5CMZA

Artificial hiv fusion inhibitor ap3 fused to the c-terminus of gp41 nhr
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
43
structure length
43
Chain Sequence
IVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improved Pharmacological and Structural Properties of HIV Fusion Inhibitor AP3 over Enfuvirtide: Highlighting Advantages of Artificial Peptide Strategy.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/inhibitor
molecule keywords Envelope glycoprotein
total genus 20
structure length 43
sequence length 43
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5cmzA00
3MD0A 2Q3IA 2VRSA 2XU6A 4XE5B 2QM7A 2WWWA 1KQLA 2W27A 4RESB 1GZLA 1YYCA 5CMZA 2H7HA 3IR9A 1A02J 5AVUB 1GK6A 5AVWB 5AW0B 2YNYA 2YO2A 5AVRB 3L36A 1NWQA 3VTPC 2BASA 1H89A 2N9BA 4M3LA 3NTNA 3M0AA 3VMZA 1FAVA 4GT1A 1JNMA 3T97A 4C7NA 1HJBA 3B8EB 2WTYA 1CSBA 1CI6B 3TNUB 3SWFA 1CI6A 3TNUA 3M0DA 4GKGA 2R32A 2WPRA 2WT7B 5AVTB 5APTA 5AW9B 4C7NB 1HUCA 3M9BA 1T2KC 3TK1A 1H88A 4B86A 3KDPB 3LIEA 5AW4B 2WPSA 3M9HA 3A5TA 3I5CA 1CZQA 3L35A 1GU5A 2WT7A 4AQRD 5APQA 3HTKA 3A2AA 5AW3B 2R5DA 2Q5UA 3M06A 5AW6B 2P2UA 3KQGA 5APSA 5APWA 5AVZB 2JJLA 2P67A 5AW1B 2P7JA 4EOTA 1MUUA 2WPQA 2R5BA 3VYIA 3TYYA 4JYBA 3P8MC 3HE5A 3V4QA 1SLQA 1S9KD 1MFZA 1H8AA 1SP4A 3VMYA 3M91A 4AYCA 1G2CB 2Q7CA 1T2KD 5AVQB 1HWTC 2R3CA 4JYCA 2W6AA 2XV5A 3OAKA 3P7KA 3MGNA 2Z5IA 2E43A 1NAFA 1J2JB 1X8YA 5APVA 3A7OA 5AW7B 1FOSE 1OXZA 2YO3A 4I2LC 2IPPA 5AVYB 2XZRA 1IO4A 5AW2B 3NMDA 5AW5B 1HBWA 3HE4B 1OWAA 5AW8B 4C46A 1MV8A 2Z5HA 5AVXB 2E42A 5AVVB 3VN0A 1A02F 1S9KE 1GD2E 1GTWA 2C9LY 1GK4A 3UIAA 3L37A 4HYTB 2KP8A 3HE4A 1DH3A 2ZXEB 4AUWA 4DZOA 3HE5B 3A3YB 3LIDA 3O8ZA 4KHXA 5APUA 5APXA 3V5BA 3P32A 3V4WA 2ZFCA 2C9NY 1JUNA 1GU4A 4LC1A 3VMXA 1FOSF 4I6MC 5AVSB 2QM8A 3NFQA 3NXSA 5APYA
chains in the Genus database with same CATH superfamily
1PGQA 3H1KD 3H1LE 2RKLA 2IDBA 3HD7D 4XE5B 1N73A 1SQVJ 1RE3C 3L73J 2KOGA 1L4AB 2Y9YA 4NPFX 2ZT9C 3AE4C 4GOEA 1YHQP 1A02J 1KQSO 1ZW0A 5AVWB 4OGQD 2FXOA 2HFED 1KTMA 1EXJA 1SFCD 4PD4D 3D70A 2OYHB 3WUVA 2JDIH 1NWQA 1N2DC 1USEA 3A0HE 3L71D 3G4SP 1IK7A 1SQPE 1HGZA 3H1KE 1LT1A 4H0LC 1FJKA 2L5GB 2N9BA 3PRJA 3L72E 4LLHA 4M3LA 3FWNA 1L0LG 1SQPJ 1JCDA 3U1AA 4IFMA 1ZR4A 2FFDA 1QLED 1OFCX 5GTIE 1LP1A 2ZYDA 3H1LD 1IFMA 1R5SA 1URQB 1L0LK 1CI6B 3ITKA 4N78E 3RK3E 2QEXP 2YXRB 1X0TA 2K1AA 3RBXA 3TF5A 1SQPK 4YXDC 1URQD 2WPRA 2WMMA 4IL6E 3IAOA 4DT0A 1W2EA 1HUCA 2QJKC 3M9BA 2FYUG 1AQTA 2JP3A 2H88C 3SWYA 4R4LA 4U7JA 3H1LJ 3A0HH 2B89A 2JEEA 4YPCA 3H1LG 1CZQA 4OWFA 3L72D 3RL0g 2PRRA 1GU5A 1L0LD 4WY4A 1Q90D 2YIUC 2PGDA 1NTMJ 3HTKA 3D6ZA 3A2AA 5CCHC 3CC4P 5AW6B 1ZV8A 1GL2B 1L0ND 1SQQD 3ABVC 3QH9A 2QRXA 1E5WA 2KNCB 2QJPC 4GODA 2JJLA 4R4MA 2P67A 2WSCH 1FC2C 4WWIA 4EOTA 3GHGA 1AV1A 3HUSB 2WPQA 2P58A 2P1JA 5CBOA 2R5BA 5KJ7C 1GL2D 1S4XA 2O01J 1PZQA 2RMZA 1ZOYC 2YIUB 1JY3O 1VQ4P 4RJTA 2IYPA 4BXLA 2N1TB 5BVZA 3Q5RA 2Y0DA 1YJNP 3AEEC 3PLNA 1AVOA 5CHXA 1BDCA 2E74B 1SFCB 3II6A 1Q81Q 1EDJA 2N1TD 1ZR2A 2OTKE 3GG2A 4HH2A 4K3AA 2Q7CA 1AFOA 1L2PA 1BDDA 1AVYA 3LW5J 1H88A 2A06G 2R3CA 1GW4A 1S3JA 2IZ0A 4H13C 1JY2P 1VL2A 2Z5IA 1EDLA 2I1JA 2Y0CA 5EFWB 4ASVA 4RKUJ 3L71J 1QEXA 4NPEA 1JEKA 1RF1A 1NTKE 1LWUC 3H1IG 1EDKA 1EDIA 1YBKA 3A0BE 4H13B 5KJ7D 3SWKA 3OW2O 1JY3P 1N86A 1VF5D 2D2CB 2WSFJ 2NPSA 3GHGC 2IPPA 1JO5A 2OYIA 1M7LA 5AW2B 1SS1A 2AXCA 3V2PA 1FZCB 1SFCC 3MHVA 1VQNP 1DEBA 3IF4A 1W5CE 4D6TJ 3AE1C 3MP7B 2FFDC 1WMKA 2Q6QA 5KAIE 3CX5E 1PIXA 4C46A 5AVXB 2W90A 1KFMA 4D6TG 2GUSA 2QG4A 3H1KG 1KB9E 2GUVA 3CMAP 1S9KE 3AE5C 1IC2A 1XTGB 3CL3D 1FDOA 1LT9A 3RL0B 1KB9I 4XFJA 2PP6A 1BCCE 1SQXE 3UIAA 3M9QA 1LNQA 2H89C 2WSEJ 1YQ3C 2ZXEB 4AUWA 3CWBJ 3CCQP 3PTZA 4UB6E 1L0NG 1N7SA 1SQBJ 1SQQG 2JWAA 2DW3A 3MUDC 3O6QB 2FYNB 4O9BA 4Y28J 1RY3A 3I56P 1N73C 1L0NJ 1NTMD 1SQQJ 1RE3A 3V5BA 2C9NY 1S2EA 1ZMEC 2A45I 2J59M 1U7MA 2IBZD 5TISH 1K05A 2WSCJ 4WB4A 1BE3G 1GL2A 3PJSK 3RK3D 3VMXA 4U3FD 4DCKA 3U1CA 3L73E 4UB8H 2Y9ZA 1EQ7A 1RF0A 2QJKB 1S5LX 1KB9H 3RK2D 1OVUA 1GMJA 3RK3B 3QWOC 2N9YB 4KT0J 5KTBA 3Q5PA 1NH4A 1KQLA 3RL0C 4CPGA 4JPZB 3W67A 1GZLA 1YYCA 2JWDA 3IR9A 3CC7P 2AXTE 4BRYB 1JMBA 3RK3C 2FXPA 2KS1B 2NPSD 5DJUB 3L73D 