5CMZA

Artificial hiv fusion inhibitor ap3 fused to the c-terminus of gp41 nhr
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
43
structure length
43
Chain Sequence
IVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein
publication title Improved Pharmacological and Structural Properties of HIV Fusion Inhibitor AP3 over Enfuvirtide: Highlighting Advantages of Artificial Peptide Strategy.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/inhibitor
total genus 20
structure length 43
sequence length 43
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5cmzA00
5AW8B 5APYA 3KDPB 2XU6A 5AW7B 3NTNA 4KHXA 4AYCA 5APSA 3L36A 2WPQA 2H7HA 2IPPA 3TNUB 1JNMA 3M91A 2E43A 2W27A 4AQRD 2C9NY 2Q7CA 1IO4A 3T97A 1S9KD 3V4WA 5APXA 3HE4A 3M0AA 5AW6B 3HE5A 2YO3A 1G2CB 1NAFA 4C46A 1KQLA 1FOSE 5AVTB 2Z5IA 2WT7A 1MV8A 1GK6A 2QM7A 5APVA 5AVYB 3TYYA 2E42A 1J2JB 1SLQA 1MUUA 1MFZA 1H88A 4RESB 3VMYA 1HBWA 2YNYA 5AW1B 1NWQA 5AVVB 2VRSA 1JUNA 3UIAA 1YYCA 1X8YA 3KQGA 2N9BA 5APTA 3VYIA 5AVXB 1FAVA 2R5DA 2ZXEB 3HE4B 3P32A 5AVSB 3M06A 1H8AA 3HE5B 5APWA 1HJBA 2QM8A 3P7KA 3NFQA 1GK4A 1HWTC 5AVWB 1S9KE 2P7JA 1A02J 1DH3A 4DZOA 4GKGA 5AW9B 2WT7B 4EOTA 1CI6A 5AVQB 4M3LA 3TK1A 3VMZA 2C9LY 4XE5B 1CSBA 1GZLA 3VN0A 4C7NB 3IR9A 1CZQA 4B86A 4C7NA 3NMDA 1A02F 3LIDA 3LIEA 1T2KD 2P2UA 3VTPC 3L35A 2WWWA 2Z5HA 5AVUB 5AVRB 1GD2E 3OAKA 4I2LC 2WPSA 3TNUA 2JJLA 3A5TA 2R32A 2Q5UA 5AW5B 4HYTB 1OXZA 2W6AA 3MGNA 3M0DA 2WPRA 3V5BA 2XV5A 2R3CA 3L37A 1GTWA 4JYBA 3B8EB 3A2AA 5AVZB 3NXSA 3M9BA 4AUWA 3HTKA 1FOSF 4I6MC 5AW4B 2BASA 5APQA 3I5CA 5APUA 3SWFA 3M9HA 2XZRA 3V4QA 2ZFCA 2R5BA 3A3YB 5AW0B 5CMZA 5AW2B 1H89A 1GU4A 3MD0A 4LC1A 1OWAA 1GU5A 2P67A 5AW3B 1CI6B 1SP4A 2WTYA 1T2KC 3VMXA 3A7OA 1HUCA 3O8ZA 2Q3IA 2KP8A 3P8MC 4JYCA 2YO2A 4GT1A
