5CMNA

Flrt3 lrr domain in complex with lphn3 olfactomedin domain
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
321
structure length
321
Chain Sequence
SCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Latrophilin-FLRT-UNC5 Interaction in Cell Adhesion.
pubmed doi rcsb
molecule keywords Leucine-rich repeat transmembrane protein FLRT3
source organism Homo sapiens
molecule tags Cell adhesion/carbohydrate binding
total genus 92
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5cmnA00
4LSXC 4R58A 1OOKG 1LTXA 3WPIA 1W8AA 3BZ5A 1U0ND 4Z8GA 3RW7A 1O6VA 1OGQA 4R6JA 4QC0A 5B0NA 4K17A 4AY9X 1XEUA 3W3NA 3A79B 2Z7XA 3RFEA 3KJ4A 4XOSA 4PERA 4YEBB 5AZ5A 4CC4C 5GS0A 4NKHA 1M0ZA 3UN9A 4CILA 3TSRE 3UL9A 4V2CA 4L3AA 4ARNA 2R9UA 4Q62A 1OTOA 3ZYNA 1K5GC 3GOZA 5CMPA 4GT6A 4EZGA 3WPEA 2Y5QA 4FS7A 4CNCA 3RIZA 5LFNA 5GS2B 4FMZA 5IJBA 3WPGA 3WPBA 4L3FA 4U09A 2Z62A 1P9AG 1O6TA 2OMUA 3E2JA 3RJ0A 5AWAA 1GWBA 1WWLA 2ID5A 5CMNA 3DZEA 1DFJI 2RR6A 5IYXC 2Q4GW 4MQWX 1M10B 3W3MA 4CP6A 2OMZA 2IFGA 1FQVA 1FT8A 3OGKB 4PQ8A 4R0AA 3ULUA 4RCAB 4V2DA 4BSUA 3O53A 4XSQA 4LI2A 1P8VA 4R6GA 4WP6A 5AWCA 2P1MB 3WPDA 2Z7XB 2V70A 4FCGA 4P8SA 2Z66A 3W3JA 2ASTB 5A5CA 4RWTC 5B4PA 4TZHA 4C2BB 4ECOA 1SQ0B 4Z64C 2UZXA 3OJAA 2UZYA 2BNHA 3W3KA 3JB9j 3RW6A 3ZYJA 3M18A 2O6SA 1FO1A 4Y61B 4Z79A 3ULVA 2JE1A 2Z82A 2CA6A 4XGOA 2JE0A 3UL7A 5AWBA 4NKGA 4U08A 3WN4A 4LXSA 2RA8A 2OMVA 3FXIA 4R09A 4RCWA 1ZIWA 2A0ZA 2FT3A 4CNMA 3P72A 2OMWA 4FHOA 4IM6A 1K5DC 3PMHG 5GQRK 4B8CD 4Q3IA 2WQXA 4MN8B 4KT1A 3ULAA 1D0BA 4UFRA 2P1NB 2O6RA 2OMYA 1OZNA 1DCEA 4KNGA 4Q3GA 4ARRA 4AW4A 1A4YA 2V9SA 1KOHA 3W3LA 1QYYA 2WQVA 2P1QB 4LSAA 4V2EA 3RFSA 4Z94G 3RGXA 1OTMA 1A9NA 3VQ1A 5AWDA 2O6QA 3WPCA 2Z64A 4LI1A 5D3IA 3RGZA 2WQWA 1P8TA 3CIGA 2V9TB 2ASSB 3REZA 1XWDC 2P1OB 3WPHA 2BEXA 4KXFB 3CVRA 4H09A 3G39A 5IJCA 5FTTB 3E3ZA 3G06A 2XOTA 4R5CA 4J0MA 4R07A 4J4LA 2ELLA 3G04C 3W3GA 4BSSA 4Z61C 