1BCCG 1SQXK 1M1JA 3BCCD 1X9VA 2QJYB 2V7QH 1IFJA 2J5UA 1ZLLA 1JMMA 2ZT9D 5KAFE 2HYNA 2KYVA 1S5LE 2FYUJ 1ZN5A 3M0AA 1QL1A 1M90Q 2I8DA 1YITP 1FAVA 3C8VA 2KLUA 3HRNA 3T97A 3U59A 3VOPA 2C0XA 1LTSC 2M5AB 3VMAA 1VQ6P 1SQBG 1IFPA 3KZIH 3TNUB 1L4AC 3JSVC 3KXDA 4HJGH 4YTPC 3TNUA 1N7SB 3SWFA 3PH0A 2MJZA 2E76C 1RHZB 1VQLP 4GKGA 1GW3A 2R32A 4D6TD 3K5BA 2WT7B 1T8ZA 1L0NK 1SQQK 2FBWC 2HODA 3BATA 3E1RA 1RE4A 4JQ0D 5AW9B 4C7NB 1SQXJ 1K8AQ 2Q1KA 1BE3E 1FBMA 3B5NC 3EFFK 3GLMA 3VP8A 4B86A 1DEEG 2OQQA 2WPVB 1SQXG 3AE2C 2Z4EA 3LIEA 2NRGA 3H1JG 3M9HA 4PV1D 3CWBE 4PV1C 4U3FE 4BWNA 3AE3C 3N4XA 1S5LH 4AQRD 3L74D 5GTIH 1VDFA 2K9JB 4PD4H 4N6JA 3G3ZA 3E7KA 3HD7A 1JM0A 1PPJG 3FXEA 3WU2E 4ZKPA 5APWA 1L0LJ 1SQPG 1Q86Q 2OTJP 2FY8A 5AW1B 1K04A 1JNMA 1QX8A 2HODB 4U3FJ 3A0BH 2IYOA 2N1TA 2RH0A 2Q9IA 1VF5B 3P8MC 1KQFB 3MUDA 3V4QA 1SLQA 1KB9D 2R44A 3AE8C 1HH0A 3GF7A 3H32A 4H0LD 3VP9A 1MFZA 1LTBC 4Y99B 3GHGB 3HUSA 2OARA 2BCCG 5CJ0A 1H0TB 4AYCA 1G2CB 1VQMP 1FZCC 4NPDA 2AEMA 1NTZG 1ZRTD 2KIKA 2LKMA 5AVQB 5CJ4A 1HWTC 1VQKP 4JYCA 3CCJP 3OAKA 2XV5A 3P7KA 1FDIA 1NTKK 1NAYA 1MZ9A 3RL0D 3USSA 3D71A 4WY4C 2KS1A 2FYUE 2KSEA 1LP1B 1G2CA 2G3AA 3L74E 2G8YA 3N7NA 4WY4D 3SFEC 3H1KJ 5APVA 3AEDC 3L72G 1FE6A 1NOHA 4I2LC 2YMYA 4IOIH 1OW8A 1OVVA 3O6QA 2XZRA 2YKQA 2KZIA 3S4RA 1MFTA 3L70D 3WMM0 1J1EB 3W68A 1U7JA 1PPJE 2HPCA 2Y0EA 1IK9A 2O3JA 2W8ZA 4L75A 2E42A 2K37A 3ZDMA 2FYZA 2IBZI 3CXHH 1GD2E 1T3JA 1YJ9P 1GTWA 1HJ0A 1FS0E 4U3FG 4YXWH 1GL2C 2B9BA 3MZWB 2KP8A 3V2NA 3BVHA 1DH3A 3P8CE 1JTHB 1RQVA 2QSIA 1FDMA 3CCVP 1USDA 1P84I 3A3YB 2NPSB 3S1KA 2BEQD 2ZAEB 3FGAD 3L71G 3O8ZA 5APUA 1KV4A 3V4WA 1IZNB 1YQ4C 3H1IJ 1IFIA 3AEFC 4H0LB 3WUUA 3JC22 4EI2A 1SQBE 1RF1B 3IN6A 2A06D 4LC1A 4PJ0E 3CX5H 4I6MC 3H32B 4GOFA 2E75B 2QM8A 1JOCA 1J1DC 1HBWA 1LTIC 3CXHE 4PJ0H 3AECC 3H1HE 2VRSA 2XU6A 3M0DC 4JBZA 2OYHA 3GMAA 1T2KC 1LTJA 3L72J 5KLIB 1Y9BA 4RESB 1SVFA 1J1EC 1LGHB 1N7SD 1YIJP 1SQBK 1M1KQ 5CMZA 5DJTB 2H7HA 2E75C 1N7SC 2LXBA 5AVUB 1GK6A 1KN7A 4IL6X 5AW0B 1LT9C 4I1LA 4W7YA 1QGKB 2KZJA 5KKZC 3L36A 2M5AA 2YXQB 3G6EP 1N8RQ 3H1HD 1PGPA 2LR2A 1EZVE 3HUSC 2IX7C 3BCCG 3H25A 1SQVE 4W7ZA 3L4FA 3L71E 3NTNA 4IFFA 1QL2A 1NTKG 3VMZA 3Q3DA 2JKVA 3BCCJ 2FYNC 2L91A 1PGJA 2FKWB 1T6AA 3CXHD 4GT1A 4HB1A 1BE3J 4GIFA 4PD4E 4C7NA 4EIJA 1CI6A 1G1IA 1LTTC 1M57D 3CCUP 3CCEP 1X79B 1LJ2A 1YI2P 2AXTH 1KQGB 5AVTB 5APTA 1JY3N 1X22A 1RF0C 2Q3EA 3HD7C 4W80A 3T97B 2XNDH 1BGYG 2KB7P 2KUBA 2OYOA 3AE7C 3AEAC 3KYQA 4GDOA 1NKZB 5TJHA 2IBZE 4OH8B 3KDPB 1BE3D 4XA4A 1EZVI 1OVRA 2B87B 2IBZG 2M8RA 1SQVD 1BCCJ 2B87A 3B4SA 3C9IA 3I5CA 5APQA 5CBNA 1NGMB 4QMAA 4WVZA 1LT9B 1FZAA 5KLVE 2KXPB 2ZYAA 3OJAB 5AW3B 2R5DA 1Q7YQ 3KZIE 2BCCJ 2P2UA 3H1JE 3KQGA 4N78D 5KLVD 3S9OA 4DJGA 3R4YA 1R8EA 1RH5B 1MUUA 1NTZJ 3L70E 3Q2YA 3Q5SA 4IL6H 4HKZH 1NU1D 2A45G 5B66H 2WZ7A 3HTKB 3TYYA 1OW7A 3CX5D 1BGYD 3B5NB 2FYUD 1KILA 3HE5A 4JYBA 4PV1B 3BCCE 2AEJA 2PAJA 5CCHA 3CPWO 1VQOP 2NZ2A 1NTKJ 1SP4A 4ASWA 1H8AA 1PGOA 1HGVA 1PV3A 3B5ND 2FFDB 3FXDA 1T2KD 5CCGA 2K9JA 2QIWA 3L75J 2CK3H 1N73B 2E5TA 2NPSC 3H1JJ 4OGQC 4RO0A 2OYIC 1T3UA 2W6AA 1L0NE 1SQQE 3WU2H 2E43A 1ZXGA 1S9KD 1NAFA 3H1HJ 2WSFH 1X8YA 1YTZT 1PFIA 1BGYE 2W6BA 3CCSP 1AQ5A 3H1HG 5KLVK 1N7LA 1D7MA 1URQA 3H6PA 4L74A 4TLFA 5B66E 3SFDC 3A7OA 1FOSE 1S72P 3EFGA 3KPEA 1U57A 3FX0A 3H1JD 3V2RA 1CW5A 2QE7H 1TU3F 2ZVNB 3MTUE 3P8CD 5AVYB 5B5EE 1Y47A 2XKMA 1FOSF 1IO4A 1P84D 3SSUA 3G71P 3HE4B 4EYYQ 1OWAA 1KILC 1NTMK 1JTHA 2KLVA 4TT3H 3JCUE 5AW8B 3TGUG 2D2CC 2IFMA 3WUTA 2CPSA 3VN0A 1A02F 1OW6A 3L70G 1J1DB 1SQBD 1Q82Q 5E79E 5K5GB 4WY4B 3G9RA 1KYOD 1YTZI 3RBZA 2J58A 2A06E 5CCGD 4DZOA 2HR3A 2HPCB 4I7ZB 2YMKA 3HE5B 5KLVG 2WQYC 2WITA 3OA7A 1BSHA 1Y8AA 2K9YA 4D6TE 3LIDA 5H2FH 2BCCE 2W6JH 5CCHD 4KHXA 4OGQB 5B5EH 4L76A 4C7RA 3P32A 1JCCA 2QJYC 1KFNA 2ZFCA 1IJDB 1PL5A 1IFNA 2H43A 2OYHC 5KKZB 4ZNCA 1GU4A 4ZKUA 1EXIA 1NTZD 5AVSB 4JF7A 1EC5A 3M91A 1RQUA 1HVVA 2YKOA 3MD0A 3NFQA 3NXSA 2KK7A 2Q3IA 5APYA 5AW4B 3Q1MA 1W2BO 5E79H 2K3RA 2M3EA 2QM7A 1EZVD 5L8RJ 2WWWA 1URQC 2W27A 4L73A 2E5YA 3L74J 2B88A 1VQ8P 3F89A 4N3YB 1FJPA 2ITAA 4KJMA 1H0TA 3L35A 2BEZF 1M8OB 3L75D 2YNYA 2YO2A 4DOJA 1SQPD 5AVRB 1XTCC 1SQVK 2QVAA 1P84H 2O1JA 