5CMNA

Flrt3 lrr domain in complex with lphn3 olfactomedin domain
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
321
Chain Sequence
SCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine-rich repeat transmembrane protein FLRT3
publication title Structural Basis of Latrophilin-FLRT-UNC5 Interaction in Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/carbohydrate binding
total genus 92
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5cmnA00
5B0NA 2R9UA 1A4YA 2Z65A 4AY9X 1GWBA 3W3LA 3M18A 1XCDA 3UL8A 2V9SA 2V9TB 4BSSA 3WN4A 4Q62A 5GMFA 1OOKG 3O6NA 4K17A 2Z64A 4QXEA 5CMPA 4FS7A 4LI1A 2OMYA 2P1PB 4LSXC 3G04C 4R5DA 3WPHA 1FS2A 3ZYNA 3OGLB 3RGXA 4TZHA 4L3FA 1DFJI 4XOSA 3G3BA 4WP6A 3RW7A 4EZGA 4R6JA 5B0TA 2XOTA 1W8AA 4GT6A 1P8VA 2P1MB 4V2CA 5A5CA 1PGVA 4R58A 4C2AB 2IFGA 4LI2A 2BEXA 3ULVA 4R5CA 5IJDA 3OGMB 4FD0A 1O6VA 4U09A 1P8TA 1JL5A 1ZIWA 1OZNA 3ZYJA 1H6TA 4ECOA 2UZXA 4Q3IA 4V2EA 4L3AA 1QYYA 4XGOA 4KXFB 3ULUA 3WPBA 4CC4C 3G39A 1H6UA 3E2JA 2Y5QA 4Z8GA 4RWTC 2WQVA 4GLPA 3DZEA 4MQWX 4V2DA 3RGZA 3RFJA 3C6OB 2CA6A 2Z62A 1U0ND 4M7EC 3W3JA 4BV4R 3G3AA 3WPEA 4HQ1A 4BSUA 1OTOA 4FMZA 1FQVA 2OMWA 1O6SA 2Z7XB 4PEQB 2BNHA 1A9NA 2WFHA 4R0AA 5HDHA 2O6QA 3RFEA 2P1NB 5AWAA 5FTTB 5GMGA 4RCAB 2ELLA 3WPDA 3A79B 1O6TA 1XKUA 4I6JB 2WQWA 2V70A 3PMHG 5GS2B 5AWDA 4FDWA 4WYKA 1SQ0B 3P72A 4J0MA 1YRGA 4CC4A 3UL9A 4KT1A 5LFNA 3W3NA 4YEBB 5B4PA 3OGKB 3ULAA 4Z79A 3CIYA 2JE0A 3OJAA 2OMVA 2P1QB 5AZ5A 1M9SA 5AWBA 4R6FA 5GS0A 4LXRA 4IM6A 5HZLB 2A0ZA 2FT3A 2Z7XA 1XECA 2Z82A 4U08A 2JE1A 4MN8B 2WQXA 4PERA 1FT8A 2RR6A 4Z61C 3ZYOA 2OMUA 2UZYA 4BSRA 4CP6A 2OMZA 3OJAB 1KOHA 4CILA 3GOZA 4LSXA 3G06A 4LSAA 1Z7XW 4FCGA 3CIGA 1P9AG 3RIZA 2Z63A 3JB9j 4Y61B 3UL7A 5AWCA 5GMHA 4AW4A 3RJ0A 1OGQA 4XSQA 4RCWA 4R09A 1FO1A 1M10B 1K5DC 3E3ZA 4NKHA 1K5GC 3W3MA 2RA8A 1M0ZA 4OQTA 3WPCA 3FXIA 4CNCA 2Z81A 4PKIG 2ASTB 2O6SA 4H09A 1KOOA 3WPIA 5IJCA 