1DS9A 2OMTA 3C6NB 4ECNA 4R6AA 1M9LA 2Z81A 4BSRA 4HQ1A 1YRGA 5GMFA 4R5DA 5HDHA 3O6NA 4R08A 4BV4R 4U7LA 3C6PB 1Z7XW 5IJDA 1IO0A 3E4GA 4G8AA 5GMHA 3E6JA 4M7EC 3ZYIA 1XCDA 3G3BA 4U06A 2WQUA 4QXEA 4LSXA 3OGLB 1XECA 2Z65A 1PGVA 4FDWA 4P91A 3WPFA 4WYKA 1KOOA 4LXRA 1XKUA 2Z63A 3UL8A 3ZYOA 3OGMB 2XWTC 1JL5A 5HZLB 4OQTA 1H6TA 4FD0A 4PSJA 4C2AB 2OMXA 1H6UA 5B0TA 4CC4A 1FS2A 3OJAB 4I6JB 4LSCA 1M9SA 1G9UA 4GLPA 4R6FA 4PKIG 3G3AA 3CIYA 2P1PB 5GMGA 4PEQB 3RFJA 1O6SA 2JQDA 2WFHA 3M19A 3SB4A 3C6OB 4QBZA 1OTNA 3VQ2A 4M7EA
chains in the Genus database with same CATH superfamily
4LSXC 4R58A 1OOKG 1LTXA 3WPIA 1W8AA 3BZ5A 1U0ND 4Z8GA 3RW7A 1O6VA 1OGQA 4R6JA 4QC0A 5B0NA 4K17A 4AY9X 1XEUA 3W3NA 3A79B 2Z7XA 3RFEA 3KJ4A 4XOSA 4PERA 4YEBB 5AZ5A 4CC4C 5GS0A 4NKHA 1M0ZA 3UN9A 4CILA 3TSRE 3UL9A 4V2CA 4L3AA 4ARNA 2R9UA 4Q62A 1OTOA 3ZYNA 1K5GC 3GOZA 5CMPA 4GT6A 4EZGA 3WPEA 2Y5QA 4FS7A 4CNCA 3RIZA 5LFNA 5GS2B 4FMZA 5IJBA 3WPGA 3WPBA 4L3FA 4U09A 2Z62A 1P9AG 1O6TA 2OMUA 3E2JA 3RJ0A 5AWAA 1GWBA 1WWLA 2ID5A 5CMNA 3DZEA 1DFJI 2RR6A 5IYXC 2Q4GW 4MQWX 1M10B 3W3MA 4CP6A 2OMZA 2IFGA 1FQVA 1FT8A 3OGKB 4PQ8A 4R0AA 3ULUA 4RCAB 4V2DA 4BSUA 3O53A 4XSQA 4LI2A 1P8VA 4R6GA 4WP6A 5AWCA 2P1MB 3WPDA 2Z7XB 2V70A 4FCGA 4P8SA 2Z66A 3W3JA 2ASTB 5A5CA 4RWTC 5B4PA 4TZHA 4C2BB 4ECOA 1SQ0B 4Z64C 2UZXA 3OJAA 2UZYA 2BNHA 3W3KA 3JB9j 3RW6A 3ZYJA 3M18A 2O6SA 1FO1A 4Y61B 4Z79A 3ULVA 2JE1A 2Z82A 2CA6A 4XGOA 2JE0A 3UL7A 5AWBA 4NKGA 4U08A 3WN4A 4LXSA 2RA8A 2OMVA 3FXIA 4R09A 4RCWA 1ZIWA 2A0ZA 2FT3A 4CNMA 3P72A 2OMWA 4FHOA 4IM6A 1K5DC 3PMHG 5GQRK 4B8CD 4Q3IA 2WQXA 4MN8B 4KT1A 3ULAA 1D0BA 4UFRA 2P1NB 2O6RA 2OMYA 1OZNA 4NZTM 1DCEA 4KNGA 4Q3GA 4ARRA 4AW4A 1A4YA 2V9SA 1KOHA 3W3LA 1QYYA 2WQVA 2P1QB 4LSAA 4V2EA 3RFSA 4Z94G 3RGXA 1OTMA 1A9NA 3VQ1A 5AWDA 2O6QA 3WPCA 2Z64A 4LI1A 5D3IA 3RGZA 2WQWA 1P8TA 3CIGA 2V9TB 2ASSB 3REZA 1XWDC 2P1OB 3WPHA 2BEXA 4KXFB 3CVRA 4H09A 3G39A 5IJCA 5FTTB 