3CI9A 1NTMG 5TISE 2BASA 1KZUB 3VTPC 1H89A 1KMIZ 1L4AA 2E75D 2R3SA 4I7ZC 4WBAA 1UIXA 4UB8E 1K9MQ 1AA0A 2GM4A 1NO4A 1KORA 3CWBD 4LGDE 1Q2NA 5GTHH 2QA4P 1NTZK 2IZ1A 2GA1A 1LTJB 3B8EB 4K35A 2WTYA 4IFDK 1VQ7P 3C1LA 1CSBA 5KJ7A 5H2FE 4PD4I 1Z56A 3M0DA 1L4AD 4Z1MH 4ZMDA 3CCMP 1DD3A 2M3BA 1L0LE 1VQ5P 1JY2O 3AE9C 1K73Q 3CCRP 1DD4A 1LTJC 3MIWA 3TK1A 1JY2N 2N1TC 2POHA 1HF9A 1HTLC 2OGUA 1FZBA 2I1KA 3V6IA 1MKMA 1NU1K 2CPBA 2WPSA 4MN4C 2O1KA 3A5TA 3CC2P 1FZGA 5KAFH 3AE6C 2E74D 3CX5I 1RF1C 2WT7A 1LWUA 3R2PA 3B71A 1FZCA 1LWUB 2M0BA 1AJYA 1PPJD 2P10A 2A45H 2XDJA 1LTAC 3KHUA 1NKNA 2O01N 2YKPA 4EDFA 2Q5UA 3M06A 3F5HA 2FXMA 5APSA 1SFCA 1NJIQ 5AVZB 4H44C 2KSJA 1NVOA 2LXCB 2P7JA 5CCGC 4A7PA 3L75G 1S1CX 4BRYA 1G1JA 5M1BA 1KYOE 3VYIA 1QVFO 3PP5A 1ZP0C 2PFXA 3B5NA 3TGUE 2ZYGA 1M1JB 1BSNA 3RK2C 4H13D 1EZVG 3CXHI 2AEFA 3AEBC 1VQ9P 3I55P 1IFDA 2HG5D 2KNCA 2O01H 1KILD 1LTGC 3GW6A 4UB6H 2E76B 2K88A 3PHLA 1WRGA 3VMYA 1BGYJ 1HJBA 1GDTA 1E79H 1PP9E 1NU1G 1PP9J 2WSSH 2V4HA 3BRVB 3EQ2A 5BU5A 5KAIH 1KC8Q 1WT6A 1VPCA 1PP9G 1NU1J 1NU1E 2E76D 4H44D 3CWBG 1ZRTE 3MGNA 1NTME 2ZXXA 5C39A 1J2JB 1VQPP 1NHLA 4H44B 3TGUJ 5BU8B 2WSEH 1KYOH 2HLOA 2JR8A 3L70J 1M56D 1NTZE 1BCCD 1SQVG 2IFNA 1OXZA 2W83C 1PP9D 2YO3A 3IFMA 3L73G 3TSIA 2MKVA 3AEGC 3EWKA 3TDKA 1FZEA 1DIPA 1KILE 3NMDA 5AW5B 2FYUK 2ZJSE 1YJWP 3D6YA 1UIIA 3LW5H 4OVNF 4Y99C 2BCCD 5KLVJ 1DX7A 2JO1A 3H1IE 3TGUD 1MV8A 2Z5HA 3CMEP 3GF3A 1VF5C 1JB0J 1R5LA 3E1IA 5AVVB 5AW7B 2UWJE 3CLQA 2C9LY 1M1JC 3RK2B 5KLIC 1GK4A 2XNXA 3L37A 1OIPA 2WVRA 4HYTB 1QVGO 3HE4A 2C0WA 2QJPB 1KD1Q 3BASA 1NTKD 1OZHA 3H1ID 2V7QJ 2RN0A 3CCLP 3CD6P 2D2CD 2OTLP 2OYIB 1OX3A 5APXA 3RGUA 3BRTB 1FU1A 3L74G 1FZFA 1JUNA 3L75E 1P84E 2SPZA 2KI7B 2E74C 2H8PD 2ZVOB 3FWLA 1KILB 1OMIA 3HD7B 3JCUH 1SQXD 1RE4C 1KYOI 2ZT9B 1NYHA 3V2QA 5GTHE
chains in the Genus database with same CATH topology
3HD7D 4XE5B 1N73A 1RE3C 2KOGA 1L4AB 1A02J 5AVWB 2HFED 1SFCD 2OYHB 1NWQA 1N2DC 1HGZA 3VP9A 4LLHA 1FJKA 2L5GB 2N9BA 4M3LA 3SWYA 3U1AA 1JCDA 1ZR4A 4IFMA 2FFDA 1IFMA 1URQB 1CI6B 1L0LK 4N78E 1SQPK 1URQD 2WPRA 1W2EA 1HUCA 3M9BA 2JEEA 1CZQA 1GU5A 4WY4A 3HTKA 3A2AA 5CCHC 5AW6B 1ZV8A 1GL2B 1E5WA 2JJLA 2P67A 2WSCH 4EOTA 3GHGA 3HUSB 2WPQA 2P1JA 2R5BA 5KJ7C 1GL2D 1JY3O 2N1TB 5BVZA 5CHXA 1SFCB 3II6A 2N1TD 1ZR2A 4HH2A 2Q7CA 1AFOA 2R3CA 1GW4A 1JY2P 2Z5IA 2I1JA 1RF1A 1LWUC 1JY3P 1N86A 2NPSA 3GHGC 2IPPA 1JO5A 2OYIA 1M7LA 5AW2B 3V2PA 1FZCB 1SFCC 1DEBA 2FFDC 4C46A 5AVXB 1KFMA 2GUSA 1S9KE 2GUVA 1IC2A 1XTGB 3CL3D 3RL0B 1LT9A 3UIAA 2PP6A 3M9QA 2ZXEB 4AUWA 1N7SA 4O9BA 1RY3A 1N73C 1RE3A 3V5BA 2C9NY 2A45I 2J59M 3RK3D 3U1CA 4WB4A 1GL2A 3VMXA 1FOSF 1EQ7A 1RF0A 3RK2D 3RK3B 5KTBA 1NH4A 1KQLA 3RL0C 1GZLA 1YYCA 3IR9A 3RK3C 2NPSD 1SQXK 1M1JA 1X9VA 1IFJA 1ZLLA 1JMMA 2HYNA 2KYVA 3M0AA 1ZN5A 1QL1A 1FAVA 3VOPA 3T97A 3HRNA 3U59A 2C0XA 1LTSC 3TNUB 3SWFA 1L4AC 3TNUA 1N7SB 2MJZA 4GKGA 1GW3A 2R32A 2WT7B 1T8ZA 1L0NK 1SQQK 2HODA 3BATA 5AW9B 4C7NB 1RE4A 3B5NC 1FBMA 3VP8A 4B86A 2Z4EA 3LIEA 3M9HA 3N4XA 4AQRD 1VDFA 4N6JA 3G3ZA 3HD7A 4ZKPA 5APWA 5AW1B 2HODB 2N1TA 2Q9IA 3P8MC 3MUDA 3V4QA 1SLQA 3H32A 1S9KD 1HH0A 1MFZA 1LTBC 4Y99B 3HUSA 3GHGB 2OARA 5CJ0A 4AYCA 1G2CB 1FZCC 2LKMA 5AVQB 5CJ4A 1HWTC 4JYCA 3OAKA 2XV5A 3P7KA 1NTKK 3RL0D 1MZ9A 4WY4C 3N7NA 1G2CA 4WY4D 5APVA 1NOHA 4I2LC 2YMYA 2XZRA 2YKQA 3WMM0 1J1EB 2HPCA 1IK9A 2E42A 2FYZA 1GD2E 1T3JA 1GTWA 1GL2C 2KP8A 3V2NA 3BVHA 1DH3A 3P8CE 1JTHB 1FDMA 3A3YB 2NPSB 3O8ZA 5APUA 3V4WA 1IFIA 1RF1B 4LC1A 4I6MC 3H32B 2QM8A 1HBWA 1JOCA 1J1DC 1LTIC 2OYHA 2VRSA 2XU6A 3M0DC 1LTJA 4RESB 1SVFA 1J1EC 1LGHB 1N7SD 1SQBK 5CMZA 2H7HA 1N7SC 5AVUB 1GK6A 5AW0B 1LT9C 4I1LA 4W7YA 3L36A 3HUSC 2IX7C 4W7ZA 3L4FA 3NTNA 4IFFA 1QL2A 3VMZA 5KJ7D 4GT1A 1JNMA 2FKWB 4C7NA 1HJBA 4GIFA 4EIJA 1LTTC 1G1IA 1CI6A 1X79B 5AVTB 5APTA 1JY3N 3HD7C 1RF0C 4W80A 1T2KC 2KB7P 1H88A 3KYQA 1NKZB 4OH8B 3KDPB 4XA4A 3I5CA 3L35A 2M8RA 3C9IA 5APQA 1LT9B 1FZAA 3OJAB 5AW3B 2R5DA 4N78D 2P2UA 3KQGA 1MUUA 2A45G 2WZ7A 3HTKB 3TYYA 3B5NB 4JYBA 1KILA 3HE5A 2PAJA 5CCHA 1H8AA 1SP4A 1HGVA 3B5ND 2FFDB 1T2KD 5CCGA 1N73B 2NPSC 2OYIC 1T3UA 2W6AA 2E43A 1NAFA 2WSFH 1X8YA 1YTZT 1PFIA 2W6BA 1AQ5A 5KLVK 1N7LA 1URQA 3H6PA 3A7OA 1FOSE 