5CMZA

Artificial hiv fusion inhibitor ap3 fused to the c-terminus of gp41 nhr
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
43
structure length
43
Chain Sequence
IVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improved Pharmacological and Structural Properties of HIV Fusion Inhibitor AP3 over Enfuvirtide: Highlighting Advantages of Artificial Peptide Strategy.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/inhibitor
molecule keywords Envelope glycoprotein
total genus 20
structure length 43
sequence length 43
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5cmzA00
5AVYB 5AW4B 1CSBA 5AW6B 3MD0A 3TK1A 1CI6A 3MGNA 4B86A 2P67A 3O8ZA 2Z5IA 1CI6B 4LC1A 5AVZB 1GU5A 1T2KC 1CZQA 2YO2A 1T2KD 2VRSA 2P2UA 3TYYA 2XV5A 1NWQA 4HYTB 1OXZA 3VN0A 4I6MC 5AW9B 3A2AA 1X8YA 3KDPB 1G2CB 5APVA 3VMYA 1IO4A 1MV8A 2XU6A 5AW5B 3M91A 4KHXA 2WTYA 5AVWB 4AYCA 4C46A 1JNMA 5AVTB 2WPQA 2IPPA 3VMZA 4DZOA 2C9NY 5AW7B 1OWAA 4JYBA 5AW1B 3OAKA 4M3LA 2R5DA 5AVRB 2P7JA 1HJBA 2E42A 3M9HA 3HE5A 3T97A 5APSA 2QM8A 1GZLA 5AVXB 2BASA 1KQLA 3A5TA 2KP8A 2WWWA 1HBWA 3HE4A 1HWTC 4AUWA 3IR9A 3L35A 4GT1A 5CMZA 1SP4A 3TNUB 3NMDA 2WPSA 3P7KA 4RESB 3NXSA 1SLQA 2XZRA 3V4QA 5AVUB 5APWA 1HUCA 1H89A 4I2LC 2Q7CA 1GTWA 1NAFA 2ZXEB 1MUUA 3A7OA 1YYCA 2R32A 3V5BA 4C7NB 1H8AA 1A02J 2YNYA 2R3CA 3HTKA 1GU4A 1JUNA 2WT7B 4JYCA 3M9BA 2H7HA 1S9KE 3P8MC 4XE5B 3HE5B 2JJLA 5AVSB 3KQGA 3M06A 5APXA 2W27A 1MFZA 3B8EB 3LIEA 3P32A 5APTA 3SWFA 3M0DA 2QM7A 1FOSF 1GK4A 2WPRA 5AW8B 1A02F 2N9BA 2W6AA 2R5BA 3NTNA 5AVVB 5AW2B 3L36A 5AW0B 5AW3B 2Q5UA 2Z5HA 2C9LY 2ZFCA 3A3YB 5APYA 2Q3IA 3HE4B 3UIAA 2YO3A 3NFQA 4C7NA 5APQA 2WT7A 3LIDA 1FOSE 3L37A 4GKGA 3V4WA 3I5CA 1GK6A 3VMXA 1DH3A 1FAVA 1H88A 3VTPC 3VYIA 1J2JB 3TNUA 4AQRD 5APUA 4EOTA 1S9KD 2E43A 1GD2E 5AVQB 3M0AA
chains in the Genus database with same CATH superfamily
5KLIC 1TU3F 4H13B 5C39A 3AEAC 2E74D 4OGQD 1L0NE 5CCHD 1YQ3C 3O8ZA 4IL6H 4LC1A 1JM0A 1U7JA 1T2KC 2R44A 5TISH 1X0TA 1YJNP 2K9JB 4H44C 1L0LD 1OIPA 4DJGA 2E74B 3TYYA 2XV5A 1BDDA 1DD4A 4HYTB 4OGQB 2QSIA 1RF1A 2PGDA 2QJKB 2ZVOB 2WVRA 1AV1A 5APVA 1RF1B 3KDPB 2WSCH 1GW4A 1KILC 1SQXG 3OA7A 2HFED 4NPDA 4WWIA 3D6YA 5KLVK 2D2CB 2WQYC 5AW5B 1HF9A 1BGYJ 2KNCA 5TISE 1SQVK 1VF5B 1K04A 1EXJA 3FWLA 2A45G 4C46A 1EDIA 1VDFA 3CLQA 1K9MQ 2JKVA 1LNQA 2NPSA 2Y0DA 2E75D 1KORA 4DZOA 1DX7A 5KLVJ 3D71A 4JYBA 1ZRTD 2A06E 5AW1B 3OAKA 4EDFA 3F89A 1KC8Q 4BRYB 5KJ7D 4M3LA 2I8DA 2M3BA 1Y9BA 3A0HE 3CCMP 1JCDA 1VQOP 2R5DA 2OYIC 1DEBA 2E75B 4PJ0H 1KILD 1R5SA 1L0LE 1WRGA 1MZ9A 3O6QB 4MN4C 3T97A 4IFMA 3TDKA 2FFDB 4WY4C 1FDIA 2WZ7A 3CXHH 1N7LA 4YTPC 1T6AA 1JY2N 4WBAA 4W80A 4KT0J 5APSA 1RE3A 1GZLA 2QM8A 1PZQA 2L91A 3B5NC 4PD4I 2N1TA 4RO0A 1GL2A 3R4YA 2KP8A 1S5LX 4IFFA 2WSFJ 3WUTA 1DEEG 3A5TA 1HBWA 1VQ7P 2BCCG 3H25A 1SP4A 2IBZD 4TT3H 3L70J 2WMMA 2ZXXA 1NJIQ 4Y28J 2J59M 1OVVA 4GODA 1OVRA 3G3ZA 4N78E 2NZ2A 3V2RA 2AXCA 3H1HJ 1SQPD 5AVUB 1KILE 1PGQA 1VQPP 3JCUE 1EDLA 1FZAA 1VQ4P 2HG5D 2FYUJ 3EWKA 3L74J 3JC22 3MHVA 1FZCB 1M57D 4HB1A 1NGMB 3R2PA 1GTWA 1GD2E 1EC5A 3B5ND 2ZXEB 1MUUA 2O01N 2JR8A 2QJPC 4EI2A 2JP3A 4EIJA 1JB0J 1YYCA 1MFTA 3H1LJ 4C7NB 3L71E 1H8AA 2FXOA 1SVFA 1YBKA 2YMKA 1GU4A 2V7QJ 2WT7B 1PP9G 3MTUE 1OX3A 3H1IG 4JYCA 3CMEP 1KFMA 4U3FE 1KYOE 3AEBC 4H0LC 2FYUE 2YIUB 1USEA 1LT9C 3PP5A 2ZYDA 2K1AA 1JY2O 3T97B 4BRYA 3KQGA 3VP8A 5KLVE 2R3SA 5APXA 3C9IA 1MFZA 1Q82Q 3H1LE 2QM7A 3L71J 3M0DA 5KAIE 1SQBG 5K5GB 1NTKD 3GW6A 3LW5J 3G71P 1ZR4A 3CXHI 1NU1J 1FOSF 1L4AB 1T3JA 2R5BA 1G1JA 5AVVB 3Q3DA 1KTMA 2B87A 1OW6A 4L75A 3PHLA 3ITKA 1HGZA 2Z5HA 3ZDMA 1M90Q 1IFMA 2W8ZA 1RF0A 2OTKE 3UIAA 4H0LD 1M1JC 1OMIA 1PGJA 2MJZA 4ZNCA 3H1KJ 5KLIB 1LWUA 3CCJP 5GTHH 3SFDC 3PJSK 1VQNP 5B66H 2N1TD 3LIDA 3RK3B 3L37A 4GKGA 4I1LA 1NVOA 3V4WA 3I5CA 3MUDC 1GL2B 1L0NJ 4NPFX 2CPBA 3S4RA 3SFEC 1NTKG 3FWNA 2AEFA 3RK2C 3KZIH 2CPSA 3IFMA 2POHA 5EFWB 1FZCA 3CX5H 4UB6H 1RE4C 1AVYA 5AVYB 5AW4B 1CSBA 2D2CD 1BCCJ 2G3AA 3GG2A 2ZAEB 3TK1A 2KIKA 1KYOI 2GUVA 2P67A 3FX0A 4O9BA 4GIFA 3AE8C 3L73E 1LTJA 1LTSC 3AE2C 1VF5C 2OTJP 3L70D 2KYVA 4I7ZB 3KYQA 5KJ7C 3HUSA 1NU1E 1SQPG 3OW2O 1YITP 1NWQA 2O1KA 1JCCA 1L4AA 2WSEJ 3EFFK 1OXZA 3EFGA 2FYNB 