5CMYA

Crystal structure of yeast ent5 n-terminal domain-native
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
158
structure length
142
Chain Sequence
EPYQIDIRRATNTDAWGPTPKHLAKVLRNRYQVPLYLMTEYTLKRLVDHINYGSEWRVVLKCLVVIEFLLLNVDTGDELNQIRSCLLTHKHILTREIAQFKVKFSNDGKMEIHERGIRKKGELILQYLEDSQFLKKERAKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insight into the N-terminal domain of the clathrin adaptor Ent5 from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Protein transport
molecule keywords Epsin-5
total genus 59
structure length 142
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5cmyA00
1DVPA 3G2WA 2DIWA 3D9KA 5CMYA 1VDYA 3D9JA 3ZYLA 4GZCA 4JXTA 2L0TB 1JWFA 3D9IA 5LP0A 3ZYKA 1X5BA 1JWGA 3D9LA 3D9MA 3D9NA 4GZDA 3G2UA 1ELKA 2KM4A 3LDZA 2L0IA 2MOWA 4FLBA 2BF0X 3CLJA 1HF8A 1SZ9A 3G2SA 1JPLA 3G2TA 3ONLA 5J08A 1EYHA 1H0AA 1JUQA 4NACA 4Q96A 1XGWA 1UJJA 1PY1A 3D9PA 3ONKA 4HFGA 3G2VA 3RRUA 1SZAA 4FU3A 3ZYMA 2DCPA 1INZA 2V8SE 1EDUA 5LOZA 3ZYQA 1HX8A 1LF8A 1MHQA 4AVXA 5CMWA 1HG5A 4Q94A 1HG2A 2LO6A 1UJKA 2QY7A 1HFAA 3D9OA
chains in the Genus database with same CATH superfamily
5KWDA 2XEEA 3FTYA 4WNGA 3LVRE 2RFAA 2IO3C 2AVPA 2OVBA 4IRUA 5ENNA 3KAEA 3AS5A 4I1MA 4XEIG 1N52A 3FTVA 4U7EB 5AAOA 4B89A 4LEUA 4GTQA 3R7QA 2J9QA 4JHRA 2PNNA 3U66A 4UQZA 4GTTA 2XPZA 3DEPA 4GYWA 4PH4B 4EQFA 4BX8A 4UWKA 3DWLG 2XS1A 5E76A 3ZHEB 4AM9A 4J8FA 1U3DA 1EPUA 4WNDA 1NL4A 3KD7A 4FULA 3URZA 5CRUA 2AW6A 1S70B 3ASFA 4UWFA 2IOSA 2P9KG 2Y0BG 3MKQA 2H6HA 3DSTA 4CDRA 5FZSA 4G26A 3DXMG 2GGFA 5AENA 2XZDG 4G8LA 5FT9A 5D0OD 3R9AB 1ZBPA 4Q94A 1UJKA 4JEHA 4PUCA 4A1GA 2L0TB 4UWLA 3ZRHA 4HVBA 2X6KA 1FCHA 3SI5A 4U8VD 5HKPA 4U0UA 1H2UA 3ABME 3EDTB 3APFA 5FQ4A 4ME2A 3KEZA 4AV7A 1N95A 2KZTB 2RG8A 3Q5MA 2WB2A 2P9UG 2Y3AA 3D9LA 4WWNA 2KCKA 4I6JA 1TYQG 2ETAA 3AS8A 3AG3E 3MA5A 3ZPJA 1Y6IA 3AAAC 1QBQA 3LJNA 5AQAA 2VSNA 4DUIA 5T4YA 5CCMA 2GROB 3NZSA 4JW1A 1N11A 3BUAA 1H6KA 2IF4A 5G04J 5BUZA 3LS8A 2QYJA 1INZA 2PM6A 2OCCE 2HM8A 4NURA 3LY7A 1TEZA 3QOUA 1E7UA 3ZYLA 3D3MA 4BERA 3T8MA 2XGSA 5CECB 1WG0A 3HYMB 2XRYA 4PS3A 4OAVB 1JCQA 3LXUX 3APCA 2CFUA 4ILHB 2C2LA 4BEPA 4MRUA 2WQ6A 3AG2E 3G2UA 2IO2C 3V79K 4HXIA 4TRQA 4Q69A 4B94A 2WXPA 2CHZA 2WXJA 3APDA 2VTBB 5T3RA 2XRZA 1V54E 4U07A 3L17A 3FU5A 1E8WA 2PQNA 3FUDA 1H19A 4GYYA 3JQ1A 2YNQA 4AIFA 2KXPC 1EYHA 3U64A 4F53A 2V8SE 4P29A 3UM0A 4AXHA 3NOCD 3L6AA 1RZ4A 1U3CA 3TG4A 4J0UA 4UQYA 4HNAD 5EYLA 3QWPA 4FU3A 2RKKA 4J8SA 3W9GA 3ENEA 2IONA 3I4GA 1SW6A 3SBTB 3CVXA 4HI9A 4K5BA 4LCTA 1UN8A 3FTUA 3UMVA 3TJPA 1OWOA 3HXDA 2VGXB 2FI7A 3UIPC 3LY9A 3MV2B 4BFRA 3PZDA 3G2TA 2WQ7A 2EILE 4CZ2D 2LXMA 2DYRE 2V5FA 3P2BA 3AG4E 1QZ2A 3CHRA 3ZKJA 2DVWA 2F37A 3FH5A 4ANVA 1SQMA 4BX9A 2J4BA 1HU3A 1OCOE 3CHSA 3L13A 2L0IA 2MHKA 4J8DA 4HOTA 3IBEA 4ATGA 2IFUA 1XGWA 1PAQA 2LNIA 3LY8A 2Y4TA 1SZAA 4A55A 3E32A 4F1PA 3GZSA 2QZAA 3TXMA 5CMWA 3MEKA 4I1OB 1JCRA 1LD8A 4I1AA 3D9OA 3E30A 4MLPA 4LNBA 3JYSA 3LEWA 3GYZA 3R7RA 3B7BA 3CVNA 3EIJA 1TJFA 2VQ2A 3DSXA 3GW4A 2VGEA 3VLEA 3PRZA 4PDXA 5G05J 3E34A 2F8XK 3CEQA 4U04A 1TN8A 4HS2A 3T5VA 2R2LA 4L7TA 3T9KA 4B8AA 4H7YA 4D10C 3D9HA 3TWRA 1IHBA 4WWPA 4GA1A 2DZOA 4HQDA 5A23A 4CDNA 4L2YA 3LJ3A 2VTBA 5D66A 4JHJA 2A5EA 5ENPD 2KCLA 5CEAA 3PREA 3ZU7B 2X6FA 3HXCA 3LYAA 3CVLA 4CT4A 4CGVA 2J4DA 4GA2A 2X6HA 3QWWA 3E4BA 3FH8A 2C0LA 3TWXA 5KJNA 3CVUA 3VTYA 5EIDA 3O4ZA 1Q2ZA 3QWVA 3JQ0A 3TL5A 5LCWC 2OVFA 2WQHA 2X3MA 3HXFA 3Q79A 3PE4A 3ONLA 4Q96A 4LERA 4U0SA 4L23A 1OWPA 4ZFHA 3J5PA 3ZYQA 3RAUA 2L6JA 3DPDA 3E33A 1OY3D 4BWRA 4A3TA 3FUJA 4DRXE 4ILIA 4K03A 4RQIA 4K5CA 3EHQA 2BKGA 4N3CA 4XIFA 4JZYA 4PS7A 3CVYA 4MBGA 3FU3A 1KZPA 3CV0A 4F3VA 2EIJE 2ETBA 2KATA 4U96D 1JWFA 4GU5A 2X38A 2ZXWE 3CK8A 1YA0A 3Q9UC 1BLXB 1TN6A 2ETCA 4GPKA 2OV8A 4HORA 2L9BA 4APOA 2F0YA 2EQXA 2GRNB 3PH0C 3QDNA 2I9CA 1N4SA 4J7WA 4DX5D 4UUCA 4WWOA 1NZNA 3FEYA 1S0PA 4A1SA 3RU0A 5DIZA 3ML9A 1SA5A 1UJJA 3U3WA 3CQGB 4MKTA 3OXGA 5HRYA 1MHQA 2NXPA 5FQ6A 1S63A 1NP7A 4G24A 5JJTA 1BI7B 3AU4A 1OWMA 4GMLA 4AEZC 2KC7A 4GZDA 3UT4A 3O48A 3QAQA 4U8YD 3C72A 3DPYA 5BNWA 2WXOA 3ZVVA 3T8KA 4DLOA 4RVBA 5CERB 1UOHA 3RJVA 1XNFA 3ABKE 4GTPA 3ZXPA 1SVXA 4GTOA 1HZ4A 1UW4B 3HVEA 3SGHA 4FLBA 4GPMA 4DX2A 3DSUA 2XCCA 1WY6A 3PZ4A 2HO1A 3ZGQA 3DXKG 2XGOA 1TNBA 3CVWA 5CMYA 2WXQA 3FH7A 3PZ2A 5G55A 3TWUA 3RSEG 5EX3A 3V30A 1O5MA 2RFMA 3JUIA 3UINC 4BETA 3IKOB 3GZ2A 4HFGA 1O1TA 1Z5SC 2IOLA 3BQOA 4TXPA 2LO6A 3CGHA 3CHQA 5FJYA 5FQ7A 4EZJA 5B3SE 1TR4A 5IY5E 3ZYKA 5E75A 5BW8C 2CHXA 2UWJG 2H6IA 2FEZA 3ZNGA 1BU9A 4JC8A 5ARGA 2GW1A 5C2YA 4LRZA 1EDUA 4DX6D 4AY5A 1Z3XA 4ABNA 1DC2A 4BESA 1MJ0A 2FO7A 3KS2A 3ZHEA 2DZNA 1N0RA 3CQCB 4KZ0A 1MX2A 4HI8A 5BXOA 4TUUA 3RO2A 4RG6A 2ZGDA 4TXQA 5J90A 3I5PA 2P9PG 4WAFA 3FU0A 2EIME 3ZUVB 4CDMA 3HG0D 4RLYA 3ESKA 1E8YA 4YNDA 1H0AA 4C48B 4B0ZA 4YDEA 3IXEA 3AJIA 1WM5A 5EIBE 2ILRA 4GYOA 5B1AE 