3EFGA 3KPEA 3V2RA 1CW5A 5AVYB 3MTUE 3P8CD 1IO4A 2XKMA 3HE4B 1OWAA 1KILC 1NTMK 1JTHA 2KLVA 5AW8B 2IFMA 2CPSA 3VN0A 1A02F 1J1DB 4WY4B 1YTZI 2J58A 5CCGD 4DZOA 2HPCB 3HE5B 2WITA 3OA7A 3LIDA 5CCHD 4KHXA 4C7RA 3P32A 1JCCA 2ZFCA 1KFNA 2H43A 1IJDB 2OYHC 1IFNA 1GU4A 4ZKUA 5AVSB 4JF7A 3NFQA 3M91A 3NXSA 1HVVA 2YKOA 3MD0A 5APYA 5AW4B 2Q3IA 2QM7A 2WWWA 1URQC 2W27A 4N3YB 1FJPA 2YNYA 2YO2A 4DOJA 5AVRB 1XTCC 1SQVK 2O1JA 3CI9A 3VTPC 2BASA 1KZUB 1H89A 1L4AA 2GM4A 1NO4A 4LGDE 1NTZK 1LTJB 3B8EB 2WTYA 4IFDK 1CSBA 5KJ7A 1Z56A 3M0DA 1L4AD 2M3BA 1JY2O 1LTJC 3MIWA 3TK1A 1JY2N 2N1TC 2POHA 1HTLC 1FZBA 2I1KA 1NU1K 2CPBA 2WPSA 3A5TA 2O1KA 1FZGA 1RF1C 2WT7A 1LWUA 3R2PA 1FZCA 1LWUB 2A45H 2XDJA 1LTAC 1NKNA 2YKPA 2Q5UA 3M06A 2FXMA 5APSA 1SFCA 5AVZB 2KSJA 2P7JA 5CCGC 1G1JA 3VYIA 3PP5A 3B5NA 1M1JB 3RK2C 1IFDA 2HG5D 2O01H 1KILD 1LTGC 3VMYA 1WRGA 1GDTA 3EQ2A 3BRVB 5BU5A 1WT6A 1VPCA 3MGNA 1J2JB 1NHLA 5BU8B 2WSEH 2HLOA 4WBAA 2IFNA 5AW7B 3IFMA 1OXZA 2YO3A 3TSIA 1FZEA 5AW5B 3NMDA 2FYUK 4Y99C 3LW5H 1DX7A 1MV8A 2Z5HA 5AVVB 3E1IA 3CLQA 2C9LY 1M1JC 3RK2B 1GK4A 2XNXA 3L37A 4HYTB 3HE4A 2C0WA 3BASA 2OYIB 5APXA 3BRTB 1FU1A 1FZFA 1JUNA 2H8PD 1KILB 3HD7B 1RE4C 3V2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MD0 A;  2Q3I A;  2VRS A;  2XU6 A;  4XE5 B;  2QM7 A;  2WWW A;  1KQL A;  2W27 A;  4RES B;  1GZL A;  1YYC A;  5CMZ A;  2H7H A;  3IR9 A;  1A02 J;  5AVU B;  1GK6 A;  5AVW B;  5AW0 B;  2YNY A;  2YO2 A;  5AVR B;  3L36 A;  1NWQ A;  3VTP C;  2BAS A;  1H89 A;  2N9B A;  4M3L A;  3NTN A;  3M0A A;  3VMZ A;  1FAV A;  4GT1 A;  1JNM A;  3T97 A;  4C7N A;  1HJB A;  3B8E B;  2WTY A;  1CSB A;  1CI6 B;  3TNU B;  3SWF A;  1CI6 A;  3TNU A;  3M0D A;  4GKG A;  2R32 A;  2WPR A;  2WT7 B;  5AVT B;  5APT A;  5AW9 B;  4C7N B;  1HUC A;  3M9B A;  1T2K C;  3TK1 A;  1H88 A;  4B86 A;  3KDP B;  3LIE A;  5AW4 B;  2WPS A;  3M9H A;  3A5T A;  3I5C A;  1CZQ A;  3L35 A;  1GU5 A;  2WT7 A;  4AQR D;  5APQ A;  3HTK A;  3A2A A;  5AW3 B;  2R5D A;  2Q5U A;  3M06 A;  5AW6 B;  2P2U A;  3KQG A;  5APS A;  5APW A;  5AVZ B;  2JJL A;  2P67 A;  5AW1 B;  2P7J A;  4EOT A;  1MUU A;  2WPQ A;  2R5B A;  3VYI A;  3TYY A;  4JYB A;  3P8M C;  3HE5 A;  3V4Q A;  1SLQ A;  1S9K D;  1MFZ A;  1H8A A;  1SP4 A;  3VMY A;  3M91 A;  4AYC A;  1G2C B;  2Q7C A;  1T2K D;  5AVQ B;  1HWT C;  2R3C A;  4JYC A;  2W6A A;  2XV5 A;  3OAK A;  3P7K A;  3MGN A;  2Z5I A;  2E43 A;  1NAF A;  1J2J B;  1X8Y A;  5APV A;  3A7O A;  5AW7 B;  1FOS E;  1OXZ A;  2YO3 A;  4I2L C;  2IPP A;  5AVY B;  2XZR A;  1IO4 A;  5AW2 B;  3NMD A;  5AW5 B;  1HBW A;  3HE4 B;  1OWA A;  5AW8 B;  4C46 A;  1MV8 A;  2Z5H A;  5AVX B;  2E42 A;  5AVV B;  3VN0 A;  1A02 F;  1S9K E;  1GD2 E;  1GTW A;  2C9L Y;  1GK4 A;  3UIA A;  3L37 A;  4HYT B;  2KP8 A;  3HE4 A;  1DH3 A;  2ZXE B;  4AUW A;  4DZO A;  3HE5 B;  3A3Y B;  3LID A;  3O8Z A;  4KHX A;  5APU A;  5APX A;  3V5B A;  3P32 A;  3V4W A;  2ZFC A;  2C9N Y;  1JUN A;  1GU4 A;  4LC1 A;  3VMX A;  1FOS F;  4I6M C;  5AVS B;  2QM8 A;  3NFQ A;  3NXS A;  5APY A; 
#chains in the Genus database with same CATH topology
 1PGQ A;  3H1K D;  3H1L E;  2RKL A;  2IDB A;  3HD7 D;  4XE5 B;  1N73 A;  1SQV J;  1RE3 C;  3L73 J;  2KOG A;  1L4A B;  2Y9Y A;  4NPF X;  2ZT9 C;  3AE4 C;  4GOE A;  1YHQ P;  1A02 J;  1KQS O;  1ZW0 A;  5AVW B;  4OGQ D;  2FXO A;  2HFE D;  1KTM A;  1EXJ A;  1SFC D;  4PD4 D;  3D70 A;  2OYH B;  3WUV A;  2JDI H;  1NWQ A;  1N2D C;  1USE A;  3A0H E;  3L71 D;  3G4S P;  1IK7 A;  1SQP E;  1HGZ A;  3H1K E;  1LT1 A;  4H0L C;  1FJK A;  2L5G B;  2N9B A;  3PRJ A;  3L72 E;  4LLH A;  4M3L A;  3FWN A;  1L0L G;  1SQP J;  1JCD A;  3U1A A;  4IFM A;  1ZR4 A;  2FFD A;  1QLE D;  1OFC X;  5GTI E;  1LP1 A;  2ZYD A;  3H1L D;  1IFM A;  1R5S A;  1URQ B;  1L0L K;  1CI6 B;  3ITK A;  4N78 E;  3RK3 E;  2QEX P;  2YXR B;  1X0T A;  2K1A A;  3RBX A;  3TF5 A;  1SQP K;  4YXD C;  1URQ D;  2WPR A;  2WMM A;  4IL6 E;  3IAO A;  4DT0 A;  1W2E A;  1HUC A;  2QJK C;  3M9B A;  2FYU G;  1AQT A;  2JP3 A;  2H88 C;  3SWY A;  4R4L A;  4U7J A;  3H1L J;  3A0H H;  2B89 A;  2JEE A;  4YPC A;  3H1L G;  1CZQ A;  4OWF A;  3L72 D;  3RL0 g;  2PRR A;  1GU5 A;  1L0L D;  4WY4 A;  1Q90 