3E3ZA 3G06A 2XOTA 4R5CA 4J0MA 4R07A 4J4LA 2ELLA 3G04C 3W3GA 4BSSA 4Z61C 1DS9A 2OMTA 3C6NB 4ECNA 4R6AA 1M9LA 2Z81A 4BSRA 4HQ1A 1YRGA 5GMFA 4R5DA 5HDHA 3O6NA 4R08A 4BV4R 4U7LA 3C6PB 1Z7XW 5IJDA 1IO0A 3E4GA 4G8AA 5GMHA 3E6JA 4M7EC 3ZYIA 1XCDA 3G3BA 4U06A 2WQUA 4QXEA 4LSXA 3OGLB 1XECA 2Z65A 1PGVA 4FDWA 4P91A 3WPFA 4WYKA 1KOOA 4LXRA 1XKUA 2Z63A 3UL8A 3ZYOA 3OGMB 2XWTC 1JL5A 5HZLB 4OQTA 1H6TA 4FD0A 4PSJA 4C2AB 2OMXA 1H6UA 5B0TA 4CC4A 1FS2A 3OJAB 4NZRM 4I6JB 4LSCA 1M9SA 1G9UA 4GLPA 4R6FA 4PKIG 3G3AA 3CIYA 2P1PB 5GMGA 4PEQB 3RFJA 1O6SA 2JQDA 2WFHA 3M19A 3SB4A 3C6OB 4QBZA 1OTNA 3VQ2A 4M7EA
chains in the Genus database with same CATH topology
4LSXC 4R58A 1OOKG 1LTXA 3WPIA 1W8AA 3BZ5A 1U0ND 4Z8GA 3RW7A 1O6VA 1OGQA 4R6JA 4QC0A 5B0NA 4K17A 4AY9X 1XEUA 3W3NA 3A79B 2Z7XA 3RFEA 3KJ4A 4XOSA 4PERA 4YEBB 5AZ5A 4CC4C 5GS0A 4NKHA 1M0ZA 3UN9A 4CILA 3TSRE 3UL9A 4V2CA 4L3AA 4ARNA 2R9UA 4Q62A 1OTOA 3ZYNA 1K5GC 3GOZA 5CMPA 4GT6A 4EZGA 3WPEA 2Y5QA 4FS7A 4CNCA 3RIZA 5LFNA 5GS2B 4FMZA 5IJBA 3WPGA 3WPBA 4L3FA 4U09A 2Z62A 1P9AG 1O6TA 2OMUA 3E2JA 3RJ0A 5AWAA 1GWBA 1WWLA 2ID5A 5CMNA 3DZEA 1DFJI 2RR6A 5IYXC 2Q4GW 4MQWX 1M10B 3W3MA 4CP6A 2OMZA 2IFGA 1FQVA 1FT8A 3OGKB 4PQ8A 4R0AA 3ULUA 4RCAB 4V2DA 4BSUA 3O53A 4XSQA 4LI2A 1P8VA 4R6GA 4WP6A 5AWCA 2P1MB 3WPDA 2Z7XB 2V70A 4FCGA 4P8SA 2Z66A 3W3JA 2ASTB 5A5CA 4RWTC 5B4PA 4TZHA 4C2BB 4ECOA 1SQ0B 4Z64C 2UZXA 3OJAA 2UZYA 2BNHA 3W3KA 3JB9j 3RW6A 3ZYJA 3M18A 2O6SA 1FO1A 4Y61B 4Z79A 3ULVA 2JE1A 2Z82A 2CA6A 4XGOA 2JE0A 3UL7A 5AWBA 4NKGA 4U08A 3WN4A 4LXSA 2RA8A 2OMVA 3FXIA 4R09A 4RCWA 1ZIWA 2A0ZA 2FT3A 4CNMA 3P72A 2OMWA 4FHOA 4IM6A 1K5DC 3PMHG 5GQRK 4B8CD 4Q3IA 2WQXA 4MN8B 4KT1A 3ULAA 1D0BA 4UFRA 2P1NB 2O6RA 2OMYA 1OZNA 1DCEA 4KNGA 4Q3GA 4ARRA 4AW4A 1A4YA 2V9SA 1KOHA 3W3LA 1QYYA 2WQVA 2P1QB 4LSAA 4V2EA 3RFSA 4Z94G 3RGXA 1OTMA 1A9NA 3VQ1A 5AWDA 2O6QA 3WPCA 2Z64A 4LI1A 5D3IA 3RGZA 2WQWA 1P8TA 3CIGA 2V9TB 