4R6AA 2OMTA 4KNGA 3RW6A 4ECNA 4U7LA 3VQ1A 1LTXA 3UN9A 4Q3GA 3WPGA 1WWLA 2P1OB 3SB4A 4C2BB 3W3GA 4U06A 4UFRA 3E6JA 3C6NB 4QBZA 3KJ4A 4Z64C 4Z94G 4P91A 5GQRK 4CNMA 3REZA 1OTMA 4PSJA 3W3KA 1XWDC 4LSCA 4NKGA 2XWTC 3CVRA 4R6GA 4ARNA 5IJBA 4M7EA 3C6PB 4G8AA 2OMXA 1M9LA 4B8CD 3BZ5A 2ID5A 3E4GA 1XEUA 1DCEA 4R07A 4FHOA 4LXSA 3TSRE 2WQUA 5CMNA 1G9UA 5IYXC 4ARRA 2Z66A 1IO0A 2ASSB 1OTNA 2JQDA 3O53A 3VQ2A 3ZYIA 4QC0A 3M19A 5D3IA 2O6RA 4J4LA 4R08A 4P8SA 1DS9A 3RFSA 3WPFA 2Q4GW 4PQ8A 1D0BA
chains in the Genus database with same CATH superfamily
5B0NA 2R9UA 1A4YA 2Z65A 4AY9X 1GWBA 3W3LA 3M18A 1XCDA 3UL8A 2V9SA 2V9TB 4BSSA 3WN4A 4Q62A 5GMFA 1OOKG 3O6NA 4K17A 2Z64A 4QXEA 5CMPA 4FS7A 4LI1A 2OMYA 2P1PB 4LSXC 3G04C 4R5DA 3WPHA 1FS2A 3ZYNA 3OGLB 3RGXA 4TZHA 4L3FA 1DFJI 4XOSA 3G3BA 4WP6A 3RW7A 4EZGA 4R6JA 5B0TA 2XOTA 1W8AA 4GT6A 1P8VA 2P1MB 4V2CA 5A5CA 1PGVA 4R58A 4C2AB 2IFGA 4LI2A 2BEXA 3ULVA 4R5CA 5IJDA 3OGMB 4FD0A 1O6VA 4U09A 1P8TA 1JL5A 1ZIWA 1OZNA 3ZYJA 1H6TA 4ECOA 2UZXA 4Q3IA 4V2EA 4L3AA 1QYYA 4XGOA 4KXFB 3ULUA 3WPBA 4CC4C 3G39A 1H6UA 3E2JA 2Y5QA 4Z8GA 4RWTC 2WQVA 4GLPA 3DZEA 4MQWX 4V2DA 3RGZA 3RFJA 3C6OB 2CA6A 2Z62A 1U0ND 4M7EC 3W3JA 4BV4R 3G3AA 3WPEA 4HQ1A 4BSUA 1OTOA 4FMZA 1FQVA 2OMWA 1O6SA 4NZRM 2Z7XB 4PEQB 2BNHA 1A9NA 2WFHA 4R0AA 5HDHA 2O6QA 3RFEA 2P1NB 5AWAA 5FTTB 5GMGA 4RCAB 2ELLA 3WPDA 3A79B 1O6TA 1XKUA 4I6JB 2WQWA 2V70A 3PMHG 5GS2B 5AWDA 4FDWA 4WYKA 1SQ0B 3P72A 4J0MA 1YRGA 4CC4A 3UL9A 4KT1A 5LFNA 3W3NA 4YEBB 5B4PA 3OGKB 3ULAA 4Z79A 3CIYA 2JE0A 3OJAA 2OMVA 2P1QB 5AZ5A 1M9SA 5AWBA 4R6FA 5GS0A 4LXRA 4IM6A 5HZLB 2A0ZA 2FT3A 2Z7XA 1XECA 2Z82A 4U08A 2JE1A 4MN8B 2WQXA 4PERA 1FT8A 2RR6A 4Z61C 3ZYOA 2OMUA 2UZYA 4BSRA 4CP6A 2OMZA 3OJAB 1KOHA 4CILA 3GOZA 4LSXA 3G06A 4LSAA 1Z7XW 4FCGA 3CIGA 1P9AG 3RIZA 2Z63A 3JB9j 4Y61B 3UL7A 5AWCA 5GMHA 4AW4A 3RJ0A 1OGQA 4XSQA 4RCWA 4R09A 1FO1A 1M10B 1K5DC 3E3ZA 4NKHA 1K5GC 3W3MA 2RA8A 1M0ZA 