3VN0A 1YTZT 2IBZI 2QJKC 2XDJA 2PP6A 4K35A 2KZJA 2OYHB 2MKVA 3VMYA 1X8YA 1NTZG 1W5CE 2WSEH 3Q1MA 1LTAC 3H1JG 3BVHA 1UIXA 3M91A 2JEEA 1EXIA 1FS0E 1P84E 2BCCE 3GMAA 3HD7A 1KYOD 4KHXA 5CBOA 5KKZB 1QL1A 5KTBA 3CCUP 4AYCA 3KPEA 4QMAA 1JOCA 1Z56A 3C1LA 1JNMA 3BCCD 3P8CD 1NKNA 5AW7B 3PH0A 1Q7YQ 2KSJA 2OGUA 3L71D 1BE3E 1ZP0C 1NTMD 3K5BA 1BGYG 5M1BA 3CMAP 1NTMJ 1JMBA 3AE3C 3HTKB 1WMKA 1JEKA 2IYPA 1EQ7A 1YIJP 3BCCJ 2WITA 5H2FE 5AVRB 2IFNA 3S9OA 2C0XA 4I7ZC 1QGKB 2XNDH 5KLVG 2KSEA 4HKZH 5E79H 1N7SC 2KUBA 4WVZA 3AEEC 5KAFH 1H0TA 2FKWB 4HJGH 4WY4B 5CCHA 3TF5A 2YKOA 1IC2A 1KFNA 2IZ0A 4C7RA 2OYHC 1M7LA 3S1KA 1VQKP 1LTJB 2BASA 1FDOA 2N9YB 3H1HE 1BE3D 1JMMA 2J58A 2LR2A 1L0LK 2Y0CA 1E5WA 3L35A 4IOIH 2CK3H 1J1EC 3TNUB 2PFXA 1FZBA 3P7KA 1S5LE 5DJUB 3VOPA 4BWNA 3CC7P 5GTIE 1XTCC 3FXEA 1MKMA 2ZVNB 1ZR2A 1N7SD 5B66E 2NRGA 2YXQB 5GTIH 4XA4A 4UB8H 1KV4A 1N2DC 1LTGC 1M56D 3TGUJ 1SFCB 3G4SP 2KS1B 1BE3J 3SSUA 3CCQP 1RHZB 2K3RA 1NAFA 2A45H 1E79H 3A7OA 1LWUB 1ZRTE 2A06D 3H1HG 1URQC 1HH0A 1ZOYC 3HTKA 3L74G 1K05A 2H7HA 2M3EA 2ZJSE 2GA1A 2KLVA 5CJ0A 1EDJA 1KILA 4XE5B 3CL3D 1PPJE 1OVUA 4L73A 4H0LB 1KD1Q 1LP1B 3VP9A 2JJLA 2Y9YA 1SQQD 2BEQD 1DD3A 1IFNA 1KB9H 1LP1A 5CCGA 2W27A 3LIEA 4GOFA 1U7MA 5APTA 4H13D 2H43A 4XFJA 3CWBJ 2WPRA 1WT6A 3MIWA 4WY4D 3TSIA 4LLHA 1W2EA 1Y8AA 1JTHB 4OVNF 2QIWA 1Q86Q 3AE7C 1D7MA 2Z4EA 2K88A 1FZEA 3RK3E 1LTIC 3HUSB 1G2CA 5AW3B 3CCSP 2IDBA 2QG4A 2Q5UA 3L71G 1YI2P 1SQBJ 1M1KQ 2C9LY 3A3YB 3CD6P 1NU1G 1L0ND 1SQQJ 2Q3IA 2YO3A 2XNXA 2A45I 3NFQA 2E76B 4C7NA 4H44B 3JCUH 1NTZK 3W68A 1FC2C 2Q3EA 1R5LA 3IN6A 3RK3D 2WT7A 2G8YA 1L0LJ 2PRRA 2QRXA 1FOSE 1IFDA 2SPZA 3B5NA 4H13C 4L76A 3CC4P 1GL2C 4GDOA 2Y0EA 3H6PA 1DH3A 1NYHA 2E76D 4D6TJ 2O3JA 3B71A 1J2JB 3TNUA 3CPWO 1SFCA 3H1KE 1ZV8A 4EOTA 3CCVP 2WSCJ 2W6BA 3L74D 4W7ZA 1SQQE 1S3JA 5AVQB 1JO5A 5AW6B 3GHGA 3H1IE 1NTKJ 3MD0A 4U3FD 1CI6A 4DOJA 1FE6A 2IYOA 3IAOA 4UB6E 1CI6B 4KJMA 2I1JA 3H1JD 4PV1C 5AVZB 3RK3C 1KILB 2QA4P 1GU5A 1S4XA 1CZQA 3II6A 3KZIE 3CWBE 1JY3P 2KI7B 4RJTA 5BVZA 1KB9E 1X22A 1T2KD 3CCLP 1EDKA 2OARA 4TLFA 1SQVE 2Q9IA 4PD4D 2FFDC 1JTHA 1NU1K 2HODA 1SQQK 1SQBE 3MZWB 4I6MC 1ZW0A 1HGVA 3JSVC 3SWYA 2GM4A 2AXTH 1SQBK 2HODB 3A2AA 1G2CB 1SQPE 1IO4A 3FXDA 3L70G 2IFMA 1NTME 1VQ6P 4IL6X 5CBNA 4W7YA 1YJ9P 2OYIA 5CCGD 1W2BO 3P8CE 2O01J 1X79B 4U3FG 4YXDC 1VQ5P 2WPVB 3C8VA 1SQVJ 4A7PA 4IL6E 1QVFO 1AVOA 2BCCD 2IPPA 2FXPA 3M0DC 4WY4A 3RBXA 2RN0A 1OWAA 1SQXK 1RF1C 4OH8B 2AXTE 3L75J 1EZVI 1RE3C 1IJDB 3L75D 3RBZA 1VQMP 1VQ8P 1VPCA 2JWDA 1KZUB 3AE1C 2N1TC 4RKUJ 3RL0B 1BCCD 1J1DC 1P84H 2L5GB 2P7JA 2WSSH 3B5NB 2FYUK 2LXCB 4PD4E 3I56P 1HJBA 1QEXA 1PP9J 3CX5D 2NPSC 1RF0C 1OW7A 3U1AA 1NTMG 2ITAA 2HYNA 1VQLP 4NPEA 3W67A 1OW8A 1K73Q 2M5AB 1BDCA 3RL0D 1N73C 2AEJA 3H1JE 1Q2NA 3BCCG 4ASVA 4Y99B 2D2CC 1NTKK 2E5TA 1NOHA 1KQLA 2KOGA 3RL0g 2B87B 3H1ID 2WWWA 3HE4A 4AUWA 1EZVD 3IR9A 5CMZA 1BSHA 1FU1A 1YQ4C 3N7NA 5E79E 1VF5D 2WPSA 4HH2A 1HVVA 4RESB 2QJYB 1KB9I 3BRTB 1FZCC 2QJPB 3WU2H 1N7SB 4L74A 3H32A 1PL5A 3D70A 2NPSD 4U7JA 3V4QA 3AE4C 2YKQA 3CX5E 4N6JA 3WUUA 2QE7H 2OYIB 2OTLP 2P58A 1R8EA 2YMYA 2BEZF 3RGUA 3D6ZA 5KAFE 4EYYQ 2KLUA 2YKPA 1H89A 1AQ5A 4I2LC 2IX7C 3ABVC 2W6JH 1IK9A 1GMJA 1U57A 3L75E 1KMIZ 3L73G 2QEXP 1H0TB 3KXDA 2E74C 2R3CA 1IFIA 1EZVG 2JWAA 3L73D 3PRJA 5L8RJ 5GTHE 1PP9E 1PV3A 3FGAD 3P8MC 3AEDC 3CXHE 4IFDK 1Q81Q 2FY8A 4H44D 3CCRP 1NTMK 2RMZA 3Q5RA 1SS1A 4PD4H 3AE9C 5CJ4A 2B9BA 4ZKUA 2E76C 1M1JA 4UB8E 3SWFA 5KLVD 3WMM0 2FYUD 2BCCJ 5AW8B 1N8RQ 1PPJD 1SQVD 2Y9ZA 1SQXE 3L4FA 2IBZG 2YIUC 2W6AA 1KB9D 3L72D 1A02F 1SQPJ 5BU5A 2LKMA 3U1CA 1Q90D 3V2PA 1X9VA 4DCKA 3L36A 1NO4A 1QLED 2KS1A 5KKZC 1FDMA 2ZFCA 3HE4B 2PAJA 4PV1D 2LXBA 3B4SA 4K3AA 1PGPA 3QWOC 1VQ9P 2AEMA 1L2PA 2E5YA 3GHGB 3L74E 1DIPA 2W83C 3CX5I 2FBWC 3Q5SA 3G6EP 2JDIH 3H1KD 3L72G 3H32B 3MP7B 1G1IA 4N78D 1FAVA 1J1EB 1NTKE 3I55P 3EQ2A 2J5UA 3VYIA 2RH0A 3CXHD 4BXLA 4AQRD 5B5EH 3HUSC 1IK7A 1ZLLA 5KJ7A 2H89C 1S9KD 2HLOA 3QH9A 1GW3A 1HTLC 3PLNA 1KQSO 1L4AC 1RQVA 3Q2YA 2A06G 1JY2P 2ZT9C 3H1HD 1URQD 4D6TE 1S1CX 1BSNA 3MGNA 4B86A 1YJWP 3OJAB 3MUDA 1T3UA 2OQQA 1VL2A 2Z5IA 4JF7A 1Y47A 3AEFC 3N4XA 3E7KA 1SQXJ 2YO2A 1QX8A 2M5AA 2VRSA 1URQB 1P84I 