3I90 A;  2FJ2 A;  2QA4 A;  5JJK A;  2HQL A;  1ZYR D;  4R4I A;  1QNK A;  1K28 A;  3I72 A;  1K8G A;  5ELC A;  5EJW A;  1FVI A;  1STH A;  1F9S A;  4JI6 L;  3HOZ G;  2B63 B;  3S2H H;  5LL6 S;  1CZW A;  3LNN A;  4HSP A;  5F2D A;  4C3I G;  5H1S E;  1XMO L;  4FF3 A;  2WAQ G;  4APV A;  3BZC A;  3GTO B;  3FP9 A;  5KND A;  2ZTE A;  4QIW B;  2QCP X;  1FL0 A;  3OYY A;  3X3N A;  1G29 1;  4BBR G;  4CDD C;  2A8V A;  4HJ7 A;  2NTS A;  3RLN A;  2F3V A;  2F0V A;  4N8X 1;  4A3K B;  1E2Z A;  1OXU A;  4QL5 A;  4IUU A;  1VQ7 A;  3S17 H;  2F0Q A;  4LF6 Q;  3NSW A;  4R4O A;  5KYL A;  2BE5 D;  3T53 B;  3DWP A;  1Q7Y C;  1GUW A;  1LTL A;  4DV4 Q;  4JI8 Q;  4IOC A;  1D2B A;  3KJP A;  2UXD Q;  2R92 B;  1WVL A;  1AW7 A;  4LFA Q;  2F3W A;  4ULL A;  2EPB A;  3A7L A;  3KJO A;  1H9R A;  1PFB A;  1K83 B;  1PVO A;  2EQS A;  1A3T A;  1VQ8 A;  2NWG A;  4KY7 A;  4BY1 H;  1NJI C;  1HNW Q;  5D65 A;  3N52 A;  2VUM G;  1IYV A;  4J15 A;  1WI5 A;  4DUY Q;  2YTY A;  4LFC L;  4ABN A;  3T16 A;  4A3J G;  2AMC B;  2NZO A;  5I2X A;  2L12 A;  1N36 L;  1EL0 A;  5IYC H;  1SMX A;  2CWA A;  1NUC A;  2ICI A;  2E76 C;  2CHB D;  2R3Z A;  1LTG D;  2SDF A;  2CW0 D;  4A75 A;  1GUG A;  1STA A;  1JMC A;  4KMU C;  5IGC A;  2AWN A;  4QMG A;  1QUQ B;  1CA6 A;  2N78 A;  2R7Z G;  3S2H B;  2M9V A;  3KK7 A;  3OW7 A;  1PZJ D;  3S1R H;  1GUT A;  1O7L A;  4R1J A;  4CBV A;  3K58 A;  2DJG C;  3KUP A;  4RGN A;  2N3S A;  1A0I A;  1HJP A;  2NN6 G;  4QY7 A;  5JJI A;  2Y0S E;  3U4Z A;  5GAG C;  2CFM A;  1Q3L A;  3NEN A;  2ATW A;  2F0I A;  4HR7 B;  3EVQ A;  1EQQ A;  3GV3 A;  2ZM6 Q;  3S17 B;  4N9T A;  3T13 A;  4A3C G;  4LF4 Q;  2Z4H A;  4Y7N H;  2F4V Q;  5M5W H;  1EYG A;  2ZJR A;  4HTH A;  1L0Y B;  1QG7 A;  4A3D G;  3KF6 A;  1KDB A;  2OTL A;  1Q1E A;  1E7Z A;  1LO5 D;  2N49 A;  3L9A X;  3OMC A;  1VQE A;  2BA1 A;  4DU9 A;  4K0K Q;  2LXJ A;  4DR1 L;  1AH9 A;  1H9K A;  3CPF A;  2X6L A;  4BY1 B;  4B3R L;  4OO1 G;  4LFB L;  4HJ5 A;  2F03 A;  3R2T A;  4GN5 A;  4HCE A;  4YWM A;  1X56 A;  4ODG A;  1DXM A;  2Z9H A;  4NB3 A;  1NBW A;  1KIX A;  3CMA A;  1HZC A;  1ESR A;  3ICE A;  3EQL C;  1WOC A;  2Q2H A;  1PH4 A;  4MZ9 A;  1EY7 A;  4K5W A;  3V96 A;  3BG3 A;  5LHY 1;  2PMZ B;  3MEH A;  1HUM A;  1STE A;  4F87 A;  2EYH A;  2HDM A;  1X3E A;  2ZXR A;  1XMQ Q;  4JI7 L;  3C2P A;  3I4M H;  1ASZ A;  2ZTC A;  5I9O A;  4DAY B;  4JBM A;  1U9R A;  5C3E G;  1BKB A;  1CKN A;  1IW7 C;  1HTP A;  1PH2 A;  3CP0 A;  4KN4 C;  2BDN A;  3M9B A;  2SEB D;  1EWH