4OQTA 3WPCA 3FXIA 4CNCA 2Z81A 4PKIG 2ASTB 2O6SA 4H09A 1KOOA 3WPIA 5IJCA 4R6AA 2OMTA 4KNGA 3RW6A 4NZTM 4ECNA 4U7LA 3VQ1A 1LTXA 3UN9A 4Q3GA 3WPGA 1WWLA 2P1OB 3SB4A 4C2BB 3W3GA 4U06A 4UFRA 3E6JA 3C6NB 4QBZA 3KJ4A 4Z64C 4Z94G 4P91A 5GQRK 4CNMA 3REZA 1OTMA 4PSJA 3W3KA 1XWDC 4LSCA 4NKGA 2XWTC 3CVRA 4R6GA 4ARNA 5IJBA 4M7EA 3C6PB 4G8AA 2OMXA 1M9LA 4B8CD 3BZ5A 2ID5A 3E4GA 1XEUA 1DCEA 4R07A 4FHOA 4LXSA 3TSRE 2WQUA 5CMNA 1G9UA 5IYXC 4ARRA 2Z66A 1IO0A 2ASSB 1OTNA 2JQDA 3O53A 3VQ2A 3ZYIA 4QC0A 3M19A 5D3IA 2O6RA 4J4LA 4R08A 4P8SA 1DS9A 3RFSA 3WPFA 2Q4GW 4PQ8A 1D0BA
chains in the Genus database with same CATH topology
5B0NA 2R9UA 1A4YA 2Z65A 4AY9X 1GWBA 3W3LA 3M18A 1XCDA 3UL8A 2V9SA 2V9TB 4BSSA 3WN4A 4Q62A 5GMFA 1OOKG 3O6NA 4K17A 2Z64A 4QXEA 5CMPA 4FS7A 4LI1A 2OMYA 2P1PB 4LSXC 3G04C 4R5DA 3WPHA 1FS2A 3ZYNA 3OGLB 3RGXA 4TZHA 4L3FA 1DFJI 4XOSA 3G3BA 4WP6A 3RW7A 4EZGA 4R6JA 5B0TA 2XOTA 1W8AA 4GT6A 1P8VA 2P1MB 4V2CA 5A5CA 1PGVA 4R58A 4C2AB 2IFGA 4LI2A 2BEXA 3ULVA 4R5CA 5IJDA 3OGMB 4FD0A 1O6VA 4U09A 1P8TA 1JL5A 1ZIWA 1OZNA 3ZYJA 1H6TA 4ECOA 2UZXA 4Q3IA 4V2EA 4L3AA 1QYYA 4XGOA 4KXFB 3ULUA 3WPBA 4CC4C 3G39A 1H6UA 3E2JA 2Y5QA 4Z8GA 4RWTC 2WQVA 4GLPA 3DZEA 4MQWX 4V2DA 3RGZA 3RFJA 3C6OB 2CA6A 2Z62A 1U0ND 4M7EC 3W3JA 4BV4R 3G3AA 3WPEA 4HQ1A 4BSUA 1OTOA 4FMZA 1FQVA 2OMWA 1O6SA 2Z7XB 4PEQB 2BNHA 1A9NA 2WFHA 4R0AA 5HDHA 2O6QA 3RFEA 2P1NB 5AWAA 5FTTB 5GMGA 4RCAB 2ELLA 3WPDA 3A79B 1O6TA 1XKUA 4I6JB 2WQWA 2V70A 3PMHG 5GS2B 5AWDA 4FDWA 4WYKA 1SQ0B 3P72A 4J0MA 1YRGA 4CC4A 3UL9A 4KT1A 5LFNA 3W3NA 4YEBB 5B4PA 3OGKB 3ULAA 4Z79A 3CIYA 2JE0A 3OJAA 2OMVA 2P1QB 5AZ5A 1M9SA 5AWBA 4R6FA 5GS0A 4LXRA 4IM6A 5HZLB 2A0ZA 2FT3A 2Z7XA 1XECA 2Z82A 4U08A 2JE1A 4MN8B 2WQXA 4PERA 1FT8A 2RR6A 4Z61C 3ZYOA 2OMUA 2UZYA 4BSRA 4CP6A 2OMZA 3OJAB 1KOHA 4CILA 3GOZA 4LSXA 3G06A 4LSAA 1Z7XW 4FCGA 3CIGA 1P9AG 3RIZA 2Z63A 3JB9j 4Y61B 3UL7A 5AWCA 5GMHA 4AW4A 3RJ0A 1OGQA 