3CHOA 2F8YA 3G2SA 3ASHA 3L08A 5HQ8A 5KJLA 2CHWA 2X6JA 4HRMB 2IU1A 3ZEFA 2DBAA 4A3VA 4O60A 4QQIA 2AJAA 5CRVA 4G8KA 3NZUA 4BSZB 3MX3A 3Q7AA 2ZISA 4BTBA 5HI7A 1IYGA 2JABA 1ELKA 4N3AA 3EIQC 3AG1E 1SA4A 4M7CA 2WXLA 2R03A 2B6CA 5ANRA 1IKND 3UTMA 1FT1A 1DVPA 2J08A 4Y6CA 5AQBA 3QJZA 1D8DA 3C5RA 2GRMA 1MYOA 5J08A 3C98A 3TXNA 5EX0A 2WM9A 3RRNB 5JHBA 3SZ7A 3EUVA 4EHMA 2LSUA 1L5JA 1O1SA 4KXKB 3ISMC 2XPYA 5CBNA 4KVOA 4KMOA 3UIOC 3UM1A 2BEDA 3Q4AB 4GCNA 4TXRA 4CCAA 1H2VC 5CEDB 3OXFA 5FZQA 2WVIA 2AWIA 3BU8A 1IQUA 4A63B 3NBNB 4YVOA 2H6FA 1A17A 4UWGA 2HR2A 1N0QA 1WDYA 2WXIA 5AQ7A 2E2EA 3FEXA 2H6GA 3PUKA 3TWQA 1RW2A 1FVHA 5AARA 4IN3B 3JUEA 2C0MA 3DSWA 4I2WA 2R17C 3FUEA 4XKBA 1MX4A 4GZ5A 1PY1A 5DBKA 1HE8A 3DSSA 4KZCA 4JD2G 2P58C 3HHMA 4UQXA 3CSTA 4FP7A 3SD5A 4ANUA 3CVPA 4ATZD 3ULEG 3R9MA 4WNFA 1DNPA 3FTXA 3DBSA 3BG0B 3FULA 4O6FA 3TWVA 1E7VA 3AU5A 3PEVB 5AJDA 5D2MC 4GMJA 1YMPA 2YHEA 3UKRG 1MX6A 2A5UA 3CHPA 3HRAA 3S7JA 1HH8A 5ITZF 3U9WA 1AWCB 3S2AA 3LDZA 3Q73A 4G11A 4GMRA 5A6CA 4URKA 1SZ9A 3SBSA 1JUQA 1ZU2A 5AJLA 3IHVA 3ULQA 3QC1A 3FTWA 3MJWA 4GZCA 4Y6WA 4HLLA 4YDOA 5CCLA 4LG6A 4GTVA 4G23A 3RO3A 2FULA 4F1SA 2L6BA 3FUKA 1HX8A 1N9AA 3QNKA 4CEMA 2ZIRA 3T5XA 4AY6A 5FINA 2VJ8A 2V0PA 3Q78A 4GB9A 4FC8A 1KPSB 1H6PA 4IYPA 1E8ZA 4FADA 2R59A 2XCBA 5JJ6A 3B7TA 4MS6A 1JCSA 1MQSA 2I1JA 2KCVA 3W9FA 5KNGA 5JHAA 4I6EA 2YINA 2PQRA 4BY6A 3ZIMA 3LPZA 4JA9A 3DSVA 4FA6A 3HXEA 1HFAA 4OYSA 1B89A 2CFZA 2RD0A 4E6HA 3UI2A 3DEOA 2EINE 5LP0A 2V4HC 4DX7D 1X5BA 4HLEA 2IY0C 1K1BA 4ANWA 3JXJA 5D0QD 2VYIA 2XEHA 2BF0X 3CK7A 4C0EA 3FU6A 5ANLA 3CIAA 1D9SA 1IHGA 2BTDA 3ASDA 4G25A 4CRWA 1AP7A 1YYHA 3DRAA 2GRRB 2XHEA 3QARA 2NSZA 4ZHBA 3V2XA 2JEKA 1QYMA 2P9SG 2R05A 3VTXA 5ENQD 3SFYA 2LXLA 3JXIA 2KZTA 3SO8A 4BTAA 2R02A 3K9IA 2HYZA 3EU9A 4HOQA 5ENOD 2XZTG 3CVQA 4OVUA 3ZW3A 5FWQA 1N94A 3ASNE 3IV0A 3WG7E 2FBNA 4HB5A 3F6QA 2PZIA 3HXBA 2AXUA 4XX5A 2XENA 4GZ6A 3B7RL 3OTNA 3PZ3A 2MOWA 4FJYA 1OCRE 4DPRA 3RRUA 4QFVA 4GTMA 3B95A 3I3NA 3ASGA 2CG2A 1DCQA 3VLDA 4G1TA 4TUMA 1PC2A 4KVMA 4APFA 2Y1LE 3NF1A 3S7BA 4XE0A 4XI0A 4N2QA 4C0MA 4BT8A 5BV0A 1K8KG 3TG5A 5JMND 4NRHB 2IQCA 1G3NB 1HF8A 5LCWJ 4K5AB 2XQ0A 2NYJA 5AQ9A 1ELWA 2GRQB 4I9CA 3Q75A 5EKQD 1KLXA 4O1OA 3PUJA 4LSZE 2AXVA 2FF4A 3V31A 4LUNU 2P9IG 4J8EA 2DIWA 1FVFA 2OEWA 3UXGA 5AYWD 1HO8A 4EZKA 4FHJA 3FUMA 3KSQA 1S64A 2VSXE 3D9NA 5ENTD 3ML8A 4G2VA 3TAXA 2LAIA 1U2VG 3LVQE 3FUHA 4KBQA 3Q15A 4FLHA 5BPPA 2V4LA 4JEUA 4EBAA 2LUHA 3PS6A 2WXFA 2J8SD 3G2WA 1TNZA 3IHYA 1HS6A 1NA0A 3WXXA 1BPOA 3HIZA 3FUNA 1IQRA 3HVEB 5ARFA 3L54A 3PVLA 1NI1A 5FIOA 3S7DA 1KT0A 4JA7A 3D9PA 2DCPA 2OOEA 5G04C 5G05C 4J6IA 2OEVA 1ELRA 1LTXA 1EF1C 2IEJA 5FZRA 3V2OA 1Y8MA 3UKUG 3ZN3A 1VDYA 4F6RD 3UX4A 1NFIE 3ESLA 2P9NG 4AP2A 5H7PA 3MZLB 2B0OE 4J8YA 3MV3B 3FTZA 1OWLA 2QC9A 3SQVA 2XEVA 1OCZE 4HOUA 2VGYA 2ONDA 3EU5A 3QK0A 1E96B 3PNTB 2IJGX 3UT8A 3L22A 1FT2A 2V5QC 4L9PA 1A5EA 3L82A 1O1RA 3QB2A 3OXLA 4WNEA 4DK5A 1N4QA 1OUVA 3PE3A 3UM3A 3RIBA 3LKUA 4JXTA 1E8XA 1IXVA 2Q7FA 3Q7FA 4U8HA 4OAUC 3MCXA 3TGOA 4DJAA 1OT8A 3NAWA 1MZCA 3MKRA 4XKCA 4DLQA 3UT7A 4IULA 3SHFA 3D9MA 1UN9A 4OVVA 4RG9A 3CLJA 3CR3A 2UY1A 2GRPB 5CHEE 2NC9A 2ZU6B 5EN5D 2LAHA 3HDXA 2HE0A 1N4RA 3TWWA 2AXZA 5FQ8A 1TNUA 2A4ZA 3B7SA 1H2TC 3CVVA 1OCCE 4GCOA 3SY2A 3ZYMA 4N39A 4HRLA 3FY4A 4C9BB 5A7DB 2DYSE 3UUXA 2VGXA 3ZFWA 2X6IA 1QQEA 2Y4UA 2J09A 3SFXA 3E37A 2WMNA 4Z68A 3FWVA 4WUYA 4B8CB 2KBXA 4F7AA 5T8IA 2MYOA 1HG2A 3MYVA 1P5QA 3C3QA 3RRMB 2WXNA 1YCSB 4EECA 1K3ZD 4YDYA 3NOGD 5HS0A 4HRNA 4U63A 4V3IA 3KSLA 1V55E 3I4RB 4EZLA 4N5CA 5B1BE 3ZXSA 4FJZA 3KEAA 3CKBA 1FPPA 3EHRA 1HG5A 4GZ3A 2MRIA 5G2NA 4UI9C 2WXMA 2I6HA 4FHKA 2VSYA 1JWGA 4RSYA 3Q49B 3CKCA 2XGMA 4ACKA 4BT9A 1KZOA 4JHKA 4EBAG 2BKKB 4UWHA 3ULYA 5LFAA 5LOZA 1DCEA 5ENSD 4K0RA 2YHCA 3CK9A 3GZ1A 3NB2A 4CYMD 3EHNA 5M72A 5FTPA 3PEUB 3LCAA 5KJMA 2P2CP 3UM2A 4GAAA 1E90A 3BG1B 1N54A 4GTSA 3FDHA 4YVQC 3AS4A 2XPIA 3EHMA 4I6GA 1N4PA 2I2OA 4KYOB 4CGWA 5EDSA 4I2ZA 3UPVA 1Z3YA 4LNUD 5BT1A 3FFLA 4TV3A 3MGBA 5CBOA 2QFCA 1X81A 4E85A 4N5QA 3SF4A 2XS8A 1QNFA 1KT1A 1H6OA 3SFZA 4JL0A 4N2SA 2WPVA 3X2QE 3EJNA 3FP3A 1BD8A 2UY1B 4XI9A 3BEEA 3JCKC 3B7UX 1ZB1A 4LNGA 3D9JA 4L1BA 4DI4A 5KCMA 4NIKA 4R7LA 3D9IA 3FTSA 4AOFA 4NQ0A 2YQ8A 2WXRA 3OAWA 3S7FA 2QYUA 1W3BA 1K1AA 4XZ4A 1HXIA 4GTRA 4U95D 3PNLB 4JVSA 4AVXA 3FHEA 2J07A 3L9TA 3QKYA 1TNOA 3J5QB 2EIKE 3ABLE 3Q47B 4M3OA 3CSFA 2PL2A 4I17A 5JJ7A 2LSVA 3ONKA 4H7XA 2DWZA 3PZ1A 3IEGA 4HBDA 5EYPF 1UG3A 3FUIA 3N71A 4W9RA 1TN7A 1WAO1 2R5SA 4B93B 1GW6A 5KJKA 3ASOE 1Z6TA 1NA3A 4L2LA 2E0IA 3FUFA 4O1PA 5AIJA 2I1KA 2WMOA 3C3RA 3P1UA 4ILGA 3C3OA 4HOSA 4ACLA 4I43A 2J49A 2WXKA 4CT0A 4BSXA 1D8EA 1LD7A 3TWTA 3U4TA 2BUGA 2QY7A 4JB8P 4GA0A 3D9KA 1OWNA 5AN8A 2KM4A 3MKQB 3CHMA 3RK6A 1BI8B 4DX1A 2Y69E 4NACA 4JPSA 4X8QA 4KT6B 1LF8A 3PDNA 2VSOE 4PS8A 5ENRD 3SNXA 1OXJA 4AJWA 1TNYA 1TJCA 3B13A 5KNHD 1JPLA 5EILA 2P9LG 2FO1E 4I9EA 3G2VA 2CG3A 3RKVA 4YDWA 2JLBA 2M63A 2GRLA 5LX8A 2WXHA 4DI3A 5BXUA 3UQ3A 5BV1A 4UI9J 4UI9K 3TWSA 4EPZA 3VLFA 2ZGGA 3NQPA 5JA4D 3Q9NC 5KBAA 5C1DA 2PM7A 4ANXA 4U0ZA 4N3BA 3L16A 2WXGA