A;  1A8V A;  1WCM H;  2D2C C;  4JI2 L;  1XTD A;  2VZA A;  2PQA B;  5CV8 A;  1JB3 A;  4C3H G;  1X3P A;  2K28 A;  3CD6 A;  5EAY A;  1TY2 A;  2FIN B;  4FXK C;  3HOV H;  1C0A A;  3URY A;  4OIJ A;  4Y7N B;  1A3U A;  4FDB A;  1SND A;  1H9S B;  5M5W B;  3RR5 A;  5K5P A;  1KL9 A;  4EX5 A;  4LUZ A;  4X65 L;  1JWS D;  2RBM A;  3DLL A;  3T1Y Q;  4K6D A;  3L0O A;  4UDU C;  2E74 C;  3TDQ A;  4K2K A;  1K8O A;  4R9W A;  3H15 A;  1IYU A;  1H95 A;  1N8R C;  3MXN B;  3NQI A;  1PYW D;  4L5T A;  4ZK9 B;  2N88 A;  4XXE A;  4ZRZ A;  4C3J H;  1HA6 A;  1A62 A;  1MIU A;  5HUR A;  4A93 H;  4RAU C;  1PLF A;  1CQF A;  4A3B G;  4DPG A;  4IJH A;  4DR6 Q;  1H9S A;  1UE5 A;  1Y1W H;  3HOZ B;  1QJO A;  1EIH A;  2JYO A;  4GKJ Q;  1E2V A;  1GO3 E;  2WAQ B;  4A76 A;  3CC7 A;  1RDP D;  2KOL A;  2F3I A;  4OL7 A;  3MXN A;  4CJ1 B;  4UAI A;  4H7B A;  1A6X A;  3A5Z B;  1VS0 A;  5M3F G;  2QF7 A;  4A3G H;  4R8I A;  4QCL A;  3HP3 A;  3NWT A;  5A2Q E;  4JI8 L;  3HOY H;  2MO0 A;  4AYB E;  3DUZ A;  2AWO A;  2RDH A;  2L5T A;  4ZUJ A;  3I4M B;  2O5I C;  2UXD L;  1YI2 A;  4X66 Q;  1RCV D;  1U0L A;  4J8Q A;  2EY6 A;  2ZT9 C;  4P2C B;  4O1N A;  1BCP C;  5E4W C;  1Y8N B;  1WCM B;  4FXD A;  1L2F A;  3H0G H;  3HOW G;  3HKS A;  1C4Q A;  1A63 A;  1X3G A;  1BBX C;  4X3T A;  2OQK A;  2NB0 A;  3HOV B;  1BBW A;  4P72 A;  3RN5 A;  4OHJ A;  1S72 A;  2F0F A;  5E4X A;  1S5B D;  4NPS A;  3VR6 A;  3SK5 A;  4QUC A;  4ZCK A;  1M4V A;  1KTK A;  5FLX c;  5FLM H;  3FKI G;  4EGV A;  1TVX A;  1OXX K;  5IWA L;  2HIV A;  1G8Z D;  3PV0 A;  1V9P A;  2YYZ A;  4NKL A;  5J22 A;  3VYT A;  3GTK H;  3G71 A;  2NZH A;  2F0D A;  5D14 A;  4HCS A;  3X3M A;  4C3J B;  2IT1 A;  3TSS A;  1EZ6 A;  2XNA C;  5CYU A;  2LKV A;  2E2H H;  4A93 B;  1VCI A;  1OXS C;  4XQN A;  2KCT A;  1VQH A;  1STY A;  1BUV T;  2L9H A;  2NYZ D;  1N33 Q;  2MP1 A;  3TRE A;  1Y1W B;  4EQP A;  2VNU D;  4LF9 L;  4XT1 B;  1PFM A;  1G51 A;  1IL2 A;  2B2U A;  4DV6 L;  5DEH A;  3HS0 C;  2B2W A;  2OQ0 A;  1EIY B;  1HUN A;  5I6W A;  3KDF B;  2AQ3 B;  1SDF A;  4TQU S;  4BY7 G;  2DGY A;  2J0T D;  5CBA E;  1I4G A;  2JA5 G;  5C5M A;  5LMN Q;  4DV5 Q;  4IPD A;  1EY8 A;  1YJW A;  4HJ8 A;  4A3G B;  4LF4 L;  3M3Y H;  4GNX C;  5FLX E;  1ENC A;  2EYL A;  2Q2T A;  2F0U A;  3S2D H;  1QB5 D;  2KEE A;  3HG9 A;  1AE2 A;  3HOY B;  3DEO A;  3AU7 A;  2Y0S B;  1I4H A;  3I3C A;  4LWC A;  3ZJY C;  2WB1 G;  5IP7 G;  5G3L F;  3RZD H;  1UE7 A;  4K0K L;  2VB2 X;  3J7Y W;  1H9M A;  3KDF A;  3H0G B;  