2ASSB 3REZA 1XWDC 2P1OB 3WPHA 2BEXA 4KXFB 3CVRA 4H09A 3G39A 5IJCA 5FTTB 3E3ZA 3G06A 2XOTA 4R5CA 4J0MA 4R07A 4J4LA 2ELLA 3G04C 3W3GA 4BSSA 4Z61C 1DS9A 2OMTA 3C6NB 4ECNA 4R6AA 1M9LA 2Z81A 4BSRA 4HQ1A 1YRGA 5GMFA 4R5DA 5HDHA 3O6NA 4R08A 4BV4R 4U7LA 3C6PB 1Z7XW 5IJDA 1IO0A 3E4GA 4G8AA 5GMHA 3E6JA 4M7EC 3ZYIA 1XCDA 3G3BA 4U06A 2WQUA 4QXEA 4LSXA 3OGLB 1XECA 2Z65A 1PGVA 4FDWA 4P91A 3WPFA 4WYKA 1KOOA 4LXRA 1XKUA 2Z63A 3UL8A 3ZYOA 3OGMB 2XWTC 1JL5A 5HZLB 4OQTA 1H6TA 4FD0A 4PSJA 4C2AB 2OMXA 1H6UA 5B0TA 4CC4A 1FS2A 3OJAB 4I6JB 4LSCA 1M9SA 1G9UA 4GLPA 4R6FA 4PKIG 3G3AA 3CIYA 2P1PB 5GMGA 4PEQB 3RFJA 1O6SA 2JQDA 2WFHA 3M19A 3SB4A 3C6OB 4QBZA 1OTNA 3VQ2A 4M7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSX C;  4R58 A;  1OOK G;  1LTX A;  3WPI A;  1W8A A;  3BZ5 A;  1U0N D;  4Z8G A;  3RW7 A;  1O6V A;  1OGQ A;  4R6J A;  4QC0 A;  5B0N A;  4K17 A;  4AY9 X;  1XEU A;  3W3N A;  3A79 B;  2Z7X A;  3RFE A;  3KJ4 A;  4XOS A;  4PER A;  4YEB B;  5AZ5 A;  4CC4 C;  5GS0 A;  4NKH A;  1M0Z A;  3UN9 A;  4CIL A;  3TSR E;  3UL9 A;  4V2C A;  4L3A A;  4ARN A;  2R9U A;  4Q62 A;  1OTO A;  3ZYN A;  1K5G C;  3GOZ A;  5CMP A;  4GT6 A;  4EZG A;  3WPE A;  2Y5Q A;  4FS7 A;  4CNC A;  3RIZ A;  5LFN A;  5GS2 B;  4FMZ A;  5IJB A;  3WPG A;  3WPB A;  4L3F A;  4U09 A;  2Z62 A;  1P9A G;  1O6T A;  2OMU A;  3E2J A;  3RJ0 A;  5AWA A;  1GWB A;  1WWL A;  2ID5 A;  5CMN A;  3DZE A;  1DFJ I;  2RR6 A;  5IYX C;  2Q4G W;  4MQW X;  1M10 B;  3W3M A;  4CP6 A;  2OMZ A;  2IFG A;  1FQV A;  1FT8 A;  3OGK B;  4PQ8 A;  4R0A A;  3ULU A;  4RCA B;  4V2D A;  4BSU A;  3O53 A;  4XSQ A;  4LI2 A;  1P8V A;  4R6G A;  4WP6 A;  5AWC A;  2P1M B;  3WPD A;  2Z7X B;  2V70 A;  4FCG A;  4P8S A;  2Z66 A;  3W3J A;  2AST B;  5A5C A;  4RWT C;  5B4P A;  4TZH A;  4C2B B;  4ECO A;  1SQ0 B;  4Z64 C;  2UZX A;  3OJA A;  2UZY A;  2BNH A;  3W3K A;  3JB9 j;  3RW6 A;  3ZYJ A;  3M18 A;  2O6S A;  1FO1 A;  4Y61 