2K9YA 2P2UA 4WB4A 1JY3N 1RY3A 1T8ZA 3CI9A 1URQA 2M8RA 1QL2A 5AW9B 3AE5C 2ZYAA 1OZHA 2N1TB 3RL0C 3CC2P 1MV8A 2KK7A 1USDA 1LTJC 2XU6A 1LT9A 4JQ0D 4R4LA 1SQPK 3GLMA 4R4MA 1LT1A 5BU8B 3A0BH 2WTYA 3TGUD 1LT9B 3A0BE 2I1KA 5AVWB 1LJ2A 2FYNC 1N7SA 1UIIA 5AVTB 2WPQA 1M1JB 1K8AQ 4OGQC 3VMZA 4Z1MH 5CCHC 2C9NY 4N3YB 1NHLA 1LGHB 1RH5B 2O01H 1BE3G 2RKLA 3G9RA 1NKZB 4DT0A 3WUVA 4U3FJ 2Q6QA 1SFCD 3V2NA 3WU2E 1RQUA 2HPCB 2DW3A 2FXMA 2V7QH 3CCEP 1BCCE 3HD7C 2KB7P 2E42A 5B5EE 3GF3A 3M9HA 4CPGA 3HE5A 4ASWA 1CW5A 2H88C 2V4HA 1LWUC 3L70E 4ZKPA 1FZGA 1KQGB 3IF4A 5AVXB 2FYZA 4JBZA 5DJTB 3TGUE 1NAYA 1ZXGA 1EZVE 1HWTC 3CWBG 4GT1A 2E75C 1KQFB 1AQTA 1NTZJ 3NMDA 1J1DB 2P1JA 3GF7A 1IFPA 1SFCC 3KHUA 3RK2B 1RE4A 2FYUG 1FBMA 2QJYC 2WSFH 3E1IA 1SQBD 3H1JJ 3NXSA 3HD7D 1SLQA 3A0HH 1L0NK 2NPSB 2XZRA 4GOEA 3AE6C 5TJHA 1M8OB 3H1LG 1NTZD 1N73B 1SQQG 4ZMDA 3RK2D 5APWA 3V6IA 1PGOA 3AECC 1HUCA 1LTBC 3PTZA 3H1IJ 4Y99C 1N86A 1IFJA 3HD7B 1GDTA 2Q7CA 2HR3A 1L0LG 5CCGC 1LTTC 1S2EA 3Q5PA 1HJ0A 4D6TD 1YTZI 2R32A 3V5BA 1KYOH 1A02J 2YNYA 2FFDA 1PIXA 4D6TG 3M9QA 1JUNA 3BCCE 3M9BA 2KZIA 2YXRB 1S9KE 2HPCA 1XTGB 2M0BA 4PV1B 5KAIH 4LGDE 1QVGO 1P84D 3U59A 3L73J 2K9JA 3HE5B 4JPZB 1ZN5A 1NH4A 3LW5H 2W90A 2ZYGA 3M06A 3H1LD 5AVSB 3V2QA 1S5LH 1YHQP 3B8EB 3E1RA 3P32A 2Q1KA 3L72J 1GK4A 3F5HA 1JY3O 1PFIA 3SWKA 2N9BA 1NU1D 3H1KG 1OFCX 1L4AD 1AA0A 2B89A 2JO1A 2C0WA 2KXPB 3CWBD 3NTNA 2ZT9D 1BGYD 3AEGC 5AW2B 1IZNB 5AW0B 1AJYA 1AFOA 2GUSA 3USSA 5APYA 3HRNA 3VMAA 1FZFA 1S72P 2KNCB 3L72E 1L0NG 2B88A 2O1JA 1PPJG 2UWJE 3BRVB 3TGUG 2H8PD 5CHXA 5H2FH 1BGYE 2ZT9B 5APQA 2P10A 3GHGC 1N73A 1FJKA 2IZ1A 3BATA 2OYHA 1NTZE 1SQXD 2QVAA 1SQVG 2OYOA 1GK6A 3VMXA 1BCCG 4YXWH 1H88A 3O6QA 1GL2D 1KN7A 3BASA 1FJPA 4PJ0E 3L75G 4YPCA 1ZMEC 2K37A 5APUA 4OWFA 2E43A 2IBZE 1PP9D 3VTPC 3M0AA 2XKMA
chains in the Genus database with same CATH topology
5CCHD 3O8ZA 4LC1A 1T2KC 3TYYA 2XV5A 4HYTB 1RF1A 5APVA 1RF1B 3KDPB 2WSCH 1GW4A 1KILC 3OA7A 2HFED 5KLVK 5AW5B 1SQVK 2A45G 4C46A 1VDFA 3CLQA 2NPSA 4DZOA 1DX7A 4JYBA 5AW1B 3OAKA 5KJ7D 4M3LA 2M3BA 1JCDA 2OYIC 2R5DA 1DEBA 1KILD 1WRGA 3T97A 1MZ9A 2FFDB 4IFMA 4WY4C 1FZFA 2WZ7A 1N7LA 1JY2N 4WBAA 4W80A 5APSA 1RE3A 1GZLA 2QM8A 3B5NC 2N1TA 1GL2A 3A5TA 2KP8A 4IFFA 1HBWA 1SP4A 2J59M 3G3ZA 4N78E 3V2RA 5AVUB 1FZAA 2HG5D 1FZCB 3R2PA 1GTWA 3B5ND 2ZXEB 1MUUA 4EIJA 1YYCA 4C7NB 1H8AA 1SVFA 1GU4A 2WT7B 3MTUE 4JYCA 1KFMA 3PP5A 1LT9C 1JY2O 3KQGA 3VP8A 5APXA 3C9IA 1MFZA 2QM7A 3M0DA 2GM4A 1FOSF 1ZR4A 1L4AB 1T3JA 2R5BA 1G1JA 5AVVB 1HGZA 2Z5HA 1IFMA 1RF0A 3UIAA 1M1JC 2MJZA 1LWUA 2N1TD 3LIDA 3RK3B 3L37A 4GKGA 4I1LA 3V4WA 3I5CA 1GL2B 2CPBA 3RK2C 2CPSA 3IFMA 2POHA 1FZCA 1RE4C 5AVYB 5AW4B 1CSBA 3TK1A 2GUVA 2P67A 4O9BA 4GIFA 1LTJA 1LTSC 2KYVA 5KJ7C 3KYQA 3HUSA 1NWQA 2O1KA 1JCCA 1L4AA 1OXZA 3EFGA 3VN0A 1YTZT 2XDJA 2PP6A 2OYHB 3VMYA 1X8YA 2WSEH 1LTAC 3M91A 2JEEA 4KHXA 5KTBA 3HD7A 1QL1A 1JNMA 4AYCA 3KPEA 1JOCA 1Z56A 3P8CD 1NKNA 5AW7B 2KSJA 3HTKB 1EQ7A 2WITA 5AVRB 2IFNA 2C0XA 1N7SC 2FKWB 5CCHA 2YKOA 1IC2A 1KFNA 4C7RA 2OYHC 1M7LA 1LTJB 2BASA 1JMMA 2J58A 1L0LK 1E5WA 3L35A 3TNUB 1J1EC 1FZBA 3P7KA 3VOPA 1XTCC 1ZR2A 1N7SD 4XA4A 1N2DC 1LTGC 1SFCB 1NAFA 2A45H 3A7OA 1LWUB 1URQC 1HH0A 3HTKA 2H7HA 2KLVA 5CJ0A 1KILA 4XE5B 3CL3D 3VP9A 2JJLA 1IFNA 5CCGA 2W27A 3LIEA 5APTA 2H43A 2WPRA 1WT6A 3MIWA 4WY4D 3TSIA 4LLHA 1W2EA 2Z4EA 1JTHB 1FZEA 1LTIC 3HUSB 1G2CA 5AW3B 2Q5UA 2C9LY 3A3YB 2Q3IA 2YO3A 2XNXA 2A45I 3NFQA 4C7NA 1NTZK 3RK3D 2WT7A 1FOSE 1IFDA 3B5NA 1GL2C 3H6PA 1DH3A 1J2JB 3TNUA 1SFCA 4EOTA 1ZV8A 2W6BA 5AVQB 4W7ZA 1JO5A 5AW6B 3GHGA 3MD0A 1CI6A 4DOJA 1CI6B 2I1JA 3RK3C 5AVZB 1GU5A 1KILB 1CZQA 3II6A 5BVZA 1JY3P 1T2KD 2OARA 2Q9IA 2FFDC 1JTHA 1NU1K 2HODA 1SQQK 4I6MC 1HGVA 3SWYA 1SQBK 2HODB 3A2AA 1G2CB 1IO4A 2IFMA 4W7YA 2OYIA 5CCGD 3P8CE 1X79B 4WY4A 2IPPA 3M0DC 1RF1C 1OWAA 1SQXK 4OH8B 1RE3C 1IJDB 1VPCA 1KZUB 2N1TC 3RL0B 1J1DC 2L5GB 2P7JA 3B5NB 1HJBA 2FYUK 2NPSC 1RF0C 3U1AA 2HYNA 3RL0D 1N73C 4Y99B 1NTKK 1NOHA 1KQLA 2KOGA 2WWWA 3HE4A 4AUWA 3IR9A 5CMZA 1FU1A 3N7NA 4HH2A 2WPSA 1FZCC 1HVVA 4RESB 3BRTB 1N7SB 3H32A 2NPSD 3V4QA 4N6JA 2YKQA 2OYIB 2YMYA 1H89A 2YKPA 1AQ5A 4I2LC 2IX7C 1IK9A 2R3CA 1IFIA 3P8MC 4IFDK 1NTMK 