chains in the Genus database with same CATH superfamily
1EXIA 3H1IG 1S72P 2YXQB 2OTJP 1YITP 3CL3D 1N7SD 4C46A 3FWLA 4WY4A 5APVA 1N73C 1M1JB 4PV1D 2A45H 3KHUA 4W7YA 1JY3O 1PGJA 1YYCA 2K1AA 2AEFA 1VQ5P 3VYIA 5AVXB 1GMJA 1JEKA 3HE5B 4D6TJ 2N1TA 2RMZA 1VQ8P 2OTLP 2WT7B 2JP3A 4M3LA 2W90A 4H13D 1N7LA 4C7NB 3JSVC 1LTIC 3CLQA 2OTKE 3CMEP 4WWIA 1FDMA 3GF3A 3PH0A 2K9JB 3AEAC 3WUVA 4QMAA 1YTZT 5AW5B 1MKMA 1OXZA 3BRVB 2WPRA 1FZCA 2OQQA 3NXSA 4N78D 2KI7B 2G3AA 1ZRTE 3II6A 3N7NA 2KZJA 3AE9C 3SWFA 2K88A 3V4QA 3SWYA 1P84H 3GLMA 5CHXA 4RJTA 1ZR4A 1KZUB 1YQ3C 4GOEA 1KB9E 1FJPA 4C7RA 3HUSB 2H89C 1WMKA 4IFFA 5CCHA 3WUUA 3RL0g 4D6TG 2E43A 2FYZA 1RHZB 5CCGD 2Q7CA 1BGYE 2B87A 1S9KD 1PL5A 3CCJP 1VF5D 1KQLA 1JOCA 3EQ2A 5AVTB 1VQNP 1PPJD 3HTKB 2I1KA 3VMYA 1HBWA 4IL6H 1IC2A 3H1LD 1NWQA 3V2QA 1X8YA 4H44C 2L5GB 1JB0J 1N73B 3CXHE 2KNCB 3AEEC 1JY2P 4B86A 3RK3B 1OFCX 2HODA 1QVFO 5EFWB 3A0HE 2ZYAA 3GMAA 5M1BA 2WPSA 2JJLA 3L72E 2W6AA 2WSEJ 1PPJG 1LTTC 3M0DA 1SQBE 3SWKA 3L71J 5CBNA 1Y9BA 3IAOA 1X79B 3RBZA 2ZFCA 3A3YB 3CX5D 1EDKA 1NTZJ 1P84E 1K8AQ 2WSSH 3A7OA 1NTMJ 3JCUH 4C7NA 3L71D 4GT1A 3H32B 1JMMA 1SQVE 4CPGA 1YJNP 2Y0EA 5APSA 3H1HJ 3CI9A 2WPVB 1RQUA 5DJTB 1KYOD 3HE4A 3CCEP 4H0LD 3S4RA 2QE7H 1NTME 1KQFB 1H88A 3IFMA 1YHQP 5AVVB 2RKLA 3H1HD 4IL6E 4PD4E 2N9BA 4TT3H 2IZ1A 2R5DA 1PZQA 1LP1B 3H1KJ 1L2PA 1YTZI 1KC8Q 3L71G 5AW9B 4R4LA 1NO4A 3G3ZA 4XE5B 1CSBA 1SFCC 3Q1MA 2Q1KA 1G1IA 4ZKPA 1KILD 2E5TA 1NTZG 2QSIA 2ZYGA 1N86A 2FXPA 4H44B 2QA4P 1VL2A 4IFMA 3D71A 1NTMG 1ZLLA 1L0LJ 2FXOA 2KK7A 3TGUJ 3V5BA 2UWJE 4Y99C 3H1HG 3HTKA 3CCRP 4HB1A 5AW4B 4WY4D 2XZRA 1N7SA 4WVZA 2FBWC 3MD0A 4U7JA 2A45I 4PJ0H 3U59A 1VQ6P 1L0LD 1DD4A 1RE4A 1L0NE 3TGUD 4L75A 3GHGA 2N1TD 3JCUE 1NTZK 1YBKA 2DW3A 2XU6A 