chains in the Genus database with same CATH topology
3LKUA 3PREA 2X6FA 1FVHA 4JXTA 3LYAA 4IN3B 3CVLA 1E8XA 4CT4A 4CGVA 2J4DA 4GA2A 2X6HA 2C0MA 2Q7FA 3QWWA 4U8HA 3E4BA 4I2WA 2R17C 3FH8A 2C0LA 3FUEA 3FTYA 5KJNA 4XKBA 3CVUA 4WNGA 3MCXA 3LVRE 3VTYA 4GZ5A 3TGOA 4DJAA 1PY1A 5DBKA 2AVPA 2OVBA 3MKRA 3O4ZA 1HE8A 3QWVA 4IRUA 3JQ0A 5ENNA 3KAEA 3AS5A 4XKCA 4KZCA 3TL5A 4I1MA 4DLQA 5LCWC 2P58C 2OVFA 3UT7A 2WQHA 3HHMA 1N52A 4IULA 2X3MA 4UQXA 3SHFA 3FTVA 3CSTA 4FP7A 3D9MA 1UN9A 3PE4A 4OVVA 3SD5A 4B89A 4LEUA 4ANUA 4RG9A 3CVPA 3CLJA 4WNFA 1DNPA 3ONLA 3CR3A 2UY1A 3FTXA 4Q96A 3DBSA 5CHEE 2NC9A 2ZU6B 4LERA 3BG0B 3FULA 4L23A 4U0SA 3R7QA 2J9QA 1OWPA 2LAHA 3HDXA 4JHRA 1E7VA 4O6FA 3AU5A 3PEVB 5AJDA 3ZYQA 3U66A 4GMJA 4UQZA 2AXZA 2L6JA 2YHEA 3DPDA 2A5UA 2XPZA 3CHPA 5FQ8A 3S7JA 1HH8A 4BWRA 4A3TA 4GYWA 2A4ZA 3U9WA 3FUJA 3B7SA 4ILIA 4PH4B 1H2TC 4K03A 3S2AA 3LDZA 4G11A 4EQFA 4BX8A 4UWKA 5A6CA 4URKA 1SZ9A 3SBSA 3CVVA 4N3CA 1JUQA 1ZU2A 4XIFA 5E76A 3ZHEB 5AJLA 4GCOA 4JZYA 3ZYMA 4AM9A 4PS7A 4J8FA 3IHVA 3CVYA 1U3DA 1EPUA 4N39A 3ULQA 3QC1A 4WNDA 4C9BB 3FY4A 5A7DB 3KD7A 3FU3A 3UUXA 3FTWA 4FULA 3CV0A 3URZA 2VGXA 3ZFWA 2X6IA 1QQEA 2AW6A 3MJWA 4F3VA 4GZCA 3ASFA 2KATA 4UWFA 1JWFA 4GU5A 2Y4UA 2IOSA 2J09A 2X38A 3MKQA 4Y6WA 2WMNA 3FWVA 3CK8A 4CDRA 1YA0A 5FZSA 4WUYA 4G26A 5CCLA 4B8CB 4GPKA 2OV8A 4HORA 2GGFA 2L9BA 4G23A 3RO3A 2FULA 5AENA 4F1SA 4APOA 5FT9A 5D0OD 3R9AB 3FUKA 1HX8A 1ZBPA 4F7AA 4Q94A 5T8IA 3QNKA 4CEMA 2EQXA 1HG2A 3PH0C 3MYVA 1P5QA 1UJKA 3T5XA 4AY6A 2VJ8A 3RRMB 2WXNA 3QDNA 2V0PA 2I9CA 4JEHA 4EECA 4PUCA 4A1GA 2L0TB 4GB9A 4UWLA 3ZRHA 4HVBA 2X6KA 4WWOA 4FC8A 1FCHA 1NZNA 3FEYA 3SI5A 4IYPA 4U63A 1S0PA 4V3IA 1E8ZA 4A1SA 4FADA 2R59A 2XCBA 4U0UA 3ML9A 5DIZA 1H2UA 3I4RB 3RU0A 5JJ6A 1UJJA 3U3WA 3EDTB 3APFA 4EZLA 4N5CA 5FQ4A 3CQGB 4ME2A 3ZXSA 3KEZA 4FJZA 3OXGA 4MKTA 4AV7A 3CKBA 1MHQA 2NXPA 4GZ3A 1HG5A 3B7TA 2KZTB 4MS6A 2MRIA 5G2NA 5FQ6A 1MQSA 1NP7A 4G24A 4UI9C 2RG8A 5JJTA 3Q5MA 3AU4A 2WXMA 2I6HA 4FHKA 2VSYA 2WB2A 1OWMA 4GMLA 4AEZC 2I1JA 2Y3AA 2KCVA 1JWGA 4RSYA 3D9LA 4WWNA 2KCKA 2KC7A 4GZDA 3Q49B 3UT4A 5JHAA 3O48A 3QAQA 4I6EA 2YINA 4I6JA 2PQRA 4BY6A 3AS8A 3CKCA 2XGMA 3MA5A 4ACKA 2WXOA 3ZVVA 3ZPJA 4BT9A 4JHKA 5BNWA 1Y6IA 4EBAG 4UWHA 5LFAA 3ZIMA 3LPZA 5LOZA 4JA9A 4FA6A 4DLOA 4K0RA 2YHCA 2VSNA 1HFAA 3CK9A 4OYSA 4RVBA 1B89A 2CFZA 2RD0A 3GZ1A 5T4YA 3RJVA 1XNFA 4E6HA 5CCMA 3NZSA 4JW1A 5LP0A 1X5BA 4HLEA 3EHNA 5M72A 1H6KA 1HZ4A 4ANWA 1UW4B 2IF4A 3HVEA 5FTPA 5G04J 4FLBA 2VYIA 5D0QD 3SGHA 2BF0X 5BUZA 3CK7A 4C0EA 3FU6A 3LS8A 3PEUB 3LCAA 5KJMA 2XCCA 1INZA 5ANLA 2PM6A 4GAAA 3CIAA 1E90A 1IHGA 1WY6A 2BTDA 3BG1B 1N54A 2HO1A 3ZGQA 2XGOA 2HM8A 3PUKA 4NURA 3ASDA 3LY7A 4G25A 4CRWA 3CVWA 1TEZA 5CMYA 2WXQA 3FH7A 3QOUA 1E7UA 5G55A 3ZYLA 3FDHA 3D3MA 5EX3A 4YVQC 3AS4A 2XPIA 2XHEA 3QARA 2NSZA 3EHMA 3JUIA 4I6GA 3T8MA 2JEKA 2XGSA 3IKOB 2I2OA 4KYOB 4CGWA 5EDSA 3GZ2A 3HYMB 4I2ZA 4HFGA 2XRYA 4PS3A 3UPVA 1Z3YA 3VTXA 2IOLA 5BT1A 3FFLA 2KZTA 2LO6A 4TV3A 2WXGA 3MGBA 3CHQA 3CGHA 5FJYA 5FQ7A 3LXUX 4BTAA 4EZJA 3K9IA 3APCA 2HYZA 2QFCA 2CFUA 4ILHB 2C2LA 3ZYKA 4HOQA 5E75A 2CHXA 2UWJG 4MRUA 5BW8C 4E85A 2WQ6A 2FEZA 3G2UA 3SF4A 1QNFA 1KT1A 3CVQA 4OVUA 4JL0A 3SFZA 4JC8A 3ZW3A 5FWQA 4N2SA 5ARGA 2GW1A 2WPVA 4HXIA 5C2YA 4TRQA 4Q69A 3IV0A 3EJNA 3FP3A 4B94A 4LRZA 1EDUA 2UY1B 2WXPA 4XI9A 2CHZA 2FBNA 2WXJA 4AY5A 3APDA 2PZIA 1Z3XA 3BEEA 4ABNA 3JCKC 2VTBB 5T3RA 3B7UX 2XRZA 2AXUA 4XX5A 3D9JA 4L1BA 2FO7A 4U07A 5KCMA 4R7LA 4GZ6A 3B7RL 3D9IA 3L17A 4DI4A 3KS2A 3ZHEA 3FTSA 4AOFA 4NQ0A 2YQ8A 2WXRA 3FU5A 3OAWA 1E8WA 2PQNA 3FUDA 1H19A 4GYYA 3S7FA 3CQCB 3OTNA 4KZ0A 2MOWA 2YNQA 3JQ1A 4FJYA 1W3BA 4AIFA 4TUUA 3RO2A 4RG6A 1EYHA 4XZ4A 1HXIA 3U64A 4DPRA 4F53A 3RRUA 3PNLB 4QFVA 4JVSA 5J90A 2V8SE 3I5PA 3I3NA 4AVXA 3FHEA 4P29A 4WAFA 3FU0A 2J07A 3ASGA 2CG2A 3QKYA 4AXHA 4CDMA 3VLDA 3L6AA 3Q47B 4M3OA 4G1TA 1U3CA 1PC2A 3ESKA 3TG4A 4KVMA 1E8YA 4J0UA 3CSFA 4YNDA 4APFA 2PL2A 4I17A 3NF1A 5JJ7A 1H0AA 4UQYA 3S7BA 4XE0A 2LSVA 3ONKA 3QWPA 4XI0A 4FU3A 4H7XA 4B0ZA 4C0MA 4N2QA 3IEGA 4BT8A 1UG3A 4J8SA 5BV0A 3FUIA 3ENEA 2IONA 3N71A 4W9RA 3I4GA 3SBTB 1WM5A 1WAO1 2ILRA 2R5SA 4GYOA 3CVXA 3CHOA 3TG5A 4NRHB 2IQCA 3G2SA 1HF8A 5LCWJ 3ASHA 3L08A 2XQ0A 4LCTA 5HQ8A 5KJLA 2CHWA 2X6JA 1GW6A 5KJKA 1UN8A 2IU1A 1ELWA 4I9CA 3ZEFA 3FTUA 5EKQD 2DBAA 4A3VA 1KLXA 1Z6TA 3PUJA 2AXVA 2FF4A 3UMVA 4LUNU 1NA3A 4L2LA 2E0IA 3TJPA 3FUFA 1OWOA 4J8EA 5AIJA 2DIWA 1FVFA 2I1KA 3NZUA 5AYWD 1HO8A 4EZKA 2WMOA 4FHJA 2VGXB 3FUMA 3MX3A 3P1UA 4ILGA 4BTBA 2FI7A 2VSXE 3D9NA 5HI7A 1IYGA 1ELKA 4N3AA 3EIQC 3LY9A 3MV2B 3ML8A 4BFRA 3PZDA 3G2TA 2WQ7A 4HOSA 4G2VA 4ACLA 3TAXA 4I43A 2J49A 2LAIA 