1KRS A;  4HED A;  2OTJ A;  4JOI C;  1I6V C;  1EY9 A;  2LXK A;  3HOX G;  4RGM A;  3S16 B;  2A6E C;  1XPO A;  1F9Q A;  1CT1 D;  1AZP A;  4E6I A;  2B2T C;  1R4P B;  1BO0 A;  3RNU A;  4J1M A;  1V8Q A;  5IOC A;  2Q8I B;  2SNM A;  3VR2 A;  4LAA A;  2EDG A;  4L63 B;  3J81 j;  2RSN A;  1E1O A;  1CUK A;  1U4R A;  4KJO A;  5KNB A;  4X64 L;  1PHJ A;  1HQR D;  5C0X G;  3GTK B;  2RVL A;  1TWG H;  5EKL A;  2B2V A;  2ENB A;  1E1T A;  3D4D A;  2LY7 A;  1HQM C;  5EPK A;  4YWL A;  3GTM H;  4IOA A;  3BJU A;  2WFW A;  3I70 A;  2E2H B;  2J7Z A;  1HH2 P;  3G6E A;  5CV6 A;  1V1O A;  2F0K A;  4CGY B;  4A3M H;  4PZ7 A;  1LM0 A;  3O13 A;  4IFD H;  4B3M L;  1N36 Q;  3JAM c;  3PO3 H;  2G9H D;  3K8A A;  2Z4I A;  2F0H A;  3WOF A;  1BXT A;  4XQQ A;  2LFN A;  1F9P A;  1MJE A;  4ME3 A;  4CJ0 B;  5E3F A;  3PO2 G;  3SE0 A;  1GVP A;  3HGB A;  4DNI A;  5K36 G;  1B9N A;  5C44 H;  2EYO A;  2E2I H;  1Z6H A;  3M3Y B;  2AQ1 B;  1EUJ A;  3S2D B;  3A8J E;  4GNX B;  1WD0 A;  4DK3 C;  5IOD A;  1RKN A;  1X6O A;  2LSS A;  4A3F G;  3T1H L;  3CW2 C;  1O7I A;  3A8I E;  3RZD B;  2KQ3 A;  1SFO H;  1L1O A;  1UNS A;  3MWY W;  1K8M A;  4Z9C B;  2KBN A;  5CGK A;  1JWM D;  2MO1 A;  3PIO 3;  2PZU A;  1I94 L;  2AUJ D;  3CC2 A;  1DM0 B;  4FNF A;  5LMN W;  2JEB I; 
#chains in the Genus database with same CATH homology
 1U4P A;  2B2Y C;  4M8A A;  4HMJ A;  1F2M A;  1STB A;  2A73 B;  2CQA A;  3K6O A;  1B50 A;  1SEB D;  1TWG B;  3K5O A;  4RKB A;  3M4Y A;  3SK6 A;  1SE2 A;  4ZUI A;  3GTM B;  3VYU A;  3NXW A;  1MBY A;  1JIC A;  3MAQ A;  3TZD A;  3Q22 A;  1M8A A;  4CJ2 C;  3GQB A;  3T4A C;  4A3M B;  4FF1 A;  3BS1 A;  2C5C A;  4G7Z C;  3PO3 B;  1AZQ A;  2A74 C;  5ELF A;  2PQE A;  2KJX A;  5JAV A;  2I46 A;  1Q12 A;  2JEA I;  4AYB B;  3F2U A;  2OT2 A;  5C44 B;  2E2I B;  4L6T B;  1IW7 D;  1ZXT A;  1CM9 A;  1SE4 A;  2R61 A;  5EQ0 A;  4K5X A;  3CRL C;  3P7J A;  2EJM A;  4XYO A;  2XN9 C;  1PFN A;  1FGB D;  1SSO A;  2R6G A;  1SAP A;  1SFO B;  3SK4 A;  2F0N A;  3FKI B;  5CR3 A;  2G9D A;  3MTS A;  4CKE A;  2PW5 A;  4TKO B;  2ZXP A;  5KYI A;  2HCI A;  4GZY C;  3NK9 A;  2LS0 1;  4ME5 A;  3U9S A;  1D5M C;  3IKJ A;  1SYD A;  5IT9 L;  2NVX B;  1CHQ D;  2HQE A;  4FP5 D;  3QIA A;  2TMP A;  2K5D A;  4FXG C;  3A54 A;  1LT4 D;  5C3X A;  3EFX D;  1LT3 D;  5JEA H;  4KKS A;  5EKK A;  4Q5V A;  5EGT A;  1GXD C;  5J39 A;  2B2Y A;  2L55 A;  5EBC A;  1F77 A;  5KRU A;  1AEX A;  4X3K A;  1TWF B;  2F0T A;  3ONA B;  1Y1V B;  2H4O A;  2HCC A;  2JXM