B;  4Z79 A;  3ULV A;  2JE1 A;  2Z82 A;  2CA6 A;  4XGO A;  2JE0 A;  3UL7 A;  5AWB A;  4NKG A;  4U08 A;  3WN4 A;  4LXS A;  2RA8 A;  2OMV A;  3FXI A;  4R09 A;  4RCW A;  1ZIW A;  2A0Z A;  2FT3 A;  4CNM A;  3P72 A;  2OMW A;  4FHO A;  4IM6 A;  1K5D C;  3PMH G;  5GQR K;  4B8C D;  4Q3I A;  2WQX A;  4MN8 B;  4KT1 A;  3ULA A;  1D0B A;  4UFR A;  2P1N B;  2O6R A;  2OMY A;  1OZN A;  1DCE A;  4KNG A;  4Q3G A;  4ARR A;  4AW4 A;  1A4Y A;  2V9S A;  1KOH A;  3W3L A;  1QYY A;  2WQV A;  2P1Q B;  4LSA A;  4V2E A;  3RFS A;  4Z94 G;  3RGX A;  1OTM A;  1A9N A;  3VQ1 A;  5AWD A;  2O6Q A;  3WPC A;  2Z64 A;  4LI1 A;  5D3I A;  3RGZ A;  2WQW A;  1P8T A;  3CIG A;  2V9T B;  2ASS B;  3REZ A;  1XWD C;  2P1O B;  3WPH A;  2BEX A;  4KXF B;  3CVR A;  4H09 A;  3G39 A;  5IJC A;  5FTT B;  3E3Z A;  3G06 A;  2XOT A;  4R5C A;  4J0M A;  4R07 A;  4J4L A;  2ELL A;  3G04 C;  3W3G A;  4BSS A;  4Z61 C;  1DS9 A;  2OMT A;  3C6N B;  4ECN A;  4R6A A;  1M9L A;  2Z81 A;  4BSR A;  4HQ1 A;  1YRG A;  5GMF A;  4R5D A;  5HDH A;  3O6N A;  4R08 A;  4BV4 R;  4U7L A;  3C6P B;  1Z7X W;  5IJD A;  1IO0 A;  3E4G A;  4G8A A;  5GMH A;  3E6J A;  4M7E C;  3ZYI A;  1XCD A;  3G3B A;  4U06 A;  2WQU A;  4QXE A;  4LSX A;  3OGL B;  1XEC A;  2Z65 A;  1PGV A;  4FDW A;  4P91 A;  3WPF A;  4WYK A;  1KOO A;  4LXR A;  1XKU A;  2Z63 A;  3UL8 A;  3ZYO A;  3OGM B;  2XWT C;  1JL5 A;  5HZL B;  4OQT A;  1H6T A;  4FD0 A;  4PSJ A;  4C2A B;  2OMX A;  1H6U A;  5B0T A;  4CC4 A;  1FS2 A;  3OJA B;  4I6J B;  4LSC A;  1M9S A;  1G9U A;  4GLP A;  4R6F A;  4PKI G;  3G3A A;  3CIY A;  2P1P B;  5GMG A;  4PEQ B;  3RFJ A;  1O6S A;  2JQD A;  2WFH A;  3M19 A;  3SB4 A;  3C6O B;  4QBZ A;  1OTN A;  3VQ2 A;  4M7E A; 
#chains in the Genus database with same CATH topology