5CJ4A 4ZKUA 1M1JA 3SWFA 3WMM0 5AW8B 1A02F 3L4FA 2W6AA 5BU5A 2LKMA 3U1CA 3V2PA 1X9VA 3L36A 1NO4A 1FDMA 2ZFCA 3HE4B 2PAJA 3GHGB 3H32B 1G1IA 4N78D 1FAVA 1J1EB 3EQ2A 3VYIA 5KJ7A 4AQRD 3HUSC 1ZLLA 1S9KD 2HLOA 1GW3A 1HTLC 1L4AC 1JY2P 1URQD 3MGNA 4B86A 3OJAB 3MUDA 1T3UA 2Z5IA 4JF7A 3N4XA 2YO2A 2VRSA 1URQB 2P2UA 4WB4A 1JY3N 1RY3A 1T8ZA 3CI9A 1URQA 2M8RA 1QL2A 5AW9B 2N1TB 3RL0C 1MV8A 2XU6A 1LTJC 1LT9A 1SQPK 5BU8B 2WTYA 1LT9B 2I1KA 5AVWB 1N7SA 5AVTB 2WPQA 1M1JB 3VMZA 2C9NY 5CCHC 4N3YB 1NHLA 1LGHB 2O01H 1NKZB 1SFCD 3V2NA 2HPCB 2FXMA 3HD7C 2KB7P 2E42A 3M9HA 3HE5A 1CW5A 4ZKPA 1LWUC 1FZGA 5AVXB 2FYZA 1HWTC 4GT1A 3NMDA 1J1DB 2P1JA 3RK2B 1SFCC 1RE4A 3E1IA 1FBMA 1AFOA 2WSFH 3NXSA 4WY4B 3HD7D 1SLQA 1L0NK 2NPSB 2XZRA 1N73B 3RK2D 5APWA 1HUCA 1LTBC 4Y99C 1N86A 1IFJA 3HD7B 1GDTA 2Q7CA 5CCGC 1LTTC 1YTZI 2R32A 3V5BA 1A02J 2YNYA 2FFDA 3M9QA 1JUNA 3M9BA 1S9KE 2HPCA 1XTGB 4LGDE 3U59A 3HE5B 1ZN5A 1NH4A 3LW5H 3M06A 5AVSB 3V2QA 3B8EB 3P32A 1GK4A 1PFIA 1JY3O 2N9BA 1L4AD 3NTNA 2C0WA 5AW2B 5AW0B 2GUSA 5APYA 3HRNA 2O1JA 3BRVB 2H8PD 5CHXA 3BVHA 5APQA 1N73A 3GHGC 2OYHA 1FJKA 3BATA 1GK6A 3VMXA 1H88A 1GL2D 3BASA 1FJPA 5APUA 2E43A 1GD2E 3VTPC 3M0AA 2XKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVY B;  5AW4 B;  1CSB A;  5AW6 B;  3MD0 A;  3TK1 A;  1CI6 A;  3MGN A;  4B86 A;  2P67 A;  3O8Z A;  2Z5I A;  1CI6 B;  4LC1 A;  5AVZ B;  1GU5 A;  1T2K C;  1CZQ A;  2YO2 A;  1T2K D;  2VRS A;  2P2U A;  3TYY A;  2XV5 A;  1NWQ A;  4HYT B;  1OXZ A;  3VN0 A;  4I6M C;  5AW9 B;  3A2A A;  1X8Y A;  3KDP B;  1G2C B;  5APV A;  3VMY A;  1IO4 A;  1MV8 A;  2XU6 A;  5AW5 B;  3M91 A;  4KHX A;  2WTY A;  5AVW B;  4AYC A;  4C46 A;  1JNM A;  5AVT B;  2WPQ A;  2IPP A;  3VMZ A;  4DZO A;  2C9N Y;  5AW7 B;  1OWA A;  4JYB A;  5AW1 B;  3OAK A;  4M3L A;  2R5D A;  5AVR B;  2P7J A;  1HJB A;  2E42 A;  3M9H A;  3HE5 A;  3T97 A;  5APS A;  2QM8 A;  1GZL A;  5AVX B;  2BAS A;  1KQL A;  3A5T A;  2KP8 A;  2WWW A;  1HBW A;  3HE4 A;  1HWT C;  4AUW A;  3IR9 A;  3L35 A;  4GT1 A;  5CMZ A;  1SP4 A;  3TNU B;  3NMD A;  2WPS A;  3P7K A;  4RES B;  3NXS A;  1SLQ A;  2XZR A;  3V4Q A;  5AVU B;  5APW A;  1HUC A;  1H89 A;  4I2L C;  2Q7C A;  1GTW A;  1NAF A;  2ZXE B;  1MUU A;  3A7O A;  1YYC A;  2R32 A;  3V5B A;  4C7N B;  1H8A A;  1A02 J;  2YNY A;  2R3C A;  3HTK A;  1GU4 A;  1JUN A;  2WT7 B;  4JYC A;  3M9B A;  2H7H A;  1S9K E;  3P8M C;  4XE5 B;  3HE5 B;  2JJL A;  5AVS B;  3KQG A;  3M06 A;  5APX A;  2W27 A;  1MFZ A;  3B8E B;  3LIE A;  3P32 A;  5APT A;  3SWF A;  3M0D A;  2QM7 A;  1FOS F;  1GK4 A;  2WPR A;  5AW8 B;  1A02 F;  2N9B A;  2W6A A;  2R5B A;  3NTN A;  5AVV B;  5AW2 B;  3L36 A;  5AW0 B;  5AW3 B;  2Q5U A;  2Z5H A;  2C9L Y;  2ZFC A;  3A3Y B;  5APY A;  2Q3I A;  3HE4 B;  3UIA A;  2YO3 A;  3NFQ A;  4C7N A;  5APQ A;  2WT7 A;  3LID A;  1FOS E;  3L37 A;  4GKG A;  3V4W A;  3I5C A;  1GK6 A;  3VMX A;  1DH3 A;  1FAV A;  1H88 A;  3VTP C;  3VYI A;  1J2J B;  3TNU A;  4AQR D;  5APU A;  4EOT A;  1S9K D;  2E43 A;  1GD2 E;  5AVQ B;  3M0A A; 
#chains in the Genus database with same CATH topology
 5KLI C;  1TU3 F;  4H13 B;  5C39 A;  3AEA C;  2E74 D;  4OGQ D;  1L0N E;  5CCH D;  1YQ3 C;  3O8Z A;  4IL6 H;  4LC1 A;  1JM0 A;  1U7J A;  1T2K C;  2R44 A;  5TIS H;  1X0T A;  1YJN P;  2K9J B;  4H44 C;  1L0L D;  1OIP A;  4DJG A;  2E74 B;  3TYY A;  2XV5 A;  1BDD A;  1DD4 A;  4HYT B;  4OGQ B;  2QSI A;  1RF1 A;  2PGD A;  2QJK B;  2ZVO B;  2WVR A;  1AV1 A;  5APV A;  1RF1 B;  3KDP B;  2WSC H;  1GW4 A;  1KIL C;  1SQX G;  3OA7 A;  2HFE D;  4NPD A;  4WWI A;  3D6Y A;  5KLV K;  2D2C B;  2WQY C;  5AW5 B;  1HF9 A;  1BGY J;  2KNC A;  5TIS E;  1SQV K;  1VF5 B;  1K04 A;  1EXJ A;  3FWL A;  2A45 G;  4C46 A;  1EDI A;  1VDF A;  3CLQ A;  1K9M Q;  2JKV A;  1LNQ A;  2NPS A;  2Y0D A;  2E75 D;  1KOR A;  4DZO A;  1DX7 A;  5KLV J;  3D71 A;  4JYB A;  1ZRT D;  2A06 E;  5AW1 B;  3OAK A;  4EDF A;  3F89 A;  1KC8 Q;  4BRY B;  5KJ7 D;  4M3L A;  2I8D A;  2M3B A;  1Y9B A;  3A0H E;  3CCM P;  1JCD A;  1VQO P;  2R5D A;  2OYI C;  1DEB A;  2E75 B;  4PJ0 H;  1KIL D;  1R5S A;  1L0L E;  1WRG A;  1MZ9 A;  3O6Q B;  4MN4 C;  3T97 A;  4IFM A;  3TDK A;  2FFD B;  4WY4 