2WXLA 2WXKA 3FUHA 3LVQE 3Q15A 4KBQA 4BSXA 4CT0A 5ANRA 4FLHA 5BPPA 2V5FA 2V4LA 3U4TA 4JEUA 2BUGA 3P2BA 4EBAA 1QZ2A 3CHRA 3PS6A 2QY7A 2WXFA 1DVPA 2J08A 3G2WA 4Y6CA 4GA0A 3D9KA 3FH5A 3IHYA 1HS6A 1OWNA 3QJZA 4ANVA 1NA0A 1SQMA 3WXXA 4BX9A 2J4BA 1BPOA 1HU3A 3HIZA 2KM4A 3CHSA 3FUNA 1IQRA 3CHMA 3L13A 3MKQB 3HVEB 2L0IA 2MHKA 4J8DA 2GRMA 5ARFA 3L54A 3PVLA 3RK6A 4HOTA 3IBEA 5J08A 4NACA 3S7DA 1KT0A 2IFUA 4ATGA 1XGWA 4JA7A 1PAQA 3C98A 3D9PA 2LNIA 3LY8A 2Y4TA 1SZAA 4JPSA 4A55A 2DCPA 2OOEA 5G04C 3GZSA 5G05C 4J6IA 5EX0A 4KT6B 3TXNA 2WM9A 1LF8A 1ELRA 3TXMA 1EF1C 3MEKA 3RRNB 4I1OB 5FZRA 5CMWA 5JHBA 3PDNA 4I1AA 3SZ7A 3D9OA 1Y8MA 4PS8A 3ZN3A 1VDYA 4MLPA 3UX4A 3ESLA 3JYSA 2LSUA 3LEWA 3SNXA 3GYZA 3R7RA 1L5JA 4AP2A 4AJWA 3EIJA 3CVNA 1TJCA 1TJFA 2VQ2A 3B13A 3GW4A 4KXKB 3MZLB 2XPYA 3VLEA 1JPLA 3MV3B 3PRZA 4KVOA 3FTZA 4KMOA 1OWLA 4PDXA 4I9EA 2XEVA 3G2VA 5G05J 2CG3A 3CEQA 4HOUA 4U04A 3RKVA 3Q4AB 4GCNA 2VGYA 2ONDA 2JLBA 2M63A 2GRLA 5LX8A 4HS2A 2WXHA 3QK0A 3T5VA 4CCAA 4DI3A 1H2VC 3UQ3A 5BV1A 4UI9J 4UI9K 4L7TA 4EPZA 1E96B 4B8AA 3PNTB 3OXFA 4H7YA 3VLFA 5FZQA 4D10C 2IJGX 2WVIA 2AWIA 3UT8A 3L22A 3NQPA 1IQUA 4WWPA 4GA1A 4YVOA 5A23A 1A17A 4UWGA 2HR2A 4CDNA 3QB2A 4L2YA 3OXLA 5C1DA 2WXIA 3LJ3A 4WNEA 2PM7A 4DK5A 2VTBA 4JHJA 4U0ZA 4ANXA 2E2EA 1OUVA 3FEXA 4N3BA 3PE3A 2KCLA 3L16A 2VSOE 3RIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVP A;  3G2W A;  2DIW A;  3D9K A;  5CMY A;  1VDY A;  3D9J A;  3ZYL A;  4GZC A;  4JXT A;  2L0T B;  1JWF A;  3D9I A;  5LP0 A;  3ZYK A;  1X5B A;  1JWG A;  3D9L A;  3D9M A;  3D9N A;  4GZD A;  3G2U A;  1ELK A;  2KM4 A;  3LDZ A;  2L0I A;  2MOW A;  4FLB A;  2BF0 X;  3CLJ A;  1HF8 A;  1SZ9 A;  3G2S A;  1JPL A;  3G2T A;  3ONL A;  5J08 A;  1EYH A;  1H0A A;  1JUQ A;  4NAC A;  4Q96 A;  1XGW A;  1UJJ A;  1PY1 A;  3D9P A;  3ONK A;  4HFG A;  3G2V A;  3RRU A;  1SZA A;  4FU3 A;  3ZYM A;  2DCP A;  1INZ A;  2V8S E;  1EDU A;  5LOZ A;  3ZYQ A;  1HX8 A;  1LF8 A;  1MHQ A;  4AVX A;  5CMW A;  1HG5 A;  4Q94 A;  1HG2 A;  2LO6 A;  1UJK A;  2QY7 A;  1HFA A;  3D9O A; 
#chains in the Genus database with same CATH topology
 5KWD A;  2XEE A;  3FTY A;  4WNG A;  3LVR E;  2RFA A;  2IO3 C;  2AVP A;  2OVB A;  4IRU A;  5ENN A;  3KAE A;  3AS5 A;  4I1M A;  4XEI G;  1N52 A;  3FTV A;  4U7E B;  5AAO A;  4B89 A;  4LEU A;  4GTQ A;  3R7Q A;  2J9Q A;  4JHR A;  2PNN A;  3U66 A;  4UQZ A;  4GTT A;  2XPZ A;  3DEP A;  4GYW A;  4PH4 B;  4EQF A;  4BX8 A;  4UWK A;  3DWL G;  2XS1 A;  5E76 A;  3ZHE B;  4AM9 A;  4J8F A;  1U3D A;  1EPU A;  4WND A;  1NL4 A;  3KD7 A;  4FUL A;  3URZ A;  5CRU A;  2AW6 A;  1S70 B;  3ASF A;  4UWF A;  2IOS A;  2P9K G;  2Y0B G;  3MKQ A;  2H6H A;  3DST A;  4CDR A;  5FZS A;  4G26 A;  3DXM G;  2GGF A;  5AEN A;  2XZD G;  4G8L A;  5FT9 A;  5D0O D;  3R9A B;  1ZBP A;  4Q94 A;  1UJK A;  4JEH A;  4PUC A;  4A1G A;  2L0T B;  4UWL A;  3ZRH A;  4HVB A;  2X6K A;  1FCH A;  3SI5 A;  4U8V D;  5HKP A;  4U0U A;  1H2U A;  3ABM E;  3EDT B;  3APF A;  5FQ4 A;  4ME2 A;  3KEZ A;  4AV7 A;  1N95 A;  2KZT B;  2RG8 A;  3Q5M A;  2WB2 A;  2P9U G;  2Y3A A;  3D9L A;  4WWN A;  2KCK A;  4I6J A;  1TYQ G;  2ETA A;  3AS8 A;  3AG3 E;  3MA5 A;  3ZPJ A;  1Y6I A;  3AAA C;  1QBQ A;  3LJN A;  5AQA A;  2VSN A;  4DUI A;  5T4Y A;  5CCM A;  2GRO B;  3NZS A;  4JW1 A;  1N11 A;  3BUA A;  1H6K A;  2IF4 A;  5G04 J;  5BUZ A;  3LS8 A;  2QYJ A;  1INZ A;  2PM6 A;  2OCC E;  2HM8 A;  4NUR A;  3LY7 A;  1TEZ A;  3QOU A;  1E7U A;  3ZYL A;  3D3M A;  4BER A;  3T8M A;  2XGS A;  5CEC B;  1WG0 A;  3HYM B;  2XRY A;  4PS3 A;  4OAV B;  1JCQ A;  3LXU X;  3APC A;  2CFU A;  4ILH B;  2C2L A;  4BEP A;  4MRU A;  2WQ6 A;  3AG2 E;  3G2U A;  2IO2 C;  3V79 K;  4HXI A;  4TRQ A;  4Q69 A;  4B94 A;  2WXP A;  2CHZ A;  2WXJ A;  3APD A;  2VTB B;  5T3R A;  2XRZ A;  1V54 E;  4U07 A;  3L17 A;  3FU5 A;  1E8W A;  2PQN A;  3FUD A;  1H19 A;  4GYY A;  3JQ1 A;  2YNQ A;  4AIF A;  2KXP C;  1EYH A;  3U64 A;  4F53 A;  2V8S E;  4P29 A;  3UM0 A;  4AXH A;  3NOC D;  3L6A A;  1RZ4 A;  1U3C A;  3TG4 A;  4J0U A;  4UQY A;  4HNA D;  5EYL A;  3QWP A;  4FU3 A;  2RKK A;  4J8S A;  3W9G A;  3ENE A;  2ION A;  3I4G A;  1SW6 A;  3SBT B;  3CVX A;  4HI9 A;  4K5B A;  4LCT A;  1UN8 A;  3FTU A;  3UMV A;  3TJP A;  1OWO A;  3HXD A;  2VGX B;  2FI7 A;  3UIP C;  3LY9 A;  3MV2 B;  4BFR A;  3PZD A;  3G2T A;  2WQ7 A;  2EIL E;  4CZ2 D;  2LXM A;  2DYR E;  2V5F A;  3P2B A;  3AG4 E;  1QZ2 A;  3CHR A;  3ZKJ A;  2DVW A;  2F37 A;  3FH5 A;  4ANV A;  1SQM A;  4BX9 A;  2J4B A;  1HU3 A;  1OCO E;  3CHS A;  3L13 A;  2L0I A;  2MHK A;  4J8D A;  4HOT A;  3IBE A;  4ATG A;  2IFU A;  1XGW A;  1PAQ A;  2LNI A;  3LY8 A;  2Y4T A;  1SZA A;  4A55 A;  3E32 A;  4F1P A;  3GZS A;  2QZA A;  3TXM A;  5CMW A;  3MEK A;  4I1O B;  1JCR A;  1LD8 A;  4I1A A;  3D9O A;  3E30 A;  4MLP A;  4LNB A;  3JYS A;  3LEW A;  3GYZ A;  3R7R