4XSQA 4RCWA 4R09A 1FO1A 1M10B 1K5DC 3E3ZA 4NKHA 1K5GC 3W3MA 2RA8A 1M0ZA 4OQTA 3WPCA 3FXIA 4CNCA 2Z81A 4PKIG 2ASTB 2O6SA 4H09A 1KOOA 3WPIA 5IJCA 4R6AA 2OMTA 4KNGA 3RW6A 4ECNA 4U7LA 3VQ1A 1LTXA 3UN9A 4Q3GA 3WPGA 1WWLA 2P1OB 3SB4A 4C2BB 3W3GA 4U06A 4UFRA 3E6JA 3C6NB 4QBZA 3KJ4A 4Z64C 4Z94G 4P91A 5GQRK 4CNMA 3REZA 1OTMA 4PSJA 3W3KA 1XWDC 4LSCA 4NKGA 2XWTC 3CVRA 4R6GA 4ARNA 5IJBA 4M7EA 3C6PB 4G8AA 2OMXA 1M9LA 4B8CD 3BZ5A 2ID5A 3E4GA 1XEUA 1DCEA 4R07A 4FHOA 4LXSA 3TSRE 2WQUA 5CMNA 1G9UA 5IYXC 4ARRA 2Z66A 1IO0A 2ASSB 1OTNA 2JQDA 3O53A 3VQ2A 3ZYIA 4QC0A 3M19A 5D3IA 2O6RA 4J4LA 4R08A 4P8SA 1DS9A 3RFSA 3WPFA 2Q4GW 4PQ8A 1D0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0N A;  2R9U A;  1A4Y A;  2Z65 A;  4AY9 X;  1GWB A;  3W3L A;  3M18 A;  1XCD A;  3UL8 A;  2V9S A;  2V9T B;  4BSS A;  3WN4 A;  4Q62 A;  5GMF A;  1OOK G;  3O6N A;  4K17 A;  2Z64 A;  4QXE A;  5CMP A;  4FS7 A;  4LI1 A;  2OMY A;  2P1P B;  4LSX C;  3G04 C;  4R5D A;  3WPH A;  1FS2 A;  3ZYN A;  3OGL B;  3RGX A;  4TZH A;  4L3F A;  1DFJ I;  4XOS A;  3G3B A;  4WP6 A;  3RW7 A;  4EZG A;  4R6J A;  5B0T A;  2XOT A;  1W8A A;  4GT6 A;  1P8V A;  2P1M B;  4V2C A;  5A5C A;  1PGV A;  4R58 A;  4C2A B;  2IFG A;  4LI2 A;  2BEX A;  3ULV A;  4R5C A;  5IJD A;  3OGM B;  4FD0 A;  1O6V A;  4U09 A;  1P8T A;  1JL5 A;  1ZIW A;  1OZN A;  3ZYJ A;  1H6T A;  4ECO A;  2UZX A;  4Q3I A;  4V2E A;  4L3A A;  1QYY A;  4XGO A;  4KXF B;  3ULU A;  3WPB A;  4CC4 C;  3G39 A;  1H6U A;  3E2J A;  2Y5Q A;  4Z8G A;  4RWT C;  2WQV A;  4GLP A;  3DZE A;  4MQW X;  4V2D A;  3RGZ A;  3RFJ A;  3C6O B;  2CA6 A;  2Z62 A;  1U0N D;  4M7E C;  3W3J A;  4BV4 R;  3G3A A;  3WPE A;  4HQ1 A;  4BSU A;  1OTO A;  4FMZ A;  1FQV A;  2OMW A;  1O6S A;  2Z7X B;  4PEQ B;  2BNH A;  1A9N A;  2WFH A;  4R0A A;  5HDH A;  2O6Q A;  3RFE A;  2P1N B;  5AWA A;  5FTT B;  5GMG A;  4RCA B;  2ELL A;  3WPD A;  3A79 B;  1O6T A;  1XKU