D;  2YIU C;  2PGD A;  1NTM J;  3HTK A;  3D6Z A;  3A2A A;  5CCH C;  3CC4 P;  5AW6 B;  1ZV8 A;  1GL2 B;  1L0N D;  1SQQ D;  3ABV C;  3QH9 A;  2QRX A;  1E5W A;  2KNC B;  2QJP C;  4GOD A;  2JJL A;  4R4M A;  2P67 A;  2WSC H;  1FC2 C;  4WWI A;  4EOT A;  3GHG A;  1AV1 A;  3HUS B;  2WPQ A;  2P58 A;  2P1J A;  5CBO A;  2R5B A;  5KJ7 C;  1GL2 D;  1S4X A;  2O01 J;  1PZQ A;  2RMZ A;  1ZOY C;  2YIU B;  1JY3 O;  1VQ4 P;  4RJT A;  2IYP A;  4BXL A;  2N1T B;  5BVZ A;  3Q5R A;  2Y0D A;  1YJN P;  3AEE C;  3PLN A;  1AVO A;  5CHX A;  1BDC A;  2E74 B;  1SFC B;  3II6 A;  1Q81 Q;  1EDJ A;  2N1T D;  1ZR2 A;  2OTK E;  3GG2 A;  4HH2 A;  4K3A A;  2Q7C A;  1AFO A;  1L2P A;  1BDD A;  1AVY A;  3LW5 J;  1H88 A;  2A06 G;  2R3C A;  1GW4 A;  1S3J A;  2IZ0 A;  4H13 C;  1JY2 P;  1VL2 A;  2Z5I A;  1EDL A;  2I1J A;  2Y0C A;  5EFW B;  4ASV A;  4RKU J;  3L71 J;  1QEX A;  4NPE A;  1JEK A;  1RF1 A;  1NTK E;  1LWU C;  3H1I G;  1EDK A;  1EDI A;  1YBK A;  3A0B E;  4H13 B;  5KJ7 D;  3SWK A;  3OW2 O;  1JY3 P;  1N86 A;  1VF5 D;  2D2C B;  2WSF J;  2NPS A;  3GHG C;  2IPP A;  1JO5 A;  2OYI A;  1M7L A;  5AW2 B;  1SS1 A;  2AXC A;  3V2P A;  1FZC B;  1SFC C;  3MHV A;  1VQN P;  1DEB A;  3IF4 A;  1W5C E;  4D6T J;  3AE1 C;  3MP7 B;  2FFD C;  1WMK A;  2Q6Q A;  5KAI E;  3CX5 E;  1PIX A;  4C46 A;  5AVX B;  2W90 A;  1KFM A;  4D6T G;  2GUS A;  2QG4 A;  3H1K G;  1KB9 E;  2GUV A;  3CMA P;  1S9K E;  3AE5 C;  1IC2 A;  1XTG B;  3CL3 D;  1FDO A;  1LT9 A;  3RL0 B;  1KB9 I;  4XFJ A;  2PP6 A;  1BCC E;  1SQX E;  3UIA A;  3M9Q A;  1LNQ A;  2H89 C;  2WSE J;  1YQ3 C;  2ZXE B;  4AUW A;  3CWB J;  3CCQ P;  3PTZ A;  4UB6 E;  1L0N G;  1N7S A;  1SQB J;  1SQQ G;  2JWA A;  2DW3 A;  3MUD C;  3O6Q B;  2FYN B;  4O9B A;  4Y28 J;  1RY3 A;  3I56 P;  1N73 C;  1L0N J;  1NTM D;  1SQQ J;  1RE3 A;  3V5B A;  2C9N Y;  1S2E A;  1ZME C;  2A45 I;  2J59 M;  1U7M A;  2IBZ D;  5TIS H;  1K05 A;  2WSC J;  4WB4 A;  1BE3 G;  1GL2 A;  3PJS K;  3RK3 D;  3VMX A;  4U3F D;  4DCK A;  3U1C A;  3L73 E;  4UB8 H;  2Y9Z A;  1EQ7 A;  1RF0 A;  2QJK B;  1S5L X;  1KB9 H;  3RK2 D;  1OVU A;  1GMJ A;  3RK3 B;  3QWO C;  2N9Y B;  4KT0 J;  5KTB A;  3Q5P A;  1NH4 A;  1KQL A;  3RL0 C;  4CPG A;  4JPZ B;  3W67 A;  1GZL A;  1YYC A;  2JWD A;  3IR9 A;  3CC7 P;  2AXT E;  4BRY B;  1JMB A;  3RK3 C;  2FXP A;  2KS1 B;  2NPS D;  5DJU B;  3L73 D;  1BCC G;  1SQX K;  1M1J A;  3BCC D;  1X9V A;  2QJY B;  2V7Q H;  1IFJ A;  2J5U A;  1ZLL A;  1JMM A;  2ZT9 D;  5KAF E;  2HYN A;  2KYV A;  1S5L E;  2FYU J;  1ZN5 A;  3M0A A;  1QL1 A;  1M90 Q;  2I8D A;  1YIT P;  1FAV A;  3C8V A;  2KLU A;  3HRN A;  3T97 A;  3U59 A;  3VOP A;  2C0X A;  1LTS C;  2M5A B;  3VMA A;  1VQ6 P;  1SQB G;  1IFP A;  3KZI H;  3TNU B;  1L4A C;  3JSV C;  3KXD A;  4HJG H;  4YTP C;  3TNU A;  1N7S B;  3SWF A;  3PH0 A;  2MJZ A;  2E76 C;  1RHZ B;  1VQL P;  4GKG A;  1GW3 A;  2R32 A;  4D6T D;  3K5B A;  2WT7 B;  1T8Z A;  1L0N K;  1SQQ K;  2FBW C;  2HOD A;  3BAT A;  3E1R A;  1RE4 A;  4JQ0 D;  5AW9 B;  4C7N B;  1SQX J;  1K8A Q;  2Q1K A;  1BE3 E;  1FBM A;  3B5N C;  3EFF K;  3GLM A;  3VP8 A;  4B86 A;  1DEE G;  2OQQ A;  2WPV B;  1SQX G;  3AE2 C;  2Z4E A;  3LIE A;  2NRG A;  3H1J G;  3M9H A;  4PV1 D;  3CWB E;  4PV1 C;  4U3F E;  4BWN A;  3AE3 C;  3N4X A;  1S5L H;  4AQR D;  3L74 D;  5GTI H;  1VDF A;  2K9J B;  4PD4 H;  4N6J A;  3G3Z A;  3E7K A;  3HD7 A;  1JM0 A;  1PPJ G;  3FXE A;  3WU2 E;  4ZKP A;  5APW A;  1L0L J;  1SQP G;  1Q86 Q;  2OTJ P;  2FY8 A;  5AW1 B;  1K04 A;  1JNM A;  1QX8 A;  2HOD B;  4U3F J;  3A0B H;  2IYO A;  2N1T A;  2RH0 A;  2Q9I A;  1VF5 B;  3P8M C;  1KQF B;  3MUD A;  3V4Q A;  1SLQ A;  1KB9 D;  2R44 A;  3AE8 C;  1HH0 A;  3GF7 A;  3H32 A;  4H0L D;  3VP9 A;  1MFZ A;  1LTB C;  4Y99 B;  3GHG B;  3HUS A;  2OAR A;  2BCC G;  5CJ0 A;  1H0T B;  4AYC A;  1G2C B;  1VQM P;  1FZC C;  4NPD A;  2AEM A;  1NTZ G;  1ZRT D;  2KIK A;  2LKM A;  5AVQ B;  5CJ4 A;  1HWT C;  1VQK P;  4JYC A;  3CCJ P;  3OAK A;  2XV5 A;  3P7K A;  1FDI A;  1NTK K;  1NAY A;  1MZ9 A;  3RL0 D;  3USS A;  3D71 A;  4WY4 C;  2KS1 A;  2FYU E;  2KSE A;  1LP1 B;  1G2C A;  2G3A A;  3L74 E;  2G8Y A;  3N7N A;  4WY4 D;  3SFE C;  3H1K J;  5APV