A;  3B7B A;  3CVN A;  3EIJ A;  1TJF A;  2VQ2 A;  3DSX A;  3GW4 A;  2VGE A;  3VLE A;  3PRZ A;  4PDX A;  5G05 J;  3E34 A;  2F8X K;  3CEQ A;  4U04 A;  1TN8 A;  4HS2 A;  3T5V A;  2R2L A;  4L7T A;  3T9K A;  4B8A A;  4H7Y A;  4D10 C;  3D9H A;  3TWR A;  1IHB A;  4WWP A;  4GA1 A;  2DZO A;  4HQD A;  5A23 A;  4CDN A;  4L2Y A;  3LJ3 A;  2VTB A;  5D66 A;  4JHJ A;  2A5E A;  5ENP D;  2KCL A;  5CEA A;  3PRE A;  3ZU7 B;  2X6F A;  3HXC A;  3LYA A;  3CVL A;  4CT4 A;  4CGV A;  2J4D A;  4GA2 A;  2X6H A;  3QWW A;  3E4B A;  3FH8 A;  2C0L A;  3TWX A;  5KJN A;  3CVU A;  3VTY A;  5EID A;  3O4Z A;  1Q2Z A;  3QWV A;  3JQ0 A;  3TL5 A;  5LCW C;  2OVF A;  2WQH A;  2X3M A;  3HXF A;  3Q79 A;  3PE4 A;  3ONL A;  4Q96 A;  4LER A;  4U0S A;  4L23 A;  1OWP A;  4ZFH A;  3J5P A;  3ZYQ A;  3RAU A;  2L6J A;  3DPD A;  3E33 A;  1OY3 D;  4BWR A;  4A3T A;  3FUJ A;  4DRX E;  4ILI A;  4K03 A;  4RQI A;  4K5C A;  3EHQ A;  2BKG A;  4N3C A;  4XIF A;  4JZY A;  4PS7 A;  3CVY A;  4MBG A;  3FU3 A;  1KZP A;  3CV0 A;  4F3V A;  2EIJ E;  2ETB A;  2KAT A;  4U96 D;  1JWF A;  4GU5 A;  2X38 A;  2ZXW E;  3CK8 A;  1YA0 A;  3Q9U C;  1BLX B;  1TN6 A;  2ETC A;  4GPK A;  2OV8 A;  4HOR A;  2L9B A;  4APO A;  2F0Y A;  2EQX A;  2GRN B;  3PH0 C;  3QDN A;  2I9C A;  1N4S A;  4J7W A;  4DX5 D;  4UUC A;  4WWO A;  1NZN A;  3FEY A;  1S0P A;  4A1S A;  3RU0 A;  5DIZ A;  3ML9 A;  1SA5 A;  1UJJ A;  3U3W A;  3CQG B;  4MKT A;  3OXG A;  5HRY A;  1MHQ A;  2NXP A;  5FQ6 A;  1S63 A;  1NP7 A;  4G24 A;  5JJT A;  1BI7 B;  3AU4 A;  1OWM A;  4GML A;  4AEZ C;  2KC7 A;  4GZD A;  3UT4 A;  3O48 A;  3QAQ A;  4U8Y D;  3C72 A;  3DPY A;  5BNW A;  2WXO A;  3ZVV A;  3T8K A;  4DLO A;  4RVB A;  5CER B;  1UOH A;  3RJV A;  1XNF A;  3ABK E;  4GTP A;  3ZXP A;  1SVX A;  4GTO A;  1HZ4 A;  1UW4 B;  3HVE A;  3SGH A;  4FLB A;  4GPM A;  4DX2 A;  3DSU A;  2XCC A;  1WY6 A;  3PZ4 A;  2HO1 A;  3ZGQ A;  3DXK G;  2XGO A;  1TNB A;  3CVW A;  5CMY A;  2WXQ A;  3FH7 A;  3PZ2 A;  5G55 A;  3TWU A;  3RSE G;  5EX3 A;  3V30 A;  1O5M A;  2RFM A;  3JUI A;  3UIN C;  4BET A;  3IKO B;  3GZ2 A;  4HFG A;  1O1T A;  1Z5S C;  2IOL A;  3BQO A;  4TXP A;  2LO6 A;  3CGH A;  3CHQ A;  5FJY A;  5FQ7 A;  4EZJ A;  5B3S E;  1TR4 A;  5IY5 E;  3ZYK A;  5E75 A;  5BW8 C;  2CHX A;  2UWJ G;  2H6I A;  2FEZ A;  3ZNG A;  1BU9 A;  4JC8 A;  5ARG A;  2GW1 A;  5C2Y A;  4LRZ A;  1EDU A;  4DX6 D;  4AY5 A;  1Z3X A;  4ABN A;  1DC2 A;  4BES A;  1MJ0 A;  2FO7 A;  3KS2 A;  3ZHE A;  2DZN A;  1N0R A;  3CQC B;  4KZ0 A;  1MX2 A;  4HI8 A;  5BXO A;  4TUU A;  3RO2 A;  4RG6 A;  2ZGD A;  4TXQ A;  5J90 A;  3I5P A;  2P9P G;  4WAF A;  3FU0 A;  2EIM E;  3ZUV B;  4CDM A;  3HG0 D;  4RLY A;  3ESK A;  1E8Y A;  4YND A;  1H0A A;  4C48 B;  4B0Z A;  4YDE A;  3IXE A;  3AJI A;  1WM5 A;  5EIB E;  2ILR A;  4GYO A;  5B1A E;  3CHO A;  2F8Y A;  3G2S A;  3ASH A;  3L08 A;  5HQ8 A;  5KJL A;  2CHW A;  2X6J A;  4HRM B;  2IU1 A;  3ZEF A;  2DBA A;  4A3V A;  4O60 A;  4QQI A;  2AJA A;  5CRV A;  4G8K A;  3NZU A;  4BSZ B;  3MX3 A;  3Q7A A;  2ZIS A;  4BTB A;  5HI7 A;  1IYG A;  2JAB A;  1ELK A;  4N3A A;  3EIQ C;  3AG1 E;  1SA4 A;  4M7C A;  2WXL A;  2R03 A;  2B6C A;  5ANR A;  1IKN D;  3UTM A;  1FT1 A;  1DVP A;  2J08 A;  4Y6C A;  5AQB A;  3QJZ A;  1D8D A;  3C5R A;  2GRM A;  1MYO A;  5J08 A;  3C98 A;  3TXN A;  5EX0 A;  2WM9 A;  3RRN B;  5JHB A;  3SZ7 A;  3EUV A;  4EHM A;  2LSU A;  1L5J A;  1O1S A;  4KXK B;  3ISM C;  2XPY A;  5CBN A;  4KVO A;  4KMO A;  3UIO C;  3UM1 A;  2BED A;  3Q4A B;  4GCN A;  4TXR A;  4CCA A;  1H2V C;  5CED B;  3OXF A;  5FZQ A;  2WVI A;  2AWI A;  3BU8 A;  1IQU A;  4A63 B;  3NBN B;  4YVO A;  2H6F A;  1A17 A;  4UWG A;  2HR2 A;  1N0Q A;  1WDY A;  2WXI A;  5AQ7 A;  2E2E A;  3FEX A;  2H6G A;  3PUK A;  3TWQ A;  1RW2 A;  1FVH A;  5AAR A;  4IN3 B;  3JUE A;  2C0M A;  3DSW A;  4I2W A;  2R17 C;  3FUE A;  4XKB A;  1MX4 A;  4GZ5 A;  1PY1 A;  5DBK A;  1HE8 A;  3DSS A;  4KZC A;  4JD2 G;  2P58 C;  3HHM A;  4UQX A;  3CST A;  4FP7 A;  3SD5 A;  4ANU A;  3CVP A;  4ATZ D;  3ULE G;  3R9M A;  4WNF A;  1DNP A;  3FTX A;  3DBS A;  3BG0 B;  3FUL A;  4O6F A;  3TWV A;  1E7V A;  3AU5 A;  3PEV B;  5AJD A;  5D2M C;  4GMJ A;  1YMP A;  2YHE A;  3UKR G;  1MX6 A;  2A5U A;  3CHP A;  3HRA A;  3S7J A;  1HH8 A;  5ITZ F;  3U9W A;  1AWC B;  3S2A A;  3LDZ A;  3Q73 A;  4G11 A;  4GMR A;  5A6C A;  4URK A;  1SZ9 A;  3SBS A;  1JUQ A;  1ZU2 A;  5AJL A;  3IHV A;  3ULQ A;  3QC1 A;  3FTW A;  3MJW A;  4GZC A;  4Y6W A;  4HLL A;  4YDO A;  5CCL A;  4LG6 A;  4GTV A;  4G23 A;  3RO3 A;  2FUL A;  4F1S A;  2L6B A;  3FUK A;  1HX8 A;  1N9A A;  3QNK A;  4CEM A;  2ZIR A;  3T5X A;  4AY6 A;  5FIN A;  2VJ8 A;  2V0P A;  3Q78 A;  4GB9 A;  4FC8 A;  1KPS B;  1H6P A;  4IYP A;  1E8Z A;  4FAD A;  2R59 A;  2XCB A;  5JJ6 A;  3B7T A;  4MS6 A;  1JCS A;  1MQS A;  2I1J A;  2KCV A;  3W9F A;  5KNG A;  