A;  4I6J B;  2WQW A;  2V70 A;  3PMH G;  5GS2 B;  5AWD A;  4FDW A;  4WYK A;  1SQ0 B;  3P72 A;  4J0M A;  1YRG A;  4CC4 A;  3UL9 A;  4KT1 A;  5LFN A;  3W3N A;  4YEB B;  5B4P A;  3OGK B;  3ULA A;  4Z79 A;  3CIY A;  2JE0 A;  3OJA A;  2OMV A;  2P1Q B;  5AZ5 A;  1M9S A;  5AWB A;  4R6F A;  5GS0 A;  4LXR A;  4IM6 A;  5HZL B;  2A0Z A;  2FT3 A;  2Z7X A;  1XEC A;  2Z82 A;  4U08 A;  2JE1 A;  4MN8 B;  2WQX A;  4PER A;  1FT8 A;  2RR6 A;  4Z61 C;  3ZYO A;  2OMU A;  2UZY A;  4BSR A;  4CP6 A;  2OMZ A;  3OJA B;  1KOH A;  4CIL A;  3GOZ A;  4LSX A;  3G06 A;  4LSA A;  1Z7X W;  4FCG A;  3CIG A;  1P9A G;  3RIZ A;  2Z63 A;  3JB9 j;  4Y61 B;  3UL7 A;  5AWC A;  5GMH A;  4AW4 A;  3RJ0 A;  1OGQ A;  4XSQ A;  4RCW A;  4R09 A;  1FO1 A;  1M10 B;  1K5D C;  3E3Z A;  4NKH A;  1K5G C;  3W3M A;  2RA8 A;  1M0Z A;  4OQT A;  3WPC A;  3FXI A;  4CNC A;  2Z81 A;  4PKI G;  2AST B;  2O6S A;  4H09 A;  1KOO A;  3WPI A;  5IJC A;  4R6A A;  2OMT A;  4KNG A;  3RW6 A;  4ECN A;  4U7L A;  3VQ1 A;  1LTX A;  3UN9 A;  4Q3G A;  3WPG A;  1WWL A;  2P1O B;  3SB4 A;  4C2B B;  3W3G A;  4U06 A;  4UFR A;  3E6J A;  3C6N B;  4QBZ A;  3KJ4 A;  4Z64 C;  4Z94 G;  4P91 A;  5GQR K;  4CNM A;  3REZ A;  1OTM A;  4PSJ A;  3W3K A;  1XWD C;  4LSC A;  4NKG A;  2XWT C;  3CVR A;  4R6G A;  4ARN A;  5IJB A;  4M7E A;  3C6P B;  4G8A A;  2OMX A;  1M9L A;  4B8C D;  3BZ5 A;  2ID5 A;  3E4G A;  1XEU A;  1DCE A;  4R07 A;  4FHO A;  4LXS A;  3TSR E;  2WQU A;  5CMN A;  1G9U A;  5IYX C;  4ARR A;  2Z66 A;  1IO0 A;  2ASS B;  1OTN A;  2JQD A;  3O53 A;  3VQ2 A;  3ZYI A;  4QC0 A;  3M19 A;  5D3I A;  2O6R A;  4J4L A;  4R08 A;  4P8S A;  1DS9 A;  3RFS A;  3WPF A;  2Q4G W;  4PQ8 A;  1D0B A; 
#chains in the Genus database with same CATH topology