 4LSX C;  4R58 A;  1OOK G;  1LTX A;  3WPI A;  1W8A A;  3BZ5 A;  1U0N D;  4Z8G A;  3RW7 A;  1O6V A;  1OGQ A;  4R6J A;  4QC0 A;  5B0N A;  4K17 A;  4AY9 X;  1XEU A;  3W3N A;  3A79 B;  2Z7X A;  3RFE A;  3KJ4 A;  4XOS A;  4PER A;  4YEB B;  5AZ5 A;  4CC4 C;  5GS0 A;  4NKH A;  1M0Z A;  3UN9 A;  4CIL A;  3TSR E;  3UL9 A;  4V2C A;  4L3A A;  4ARN A;  2R9U A;  4Q62 A;  1OTO A;  3ZYN A;  1K5G C;  3GOZ A;  5CMP A;  4GT6 A;  4EZG A;  3WPE A;  2Y5Q A;  4FS7 A;  4CNC A;  3RIZ A;  5LFN A;  5GS2 B;  4FMZ A;  5IJB A;  3WPG A;  3WPB A;  4L3F A;  4U09 A;  2Z62 A;  1P9A G;  1O6T A;  2OMU A;  3E2J A;  3RJ0 A;  5AWA A;  1GWB A;  1WWL A;  2ID5 A;  5CMN A;  3DZE A;  1DFJ I;  2RR6 A;  5IYX C;  2Q4G W;  4MQW X;  1M10 B;  3W3M A;  4CP6 A;  2OMZ A;  2IFG A;  1FQV A;  1FT8 A;  3OGK B;  4PQ8 A;  4R0A A;  3ULU A;  4RCA B;  4V2D A;  4BSU A;  3O53 A;  4XSQ A;  4LI2 A;  1P8V A;  4R6G A;  4WP6 A;  5AWC A;  2P1M B;  3WPD A;  2Z7X B;  2V70 A;  4FCG A;  4P8S A;  2Z66 A;  3W3J A;  2AST B;  5A5C A;  4RWT C;  5B4P A;  4TZH A;  4C2B B;  4ECO A;  1SQ0 B;  4Z64 C;  2UZX A;  3OJA A;  2UZY A;  2BNH A;  3W3K A;  3JB9 j;  3RW6 A;  3ZYJ A;  3M18 A;  2O6S A;  1FO1 A;  4Y61 B;  4Z79 A;  3ULV A;  2JE1 A;  2Z82 A;  2CA6 A;  4XGO A;  2JE0 A;  3UL7 A;  5AWB A;  4NKG A;  4U08 A;  3WN4 A;  4LXS A;  2RA8 A;  2OMV A;  3FXI A;  4R09 A;  4RCW A;  1ZIW A;  2A0Z A;  2FT3 A;  4CNM A;  3P72 A;  2OMW A;  4FHO A;  4IM6 A;  1K5D C;  3PMH G;  5GQR K;  4B8C D;  4Q3I A;  2WQX A;  4MN8 B;  4KT1 A;  3ULA A;  1D0B A;  4UFR A;  2P1N B;  2O6R A;  2OMY A;  1OZN A;  4NZT M;  1DCE A;  4KNG A;  4Q3G A;  4ARR A;  4AW4 A;  1A4Y A;  2V9S A;  1KOH A;  3W3L A;  1QYY A;  2WQV A;  2P1Q B;  4LSA A;  4V2E A;  3RFS A;  4Z94 G;  3RGX A;  1OTM A;  1A9N A;  3VQ1 A;  5AWD A;  2O6Q A;  3WPC A;  2Z64 A;  4LI1 A;  5D3I A;  3RGZ A;  2WQW A;  1P8T A;  3CIG A;  2V9T B;  2ASS B;  3REZ A;  1XWD C;  2P1O B;  3WPH A;  2BEX A;  4KXF B;  3CVR A;  4H09 A;  3G39 A;  5IJC A;  5FTT B;  3E3Z A;  3G06 A;  2XOT A;  4R5C A;  4J0M A;  4R07 A;  4J4L A;  2ELL A;  3G04 C;  