5JHA A;  4I6E A;  2YIN A;  2PQR A;  4BY6 A;  3ZIM A;  3LPZ A;  4JA9 A;  3DSV A;  4FA6 A;  3HXE A;  1HFA A;  4OYS A;  1B89 A;  2CFZ A;  2RD0 A;  4E6H A;  3UI2 A;  3DEO A;  2EIN E;  5LP0 A;  2V4H C;  4DX7 D;  1X5B A;  4HLE A;  2IY0 C;  1K1B A;  4ANW A;  3JXJ A;  5D0Q D;  2VYI A;  2XEH A;  2BF0 X;  3CK7 A;  4C0E A;  3FU6 A;  5ANL A;  3CIA A;  1D9S A;  1IHG A;  2BTD A;  3ASD A;  4G25 A;  4CRW A;  1AP7 A;  1YYH A;  3DRA A;  2GRR B;  2XHE A;  3QAR A;  2NSZ A;  4ZHB A;  3V2X A;  2JEK A;  1QYM A;  2P9S G;  2R05 A;  3VTX A;  5ENQ D;  3SFY A;  2LXL A;  3JXI A;  2KZT A;  3SO8 A;  4BTA A;  2R02 A;  3K9I A;  2HYZ A;  3EU9 A;  4HOQ A;  5ENO D;  2XZT G;  3CVQ A;  4OVU A;  3ZW3 A;  5FWQ A;  1N94 A;  3ASN E;  3IV0 A;  3WG7 E;  2FBN A;  4HB5 A;  3F6Q A;  2PZI A;  3HXB A;  2AXU A;  4XX5 A;  2XEN A;  4GZ6 A;  3B7R L;  3OTN A;  3PZ3 A;  2MOW A;  4FJY A;  1OCR E;  4DPR A;  3RRU A;  4QFV A;  4GTM A;  3B95 A;  3I3N A;  3ASG A;  2CG2 A;  1DCQ A;  3VLD A;  4G1T A;  4TUM A;  1PC2 A;  4KVM A;  4APF A;  2Y1L E;  3NF1 A;  3S7B A;  4XE0 A;  4XI0 A;  4N2Q A;  4C0M A;  4BT8 A;  5BV0 A;  1K8K G;  3TG5 A;  5JMN D;  4NRH B;  2IQC A;  1G3N B;  1HF8 A;  5LCW J;  4K5A B;  2XQ0 A;  2NYJ A;  5AQ9 A;  1ELW A;  2GRQ B;  4I9C A;  3Q75 A;  5EKQ D;  1KLX A;  4O1O A;  3PUJ A;  4LSZ E;  2AXV A;  2FF4 A;  3V31 A;  4LUN U;  2P9I G;  4J8E A;  2DIW A;  1FVF A;  2OEW A;  3UXG A;  5AYW D;  1HO8 A;  4EZK A;  4FHJ A;  3FUM A;  3KSQ A;  1S64 A;  2VSX E;  3D9N A;  5ENT D;  3ML8 A;  4G2V A;  3TAX A;  2LAI A;  1U2V G;  3LVQ E;  3FUH A;  4KBQ A;  3Q15 A;  4FLH A;  5BPP A;  2V4L A;  4JEU A;  4EBA A;  2LUH A;  3PS6 A;  2WXF A;  2J8S D;  3G2W A;  1TNZ A;  3IHY A;  1HS6 A;  1NA0 A;  3WXX A;  1BPO A;  3HIZ A;  3FUN A;  1IQR A;  3HVE B;  5ARF A;  3L54 A;  3PVL A;  1NI1 A;  5FIO A;  3S7D A;  1KT0 A;  4JA7 A;  3D9P A;  2DCP A;  2OOE A;  5G04 C;  5G05 C;  4J6I A;  2OEV A;  1ELR A;  1LTX A;  1EF1 C;  2IEJ A;  5FZR A;  3V2O A;  1Y8M A;  3UKU G;  3ZN3 A;  1VDY A;  4F6R D;  3UX4 A;  1NFI E;  3ESL A;  2P9N G;  4AP2 A;  5H7P A;  3MZL B;  2B0O E;  4J8Y A;  3MV3 B;  3FTZ A;  1OWL A;  2QC9 A;  3SQV A;  2XEV A;  1OCZ E;  4HOU A;  2VGY A;  2OND A;  3EU5 A;  3QK0 A;  1E96 B;  3PNT B;  2IJG X;  3UT8 A;  3L22 A;  1FT2 A;  2V5Q C;  4L9P A;  1A5E A;  3L82 A;  1O1R A;  3QB2 A;  3OXL A;  4WNE A;  4DK5 A;  1N4Q A;  1OUV A;  3PE3 A;  3UM3 A;  3RIB A;  3LKU A;  4JXT A;  1E8X A;  1IXV A;  2Q7F A;  3Q7F A;  4U8H A;  4OAU C;  3MCX A;  3TGO A;  4DJA A;  1OT8 A;  3NAW A;  1MZC A;  3MKR A;  4XKC A;  4DLQ A;  3UT7 A;  4IUL A;  3SHF A;  3D9M A;  1UN9 A;  4OVV A;  4RG9 A;  3CLJ A;  3CR3 A;  2UY1 A;  2GRP B;  5CHE E;  2NC9 A;  2ZU6 B;  5EN5 D;  2LAH A;  3HDX A;  2HE0 A;  1N4R A;  3TWW A;  2AXZ A;  5FQ8 A;  1TNU A;  2A4Z A;  3B7S A;  1H2T C;  3CVV A;  1OCC E;  4GCO A;  3SY2 A;  3ZYM A;  4N39 A;  4HRL A;  3FY4 A;  4C9B B;  5A7D B;  2DYS E;  3UUX A;  2VGX A;  3ZFW A;  2X6I A;  1QQE A;  2Y4U A;  2J09 A;  3SFX A;  3E37 A;  2WMN A;  4Z68 A;  3FWV A;  4WUY A;  4B8C B;  2KBX A;  4F7A A;  5T8I A;  2MYO A;  1HG2 A;  3MYV A;  1P5Q A;  3C3Q A;  3RRM B;  2WXN A;  1YCS B;  4EEC A;  1K3Z D;  4YDY A;  3NOG D;  5HS0 A;  4HRN A;  4U63 A;  4V3I A;  3KSL A;  1V55 E;  3I4R B;  4EZL A;  4N5C A;  5B1B E;  3ZXS A;  4FJZ A;  3KEA A;  3CKB A;  1FPP A;  3EHR A;  1HG5 A;  4GZ3 A;  2MRI A;  5G2N A;  4UI9 C;  2WXM A;  2I6H A;  4FHK A;  2VSY A;  1JWG A;  4RSY A;  3Q49 B;  3CKC A;  2XGM A;  4ACK A;  4BT9 A;  1KZO A;  4JHK A;  4EBA G;  2BKK B;  4UWH A;  3ULY A;  5LFA A;  5LOZ A;  1DCE A;  5ENS D;  4K0R A;  2YHC A;  3CK9 A;  3GZ1 A;  3NB2 A;  4CYM D;  3EHN A;  5M72 A;  5FTP A;  3PEU B;  3LCA A;  5KJM A;  2P2C P;  3UM2 A;  4GAA A;  1E90 A;  3BG1 B;  1N54 A;  4GTS A;  3FDH A;  4YVQ C;  3AS4 A;  2XPI A;  3EHM A;  4I6G A;  1N4P A;  2I2O A;  4KYO B;  4CGW A;  5EDS A;  4I2Z A;  3UPV A;  1Z3Y A;  4LNU D;  5BT1 A;  3FFL A;  4TV3 A;  3MGB A;  5CBO A;  2QFC A;  1X81 A;  4E85 A;  4N5Q A;  3SF4 A;  2XS8 A;  1QNF A;  1KT1 A;  1H6O A;  3SFZ A;  4JL0 A;  4N2S A;  2WPV A;  3X2Q E;  3EJN A;  3FP3 A;  1BD8 A;  2UY1 B;  4XI9 A;  3BEE A;  3JCK C;  3B7U X;  1ZB1 A;  4LNG A;  3D9J A;  4L1B A;  4DI4 A;  5KCM A;  4NIK A;  4R7L A;  3D9I A;  3FTS A;  4AOF A;  4NQ0 A;  2YQ8 A;  2WXR A;  3OAW A;  3S7F A;  2QYU A;  1W3B A;  1K1A A;  4XZ4 A;  1HXI A;  4GTR A;  4U95 D;  3PNL B;  4JVS A;  4AVX A;  3FHE A;  2J07 A;  3L9T A;  3QKY A;  1TNO A;  3J5Q B;  2EIK E;  3ABL E;  3Q47 B;  4M3O A;  3CSF A;  2PL2 A;  4I17 A;  5JJ7 A;  2LSV A;  3ONK A;  4H7X A;  2DWZ A;  3PZ1 A;  3IEG A;  4HBD A;  5EYP F;  1UG3 A;  3FUI A;  3N71 A;  4W9R A;  1TN7 A;  1WAO 1;  2R5S A;  4B93 B;  1GW6 A;  5KJK A;  3ASO E;  1Z6T A;  1NA3 A;  4L2L A;  2E0I A;  3FUF A;  4O1P A;  5AIJ A;  2I1K A;  2WMO A;  3C3R A;  3P1U A;  