C;  1FDI A;  2WZ7 A;  3CXH H;  1N7L A;  4YTP C;  1T6A A;  1JY2 N;  4WBA A;  4W80 A;  4KT0 J;  5APS A;  1RE3 A;  1GZL A;  2QM8 A;  1PZQ A;  2L91 A;  3B5N C;  4PD4 I;  2N1T A;  4RO0 A;  1GL2 A;  3R4Y A;  2KP8 A;  1S5L X;  4IFF A;  2WSF J;  3WUT A;  1DEE G;  3A5T A;  1HBW A;  1VQ7 P;  2BCC G;  3H25 A;  1SP4 A;  2IBZ D;  4TT3 H;  3L70 J;  2WMM A;  2ZXX A;  1NJI Q;  4Y28 J;  2J59 M;  1OVV A;  4GOD A;  1OVR A;  3G3Z A;  4N78 E;  2NZ2 A;  3V2R A;  2AXC A;  3H1H J;  1SQP D;  5AVU B;  1KIL E;  1PGQ A;  1VQP P;  3JCU E;  1EDL A;  1FZA A;  1VQ4 P;  2HG5 D;  2FYU J;  3EWK A;  3L74 J;  3JC2 2;  3MHV A;  1FZC B;  1M57 D;  4HB1 A;  1NGM B;  3R2P A;  1GTW A;  1GD2 E;  1EC5 A;  3B5N D;  2ZXE B;  1MUU A;  2O01 N;  2JR8 A;  2QJP C;  4EI2 A;  2JP3 A;  4EIJ A;  1JB0 J;  1YYC A;  1MFT A;  3H1L J;  4C7N B;  3L71 E;  1H8A A;  2FXO A;  1SVF A;  1YBK A;  2YMK A;  1GU4 A;  2V7Q J;  2WT7 B;  1PP9 G;  3MTU E;  1OX3 A;  3H1I G;  4JYC A;  3CME P;  1KFM A;  4U3F E;  1KYO E;  3AEB C;  4H0L C;  2FYU E;  2YIU B;  1USE A;  1LT9 C;  3PP5 A;  2ZYD A;  2K1A A;  1JY2 O;  3T97 B;  4BRY A;  3KQG A;  3VP8 A;  5KLV E;  2R3S A;  5APX A;  3C9I A;  1MFZ A;  1Q82 Q;  3H1L E;  2QM7 A;  3L71 J;  3M0D A;  5KAI E;  1SQB G;  5K5G B;  1NTK D;  3GW6 A;  3LW5 J;  3G71 P;  1ZR4 A;  3CXH I;  1NU1 J;  1FOS F;  1L4A B;  1T3J A;  2R5B A;  1G1J A;  5AVV B;  3Q3D A;  1KTM A;  2B87 A;  1OW6 A;  4L75 A;  3PHL A;  3ITK A;  1HGZ A;  2Z5H A;  3ZDM A;  1M90 Q;  1IFM A;  2W8Z A;  1RF0 A;  2OTK E;  3UIA A;  4H0L D;  1M1J C;  1OMI A;  1PGJ A;  2MJZ A;  4ZNC A;  3H1K J;  5KLI B;  1LWU A;  3CCJ P;  5GTH H;  3SFD C;  3PJS K;  1VQN P;  5B66 H;  2N1T D;  3LID A;  3RK3 B;  3L37 A;  4GKG A;  4I1L A;  1NVO A;  3V4W A;  3I5C A;  3MUD C;  1GL2 B;  1L0N J;  4NPF X;  2CPB A;  3S4R A;  3SFE C;  1NTK G;  3FWN A;  2AEF A;  3RK2 C;  3KZI H;  2CPS A;  3IFM A;  2POH A;  5EFW B;  1FZC A;  3CX5 H;  4UB6 H;  1RE4 C;  1AVY A;  5AVY B;  5AW4 B;  1CSB A;  2D2C D;  1BCC J;  2G3A A;  3GG2 A;  2ZAE B;  3TK1 A;  2KIK A;  1KYO I;  2GUV A;  2P67 A;  3FX0 A;  4O9B A;  4GIF A;  3AE8 C;  3L73 E;  1LTJ A;  1LTS C;  3AE2 C;  1VF5 C;  2OTJ P;  3L70 D;  2KYV A;  4I7Z B;  3KYQ A;  5KJ7 C;  3HUS A;  1NU1 E;  1SQP G;  3OW2 O;  1YIT P;  1NWQ A;  2O1K A;  1JCC A;  1L4A A;  2WSE J;  3EFF K;  1OXZ A;  3EFG A;  2FYN B;  3VN0 A;  1YTZ T;  2IBZ I;  2QJK C;  2XDJ A;  2PP6 A;  4K35 A;  2KZJ A;  2OYH B;  2MKV A;  3VMY A;  1X8Y A;  1NTZ G;  1W5C E;  2WSE H;  3Q1M A;  1LTA C;  3H1J G;  3BVH A;  1UIX A;  3M91 A;  2JEE A;  1EXI A;  1FS0 E;  1P84 E;  2BCC E;  3GMA A;  3HD7 A;  1KYO D;  4KHX A;  5CBO A;  5KKZ B;  1QL1 A;  5KTB A;  3CCU P;  4AYC A;  3KPE A;  4QMA A;  1JOC A;  1Z56 A;  3C1L A;  1JNM A;  3BCC D;  3P8C D;  1NKN A;  5AW7 B;  3PH0 A;  1Q7Y Q;  2KSJ A;  2OGU A;  3L71 D;  1BE3 E;  1ZP0 C;  1NTM D;  3K5B A;  1BGY G;  5M1B A;  3CMA P;  1NTM J;  1JMB A;  3AE3 C;  3HTK B;  1WMK A;  1JEK A;  2IYP A;  1EQ7 A;  1YIJ P;  3BCC J;  2WIT A;  5H2F E;  5AVR B;  2IFN A;  3S9O A;  2C0X A;  4I7Z C;  1QGK B;  2XND H;  5KLV G;  2KSE A;  4HKZ H;  5E79 H;  1N7S C;  2KUB A;  4WVZ A;  3AEE C;  5KAF H;  1H0T A;  2FKW B;  4HJG H;  4WY4 B;  5CCH A;  3TF5 A;  2YKO A;  1IC2 A;  1KFN A;  2IZ0 A;  4C7R A;  2OYH C;  1M7L A;  3S1K A;  1VQK P;  1LTJ B;  2BAS A;  1FDO A;  2N9Y B;  3H1H E;  1BE3 D;  1JMM A;  2J58 A;  2LR2 A;  1L0L K;  2Y0C A;  1E5W A;  3L35 A;  4IOI H;  2CK3 H;  1J1E C;  3TNU B;  2PFX A;  1FZB A;  3P7K A;  1S5L E;  5DJU B;  3VOP A;  4BWN A;  3CC7 P;  5GTI E;  1XTC C;  3FXE A;  1MKM A;  2ZVN B;  1ZR2 A;  1N7S D;  5B66 E;  2NRG A;  2YXQ B;  5GTI H;  4XA4 A;  4UB8 H;  1KV4 A;  1N2D C;  1LTG C;  1M56 D;  3TGU J;  1SFC B;  3G4S P;  2KS1 B;  1BE3 J;  3SSU A;  3CCQ P;  1RHZ B;  2K3R A;  1NAF A;  2A45 H;  1E79 H;  3A7O A;  1LWU B;  1ZRT E;  2A06 D;  3H1H G;  1URQ C;  1HH0 A;  1ZOY C;  3HTK A;  3L74 G;  1K05 A;  2H7H A;  2M3E A;  2ZJS E;  2GA1 A;  2KLV A;  5CJ0 A;  1EDJ A;  1KIL A;  4XE5 B;  3CL3 D;  1PPJ E;  1OVU A;  4L73 A;  4H0L B;  1KD1 Q;  1LP1 B;  3VP9 A;  2JJL A;  2Y9Y A;  1SQQ D;  2BEQ D;  1DD3 A;  1IFN A;  1KB9 H;  1LP1 A;  5CCG