 5B0N A;  2R9U A;  1A4Y A;  2Z65 A;  4AY9 X;  1GWB A;  3W3L A;  3M18 A;  1XCD A;  3UL8 A;  2V9S A;  2V9T B;  4BSS A;  3WN4 A;  4Q62 A;  5GMF A;  1OOK G;  3O6N A;  4K17 A;  2Z64 A;  4QXE A;  5CMP A;  4FS7 A;  4LI1 A;  2OMY A;  2P1P B;  4LSX C;  3G04 C;  4R5D A;  3WPH A;  1FS2 A;  3ZYN A;  3OGL B;  3RGX A;  4TZH A;  4L3F A;  1DFJ I;  4XOS A;  3G3B A;  4WP6 A;  3RW7 A;  4EZG A;  4R6J A;  5B0T A;  2XOT A;  1W8A A;  4GT6 A;  1P8V A;  2P1M B;  4V2C A;  5A5C A;  1PGV A;  4R58 A;  4C2A B;  2IFG A;  4LI2 A;  2BEX A;  3ULV A;  4R5C A;  5IJD A;  3OGM B;  4FD0 A;  1O6V A;  4U09 A;  1P8T A;  1JL5 A;  1ZIW A;  1OZN A;  3ZYJ A;  1H6T A;  4ECO A;  2UZX A;  4Q3I A;  4V2E A;  4L3A A;  1QYY A;  4XGO A;  4KXF B;  3ULU A;  3WPB A;  4CC4 C;  3G39 A;  1H6U A;  3E2J A;  2Y5Q A;  4Z8G A;  4RWT C;  2WQV A;  4GLP A;  3DZE A;  4MQW X;  4V2D A;  3RGZ A;  3RFJ A;  3C6O B;  2CA6 A;  2Z62 A;  1U0N D;  4M7E C;  3W3J A;  4BV4 R;  3G3A A;  3WPE A;  4HQ1 A;  4BSU A;  1OTO A;  4FMZ A;  1FQV A;  2OMW A;  1O6S A;  4NZR M;  2Z7X B;  4PEQ B;  2BNH A;  1A9N A;  2WFH A;  4R0A A;  5HDH A;  2O6Q A;  3RFE A;  2P1N B;  5AWA A;  5FTT B;  5GMG A;  4RCA B;  2ELL A;  3WPD A;  3A79 B;  1O6T A;  1XKU A;  4I6J B;  2WQW A;  2V70 A;  3PMH G;  5GS2 B;  5AWD A;  4FDW A;  4WYK A;  1SQ0 B;  3P72 A;  4J0M A;  1YRG A;  4CC4 A;  3UL9 A;  4KT1 A;  5LFN A;  3W3N A;  4YEB B;  5B4P A;  3OGK B;  3ULA A;  4Z79 A;  3CIY A;  2JE0 A;  3OJA A;  2OMV A;  2P1Q B;  5AZ5 A;  1M9S A;  5AWB A;  4R6F A;  5GS0 A;  4LXR A;  4IM6 A;  5HZL B;  2A0Z A;  2FT3 A;  2Z7X A;  1XEC A;  2Z82 A;  4U08 A;  2JE1 A;  4MN8 B;  2WQX A;  4PER A;  1FT8 A;  2RR6 A;  4Z61 C;  3ZYO A;  2OMU A;  2UZY A;  4BSR A;  4CP6 A;  2OMZ A;  3OJA B;  1KOH A;  4CIL A;  3GOZ A;  4LSX A;  3G06 A;  4LSA A;  1Z7X W;  4FCG A;  3CIG A;  1P9A G;  3RIZ A;  2Z63 A;  3JB9 j;  4Y61 B;  3UL7 A;  5AWC A;  5GMH A;  4AW4 A;  3RJ0 A;  1OGQ A;  4XSQ A;  4RCW A;  4R09 A;  1FO1 A;  1M10 B;  1K5D C;  3E3Z A;  4NKH A;  1K5G C;  3W3M A;  2RA8 A;  1M0Z A;  4OQT A;  3WPC A;  3FXI A;  4CNC A;  2Z81 A;  