4ILG A;  3C3O A;  4HOS A;  4ACL A;  4I43 A;  2J49 A;  2WXK A;  4CT0 A;  4BSX A;  1D8E A;  1LD7 A;  3TWT A;  3U4T A;  2BUG A;  2QY7 A;  4JB8 P;  4GA0 A;  3D9K A;  1OWN A;  5AN8 A;  2KM4 A;  3MKQ B;  3CHM A;  3RK6 A;  1BI8 B;  4DX1 A;  2Y69 E;  4NAC A;  4JPS A;  4X8Q A;  4KT6 B;  1LF8 A;  3PDN A;  2VSO E;  4PS8 A;  5ENR D;  3SNX A;  1OXJ A;  4AJW A;  1TNY A;  1TJC A;  3B13 A;  5KNH D;  1JPL A;  5EIL A;  2P9L G;  2FO1 E;  4I9E A;  3G2V A;  2CG3 A;  3RKV A;  4YDW A;  2JLB A;  2M63 A;  2GRL A;  5LX8 A;  2WXH A;  4DI3 A;  5BXU A;  3UQ3 A;  5BV1 A;  4UI9 J;  4UI9 K;  3TWS A;  4EPZ A;  3VLF A;  2ZGG A;  3NQP A;  5JA4 D;  3Q9N C;  5KBA A;  5C1D A;  2PM7 A;  4ANX A;  4U0Z A;  4N3B A;  3L16 A;  2WXG A; 
#chains in the Genus database with same CATH homology
 3LKU A;  3PRE A;  2X6F A;  1FVH A;  4JXT A;  3LYA A;  4IN3 B;  3CVL A;  1E8X A;  4CT4 A;  4CGV A;  2J4D A;  4GA2 A;  2X6H A;  2C0M A;  2Q7F A;  3QWW A;  4U8H A;  3E4B A;  4I2W A;  2R17 C;  3FH8 A;  2C0L A;  3FUE A;  3FTY A;  5KJN A;  4XKB A;  3CVU A;  4WNG A;  3MCX A;  3LVR E;  3VTY A;  4GZ5 A;  3TGO A;  4DJA A;  1PY1 A;  5DBK A;  2AVP A;  2OVB A;  3MKR A;  3O4Z A;  1HE8 A;  3QWV A;  4IRU A;  3JQ0 A;  5ENN A;  3KAE A;  3AS5 A;  4XKC A;  4KZC A;  3TL5 A;  4I1M A;  4DLQ A;  5LCW C;  2P58 C;  2OVF A;  3UT7 A;  2WQH A;  3HHM A;  1N52 A;  4IUL A;  2X3M A;  4UQX A;  3SHF A;  3FTV A;  3CST A;  4FP7 A;  3D9M A;  1UN9 A;  3PE4 A;  4OVV A;  3SD5 A;  4B89 A;  4LEU A;  4ANU A;  4RG9 A;  3CVP A;  3CLJ A;  4WNF A;  1DNP A;  3ONL A;  3CR3 A;  2UY1 A;  3FTX A;  4Q96 A;  3DBS A;  5CHE E;  2NC9 A;  2ZU6 B;  4LER A;  3BG0 B;  3FUL A;  4L23 A;  4U0S A;  3R7Q A;  2J9Q A;  1OWP A;  2LAH A;  3HDX A;  4JHR A;  1E7V A;  4O6F A;  3AU5 A;  3PEV B;  5AJD A;  3ZYQ A;  3U66 A;  4GMJ A;  4UQZ A;  2AXZ A;  2L6J A;  2YHE A;  3DPD A;  2A5U A;  2XPZ A;  3CHP A;  5FQ8 A;  3S7J A;  1HH8 A;  4BWR A;  4A3T A;  4GYW A;  2A4Z A;  3U9W A;  3FUJ A;  3B7S A;  4ILI A;  4PH4 B;  1H2T C;  4K03 A;  3S2A A;  3LDZ A;  4G11 A;  4EQF A;  4BX8 A;  4UWK A;  5A6C A;  4URK A;  1SZ9 A;  3SBS A;  3CVV A;  4N3C A;  1JUQ A;  1ZU2 A;  4XIF A;  5E76 A;  3ZHE B;  5AJL A;  4GCO A;  4JZY A;  3ZYM A;  4AM9 A;  4PS7 A;  4J8F A;  3IHV A;  3CVY A;  1U3D A;  1EPU A;  4N39 A;  3ULQ A;  3QC1 A;  4WND A;  4C9B B;  3FY4 A;  5A7D B;  3KD7 A;  3FU3 A;  3UUX A;  3FTW A;  4FUL A;  3CV0 A;  3URZ A;  2VGX A;  3ZFW A;  2X6I A;  1QQE A;  2AW6 A;  3MJW A;  4F3V A;  4GZC A;  3ASF A;  2KAT A;  4UWF A;  1JWF A;  4GU5 A;  2Y4U A;  2IOS A;  2J09 A;  2X38 A;  3MKQ A;  4Y6W A;  2WMN A;  3FWV A;  3CK8 A;  4CDR A;  1YA0 A;  5FZS A;  4WUY A;  4G26 A;  5CCL A;  4B8C B;  4GPK A;  2OV8 A;  4HOR A;  2GGF A;  2L9B A;  4G23 A;  3RO3 A;  2FUL A;  5AEN A;  4F1S A;  4APO A;  5FT9 A;  5D0O D;  3R9A B;  3FUK A;  1HX8 A;  1ZBP A;  4F7A A;  4Q94 A;  5T8I A;  3QNK A;  4CEM A;  2EQX A;  1HG2 A;  3PH0 C;  3MYV A;  1P5Q A;  1UJK A;  3T5X A;  4AY6 A;  2VJ8 A;  3RRM B;  2WXN A;  3QDN A;  2V0P A;  2I9C A;  4JEH A;  4EEC A;  4PUC A;  4A1G A;  2L0T B;  4GB9 A;  4UWL A;  3ZRH A;  4HVB A;  2X6K A;  4WWO A;  4FC8 A;  1FCH A;  1NZN A;  3FEY A;  3SI5 A;  4IYP A;  4U63 A;  1S0P A;  4V3I A;  1E8Z A;  4A1S A;  4FAD A;  2R59 A;  2XCB A;  4U0U A;  3ML9 A;  5DIZ A;  1H2U A;  3I4R B;  3RU0 A;  5JJ6 A;  1UJJ A;  3U3W A;  3EDT B;  3APF A;  4EZL A;  4N5C A;  5FQ4 A;  3CQG B;  4ME2 A;  3ZXS A;  3KEZ A;  4FJZ A;  3OXG A;  4MKT A;  4AV7 A;  3CKB A;  1MHQ A;  2NXP A;  4GZ3 A;  1HG5 A;  3B7T A;  2KZT B;  4MS6 A;  2MRI A;  5G2N A;  5FQ6 A;  1MQS A;  1NP7 A;  4G24 A;  4UI9 C;  2RG8 A;  5JJT A;  3Q5M A;  3AU4 A;  2WXM A;  2I6H A;  4FHK A;  2VSY A;  2WB2 A;  1OWM A;  4GML A;  4AEZ C;  2I1J A;  2Y3A A;  2KCV A;  1JWG A;  4RSY A;  3D9L A;  4WWN A;  2KCK A;  2KC7 A;  4GZD A;  3Q49 B;  3UT4 A;  5JHA A;  3O48 A;  3QAQ A;  4I6E A;  2YIN A;  4I6J A;  2PQR A;  4BY6 A;  3AS8 A;  3CKC A;  2XGM A;  3MA5 A;  4ACK A;  2WXO A;  3ZVV A;  3ZPJ A;  4BT9 A;  4JHK A;  5BNW A;  1Y6I A;  4EBA G;  4UWH A;  5LFA A;  3ZIM A;  3LPZ A;  5LOZ A;  4JA9 A;  4FA6 A;  4DLO A;  4K0R A;  2YHC A;  2VSN A;  1HFA A;  3CK9 A;  4OYS A;  4RVB A;  1B89 A;  2CFZ A;  2RD0 A;  3GZ1 A;  5T4Y A;  3RJV A;  1XNF A;  4E6H A;  5CCM A;  3NZS A;  4JW1 A;  5LP0 A;  1X5B A;  4HLE A;  3EHN A;  5M72 A;  1H6K A;  1HZ4 A;  4ANW A;  1UW4 B;  2IF4 A;  3HVE A;  5FTP A;  5G04 J;  4FLB A;  2VYI A;  5D0Q D;  3SGH A;  2BF0 X;  5BUZ A;  3CK7 A;  4C0E A;  3FU6 A;  3LS8 A;  3PEU B;  3LCA A;  5KJM A;  2XCC A;  1INZ A;  5ANL A;  2PM6 A;  4GAA A;  3CIA A;  1E90 A;  1IHG A;  1WY6 A;  2BTD A;  3BG1 B;  1N54 A;  2HO1 A;  3ZGQ A;  2XGO A;  2HM8 A;  3PUK A;  4NUR A;  3ASD A;  3LY7 A;  4G25 A;  4CRW A;  3CVW A;  1TEZ A;  5CMY A;  2WXQ A;  3FH7 A;  3QOU A;  1E7U A;  5G55 A;  3ZYL A;  3FDH A;  