A;  3AED C;  3L72 G;  1FE6 A;  1NOH A;  4I2L C;  2YMY A;  4IOI H;  1OW8 A;  1OVV A;  3O6Q A;  2XZR A;  2YKQ A;  2KZI A;  3S4R A;  1MFT A;  3L70 D;  3WMM 0;  1J1E B;  3W68 A;  1U7J A;  1PPJ E;  2HPC A;  2Y0E A;  1IK9 A;  2O3J A;  2W8Z A;  4L75 A;  2E42 A;  2K37 A;  3ZDM A;  2FYZ A;  2IBZ I;  3CXH H;  1GD2 E;  1T3J A;  1YJ9 P;  1GTW A;  1HJ0 A;  1FS0 E;  4U3F G;  4YXW H;  1GL2 C;  2B9B A;  3MZW B;  2KP8 A;  3V2N A;  3BVH A;  1DH3 A;  3P8C E;  1JTH B;  1RQV A;  2QSI A;  1FDM A;  3CCV P;  1USD A;  1P84 I;  3A3Y B;  2NPS B;  3S1K A;  2BEQ D;  2ZAE B;  3FGA D;  3L71 G;  3O8Z A;  5APU A;  1KV4 A;  3V4W A;  1IZN B;  1YQ4 C;  3H1I J;  1IFI A;  3AEF C;  4H0L B;  3WUU A;  3JC2 2;  4EI2 A;  1SQB E;  1RF1 B;  3IN6 A;  2A06 D;  4LC1 A;  4PJ0 E;  3CX5 H;  4I6M C;  3H32 B;  4GOF A;  2E75 B;  2QM8 A;  1JOC A;  1J1D C;  1HBW A;  1LTI C;  3CXH E;  4PJ0 H;  3AEC C;  3H1H E;  2VRS A;  2XU6 A;  3M0D C;  4JBZ A;  2OYH A;  3GMA A;  1T2K C;  1LTJ A;  3L72 J;  5KLI B;  1Y9B A;  4RES B;  1SVF A;  1J1E C;  1LGH B;  1N7S D;  1YIJ P;  1SQB K;  1M1K Q;  5CMZ A;  5DJT B;  2H7H A;  2E75 C;  1N7S C;  2LXB A;  5AVU B;  1GK6 A;  1KN7 A;  4IL6 X;  5AW0 B;  1LT9 C;  4I1L A;  4W7Y A;  1QGK B;  2KZJ A;  5KKZ C;  3L36 A;  2M5A A;  2YXQ B;  3G6E P;  1N8R Q;  3H1H D;  1PGP A;  2LR2 A;  1EZV E;  3HUS C;  2IX7 C;  3BCC G;  3H25 A;  1SQV E;  4W7Z A;  3L4F A;  3L71 E;  3NTN A;  4IFF A;  1QL2 A;  1NTK G;  3VMZ A;  3Q3D A;  2JKV A;  3BCC J;  2FYN C;  2L91 A;  1PGJ A;  2FKW B;  1T6A A;  3CXH D;  4GT1 A;  4HB1 A;  1BE3 J;  4GIF A;  4PD4 E;  4C7N A;  4EIJ A;  1CI6 A;  1G1I A;  1LTT C;  1M57 D;  3CCU P;  3CCE P;  1X79 B;  1LJ2 A;  1YI2 P;  2AXT H;  1KQG B;  5AVT B;  5APT A;  1JY3 N;  1X22 A;  1RF0 C;  2Q3E A;  3HD7 C;  4W80 A;  3T97 B;  2XND H;  1BGY G;  2KB7 P;  2KUB A;  2OYO A;  3AE7 C;  3AEA C;  3KYQ A;  4GDO A;  1NKZ B;  5TJH A;  2IBZ E;  4OH8 B;  3KDP B;  1BE3 D;  4XA4 A;  1EZV I;  1OVR A;  2B87 B;  2IBZ G;  2M8R A;  1SQV D;  1BCC J;  2B87 A;  3B4S A;  3C9I A;  3I5C A;  5APQ A;  5CBN A;  1NGM B;  4QMA A;  4WVZ A;  1LT9 B;  1FZA A;  5KLV E;  2KXP B;  2ZYA A;  3OJA B;  5AW3 B;  2R5D A;  1Q7Y Q;  3KZI E;  2BCC J;  2P2U A;  3H1J E;  3KQG A;  4N78 D;  5KLV D;  3S9O A;  4DJG A;  3R4Y A;  1R8E A;  1RH5 B;  1MUU A;  1NTZ J;  3L70 E;  3Q2Y A;  3Q5S A;  4IL6 H;  4HKZ H;  1NU1 D;  2A45 G;  5B66 H;  2WZ7 A;  3HTK B;  3TYY A;  1OW7 A;  3CX5 D;  1BGY D;  3B5N B;  2FYU D;  1KIL A;  3HE5 A;  4JYB A;  4PV1 B;  3BCC E;  2AEJ A;  2PAJ A;  5CCH A;  3CPW O;  1VQO P;  2NZ2 A;  1NTK J;  1SP4 A;  4ASW A;  1H8A A;  1PGO A;  1HGV A;  1PV3 A;  3B5N D;  2FFD B;  3FXD A;  1T2K D;  5CCG A;  2K9J A;  2QIW A;  3L75 J;  2CK3 H;  1N73 B;  2E5T A;  2NPS C;  3H1J J;  4OGQ C;  4RO0 A;  2OYI C;  1T3U A;  2W6A A;  1L0N E;  1SQQ E;  3WU2 H;  2E43 A;  1ZXG A;  1S9K D;  1NAF A;  3H1H J;  2WSF H;  1X8Y A;  1YTZ T;  1PFI A;  1BGY E;  2W6B A;  3CCS P;  1AQ5 A;  3H1H G;  5KLV K;  1N7L A;  1D7M A;  1URQ A;  3H6P A;  4L74 A;  4TLF A;  5B66 E;  3SFD C;  3A7O A;  1FOS E;  1S72 P;  3EFG A;  3KPE A;  1U57 A;  3FX0 A;  3H1J D;  3V2R A;  1CW5 A;  2QE7 H;  1TU3 F;  2ZVN B;  3MTU E;  3P8C D;  5AVY B;  5B5E E;  1Y47 A;  2XKM A;  1FOS F;  1IO4 A;  1P84 D;  3SSU A;  3G71 P;  3HE4 B;  4EYY Q;  1OWA A;  1KIL C;  1NTM K;  1JTH A;  2KLV A;  4TT3 H;  3JCU E;  5AW8 B;  3TGU G;  2D2C C;  2IFM A;  3WUT A;  2CPS A;  3VN0 A;  1A02 F;  1OW6 A;  3L70 G;  1J1D B;  1SQB D;  1Q82 Q;  5E79 E;  5K5G B;  4WY4 B;  3G9R A;  1KYO D;  1YTZ I;  3RBZ A;  2J58 A;  2A06 E;  5CCG D;  4DZO A;  2HR3 A;  2HPC B;  4I7Z B;  2YMK A;  3HE5 B;  5KLV G;  2WQY C;  2WIT A;  3OA7 A;  1BSH A;  1Y8A A;  2K9Y A;  4D6T E;  3LID A;  5H2F H;  2BCC E;  2W6J H;  5CCH D;  4KHX A;  4OGQ B;  5B5E H;  4L76 A;  4C7R A;  3P32 A;  1JCC A;  2QJY C;  1KFN A;  2ZFC A;  1IJD B;  1PL5 A;  1IFN A;  2H43 A;  2OYH C;  5KKZ B;  4ZNC A;  1GU4 A;  4ZKU A;  1EXI A;  1NTZ D;  5AVS B;  4JF7 A;  1EC5 A;  3M91 A;  1RQU A;  1HVV A;  2YKO A;  3MD0 A;  3NFQ A;  3NXS A;  2KK7 A;  2Q3I A;  5APY A;  5AW4 B;  3Q1M A;  1W2B O;  5E79 H;  2K3R A;  2M3E A;  2QM7 A;  1EZV D;  5L8R