3W3G A;  4BSS A;  4Z61 C;  1DS9 A;  2OMT A;  3C6N B;  4ECN A;  4R6A A;  1M9L A;  2Z81 A;  4BSR A;  4HQ1 A;  1YRG A;  5GMF A;  4R5D A;  5HDH A;  3O6N A;  4R08 A;  4BV4 R;  4U7L A;  3C6P B;  1Z7X W;  5IJD A;  1IO0 A;  3E4G A;  4G8A A;  5GMH A;  3E6J A;  4M7E C;  3ZYI A;  1XCD A;  3G3B A;  4U06 A;  2WQU A;  4QXE A;  4LSX A;  3OGL B;  1XEC A;  2Z65 A;  1PGV A;  4FDW A;  4P91 A;  3WPF A;  4WYK A;  1KOO A;  4LXR A;  1XKU A;  2Z63 A;  3UL8 A;  3ZYO A;  3OGM B;  2XWT C;  1JL5 A;  5HZL B;  4OQT A;  1H6T A;  4FD0 A;  4PSJ A;  4C2A B;  2OMX A;  1H6U A;  5B0T A;  4CC4 A;  1FS2 A;  3OJA B;  4NZR M;  4I6J B;  4LSC A;  1M9S A;  1G9U A;  4GLP A;  4R6F A;  4PKI G;  3G3A A;  3CIY A;  2P1P B;  5GMG A;  4PEQ B;  3RFJ A;  1O6S A;  2JQD A;  2WFH A;  3M19 A;  3SB4 A;  3C6O B;  4QBZ A;  1OTN A;  3VQ2 A;  4M7E A; 
#chains in the Genus database with same CATH homology
 4LSX C;  4R58 A;  1OOK G;  1LTX A;  3WPI A;  1W8A A;  3BZ5 A;  1U0N D;  4Z8G A;  3RW7 A;  1O6V A;  1OGQ A;  4R6J A;  4QC0 A;  5B0N A;  4K17 A;  4AY9 X;  1XEU A;  3W3N A;  3A79 B;  2Z7X A;  3RFE A;  3KJ4 A;  4XOS A;  4PER A;  4YEB B;  5AZ5 A;  4CC4 C;  5GS0 A;  4NKH A;  1M0Z A;  3UN9 A;  4CIL A;  3TSR E;  3UL9 A;  4V2C A;  4L3A A;  4ARN A;  2R9U A;  4Q62 A;  1OTO A;  3ZYN A;  1K5G C;  3GOZ A;  5CMP A;  4GT6 A;  4EZG A;  3WPE A;  2Y5Q A;  4FS7 A;  4CNC A;  3RIZ A;  5LFN A;  5GS2 B;  4FMZ A;  5IJB A;  3WPG A;  3WPB A;  4L3F A;  4U09 A;  2Z62 A;  1P9A G;  1O6T A;  2OMU A;  3E2J A;  3RJ0 A;  5AWA A;  1GWB A;  1WWL A;  2ID5 A;  5CMN A;  3DZE A;  1DFJ I;  2RR6 A;  5IYX C;  2Q4G W;  4MQW X;  1M10 B;  3W3M A;  4CP6 A;  2OMZ A;  2IFG A;  1FQV A;  1FT8 A;  3OGK B;  4PQ8 A;  4R0A A;  3ULU A;  4RCA B;  4V2D A;  4BSU A;  3O53 A;  4XSQ A;  4LI2 A;  1P8V A;  4R6G A;  4WP6 A;  5AWC A;  2P1M B;  3WPD A;  2Z7X B;  2V70 A;  4FCG A;  4P8S A;  2Z66 A;  3W3J A;  2AST B;  5A5C A;  4RWT C;  