B;  2L1B A;  2WKC A;  3R2I A;  2ZXO A;  3VYS A;  3TBI B;  5TSS A;  1FYC A;  3Q6S A;  5CV7 A;  3NTH A;  1TQO A;  2JA6 B;  5CV9 A;  1W6K A;  2IL8 A;  1CHP D;  1RTO A;  2BCO A;  5CMD A;  3HOU B;  3RLF A;  1S5F D;  4IFD J;  3UI2 A;  3KLS A;  2X69 A;  2FMC A;  2EY1 A;  1O80 A;  1L0X B;  4ZQ3 A;  2A69 C;  2EYF A;  3RZO B;  1JE4 A;  1UEA B;  2OF1 A;  1DOL A;  1XXG A;  1CA5 A;  3CU7 A;  5FO8 B;  2NVY B;  4RFB A;  3E5S A;  3FDT A;  2QEJ C;  5D3I B;  2BDO A;  1HPC A;  3RMH A;  3P75 A;  3FRP B;  1DZ1 A;  1FD7 D;  4PMB A;  4BS9 A;  2K03 A;  4XT3 B;  3H94 A;  1SNP A;  3N6R A;  1SNQ A;  3WOE A;  5JVH 3;  1HHV A;  3QWN A;  4U68 A;  4DF7 A;  1IL8 A;  3K7A B;  3DXJ C;  3C3L A;  1C48 A;  3M85 A;  4K2L A;  4LK1 C;  2PZT A;  1CFM A;  3I91 A;  4C56 C;  4TRD A;  5JPN C;  5JPM C;  1GUS A;  3I73 A;  1HA5 A;  2L11 A;  4I65 A;  5A35 A;  1JCK B;  1D1I A;  4XDX A;  1LV9 A;  1YNN D;  3CRK C;  3DM1 A;  4DXG A;  2F0W A;  2A6E D;  1EY5 A;  4IQZ A;  2Q8R E;  1SJH D;  2DNC A;  1STN A;  1OXV A;  3R8B A;  4M1U B;  2EYJ A;  1QWY A;  3MFY A;  4RCN A;  4YIJ A;  3R3O A;  1WTV A;  1JR0 D;  3SR1 A;  1SNM A;  2XWJ B;  4O42 A;  4MN3 A;  4ZKB B;  3S15 B;  1SYB A;  3DMU A;  4IFD I;  2JSO A;  2NVT B;  3VYR A;  2WP8 J;  1I3Q B;  1A3V A;  1XWE A;  1IKM A;  1HCZ A;  4RKL A;  3DHQ A;  1GJX A;  2Z1C A;  1I50 B;  3EJI A;  4C1N I;  5JEA J;  4QB4 A;  1PDQ A;  3BVG A;  5C4H A;  2CVR A;  5DAU A;  4A3I B;  1X3Q A;  4DAY A;  4NMZ A;  2JA8 B;  1EWC A;  3E6Z X;  2JA7 B;  3NPP A;  1NSN S;  1LT6 D;  1LTR D;  2PPB C;  2PNR C;  3U9O A;  1VDZ A;  4F88 A;  2EJF C;  3QO2 A;  2K05 A;  3TP5 A;  2BA0 A;  1D5X C;  5FKA C;  3BVM A;  4NDX A;  4KD3 A;  4C3I B;  3SHL A;  1G2S A;  1EYC A;  3OPO A;  1ILP A;  1AP0 A;  2YU9 B;  3J7A V;  4X3S A;  1NCV A;  2NN6 H;  5IGG A;  4DAP A;  1LTT D;  5IGD A;  1WTO A;  1B44 D;  4BBR B;  1KLG D;  3H3V C;  4Q0F A;  2WII B;  3OWF A;  4IUN A;  2EE1 A;  5IGE A;  1S5D D;  4G7O C;  2EY5 A;  2PCF B;  2EYM A;  3QB3 A;  2HDL A;  2IWH A;  5FOB B;  1I4P A;  2QKI C;  3GTP B;  1ZEQ X;  4OO1 H;  1SYC A;  2VUM B;  4IAL A;  1TKW B;  1EQV A;  5I2Y A;  4DFA A;  1PZK D;  2BE5 C;  2F1M A;  4A3J B;  3S1N B;  5C0X I;  1SJE D;  1KNA A;  1TY0 A;  4JBW A;  2WV6 D;  1E2W A;  2K5Q A;  2J4X A;  4WOR A;  4G7H C;  3FVQ A;  1SYG A;  1I4Q A;  2R7Z B;  1TS2 A;  1RF2 D;  4KY6 A;  1O7Z A;  1D6E C;  1TS5 A;  3M4O B;  3VA7 A;  2IX3 A;  5FK9 C;  3MZ5 A;  1PTO C;  4OIK A;  1KDA A;  4KHZ A;  1BQQ T;  1DYQ A;  1PTO H;  5T1I A;  