A;  2W27 A;  3LIE A;  4GOF A;  1U7M A;  5APT A;  4H13 D;  2H43 A;  4XFJ A;  3CWB J;  2WPR A;  1WT6 A;  3MIW A;  4WY4 D;  3TSI A;  4LLH A;  1W2E A;  1Y8A A;  1JTH B;  4OVN F;  2QIW A;  1Q86 Q;  3AE7 C;  1D7M A;  2Z4E A;  2K88 A;  1FZE A;  3RK3 E;  1LTI C;  3HUS B;  1G2C A;  5AW3 B;  3CCS P;  2IDB A;  2QG4 A;  2Q5U A;  3L71 G;  1YI2 P;  1SQB J;  1M1K Q;  2C9L Y;  3A3Y B;  3CD6 P;  1NU1 G;  1L0N D;  1SQQ J;  2Q3I A;  2YO3 A;  2XNX A;  2A45 I;  3NFQ A;  2E76 B;  4C7N A;  4H44 B;  3JCU H;  1NTZ K;  3W68 A;  1FC2 C;  2Q3E A;  1R5L A;  3IN6 A;  3RK3 D;  2WT7 A;  2G8Y A;  1L0L J;  2PRR A;  2QRX A;  1FOS E;  1IFD A;  2SPZ A;  3B5N A;  4H13 C;  4L76 A;  3CC4 P;  1GL2 C;  4GDO A;  2Y0E A;  3H6P A;  1DH3 A;  1NYH A;  2E76 D;  4D6T J;  2O3J A;  3B71 A;  1J2J B;  3TNU A;  3CPW O;  1SFC A;  3H1K E;  1ZV8 A;  4EOT A;  3CCV P;  2WSC J;  2W6B A;  3L74 D;  4W7Z A;  1SQQ E;  1S3J A;  5AVQ B;  1JO5 A;  5AW6 B;  3GHG A;  3H1I E;  1NTK J;  3MD0 A;  4U3F D;  1CI6 A;  4DOJ A;  1FE6 A;  2IYO A;  3IAO A;  4UB6 E;  1CI6 B;  4KJM A;  2I1J A;  3H1J D;  4PV1 C;  5AVZ B;  3RK3 C;  1KIL B;  2QA4 P;  1GU5 A;  1S4X A;  1CZQ A;  3II6 A;  3KZI E;  3CWB E;  1JY3 P;  2KI7 B;  4RJT A;  5BVZ A;  1KB9 E;  1X22 A;  1T2K D;  3CCL P;  1EDK A;  2OAR A;  4TLF A;  1SQV E;  2Q9I A;  4PD4 D;  2FFD C;  1JTH A;  1NU1 K;  2HOD A;  1SQQ K;  1SQB E;  3MZW B;  4I6M C;  1ZW0 A;  1HGV A;  3JSV C;  3SWY A;  2GM4 A;  2AXT H;  1SQB K;  2HOD B;  3A2A A;  1G2C B;  1SQP E;  1IO4 A;  3FXD A;  3L70 G;  2IFM A;  1NTM E;  1VQ6 P;  4IL6 X;  5CBN A;  4W7Y A;  1YJ9 P;  2OYI A;  5CCG D;  1W2B O;  3P8C E;  2O01 J;  1X79 B;  4U3F G;  4YXD C;  1VQ5 P;  2WPV B;  3C8V A;  1SQV J;  4A7P A;  4IL6 E;  1QVF O;  1AVO A;  2BCC D;  2IPP A;  2FXP A;  3M0D C;  4WY4 A;  3RBX A;  2RN0 A;  1OWA A;  1SQX K;  1RF1 C;  4OH8 B;  2AXT E;  3L75 J;  1EZV I;  1RE3 C;  1IJD B;  3L75 D;  3RBZ A;  1VQM P;  1VQ8 P;  1VPC A;  2JWD A;  1KZU B;  3AE1 C;  2N1T C;  4RKU J;  3RL0 B;  1BCC D;  1J1D C;  1P84 H;  2L5G B;  2P7J A;  2WSS H;  3B5N B;  2FYU K;  2LXC B;  4PD4 E;  3I56 P;  1HJB A;  1QEX A;  1PP9 J;  3CX5 D;  2NPS C;  1RF0 C;  1OW7 A;  3U1A A;  1NTM G;  2ITA A;  2HYN A;  1VQL P;  4NPE A;  3W67 A;  1OW8 A;  1K73 Q;  2M5A B;  1BDC A;  3RL0 D;  1N73 C;  2AEJ A;  3H1J E;  1Q2N A;  3BCC G;  4ASV A;  4Y99 B;  2D2C C;  1NTK K;  2E5T A;  1NOH A;  1KQL A;  2KOG A;  3RL0 g;  2B87 B;  3H1I D;  2WWW A;  3HE4 A;  4AUW A;  1EZV D;  3IR9 A;  5CMZ A;  1BSH A;  1FU1 A;  1YQ4 C;  3N7N A;  5E79 E;  1VF5 D;  2WPS A;  4HH2 A;  1HVV A;  4RES B;  2QJY B;  1KB9 I;  3BRT B;  1FZC C;  2QJP B;  3WU2 H;  1N7S B;  4L74 A;  3H32 A;  1PL5 A;  3D70 A;  2NPS D;  4U7J A;  3V4Q A;  3AE4 C;  2YKQ A;  3CX5 E;  4N6J A;  3WUU A;  2QE7 H;  2OYI B;  2OTL P;  2P58 A;  1R8E A;  2YMY A;  2BEZ F;  3RGU A;  3D6Z A;  5KAF E;  4EYY Q;  2KLU A;  2YKP A;  1H89 A;  1AQ5 A;  4I2L C;  2IX7 C;  3ABV C;  2W6J H;  1IK9 A;  1GMJ A;  1U57 A;  3L75 E;  1KMI Z;  3L73 G;  2QEX P;  1H0T B;  3KXD A;  2E74 C;  2R3C A;  1IFI A;  1EZV G;  2JWA A;  3L73 D;  3PRJ A;  5L8R J;  5GTH E;  1PP9 E;  1PV3 A;  3FGA D;  3P8M C;  3AED C;  3CXH E;  4IFD K;  1Q81 Q;  2FY8 A;  4H44 D;  3CCR P;  1NTM K;  2RMZ A;  3Q5R A;  1SS1 A;  4PD4 H;  3AE9 C;  5CJ4 A;  2B9B A;  4ZKU A;  2E76 C;  1M1J A;  4UB8 E;  3SWF A;  5KLV D;  3WMM 0;  2FYU D;  2BCC J;  5AW8 B;  1N8R Q;  1PPJ D;  1SQV D;  2Y9Z A;  1SQX E;  3L4F A;  2IBZ G;  2YIU C;  2W6A A;  1KB9 D;  3L72 D;  1A02 F;  1SQP J;  5BU5 A;  2LKM A;  3U1C A;  1Q90 D;  3V2P A;  1X9V A;  4DCK A;  3L36 A;  1NO4 A;  1QLE D;  2KS1 A;  5KKZ C;  1FDM A;  2ZFC A;  3HE4 B;  2PAJ A;  4PV1 D;  2LXB A;  3B4S A;  4K3A A;  1PGP A;  3QWO C;  1VQ9 P;  2AEM A;  1L2P A;  2E5Y A;  3GHG B;  3L74 E;  1DIP A;  2W83 C;  3CX5 I;  2FBW C;  3Q5S A;  3G6E P;  2JDI H;  3H1K D;  3L72 G;  3H32 B;  3MP7 B;  1G1I A;  4N78 D;  1FAV A;  1J1E B;  1NTK E;  3I55 P;  3EQ2 A;  2J5U A;  3VYI A;  2RH0 A;  3CXH D;  4BXL A;  4AQR D;  5B5E H;  3HUS C;  1IK7 A;  1ZLL A;  5KJ7 A;  2H89 C;  1S9K D;  2HLO A;  3QH9 A;  1GW3 A;  1HTL C;  3PLN A;  1KQS O;  1L4A C;  1RQV A;  3Q2Y A;  2A06 