J;  2WWW A;  1URQ C;  2W27 A;  4L73 A;  2E5Y A;  3L74 J;  2B88 A;  1VQ8 P;  3F89 A;  4N3Y B;  1FJP A;  2ITA A;  4KJM A;  1H0T A;  3L35 A;  2BEZ F;  1M8O B;  3L75 D;  2YNY A;  2YO2 A;  4DOJ A;  1SQP D;  5AVR B;  1XTC C;  1SQV K;  2QVA A;  1P84 H;  2O1J A;  3CI9 A;  1NTM G;  5TIS E;  2BAS A;  1KZU B;  3VTP C;  1H89 A;  1KMI Z;  1L4A A;  2E75 D;  2R3S A;  4I7Z C;  4WBA A;  1UIX A;  4UB8 E;  1K9M Q;  1AA0 A;  2GM4 A;  1NO4 A;  1KOR A;  3CWB D;  4LGD E;  1Q2N A;  5GTH H;  2QA4 P;  1NTZ K;  2IZ1 A;  2GA1 A;  1LTJ B;  3B8E B;  4K35 A;  2WTY A;  4IFD K;  1VQ7 P;  3C1L A;  1CSB A;  5KJ7 A;  5H2F E;  4PD4 I;  1Z56 A;  3M0D A;  1L4A D;  4Z1M H;  4ZMD A;  3CCM P;  1DD3 A;  2M3B A;  1L0L E;  1VQ5 P;  1JY2 O;  3AE9 C;  1K73 Q;  3CCR P;  1DD4 A;  1LTJ C;  3MIW A;  3TK1 A;  1JY2 N;  2N1T C;  2POH A;  1HF9 A;  1HTL C;  2OGU A;  1FZB A;  2I1K A;  3V6I A;  1MKM A;  1NU1 K;  2CPB A;  2WPS A;  4MN4 C;  2O1K A;  3A5T A;  3CC2 P;  1FZG A;  5KAF H;  3AE6 C;  2E74 D;  3CX5 I;  1RF1 C;  2WT7 A;  1LWU A;  3R2P A;  3B71 A;  1FZC A;  1LWU B;  2M0B A;  1AJY A;  1PPJ D;  2P10 A;  2A45 H;  2XDJ A;  1LTA C;  3KHU A;  1NKN A;  2O01 N;  2YKP A;  4EDF A;  2Q5U A;  3M06 A;  3F5H A;  2FXM A;  5APS A;  1SFC A;  1NJI Q;  5AVZ B;  4H44 C;  2KSJ A;  1NVO A;  2LXC B;  2P7J A;  5CCG C;  4A7P A;  3L75 G;  1S1C X;  4BRY A;  1G1J A;  5M1B A;  1KYO E;  3VYI A;  1QVF O;  3PP5 A;  1ZP0 C;  2PFX A;  3B5N A;  3TGU E;  2ZYG A;  1M1J B;  1BSN A;  3RK2 C;  4H13 D;  1EZV G;  3CXH I;  2AEF A;  3AEB C;  1VQ9 P;  3I55 P;  1IFD A;  2HG5 D;  2KNC A;  2O01 H;  1KIL D;  1LTG C;  3GW6 A;  4UB6 H;  2E76 B;  2K88 A;  3PHL A;  1WRG A;  3VMY A;  1BGY J;  1HJB A;  1GDT A;  1E79 H;  1PP9 E;  1NU1 G;  1PP9 J;  2WSS H;  2V4H A;  3BRV B;  3EQ2 A;  5BU5 A;  5KAI H;  1KC8 Q;  1WT6 A;  1VPC A;  1PP9 G;  1NU1 J;  1NU1 E;  2E76 D;  4H44 D;  3CWB G;  1ZRT E;  3MGN A;  1NTM E;  2ZXX A;  5C39 A;  1J2J B;  1VQP P;  1NHL A;  4H44 B;  3TGU J;  5BU8 B;  2WSE H;  1KYO H;  2HLO A;  2JR8 A;  3L70 J;  1M56 D;  1NTZ E;  1BCC D;  1SQV G;  2IFN A;  1OXZ A;  2W83 C;  1PP9 D;  2YO3 A;  3IFM A;  3L73 G;  3TSI A;  2MKV A;  3AEG C;  3EWK A;  3TDK A;  1FZE A;  1DIP A;  1KIL E;  3NMD A;  5AW5 B;  2FYU K;  2ZJS E;  1YJW P;  3D6Y A;  1UII A;  3LW5 H;  4OVN F;  4Y99 C;  2BCC D;  5KLV J;  1DX7 A;  2JO1 A;  3H1I E;  3TGU D;  1MV8 A;  2Z5H A;  3CME P;  3GF3 A;  1VF5 C;  1JB0 J;  1R5L A;  3E1I A;  5AVV B;  5AW7 B;  2UWJ E;  3CLQ A;  2C9L Y;  1M1J C;  3RK2 B;  5KLI C;  1GK4 A;  2XNX A;  3L37 A;  1OIP A;  2WVR A;  4HYT B;  1QVG O;  3HE4 A;  2C0W A;  2QJP B;  1KD1 Q;  3BAS A;  1NTK D;  1OZH A;  3H1I D;  2V7Q J;  2RN0 A;  3CCL P;  3CD6 P;  2D2C D;  2OTL P;  2OYI B;  1OX3 A;  5APX A;  3RGU A;  3BRT B;  1FU1 A;  3L74 G;  1FZF A;  1JUN A;  3L75 E;  1P84 E;  2SPZ A;  2KI7 B;  2E74 C;  2H8P D;  2ZVO B;  3FWL A;  1KIL B;  1OMI A;  3HD7 B;  3JCU H;  1SQX D;  1RE4 C;  1KYO I;  2ZT9 B;  1NYH A;  3V2Q A;  5GTH E; 
#chains in the Genus database with same CATH homology
 3HD7 D;  4XE5 B;  1N73 A;  1RE3 C;  2KOG A;  1L4A B;  1A02 J;  5AVW B;  2HFE D;  1SFC D;  2OYH B;  1NWQ A;  1N2D C;  1HGZ A;  3VP9 A;  4LLH A;  1FJK A;  2L5G B;  2N9B A;  4M3L A;  3SWY A;  3U1A A;  1JCD A;  1ZR4 A;  4IFM A;  2FFD A;  1IFM A;  1URQ B;  1CI6 B;  1L0L K;  4N78 E;  1SQP K;  1URQ D;  2WPR A;  1W2E A;  1HUC A;  3M9B A;  2JEE A;  1CZQ A;  1GU5 A;  4WY4 A;  3HTK A;  3A2A A;  5CCH C;  5AW6 B;  1ZV8 A;  1GL2 B;  1E5W A;  2JJL A;  2P67 A;  2WSC H;  4EOT A;  3GHG A;  3HUS B;  2WPQ A;  2P1J A;  2R5B A;  5KJ7 C;  1GL2 D;  1JY3 O;  2N1T B;  5BVZ A;  5CHX A;  1SFC B;  3II6 A;  2N1T D;  1ZR2 A;  4HH2 A;  2Q7C A;  1AFO A;  2R3C A;  1GW4 A;  1JY2 P;  2Z5I A;  2I1J A;  1RF1 A;  1LWU C;  1JY3 P;  1N86 A;  2NPS A;  3GHG C;  2IPP A;  1JO5 A;  2OYI A;  1M7L A;  5AW2 B;  3V2P A;  1FZC B;  1SFC C;  1DEB A;  2FFD C;  4C46 A;  5AVX B;  1KFM A;  2GUS A;  1S9K E;  2GUV A;  1IC2 A;  1XTG B;  3CL3 D;  3RL0 B;  1LT9 A;  3UIA A;  2PP6 A;  3M9Q A;  2ZXE B;  4AUW A;  1N7S A;  4O9B A;  1RY3 A;  1N73 C;  1RE3 A;  3V5B A;  2C9N Y;  2A45 I;  2J59 M;  3RK3 D;  3U1C A;  4WB4 