3C1F A;  2B8G A;  1RTN A;  1G91 A;  4BA2 I;  2KVM A;  4A3D B;  3NE5 B;  5C4J B;  1EOT A;  4B9W A;  1BCP B;  3GTG B;  5G3L D;  2K32 A;  3MXU A;  1MD2 D;  1F9R A;  2D5D A;  3QOJ A;  1Y8P B;  2F0G A;  4RCO A;  3D31 A;  3J80 L;  1FR3 A;  1ESF A;  5KEE A;  1PMR A;  1I4R A;  2IX1 A;  2A69 D;  1R9T B;  1SXT A;  4RWS C;  4PQX A;  1JWU D;  1QOH A;  4L8J A;  1VF7 A;  3BYT B;  1SYE A;  4TSS A;  5ELD A;  2WKD A;  3LX0 A;  3NQT A;  4RH6 A;  2O5J C;  2EXZ A;  2MHV A;  1VMC A;  4HSV A;  5IT9 E;  1GUO A;  2DN8 A;  1F2Z A;  5C3E B;  4KHV A;  3ZYY X;  1OXT A;  4N9P A;  1HFG A;  1Q8I A;  1EU3 A;  2M2L A;  3G7L A;  4FF4 A;  1DJR D;  1QE6 A;  4C3H B;  1PTO B;  3K5N A;  3MHB A;  1TU2 B;  1TWH B;  2PW7 A;  1LLR D;  3MXG A;  2FHT A;  3MFG A;  3T51 B;  2O4X A;  3SVM A;  5FO7 B;  3D3R A;  4KN7 C;  3TME A;  3E0J A;  2NBF A;  2AUK A;  3QG1 A;  1ONL A;  3TZU A;  3R93 A;  5IIF A;  3MXP A;  3PUY A;  4A3B B;  5ELE A;  2RDG A;  4RGT A;  1C8C A;  3D6W A;  1ENA A;  2IX0 A;  1LTI D;  3H91 A;  1DD2 A;  4QF4 A;  2K33 A;  3HZX A;  1O78 A;  5M3F B;  2OEO A;  2F0E A;  1ENF A;  3PUV A;  1SNO A;  5DM6 3;  4XQJ A;  2B2T A;  4K8I A;  4HN7 A;  1MSG A;  3FPU B;  3IL8 A;  1SBB B;  1S5C D;  5EBD A;  5I9P A;  2MUY A;  2LMC B;  3BZD B;  1Y69 U;  3HOW B;  2MPM A;  3Q23 A;  3KF8 A;  1HRJ A;  1V1P B;  1JOO A;  2K04 A;  1LAC A;  5CV4 A;  1UAP A;  1KDC A;  3OIQ A;  3GO5 A;  2KCN A;  4B08 A;  3QOL A;  1YNJ C;  1STG A;  2NUC A;  1EEI D;  3SDZ A;  3FEW X;  5T1G A;  5C0X H;  4DN4 M;  1R4Q B;  2IW3 A;  1TS4 A;  3Q0A A;  2F0O A;  3K57 A;  3AMU A;  1CTM A;  1U4M A;  3HEJ A;  4KJN A;  4H44 C;  1V43 A;  2F0L A;  2A6H C;  2K7V A;  1Y8O B;  2RKS A;  4IZ8 A;  4BY7 B;  2XWB B;  2JA5 B;  1F2Y A;  1FNU A;  3PUX A;  5K36 H;  4I7Z C;  2F0J A;  2NN6 I;  1JOR A;  1VF5 C;  5COR A;  2KEC A;  3OHX C;  4PNY A;  3K0Y A;  3Q24 A;  2IJ0 A;  2WB1 B;  1AN8 A;  1TT2 A;  3MA2 B;  3NBH A;  4BA1 I;  1X32 A;  3FMC A;  4NP5 A;  1II3 A;  3NP8 A;  1BCP F;  1LTA D;  2TSS A;  3BDC A;  2EJG C;  5BN4 A;  3DWA A;  4BBS B;  3HOX B;  1BCP D;  3KLR A;  3L7Z C;  1NR4 A;  4OO1 I;  1WTR A;  5M9O A;  5KGU A;  5CV5 A;  3ERO A;  3SXH A;  3KBX A;  2WIN B;  1J8I A;  2MJ8 A;  1GHK A;  1ROD A;  3K5M A;  3JAM L;  1NAP A;  4BWG B;  1S5E D;  5HGT A;  1PZI D;  2ID0 A;  3D6C A;  1XX8 A;  4LJZ C;  1AFP A;  2C9O A;  1B2T A;  5M5X B;  1BNZ A;  3QJY A;  5BN3 A;  3I8Z A;  4ZLT F;  3PO2 B;  1QIL A;  2I07 B;  3RUZ A;  4B9X A;  1PTO F;  3LWU A;  4J6H A;  4WJW A;  3TN2 A;  