4PKI G;  2AST B;  2O6S A;  4H09 A;  1KOO A;  3WPI A;  5IJC A;  4R6A A;  2OMT A;  4KNG A;  3RW6 A;  4NZT M;  4ECN A;  4U7L A;  3VQ1 A;  1LTX A;  3UN9 A;  4Q3G A;  3WPG A;  1WWL A;  2P1O B;  3SB4 A;  4C2B B;  3W3G A;  4U06 A;  4UFR A;  3E6J A;  3C6N B;  4QBZ A;  3KJ4 A;  4Z64 C;  4Z94 G;  4P91 A;  5GQR K;  4CNM A;  3REZ A;  1OTM A;  4PSJ A;  3W3K A;  1XWD C;  4LSC A;  4NKG A;  2XWT C;  3CVR A;  4R6G A;  4ARN A;  5IJB A;  4M7E A;  3C6P B;  4G8A A;  2OMX A;  1M9L A;  4B8C D;  3BZ5 A;  2ID5 A;  3E4G A;  1XEU A;  1DCE A;  4R07 A;  4FHO A;  4LXS A;  3TSR E;  2WQU A;  5CMN A;  1G9U A;  5IYX C;  4ARR A;  2Z66 A;  1IO0 A;  2ASS B;  1OTN A;  2JQD A;  3O53 A;  3VQ2 A;  3ZYI A;  4QC0 A;  3M19 A;  5D3I A;  2O6R A;  4J4L A;  4R08 A;  4P8S A;  1DS9 A;  3RFS A;  3WPF A;  2Q4G W;  4PQ8 A;  1D0B A; 
#chains in the Genus database with same CATH homology
 5B0N A;  2R9U A;  1A4Y A;  2Z65 A;  4AY9 X;  1GWB A;  3W3L A;  3M18 A;  1XCD A;  3UL8 A;  2V9S A;  2V9T B;  4BSS A;  3WN4 A;  4Q62 A;  5GMF A;  1OOK G;  3O6N A;  4K17 A;  2Z64 A;  4QXE A;  5CMP A;  4FS7 A;  4LI1 A;  2OMY A;  2P1P B;  4LSX C;  3G04 C;  4R5D A;  3WPH A;  1FS2 A;  3ZYN A;  3OGL B;  3RGX A;  4TZH A;  4L3F A;  1DFJ I;  4XOS A;  3G3B A;  4WP6 A;  3RW7 A;  4EZG A;  4R6J A;  5B0T A;  2XOT A;  1W8A A;  4GT6 A;  1P8V A;  2P1M B;  4V2C A;  5A5C A;  1PGV A;  4R58 A;  4C2A B;  2IFG A;  4LI2 A;  2BEX A;  3ULV A;  4R5C A;  5IJD A;  3OGM B;  4FD0 A;  1O6V A;  4U09 A;  1P8T A;  1JL5 A;  1ZIW A;  1OZN A;  3ZYJ A;  1H6T A;  4ECO A;  2UZX A;  4Q3I A;  4V2E A;  4L3A A;  1QYY A;  4XGO A;  4KXF B;  3ULU A;  3WPB A;  4CC4 C;  3G39 A;  1H6U A;  3E2J A;  2Y5Q A;  4Z8G A;  4RWT C;  2WQV A;  4GLP A;  3DZE A;  4MQW X;  4V2D A;  3RGZ A;  3RFJ A;  3C6O B;  2CA6 A;  2Z62 A;  1U0N D;  4M7E C;  3W3J A;  4BV4 R;  3G3A A;  3WPE A;  4HQ1 A;  4BSU A;  1OTO A;  4FMZ A;  1FQV A;  2OMW A;  1O6S A;  