3D3M A;  5EX3 A;  4YVQ C;  3AS4 A;  2XPI A;  2XHE A;  3QAR A;  2NSZ A;  3EHM A;  3JUI A;  4I6G A;  3T8M A;  2JEK A;  2XGS A;  3IKO B;  2I2O A;  4KYO B;  4CGW A;  5EDS A;  3GZ2 A;  3HYM B;  4I2Z A;  4HFG A;  2XRY A;  4PS3 A;  3UPV A;  1Z3Y A;  3VTX A;  2IOL A;  5BT1 A;  3FFL A;  2KZT A;  2LO6 A;  4TV3 A;  2WXG A;  3MGB A;  3CHQ A;  3CGH A;  5FJY A;  5FQ7 A;  3LXU X;  4BTA A;  4EZJ A;  3K9I A;  3APC A;  2HYZ A;  2QFC A;  2CFU A;  4ILH B;  2C2L A;  3ZYK A;  4HOQ A;  5E75 A;  2CHX A;  2UWJ G;  4MRU A;  5BW8 C;  4E85 A;  2WQ6 A;  2FEZ A;  3G2U A;  3SF4 A;  1QNF A;  1KT1 A;  3CVQ A;  4OVU A;  4JL0 A;  3SFZ A;  4JC8 A;  3ZW3 A;  5FWQ A;  4N2S A;  5ARG A;  2GW1 A;  2WPV A;  4HXI A;  5C2Y A;  4TRQ A;  4Q69 A;  3IV0 A;  3EJN A;  3FP3 A;  4B94 A;  4LRZ A;  1EDU A;  2UY1 B;  2WXP A;  4XI9 A;  2CHZ A;  2FBN A;  2WXJ A;  4AY5 A;  3APD A;  2PZI A;  1Z3X A;  3BEE A;  4ABN A;  3JCK C;  2VTB B;  5T3R A;  3B7U X;  2XRZ A;  2AXU A;  4XX5 A;  3D9J A;  4L1B A;  2FO7 A;  4U07 A;  5KCM A;  4R7L A;  4GZ6 A;  3B7R L;  3D9I A;  3L17 A;  4DI4 A;  3KS2 A;  3ZHE A;  3FTS A;  4AOF A;  4NQ0 A;  2YQ8 A;  2WXR A;  3FU5 A;  3OAW A;  1E8W A;  2PQN A;  3FUD A;  1H19 A;  4GYY A;  3S7F A;  3CQC B;  3OTN A;  4KZ0 A;  2MOW A;  2YNQ A;  3JQ1 A;  4FJY A;  1W3B A;  4AIF A;  4TUU A;  3RO2 A;  4RG6 A;  1EYH A;  4XZ4 A;  1HXI A;  3U64 A;  4DPR A;  4F53 A;  3RRU A;  3PNL B;  4QFV A;  4JVS A;  5J90 A;  2V8S E;  3I5P A;  3I3N A;  4AVX A;  3FHE A;  4P29 A;  4WAF A;  3FU0 A;  2J07 A;  3ASG A;  2CG2 A;  3QKY A;  4AXH A;  4CDM A;  3VLD A;  3L6A A;  3Q47 B;  4M3O A;  4G1T A;  1U3C A;  1PC2 A;  3ESK A;  3TG4 A;  4KVM A;  1E8Y A;  4J0U A;  3CSF A;  4YND A;  4APF A;  2PL2 A;  4I17 A;  3NF1 A;  5JJ7 A;  1H0A A;  4UQY A;  3S7B A;  4XE0 A;  2LSV A;  3ONK A;  3QWP A;  4XI0 A;  4FU3 A;  4H7X A;  4B0Z A;  4C0M A;  4N2Q A;  3IEG A;  4BT8 A;  1UG3 A;  4J8S A;  5BV0 A;  3FUI A;  3ENE A;  2ION A;  3N71 A;  4W9R A;  3I4G A;  3SBT B;  1WM5 A;  1WAO 1;  2ILR A;  2R5S A;  4GYO A;  3CVX A;  3CHO A;  3TG5 A;  4NRH B;  2IQC A;  3G2S A;  1HF8 A;  5LCW J;  3ASH A;  3L08 A;  2XQ0 A;  4LCT A;  5HQ8 A;  5KJL A;  2CHW A;  2X6J A;  1GW6 A;  5KJK A;  1UN8 A;  2IU1 A;  1ELW A;  4I9C A;  3ZEF A;  3FTU A;  5EKQ D;  2DBA A;  4A3V A;  1KLX A;  1Z6T A;  3PUJ A;  2AXV A;  2FF4 A;  3UMV A;  4LUN U;  1NA3 A;  4L2L A;  2E0I A;  3TJP A;  3FUF A;  1OWO A;  4J8E A;  5AIJ A;  2DIW A;  1FVF A;  2I1K A;  3NZU A;  5AYW D;  1HO8 A;  4EZK A;  2WMO A;  4FHJ A;  2VGX B;  3FUM A;  3MX3 A;  3P1U A;  4ILG A;  4BTB A;  2FI7 A;  2VSX E;  3D9N A;  5HI7 A;  1IYG A;  1ELK A;  4N3A A;  3EIQ C;  3LY9 A;  3MV2 B;  3ML8 A;  4BFR A;  3PZD A;  3G2T A;  2WQ7 A;  4HOS A;  4G2V A;  4ACL A;  3TAX A;  4I43 A;  2J49 A;  2LAI A;  2WXL A;  2WXK A;  3FUH A;  3LVQ E;  3Q15 A;  4KBQ A;  4BSX A;  4CT0 A;  5ANR A;  4FLH A;  5BPP A;  2V5F A;  2V4L A;  3U4T A;  4JEU A;  2BUG A;  3P2B A;  4EBA A;  1QZ2 A;  3CHR A;  3PS6 A;  2QY7 A;  2WXF A;  1DVP A;  2J08 A;  3G2W A;  4Y6C A;  4GA0 A;  3D9K A;  3FH5 A;  3IHY A;  1HS6 A;  1OWN A;  3QJZ A;  4ANV A;  1NA0 A;  1SQM A;  3WXX A;  4BX9 A;  2J4B A;  1BPO A;  1HU3 A;  3HIZ A;  2KM4 A;  3CHS A;  3FUN A;  1IQR A;  3CHM A;  3L13 A;  3MKQ B;  3HVE B;  2L0I A;  2MHK A;  4J8D A;  2GRM A;  5ARF A;  3L54 A;  3PVL A;  3RK6 A;  4HOT A;  3IBE A;  5J08 A;  4NAC A;  3S7D A;  1KT0 A;  2IFU A;  4ATG A;  1XGW A;  4JA7 A;  1PAQ A;  3C98 A;  3D9P A;  2LNI A;  3LY8 A;  2Y4T A;  1SZA A;  4JPS A;  4A55 A;  2DCP A;  2OOE A;  5G04 C;  3GZS A;  5G05 C;  4J6I A;  5EX0 A;  4KT6 B;  3TXN A;  2WM9 A;  1LF8 A;  1ELR A;  3TXM A;  1EF1 C;  3MEK A;  3RRN B;  4I1O B;  5FZR A;  5CMW A;  5JHB A;  3PDN A;  4I1A A;  3SZ7 A;  3D9O A;  1Y8M A;  4PS8 A;  3ZN3 A;  1VDY A;  4MLP A;  3UX4 A;  3ESL A;  3JYS A;  2LSU A;  3LEW A;  3SNX A;  3GYZ A;  3R7R A;  1L5J A;  4AP2 A;  4AJW A;  3EIJ A;  3CVN A;  1TJC A;  1TJF A;  2VQ2 A;  3B13 A;  3GW4 A;  4KXK B;  3MZL B;  2XPY A;  3VLE A;  1JPL A;  3MV3 B;  3PRZ A;  4KVO A;  3FTZ A;  4KMO A;  1OWL A;  4PDX A;  4I9E A;  2XEV A;  3G2V A;  5G05 J;  2CG3 A;  3CEQ A;  4HOU A;  4U04 A;  3RKV A;  3Q4A B;  4GCN A;  2VGY A;  2OND A;  2JLB A;  2M63 A;  2GRL A;  5LX8 A;  4HS2 A;  2WXH A;  3QK0 A;  3T5V A;  4CCA A;  4DI3 A;  1H2V C;  3UQ3 A;  5BV1 A;  4UI9 J;  4UI9 K;  4L7T A;  4EPZ A;  1E96 B;  4B8A A;  3PNT B;  3OXF A;  4H7Y A;  3VLF A;  5FZQ A;  4D10 C;  2IJG X;  2WVI A;  2AWI A;  3UT8 A;  3L22 A;  3NQP A;  1IQU A;  4WWP A;  4GA1 A;  4YVO A;  5A23 A;  1A17 A;  4UWG A;  2HR2 A;  4CDN A;  3QB2 A;  4L2Y A;  3OXL A;  5C1D A;  2WXI A;  3LJ3 A;  4WNE A;  2PM7 A;  4DK5 A;  2VTB A;  4JHJ A;  4U0Z A;  4ANX A;  2E2E A;  1OUV A;  3FEX A;  4N3B A;  3PE3 A;  2KCL A;  3L16 A;  2VSO E;  3RIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...