2KCC A;  2D9U A;  4A3F B;  1QNU A;  1PTO D;  1PRT C;  4C3J G;  2JP1 A;  3EA6 A;  2B39 A;  1KNE A;  2PYK A;  3NTI A;  1T5X D;  2EYP A;  3W3A A;  3P20 A;  1PXU A;  1MGS A;  1BOS A;  4KD4 A;  2N55 A;  3J81 L;  3S9W A;  2XSC A;  4KKU A;  4A3E B;  3S1Q B;  4HAE A;  2V4D A;  3D4R A;  1QCB D;  3GTL B;  3MVV A;  4DNT B;  3ERQ A;  1S4Z A;  5AFW A;  1JOK A;  3PUW A;  5I4D A;  1DON A;  1O7Y A;  1W6J A;  2A68 C;  4V0B A;  4KI0 A;  3K5L A;  1JC7 A;  2L0C A;  4ZYS A;  3ND9 A;  1WD1 A;  4H0L C;  3V2T A;  4XYQ A;  3NHH A;  2JE6 I;  4FVM A;  5EPJ A;  5CBE E;  4DGZ A;  1TS3 A;  3VR5 A;  3OWE B;  3T56 B;  5C0X J;  2L4N A;  3S14 B;  5ELB A;  1RHP A;  2KA7 A;  4XIG S;  1CZG A;  4ID6 A;  4DA2 A;  1A2U A;  2NVQ B;  3MC0 B;  2A5H A;  5EKI A;  1PRT B;  1ET6 A;  5KNC A;  4KK7 A;  5ISR A;  4FO2 A;  3I4L A;  5M3M B;  4ZAI A;  4R8N A;  3S1R B;  2RQX A;  3RD4 A;  3OIP A;  1FNW A;  3D4W A;  1RD9 D;  3P1H A;  3FPP A;  2XRS D;  3A7A B;  2OXP A;  4K14 A;  3VA5 A;  1UUP A;  3AB9 A;  3KLS X;  2B2U C;  1SMY C;  1WTW A;  3J80 E;  1EEF D;  3CQZ B;  2B2W C;  3OMG A;  2F0M A;  1TII D;  4RGO S;  4KY5 A;  2DNE A;  3ITP A;  1LAB A;  4U67 3;  1LTB D;  2Z8L A;  4PMC A;  1ZYR C;  3GTJ B;  3M7N A;  2XIW A;  3L3O C;  5DNF A;  4IUR A;  2AQ2 B;  1ZKO A;  1DOK A;  2VXW A;  2DY8 A;  3GD7 A;  2PZW A;  5D3D A;  2IPK D;  2MGS A;  3PUZ A;  4KTA A;  4IUT A;  1H9J A;  4IUP A;  2R93 B;  5EPL A;  5JOB A;  4KKT A;  1LT5 D;  1VMP A;  5JVG 3;  4FYD A;  4IFD G;  1E0B A;  2EVB A;  1A15 A;  3BDL A;  1G2T A;  3CHB D;  1TR5 A;  4KV6 A;  2VB3 X;  4K8J A;  1YNJ D;  5IGF A;  2F0S A;  2PO4 A;  1KLU D;  2EY2 A;  2XRQ D;  3NUC A;  1T5E A;  2B2V C;  2SNS A;  2NTT A;  3KBG A;  3PMF A;  4EQO A;  2KED A;  1WTX A;  1EY6 A;  5BN5 A;  1I4X A;  1EY0 A;  2A6H D;  4DXF A;  3DWQ A;  1IHZ A;  4EQN A;  1EYA A;  3IFD A;  1EZ8 A;  5C6A A;  1EY4 A;  1G6Z A;  3ND8 A;  2Q8T A;  4V19 0;  1JQY D;  2GA4 B;  2CW0 C;  4IN3 A;  1U4L A;  2E2J B;  4F8M A;  2O2L D;  1B4O A;  1Q90 A;  2WAC A;  3G6J B;  3VR3 A;  1B1Z A;  1ET9 A;  2M00 A;  3A56 A;  1FNV A;  3GV6 A;  3H09 A;  1TWC B;  3H6M A;  3TP8 A;  1ML0 D;  3GTQ B;  1ILQ A;  2EOT A;  1YNN C;  3C1E A;  3K59 A;  3IFT A;  4PMW A;  2SOB A;  2H1E A;  1DOM A;  4OGQ C;  4G4K A;  4ILW A;  1B9M A;  4PV1 C;  4S3S A;  4RHS A;  3IAY A;  1EYD A;  4CHT B;  5JJZ A;  5FO9 B;  4JK1 C;  5IGB A;  1EFI D;  4EVO A;  1JOQ A;  1NR2 A;  3V05 A;  3LWE A;  3J7A F;  1D1K A;  1PRT F;  4DNR B;  3M7G A;  5CC4 A;  3WDN A;  1Z7T