A;  1GL2 A;  3VMX A;  1FOS F;  1EQ7 A;  1RF0 A;  3RK2 D;  3RK3 B;  5KTB A;  1NH4 A;  1KQL A;  3RL0 C;  1GZL A;  1YYC A;  3IR9 A;  3RK3 C;  2NPS D;  1SQX K;  1M1J A;  1X9V A;  1IFJ A;  1ZLL A;  1JMM A;  2HYN A;  2KYV A;  3M0A A;  1ZN5 A;  1QL1 A;  1FAV A;  3VOP A;  3T97 A;  3HRN A;  3U59 A;  2C0X A;  1LTS C;  3TNU B;  3SWF A;  1L4A C;  3TNU A;  1N7S B;  2MJZ A;  4GKG A;  1GW3 A;  2R32 A;  2WT7 B;  1T8Z A;  1L0N K;  1SQQ K;  2HOD A;  3BAT A;  5AW9 B;  4C7N B;  1RE4 A;  3B5N C;  1FBM A;  3VP8 A;  4B86 A;  2Z4E A;  3LIE A;  3M9H A;  3N4X A;  4AQR D;  1VDF A;  4N6J A;  3G3Z A;  3HD7 A;  4ZKP A;  5APW A;  5AW1 B;  2HOD B;  2N1T A;  2Q9I A;  3P8M C;  3MUD A;  3V4Q A;  1SLQ A;  3H32 A;  1S9K D;  1HH0 A;  1MFZ A;  1LTB C;  4Y99 B;  3HUS A;  3GHG B;  2OAR A;  5CJ0 A;  4AYC A;  1G2C B;  1FZC C;  2LKM A;  5AVQ B;  5CJ4 A;  1HWT C;  4JYC A;  3OAK A;  2XV5 A;  3P7K A;  1NTK K;  3RL0 D;  1MZ9 A;  4WY4 C;  3N7N A;  1G2C A;  4WY4 D;  5APV A;  1NOH A;  4I2L C;  2YMY A;  2XZR A;  2YKQ A;  3WMM 0;  1J1E B;  2HPC A;  1IK9 A;  2E42 A;  2FYZ A;  1GD2 E;  1T3J A;  1GTW A;  1GL2 C;  2KP8 A;  3V2N A;  3BVH A;  1DH3 A;  3P8C E;  1JTH B;  1FDM A;  3A3Y B;  2NPS B;  3O8Z A;  5APU A;  3V4W A;  1IFI A;  1RF1 B;  4LC1 A;  4I6M C;  3H32 B;  2QM8 A;  1HBW A;  1JOC A;  1J1D C;  1LTI C;  2OYH A;  2VRS A;  2XU6 A;  3M0D C;  1LTJ A;  4RES B;  1SVF A;  1J1E C;  1LGH B;  1N7S D;  1SQB K;  5CMZ A;  2H7H A;  1N7S C;  5AVU B;  1GK6 A;  5AW0 B;  1LT9 C;  4I1L A;  4W7Y A;  3L36 A;  3HUS C;  2IX7 C;  4W7Z A;  3L4F A;  3NTN A;  4IFF A;  1QL2 A;  3VMZ A;  5KJ7 D;  4GT1 A;  1JNM A;  2FKW B;  4C7N A;  1HJB A;  4GIF A;  4EIJ A;  1LTT C;  1G1I A;  1CI6 A;  1X79 B;  5AVT B;  5APT A;  1JY3 N;  3HD7 C;  1RF0 C;  4W80 A;  1T2K C;  2KB7 P;  1H88 A;  3KYQ A;  1NKZ B;  4OH8 B;  3KDP B;  4XA4 A;  3I5C A;  3L35 A;  2M8R A;  3C9I A;  5APQ A;  1LT9 B;  1FZA A;  3OJA B;  5AW3 B;  2R5D A;  4N78 D;  2P2U A;  3KQG A;  1MUU A;  2A45 G;  2WZ7 A;  3HTK B;  3TYY A;  3B5N B;  4JYB A;  1KIL A;  3HE5 A;  2PAJ A;  5CCH A;  1H8A A;  1SP4 A;  1HGV A;  3B5N D;  2FFD B;  1T2K D;  5CCG A;  1N73 B;  2NPS C;  2OYI C;  1T3U A;  2W6A A;  2E43 A;  1NAF A;  2WSF H;  1X8Y A;  1YTZ T;  1PFI A;  2W6B A;  1AQ5 A;  5KLV K;  1N7L A;  1URQ A;  3H6P A;  3A7O A;  1FOS E;  3EFG A;  3KPE A;  3V2R A;  1CW5 A;  5AVY B;  3MTU E;  3P8C D;  1IO4 A;  2XKM A;  3HE4 B;  1OWA A;  1KIL C;  1NTM K;  1JTH A;  2KLV A;  5AW8 B;  2IFM A;  2CPS A;  3VN0 A;  1A02 F;  1J1D B;  4WY4 B;  1YTZ I;  2J58 A;  5CCG D;  4DZO A;  2HPC B;  3HE5 B;  2WIT A;  3OA7 A;  3LID A;  5CCH D;  4KHX A;  4C7R A;  3P32 A;  1JCC A;  2ZFC A;  1KFN A;  2H43 A;  1IJD B;  2OYH C;  1IFN A;  1GU4 A;  4ZKU A;  5AVS B;  4JF7 A;  3NFQ A;  3M91 A;  3NXS A;  1HVV A;  2YKO A;  3MD0 A;  5APY A;  5AW4 B;  2Q3I A;  2QM7 A;  2WWW A;  1URQ C;  2W27 A;  4N3Y B;  1FJP A;  2YNY A;  2YO2 A;  4DOJ A;  5AVR B;  1XTC C;  1SQV K;  2O1J A;  3CI9 A;  3VTP C;  2BAS A;  1KZU B;  1H89 A;  1L4A A;  2GM4 A;  1NO4 A;  4LGD E;  1NTZ K;  1LTJ B;  3B8E B;  2WTY A;  4IFD K;  1CSB A;  5KJ7 A;  1Z56 A;  3M0D A;  1L4A D;  2M3B A;  1JY2 O;  1LTJ C;  3MIW A;  3TK1 A;  1JY2 N;  2N1T C;  2POH A;  1HTL C;  1FZB A;  2I1K A;  1NU1 K;  2CPB A;  2WPS A;  3A5T A;  2O1K A;  1FZG A;  1RF1 C;  2WT7 A;  1LWU A;  3R2P A;  1FZC A;  1LWU B;  2A45 H;  2XDJ A;  1LTA C;  1NKN A;  2YKP A;  2Q5U A;  3M06 A;  2FXM A;  5APS A;  1SFC A;  5AVZ B;  2KSJ A;  2P7J A;  5CCG C;  1G1J A;  3VYI A;  3PP5 A;  3B5N A;  1M1J B;  3RK2 C;  1IFD A;  2HG5 D;  2O01 H;  1KIL D;  1LTG C;  3VMY A;  1WRG A;  1GDT A;  3EQ2 A;  3BRV B;  5BU5 A;  1WT6 A;  1VPC A;  3MGN A;  1J2J B;  1NHL A;  5BU8 B;  2WSE H;  2HLO A;  4WBA A;  2IFN A;  5AW7 B;  3IFM A;  1OXZ A;  2YO3 A;  3TSI A;  1FZE A;  5AW5 B;  3NMD A;  2FYU K;  4Y99 C;  3LW5 H;  1DX7 A;  1MV8 A;  2Z5H A;  5AVV B;  3E1I A;  3CLQ A;  2C9L Y;  1M1J C;  3RK2 B;  1GK4 A;  2XNX A;  3L37 A;  4HYT B;  3HE4 A;  2C0W A;  3BAS A;  2OYI B;  5APX A;  3BRT B;  1FU1 A;  1FZF A;  1JUN A;  2H8P D;  1KIL B;  3HD7 B;  1RE4 C;  3V2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...