2Z7X B;  4PEQ B;  2BNH A;  1A9N A;  2WFH A;  4R0A A;  5HDH A;  2O6Q A;  3RFE A;  2P1N B;  5AWA A;  5FTT B;  5GMG A;  4RCA B;  2ELL A;  3WPD A;  3A79 B;  1O6T A;  1XKU A;  4I6J B;  2WQW A;  2V70 A;  3PMH G;  5GS2 B;  5AWD A;  4FDW A;  4WYK A;  1SQ0 B;  3P72 A;  4J0M A;  1YRG A;  4CC4 A;  3UL9 A;  4KT1 A;  5LFN A;  3W3N A;  4YEB B;  5B4P A;  3OGK B;  3ULA A;  4Z79 A;  3CIY A;  2JE0 A;  3OJA A;  2OMV A;  2P1Q B;  5AZ5 A;  1M9S A;  5AWB A;  4R6F A;  5GS0 A;  4LXR A;  4IM6 A;  5HZL B;  2A0Z A;  2FT3 A;  2Z7X A;  1XEC A;  2Z82 A;  4U08 A;  2JE1 A;  4MN8 B;  2WQX A;  4PER A;  1FT8 A;  2RR6 A;  4Z61 C;  3ZYO A;  2OMU A;  2UZY A;  4BSR A;  4CP6 A;  2OMZ A;  3OJA B;  1KOH A;  4CIL A;  3GOZ A;  4LSX A;  3G06 A;  4LSA A;  1Z7X W;  4FCG A;  3CIG A;  1P9A G;  3RIZ A;  2Z63 A;  3JB9 j;  4Y61 B;  3UL7 A;  5AWC A;  5GMH A;  4AW4 A;  3RJ0 A;  1OGQ A;  4XSQ A;  4RCW A;  4R09 A;  1FO1 A;  1M10 B;  1K5D C;  3E3Z A;  4NKH A;  1K5G C;  3W3M A;  2RA8 A;  1M0Z A;  4OQT A;  3WPC A;  3FXI A;  4CNC A;  2Z81 A;  4PKI G;  2AST B;  2O6S A;  4H09 A;  1KOO A;  3WPI A;  5IJC A;  4R6A A;  2OMT A;  4KNG A;  3RW6 A;  4ECN A;  4U7L A;  3VQ1 A;  1LTX A;  3UN9 A;  4Q3G A;  3WPG A;  1WWL A;  2P1O B;  3SB4 A;  4C2B B;  3W3G A;  4U06 A;  4UFR A;  3E6J A;  3C6N B;  4QBZ A;  3KJ4 A;  4Z64 C;  4Z94 G;  4P91 A;  5GQR K;  4CNM A;  3REZ A;  1OTM A;  4PSJ A;  3W3K A;  1XWD C;  4LSC A;  4NKG A;  2XWT C;  3CVR A;  4R6G A;  4ARN A;  5IJB A;  4M7E A;  3C6P B;  4G8A A;  2OMX A;  1M9L A;  4B8C D;  3BZ5 A;  2ID5 A;  3E4G A;  1XEU A;  1DCE A;  4R07 A;  4FHO A;  4LXS A;  3TSR E;  2WQU A;  5CMN A;  1G9U A;  5IYX C;  4ARR A;  2Z66 A;  1IO0 A;  2ASS B;  1OTN A;  2JQD A;  3O53 A;  3VQ2 A;  3ZYI A;  4QC0 A;  3M19 A;  5D3I A;  2O6R A;  4J4L A;  4R08 A;  4P8S A;  1DS9 A;  3RFS A;  3WPF A;  2Q4G W;  4PQ8 A;  1D0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...