A;  3TP6 A;  3I4N B;  2X6G A;  3PIP 3;  1HTL D;  5A2Q L;  1IKL A;  1PRT D;  4C1N K;  4MIU A;  2ICE C;  2NZ1 D;  1XYI A;  3W2D A;  2DY7 A;  2QDB A;  3DEP A;  4RHR A;  3OOC A;  1I6H B;  5JEA G;  2F4I A;  3BDO A;  1BR9 A;  4DK1 A;  4MHE A;  4DK0 A;  2K6A A;  1OO9 B;  3GP7 A;  3CKI B;  3S1M B;  1GOZ A;  2E75 C;  4H13 C;  1MI2 A;  3A55 A;  5COY A;  1J9O A;  3HKZ B;  3NWS A;  1HFN A;  4FF2 A;  3D8G A;  5C4X B;  4IUV A;  3NTK A;  1Q1B A;  2A68 D;  3JAM E;  4K6L A;  1CQV A;  4RA8 A;  2BOS A;  2KHS A;  4WFN 3;  2D62 A;  5J1Z A;  3A8K E;  5C4Z A;  5E1F A;  5KIX A;  5C5L A;  4XTC S;  1EU4 A;  4LMQ D;  1KAB A;  4G57 A;  4K5V A;  1MSH A;  1BDO A;  2RSO A;  1B53 A;  1EQT A;  1XTC D;  1GHJ A;  2E2D C;  1KAA A;  4CKC A;  2B8F A;  2EZV A;  5FLX L;  5C3W A;  1EIG A;  2K01 A;  2KUM A;  3C46 A;  5LL6 X;  2RA4 A;  4IUQ A;  2XVS A;  1F2L A;  1GUN A;  4X3U A;  1Z47 A;  1CI3 M;  1HXY D;  2K5W A;  4WRD A;  2FFK B;  2HUG A;  2RDF A;  4ZKC B;  4F7X A;  5DM7 3;  4HMI A;  1ICW A;  3NBI A;  3J81 E;  1RJT A;  1SE3 A;  1V1P A;  1TWA B;  3HRZ C;  4C2M B;  2F0P A;  2QIL A;  3SEB A;  3BVZ A;  5NUC A;  3TP7 A;  3VR4 A;  4QUF A;  2K1B A;  1SNC A;  4NW2 A;  1BF4 A;  1SMY D;  3OSO A;  1A2T A;  1D5Z C;  5M5Y B;  3BYY B;  5I6Y A;  4DAV A;  3SK8 A;  1CK1 A;  1WTQ A;  4CKB A;  1SYF A;  1DCZ A;  2FMM A;  1LTS D;  1B3A A;  3I90 A;  2FJ2 A;  1ZYR D;  1QNK A;  3I72 A;  5ELC A;  5EJW A;  1STH A;  1F9S A;  2B63 B;  5LL6 S;  1CZW A;  3LNN A;  4HSP A;  5F2D A;  4C3I G;  4FF3 A;  3GTO B;  5KND A;  4QIW B;  2QCP X;  3X3N A;  1G29 1;  2NTS A;  2F3V A;  2F0V A;  4A3K B;  1E2Z A;  1OXU A;  4IUU A;  2F0Q A;  3NSW A;  5KYL A;  2BE5 D;  3T53 B;  3DWP A;  1GUW A;  1D2B A;  2R92 B;  1WVL A;  1AW7 A;  2F3W A;  4ULL A;  2EPB A;  3A7L A;  1H9R A;  1PFB A;  1K83 B;  1A3T A;  2NWG A;  4KY7 A;  5D65 A;  3N52 A;  1IYV A;  4ABN A;  3T16 A;  5I2X A;  2L12 A;  1EL0 A;  1NUC A;  2ICI A;  2E76 C;  2CHB D;  2R3Z A;  1LTG D;  2SDF A;  2CW0 D;  1GUG A;  1STA A;  4KMU C;  5IGC A;  2AWN A;  4QMG A;  1CA6 A;  3S2H B;  2M9V A;  3KK7 A;  3OW7 A;  1PZJ D;  1GUT A;  1O7L A;  4CBV A;  3K58 A;  3KUP A;  4RGN A;  2NN6 G;  1Q3L A;  2F0I A;  4HR7 B;  3EVQ A;  3GV3 A;  3S17 B;  4N9T A;  3T13 A;  2Z4H A;  4HTH A;  1L0Y B;  1QG7 A;  1KDB A;  1Q1E A;  1LO5 D;  3L9A X;  3OMC A;  2BA1 A;  4DU9 A;  1H9K A;  2X6L A;  4BY1 B;  4OO1 G;  2F03 A;  3R2T A;  4HCE A;  4ODG A;  1DXM A;  1ESR A;  3EQL C;  1EY7 A;  4K5W A;  3V96 A;  3BG3 A;  5LHY 1;  