3NTNA 4KHXA 4ASVA 4BWNA 3H1JE 3H1KG 1NTMK 1NAFA 1NH4A 3C1LA 3L75J 4OGQB 3EFFK 2L91A 2ZT9D 3RK2C 3UIAA 4Z1MH 3KQGA 2H43A 1L0LG 3P32A 2E76C 3TGUG 3B4SA 5GTHH 1URQC 3L75D 3Q5PA 1VQ7P 3AE8C 3FXEA 1RE3C 3H32A 1VQMP 2V7QJ 1Y47A 3MIWA 1Q82Q 4I2LC 3A5TA 5CCHD 2Y9ZA 3H6PA 1SFCB 1L4AB 2CK3H 1QX8A 1DX7A 3FGAD 3M9BA 1T3JA 2KSEA 4I6MC 5BU5A 2BASA 5APUA 3CC7P 1FC2C 1L0LK 1SQQD 2W83C 3PP5A 2B9BA 1GU5A 1LTJC 1NTKD 1SP4A 4PJ0E 3L75G 1G2CA 4Y99B 2WPQA 2JKVA 1EZVG 2GA1A 1BCCD 2RN0A 5TISH 1EQ7A 3EWKA 1S2EA 2A06D 4ZNCA 2XKMA 5C39A 3S1KA 1VQPP 1RQVA 1PIXA 2O01J 2IZ0A 3CCQP 2OYIC 1FZEA 3L4FA 3CCSP 5KJ7C 2HYNA 2YKOA 2ZXEB 1DEBA 4HH2A 1BDCA 1K04A 3L70E 1FDOA 4WB4A 1KD1Q 5GTHE 1GL2A 1LJ2A 3KPEA 1T2KD 3BCCJ 3L73E 3RK2B 2YKPA 2HLOA 4EYYQ 2E76B 2MKVA 1RH5B 3E7KA 1URQB 1KTMA 1MZ9A 5K5GB 1XTCC 3USSA 1Q81Q 2BCCD 3B71A 2KLVA 3H1IE 2W6BA 4K35A 3W68A 2K37A 2PAJA 1ZMEC 3AE6C 1ZR2A 1FU1A 1KFNA 1LTBC 1SQXJ 3D6ZA 3LW5J 1KQSO 5AW7B 4AYCA 4UB6H 2OYHA 3M91A 2HFED 4AQRD 1IO4A 1LTJB 3T97A 3V4WA 1KB9H 1KILA 3B5NC 1PGOA 5TISE 1GK6A 1L4AA 2WMMA 2E42A 1EDJA 3U1CA 3BCCG 3PHLA 4TLFA 4BRYB 1J1EC 4O9BA 1SQXD 3WUTA 3KZIH 1JUNA 1AVOA 3U1AA 1PFIA 3K5BA 2IBZD 4GKGA 4EI2A 5GTIH 2IX7C 2OYIB 1N2DC 3VTPC 1PGQA 3MP7B 3HD7A 1JCDA 3RK3D 2I8DA 4PV1C 3FX0A 2JR8A 3CXHH 3ABVC 3L37A 1SQXG 3AEBC 1VQOP 1KN7A 2R44A 1IFIA 1NHLA 2IYPA 3A0HH 1RF0A 2K3RA 5CMZA 5AW2B 2LR2A 4D6TE 1W2EA 1GW3A 1X22A 3PRJA 4JPZB 4RKUJ 1HGZA 2M3EA 1JY2O 3ITKA 5AW8B 4N78E 1U7MA 4I1LA 2FY8A 1Q2NA 1OVRA 3FWNA 4UB6E 2CPBA 2JWDA 2WSEH 2M0BA 3AE1C 1HF9A 1XTGB 3O6QB 1SQXK 4L73A 1MUUA 1ZRTD 2C0XA 1RE3A 3H1LJ 1PV3A 1S5LX 3KZIE 4EDFA 1LWUC 1KYOH 3E1IA 3B5NB 1S9KE 1ZV8A 1JO5A 3IR9A 1E5WA 1J1EB 1PPJE 5GTIE 3W67A 5TJHA 1HH0A 1IFMA 2BEZF 2P10A 4PD4H 1JM0A 3AE7C 1NOHA 1NKZB 