G;  1JY2 P;  2ZT9 C;  3H1H D;  1URQ D;  4D6T E;  1S1C X;  1BSN A;  3MGN A;  4B86 A;  1YJW P;  3OJA B;  3MUD A;  1T3U A;  2OQQ A;  1VL2 A;  2Z5I A;  4JF7 A;  1Y47 A;  3AEF C;  3N4X A;  3E7K A;  1SQX J;  2YO2 A;  1QX8 A;  2M5A A;  2VRS A;  1URQ B;  1P84 I;  2K9Y A;  2P2U A;  4WB4 A;  1JY3 N;  1RY3 A;  1T8Z A;  3CI9 A;  1URQ A;  2M8R A;  1QL2 A;  5AW9 B;  3AE5 C;  2ZYA A;  1OZH A;  2N1T B;  3RL0 C;  3CC2 P;  1MV8 A;  2KK7 A;  1USD A;  1LTJ C;  2XU6 A;  1LT9 A;  4JQ0 D;  4R4L A;  1SQP K;  3GLM A;  4R4M A;  1LT1 A;  5BU8 B;  3A0B H;  2WTY A;  3TGU D;  1LT9 B;  3A0B E;  2I1K A;  5AVW B;  1LJ2 A;  2FYN C;  1N7S A;  1UII A;  5AVT B;  2WPQ A;  1M1J B;  1K8A Q;  4OGQ C;  3VMZ A;  4Z1M H;  5CCH C;  2C9N Y;  4N3Y B;  1NHL A;  1LGH B;  1RH5 B;  2O01 H;  1BE3 G;  2RKL A;  3G9R A;  1NKZ B;  4DT0 A;  3WUV A;  4U3F J;  2Q6Q A;  1SFC D;  3V2N A;  3WU2 E;  1RQU A;  2HPC B;  2DW3 A;  2FXM A;  2V7Q H;  3CCE P;  1BCC E;  3HD7 C;  2KB7 P;  2E42 A;  5B5E E;  3GF3 A;  3M9H A;  4CPG A;  3HE5 A;  4ASW A;  1CW5 A;  2H88 C;  2V4H A;  1LWU C;  3L70 E;  4ZKP A;  1FZG A;  1KQG B;  3IF4 A;  5AVX B;  2FYZ A;  4JBZ A;  5DJT B;  3TGU E;  1NAY A;  1ZXG A;  1EZV E;  1HWT C;  3CWB G;  4GT1 A;  2E75 C;  1KQF B;  1AQT A;  1NTZ J;  3NMD A;  1J1D B;  2P1J A;  3GF7 A;  1IFP A;  1SFC C;  3KHU A;  3RK2 B;  1RE4 A;  2FYU G;  1FBM A;  2QJY C;  2WSF H;  3E1I A;  1SQB D;  3H1J J;  3NXS A;  3HD7 D;  1SLQ A;  3A0H H;  1L0N K;  2NPS B;  2XZR A;  4GOE A;  3AE6 C;  5TJH A;  1M8O B;  3H1L G;  1NTZ D;  1N73 B;  1SQQ G;  4ZMD A;  3RK2 D;  5APW A;  3V6I A;  1PGO A;  3AEC C;  1HUC A;  1LTB C;  3PTZ A;  3H1I J;  4Y99 C;  1N86 A;  1IFJ A;  3HD7 B;  1GDT A;  2Q7C A;  2HR3 A;  1L0L G;  5CCG C;  1LTT C;  1S2E A;  3Q5P A;  1HJ0 A;  4D6T D;  1YTZ I;  2R32 A;  3V5B A;  1KYO H;  1A02 J;  2YNY A;  2FFD A;  1PIX A;  4D6T G;  3M9Q A;  1JUN A;  3BCC E;  3M9B A;  2KZI A;  2YXR B;  1S9K E;  2HPC A;  1XTG B;  2M0B A;  4PV1 B;  5KAI H;  4LGD E;  1QVG O;  1P84 D;  3U59 A;  3L73 J;  2K9J A;  3HE5 B;  4JPZ B;  1ZN5 A;  1NH4 A;  3LW5 H;  2W90 A;  2ZYG A;  3M06 A;  3H1L D;  5AVS B;  3V2Q A;  1S5L H;  1YHQ P;  3B8E B;  3E1R A;  3P32 A;  2Q1K A;  3L72 J;  1GK4 A;  3F5H A;  1JY3 O;  1PFI A;  3SWK A;  2N9B A;  1NU1 D;  3H1K G;  1OFC X;  1L4A D;  1AA0 A;  2B89 A;  2JO1 A;  2C0W A;  2KXP B;  3CWB D;  3NTN A;  2ZT9 D;  1BGY D;  3AEG C;  5AW2 B;  1IZN B;  5AW0 B;  1AJY A;  1AFO A;  2GUS A;  3USS A;  5APY A;  3HRN A;  3VMA A;  1FZF A;  1S72 P;  2KNC B;  3L72 E;  1L0N G;  2B88 A;  2O1J A;  1PPJ G;  2UWJ E;  3BRV B;  3TGU G;  2H8P D;  5CHX A;  5H2F H;  1BGY E;  2ZT9 B;  5APQ A;  2P10 A;  3GHG C;  1N73 A;  1FJK A;  2IZ1 A;  3BAT A;  2OYH A;  1NTZ E;  1SQX D;  2QVA A;  1SQV G;  2OYO A;  1GK6 A;  3VMX A;  1BCC G;  4YXW H;  1H88 A;  3O6Q A;  1GL2 D;  1KN7 A;  3BAS A;  1FJP A;  4PJ0 E;  3L75 G;  4YPC A;  1ZME C;  2K37 A;  5APU A;  4OWF A;  2E43 A;  2IBZ E;  1PP9 D;  3VTP C;  3M0A A;  2XKM A; 
#chains in the Genus database with same CATH homology
 5CCH D;  3O8Z A;  4LC1 A;  1T2K C;  3TYY A;  2XV5 A;  4HYT B;  1RF1 A;  5APV A;  1RF1 B;  3KDP B;  2WSC H;  1GW4 A;  1KIL C;  3OA7 A;  2HFE D;  5KLV K;  5AW5 B;  1SQV K;  2A45 G;  4C46 A;  1VDF A;  3CLQ A;  2NPS A;  4DZO A;  1DX7 A;  4JYB A;  5AW1 B;  3OAK A;  5KJ7 D;  4M3L A;  2M3B A;  1JCD A;  2OYI C;  2R5D A;  1DEB A;  1KIL D;  1WRG A;  3T97 A;  1MZ9 A;  2FFD B;  4IFM A;  4WY4 C;  1FZF A;  2WZ7 A;  1N7L A;  1JY2 N;  4WBA A;  4W80 A;  5APS A;  1RE3 A;  1GZL A;  2QM8 A;  3B5N C;  2N1T A;  1GL2 A;  3A5T A;  2KP8 A;  4IFF A;  1HBW A;  1SP4 A;  2J59 M;  3G3Z A;  4N78 E;  3V2R A;  5AVU B;  1FZA A;  2HG5 D;  1FZC B;  3R2P A;  1GTW A;  3B5N D;  2ZXE B;  1MUU A;  4EIJ A;  1YYC A;  4C7N B;  1H8A A;  1SVF A;  1GU4 A;  2WT7 B;  3MTU E;  4JYC A;  1KFM A;  3PP5 A;  1LT9 C;  1JY2 O;  3KQG A;  3VP8 A;  5APX A;  3C9I A;  1MFZ A;  2QM7 A;  3M0D A;  2GM4 A;  1FOS F;  1ZR4 A;  1L4A B;  1T3J A;  2R5B A;  1G1J A;  5AVV B;  1HGZ A;  2Z5H A;  1IFM A;  1RF0 A;  3UIA A;  1M1J C;  2MJZ A;  1LWU A;  2N1T D;  3LID A;  3RK3 B;  3L37 A;  4GKG A;  4I1L A;  3V4W A;  3I5C A;  1GL2 