2PMZ B;  3MEH A;  1HUM A;  1STE A;  4F87 A;  2EYH A;  2HDM A;  2ZXR A;  3C2P A;  5I9O A;  1U9R A;  1IW7 C;  1HTP A;  4KN4 C;  2BDN A;  2SEB D;  1EWH A;  2D2C C;  5CV8 A;  1JB3 A;  4C3H G;  1X3P A;  2K28 A;  1TY2 A;  2FIN B;  4FXK C;  3URY A;  4OIJ A;  4Y7N B;  1A3U A;  1SND A;  1H9S B;  5M5W B;  5K5P A;  1JWS D;  2RBM A;  4K6D A;  4UDU C;  2E74 C;  3TDQ A;  4K2K A;  1K8O A;  4R9W A;  1IYU A;  3NQI A;  1PYW D;  4ZK9 B;  2N88 A;  4XXE A;  4ZRZ A;  1HA6 A;  5HUR A;  4RAU C;  1PLF A;  1CQF A;  1H9S A;  3HOZ B;  1QJO A;  1EIH A;  2JYO A;  1E2V A;  2WAQ B;  1RDP D;  2KOL A;  4OL7 A;  3MXN A;  4CJ1 B;  4UAI A;  4H7B A;  1A6X A;  2QF7 A;  4R8I A;  4QCL A;  3HP3 A;  3NWT A;  5A2Q E;  3DUZ A;  2AWO A;  2RDH A;  2L5T A;  4ZUJ A;  3I4M B;  2O5I C;  1RCV D;  4J8Q A;  2EY6 A;  2ZT9 C;  4P2C B;  4O1N A;  1BCP C;  5E4W C;  1Y8N B;  1WCM B;  4FXD A;  1C4Q A;  1BBX C;  4X3T A;  2NB0 A;  3HOV B;  4OHJ A;  2F0F A;  5E4X A;  1S5B D;  3VR6 A;  3SK5 A;  4QUC A;  1M4V A;  1KTK A;  4EGV A;  1TVX A;  1OXX K;  1G8Z D;  3PV0 A;  2YYZ A;  4NKL A;  5J22 A;  3VYT A;  2F0D A;  5D14 A;  4HCS A;  3X3M A;  4C3J B;  2IT1 A;  3TSS A;  1EZ6 A;  2XNA C;  5CYU A;  2LKV A;  4A93 B;  1VCI A;  1OXS C;  4XQN A;  1STY A;  1BUV T;  2L9H A;  2NYZ D;  2MP1 A;  1Y1W B;  4EQP A;  2VNU D;  4XT1 B;  1PFM A;  2B2U A;  5DEH A;  3HS0 C;  2B2W A;  1HUN A;  5I6W A;  2AQ3 B;  1SDF A;  4TQU S;  2J0T D;  5CBA E;  1I4G A;  5C5M A;  1EY8 A;  4A3G B;  5FLX E;  1ENC A;  2EYL A;  2F0U A;  1QB5 D;  2KEE A;  3HG9 A;  3HOY B;  3DEO A;  3AU7 A;  2Y0S B;  1I4H A;  3I3C A;  5G3L F;  2VB2 X;  3J7Y W;  1H9M A;  3H0G B;  4HED A;  1I6V C;  1EY9 A;  4RGM A;  3S16 B;  2A6E C;  1F9Q A;  1CT1 D;  1AZP A;  4E6I A;  2B2T C;  1R4P B;  1BO0 A;  4J1M A;  5IOC A;  1V8Q A;  2Q8I B;  2SNM A;  3VR2 A;  4LAA A;  2EDG A;  4L63 B;  2RSN A;  1U4R A;  4KJO A;  5KNB A;  1HQR D;  5C0X G;  3GTK B;  2RVL A;  5EKL A;  2B2V A;  2ENB A;  3D4D A;  2LY7 A;  1HQM C;  5EPK A;  3I70 A;  2E2H B;  2J7Z A;  5CV6 A;  1V1O A;  2F0K A;  4CGY B;  3O13 A;  4IFD H;  2G9H D;  2Z4I A;  2F0H A;  3WOF A;  1BXT A;  4XQQ A;  2LFN A;  1F9P A;  4CJ0 B;  5E3F A;  3SE0 A;  3HGB A;  5K36 G;  1B9N A;  2EYO A;  1Z6H A;  3M3Y B;  2AQ1 B;  3S2D B;  3A8J E;  1WD0 A;  5IOD A;  1RKN A;  3A8I E;  3RZD B;  2KQ3 A;  1UNS A;  3MWY W;  1K8M A;  4Z9C B;  5CGK A;  1JWM D;  3PIO 3;  2PZU A;  2AUJ D;  1DM0 B;  4FNF A;  1WTP A;  2JEB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...