5B4P A;  4TZH A;  4C2B B;  4ECO A;  1SQ0 B;  4Z64 C;  2UZX A;  3OJA A;  2UZY A;  2BNH A;  3W3K A;  3JB9 j;  3RW6 A;  3ZYJ A;  3M18 A;  2O6S A;  1FO1 A;  4Y61 B;  4Z79 A;  3ULV A;  2JE1 A;  2Z82 A;  2CA6 A;  4XGO A;  2JE0 A;  3UL7 A;  5AWB A;  4NKG A;  4U08 A;  3WN4 A;  4LXS A;  2RA8 A;  2OMV A;  3FXI A;  4R09 A;  4RCW A;  1ZIW A;  2A0Z A;  2FT3 A;  4CNM A;  3P72 A;  2OMW A;  4FHO A;  4IM6 A;  1K5D C;  3PMH G;  5GQR K;  4B8C D;  4Q3I A;  2WQX A;  4MN8 B;  4KT1 A;  3ULA A;  1D0B A;  4UFR A;  2P1N B;  2O6R A;  2OMY A;  1OZN A;  1DCE A;  4KNG A;  4Q3G A;  4ARR A;  4AW4 A;  1A4Y A;  2V9S A;  1KOH A;  3W3L A;  1QYY A;  2WQV A;  2P1Q B;  4LSA A;  4V2E A;  3RFS A;  4Z94 G;  3RGX A;  1OTM A;  1A9N A;  3VQ1 A;  5AWD A;  2O6Q A;  3WPC A;  2Z64 A;  4LI1 A;  5D3I A;  3RGZ A;  2WQW A;  1P8T A;  3CIG A;  2V9T B;  2ASS B;  3REZ A;  1XWD C;  2P1O B;  3WPH A;  2BEX A;  4KXF B;  3CVR A;  4H09 A;  3G39 A;  5IJC A;  5FTT B;  3E3Z A;  3G06 A;  2XOT A;  4R5C A;  4J0M A;  4R07 A;  4J4L A;  2ELL A;  3G04 C;  3W3G A;  4BSS A;  4Z61 C;  1DS9 A;  2OMT A;  3C6N B;  4ECN A;  4R6A A;  1M9L A;  2Z81 A;  4BSR A;  4HQ1 A;  1YRG A;  5GMF A;  4R5D A;  5HDH A;  3O6N A;  4R08 A;  4BV4 R;  4U7L A;  3C6P B;  1Z7X W;  5IJD A;  1IO0 A;  3E4G A;  4G8A A;  5GMH A;  3E6J A;  4M7E C;  3ZYI A;  1XCD A;  3G3B A;  4U06 A;  2WQU A;  4QXE A;  4LSX A;  3OGL B;  1XEC A;  2Z65 A;  1PGV A;  4FDW A;  4P91 A;  3WPF A;  4WYK A;  1KOO A;  4LXR A;  1XKU A;  2Z63 A;  3UL8 A;  3ZYO A;  3OGM B;  2XWT C;  1JL5 A;  5HZL B;  4OQT A;  1H6T A;  4FD0 A;  4PSJ A;  4C2A B;  2OMX A;  1H6U A;  5B0T A;  4CC4 A;  1FS2 A;  3OJA B;  4I6J B;  4LSC A;  1M9S A;  1G9U A;  4GLP A;  4R6F A;  4PKI G;  3G3A A;  3CIY A;  2P1P B;  5GMG A;  4PEQ B;  3RFJ A;  1O6S A;  2JQD A;  2WFH A;  3M19 A;  3SB4 A;  3C6O B;  4QBZ A;  1OTN A;  3VQ2 A;  4M7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...