B;  2CPB A;  3RK2 C;  2CPS A;  3IFM A;  2POH A;  1FZC A;  1RE4 C;  5AVY B;  5AW4 B;  1CSB A;  3TK1 A;  2GUV A;  2P67 A;  4O9B A;  4GIF A;  1LTJ A;  1LTS C;  2KYV A;  5KJ7 C;  3KYQ A;  3HUS A;  1NWQ A;  2O1K A;  1JCC A;  1L4A A;  1OXZ A;  3EFG A;  3VN0 A;  1YTZ T;  2XDJ A;  2PP6 A;  2OYH B;  3VMY A;  1X8Y A;  2WSE H;  1LTA C;  3M91 A;  2JEE A;  4KHX A;  5KTB A;  3HD7 A;  1QL1 A;  1JNM A;  4AYC A;  3KPE A;  1JOC A;  1Z56 A;  3P8C D;  1NKN A;  5AW7 B;  2KSJ A;  3HTK B;  1EQ7 A;  2WIT A;  5AVR B;  2IFN A;  2C0X A;  1N7S C;  2FKW B;  5CCH A;  2YKO A;  1IC2 A;  1KFN A;  4C7R A;  2OYH C;  1M7L A;  1LTJ B;  2BAS A;  1JMM A;  2J58 A;  1L0L K;  1E5W A;  3L35 A;  3TNU B;  1J1E C;  1FZB A;  3P7K A;  3VOP A;  1XTC C;  1ZR2 A;  1N7S D;  4XA4 A;  1N2D C;  1LTG C;  1SFC B;  1NAF A;  2A45 H;  3A7O A;  1LWU B;  1URQ C;  1HH0 A;  3HTK A;  2H7H A;  2KLV A;  5CJ0 A;  1KIL A;  4XE5 B;  3CL3 D;  3VP9 A;  2JJL A;  1IFN A;  5CCG A;  2W27 A;  3LIE A;  5APT A;  2H43 A;  2WPR A;  1WT6 A;  3MIW A;  4WY4 D;  3TSI A;  4LLH A;  1W2E A;  2Z4E A;  1JTH B;  1FZE A;  1LTI C;  3HUS B;  1G2C A;  5AW3 B;  2Q5U A;  2C9L Y;  3A3Y B;  2Q3I A;  2YO3 A;  2XNX A;  2A45 I;  3NFQ A;  4C7N A;  1NTZ K;  3RK3 D;  2WT7 A;  1FOS E;  1IFD A;  3B5N A;  1GL2 C;  3H6P A;  1DH3 A;  1J2J B;  3TNU A;  1SFC A;  4EOT A;  1ZV8 A;  2W6B A;  5AVQ B;  4W7Z A;  1JO5 A;  5AW6 B;  3GHG A;  3MD0 A;  1CI6 A;  4DOJ A;  1CI6 B;  2I1J A;  3RK3 C;  5AVZ B;  1GU5 A;  1KIL B;  1CZQ A;  3II6 A;  5BVZ A;  1JY3 P;  1T2K D;  2OAR A;  2Q9I A;  2FFD C;  1JTH A;  1NU1 K;  2HOD A;  1SQQ K;  4I6M C;  1HGV A;  3SWY A;  1SQB K;  2HOD B;  3A2A A;  1G2C B;  1IO4 A;  2IFM A;  4W7Y A;  2OYI A;  5CCG D;  3P8C E;  1X79 B;  4WY4 A;  2IPP A;  3M0D C;  1RF1 C;  1OWA A;  1SQX K;  4OH8 B;  1RE3 C;  1IJD B;  1VPC A;  1KZU B;  2N1T C;  3RL0 B;  1J1D C;  2L5G B;  2P7J A;  3B5N B;  1HJB A;  2FYU K;  2NPS C;  1RF0 C;  3U1A A;  2HYN A;  3RL0 D;  1N73 C;  4Y99 B;  1NTK K;  1NOH A;  1KQL A;  2KOG A;  2WWW A;  3HE4 A;  4AUW A;  3IR9 A;  5CMZ A;  1FU1 A;  3N7N A;  4HH2 A;  2WPS A;  1FZC C;  1HVV A;  4RES B;  3BRT B;  1N7S B;  3H32 A;  2NPS D;  3V4Q A;  4N6J A;  2YKQ A;  2OYI B;  2YMY A;  1H89 A;  2YKP A;  1AQ5 A;  4I2L C;  2IX7 C;  1IK9 A;  2R3C A;  1IFI A;  3P8M C;  4IFD K;  1NTM K;  5CJ4 A;  4ZKU A;  1M1J A;  3SWF A;  3WMM 0;  5AW8 B;  1A02 F;  3L4F A;  2W6A A;  5BU5 A;  2LKM A;  3U1C A;  3V2P A;  1X9V A;  3L36 A;  1NO4 A;  1FDM A;  2ZFC A;  3HE4 B;  2PAJ A;  3GHG B;  3H32 B;  1G1I A;  4N78 D;  1FAV A;  1J1E B;  3EQ2 A;  3VYI A;  5KJ7 A;  4AQR D;  3HUS C;  1ZLL A;  1S9K D;  2HLO A;  1GW3 A;  1HTL C;  1L4A C;  1JY2 P;  1URQ D;  3MGN A;  4B86 A;  3OJA B;  3MUD A;  1T3U A;  2Z5I A;  4JF7 A;  3N4X A;  2YO2 A;  2VRS A;  1URQ B;  2P2U A;  4WB4 A;  1JY3 N;  1RY3 A;  1T8Z A;  3CI9 A;  1URQ A;  2M8R A;  1QL2 A;  5AW9 B;  2N1T B;  3RL0 C;  1MV8 A;  2XU6 A;  1LTJ C;  1LT9 A;  1SQP K;  5BU8 B;  2WTY A;  1LT9 B;  2I1K A;  5AVW B;  1N7S A;  5AVT B;  2WPQ A;  1M1J B;  3VMZ A;  2C9N Y;  5CCH C;  4N3Y B;  1NHL A;  1LGH B;  2O01 H;  1NKZ B;  1SFC D;  3V2N A;  2HPC B;  2FXM A;  3HD7 C;  2KB7 P;  2E42 A;  3M9H A;  3HE5 A;  1CW5 A;  4ZKP A;  1LWU C;  1FZG A;  5AVX B;  2FYZ A;  1HWT C;  4GT1 A;  3NMD A;  1J1D B;  2P1J A;  3RK2 B;  1SFC C;  1RE4 A;  3E1I A;  1FBM A;  1AFO A;  2WSF H;  3NXS A;  4WY4 B;  3HD7 D;  1SLQ A;  1L0N K;  2NPS B;  2XZR A;  1N73 B;  3RK2 D;  5APW A;  1HUC A;  1LTB C;  4Y99 C;  1N86 A;  1IFJ A;  3HD7 B;  1GDT A;  2Q7C A;  5CCG C;  1LTT C;  1YTZ I;  2R32 A;  3V5B A;  1A02 J;  2YNY A;  2FFD A;  3M9Q A;  1JUN A;  3M9B A;  1S9K E;  2HPC A;  1XTG B;  4LGD E;  3U59 A;  3HE5 B;  1ZN5 A;  1NH4 A;  3LW5 H;  3M06 A;  5AVS B;  3V2Q A;  3B8E B;  3P32 A;  1GK4 A;  1PFI A;  1JY3 O;  2N9B A;  1L4A D;  3NTN A;  2C0W A;  5AW2 B;  5AW0 B;  2GUS A;  5APY A;  3HRN A;  2O1J A;  3BRV B;  2H8P D;  5CHX A;  3BVH A;  5APQ A;  1N73 A;  3GHG C;  2OYH A;  1FJK A;  3BAT A;  1GK6 A;  3VMX A;  1H88 A;  1GL2 D;  3BAS A;  1FJP A;  5APU A;  2E43 A;  1GD2 E;  3VTP C;  3M0A A;  2XKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...