1BGYD 1JCCA 2QJPC 3GW6A 1LTJA 2SPZA 1ZW0A 2POHA 1N8RQ 1USEA 1PGPA 2JO1A 2IBZI 1NGMB 1WRGA 3VMAA 2XDJA 4PV1B 3AE3C 2P67A 4ZKUA 2KS1B 2Y9YA 4A7PA 2KP8A 1M1JA 3H1LG 1K05A 3PTZA 3JC22 1S4XA 2J5UA 2H7HA 3PJSK 1GL2D 4WBAA 2KXPB 1SQPJ 3MZWB 1SQBD 3BATA 3HE5A 2Z5IA 2WT7A 1PP9J 2AEMA 3L71E 3TF5A 1IJDB 2H88C 1X9VA 1IFNA 5KLVJ 2E74C 1SS1A 2K9JA 4OGQD 1NTZE 1SQPD 1P84D 5APWA 1HJBA 2QM8A 3AEDC 1GK4A 5AVWB 1KYOE 1R5SA 3TSIA 2QEXP 4EOTA 5AVQB 5B5EE 1PP9D 4U3FJ 2NPSC 1QVGO 1SQVD 4JQ0D 3VP8A 1K73Q 2P2UA 2XNXA 1DD3A 1LWUB 5KLVD 3H1HE 1JY3N 2ZVNB 1LT1A 3O6QA 1AQTA 4U3FD 3HUSA 2CPSA 1FOSF 1KB9I 3I5CA 1SFCD 3M9HA 1L4AD 1VQLP 2YMKA 2QJPB 3GF7A 1H89A 1OVUA 5AW3B 3H1KE 1PP9G 2WTYA 3VMXA 4YTPC 2M5AB 2ZAEB 4GODA 1JY2N 5KLVG 4YXDC 2V7QH 1FS0E 1DEEG 4W7ZA 2P58A 5APXA 1BSHA 1L0LE 4U3FG 3HD7D 4EIJA 4WY4C 3TGUE 1N73A 4NPEA 2KNCA 5KAIH 2W8ZA 2O3JA 1KQGB 1BE3J 3CXHI 3R4YA 2B88A 5L8RJ 1BDDA 2Z4EA 1OW7A 3BASA 1L0ND 2E75C 1AV1A 1CZQA 1IK9A 5KLVK 1BE3D 3H1JD 2E74B 2Z5HA 1GD2E 2PFXA 1NU1J 4JBZA 2KIKA 3AE5C 1FZCC 2OGUA 1GDTA 2AXCA 2XV5A 2Y0CA 2NPSB 2ZT9C 2E76D 4JYBA 3G6EP 1P84I 3L75E 2O01H 2P1JA 5APQA 1T6AA 1EZVE 2QJKC 1SQQJ 1NU1D 3FXDA 4DOJA 1NTKJ 1YQ4C 1EXJA 1WT6A 3C9IA 1BE3G 2YO2A 3CMAP 1LWUA 2HR3A 1LTAC 4N6JA 2W27A 1BCCJ 1LP1A 2O1KA 4PD4I 2YIUC 2ITAA 1NAYA 1NVOA 5AVYB 1MFZA 2IFMA 3R2PA 3RL0D 1ZN5A 4NPDA 5KAIE 3CWBJ 5AW1B 1FZFA 1NU1G 1LNQA 3RGUA 2BEQD 1FAVA 1NKNA 2IYOA 3CPWO 3P7KA 2P7JA 1A02J 2QJYC 2WSFJ 2WQYC 1U57A 2A06E 3VN0A 3ZDMA 1QL2A 1RY3A 2KUBA 3OJAB 4K3AA 3MUDC 1SQQG 3CWBD 5CBOA 3OAKA 1FZGA 1NTKG 2R32A 3C8VA 2J58A 2E75B 2KZIA 2D2CC 3M0DC 5KJ7D 1GTWA 1IFJA 2M3BA 2BCCJ 1BCCG 2J59M 3PLNA 1OWAA 1J1DC 2A06G 1FZCB 1AJYA 1T2KC 2ZT9B 1QGKB 3CWBG 3AEGC 3KDPB 1ZOYC 2WSCJ 1SQQK 1VQ4P 3L74J 3E1RA 2ZXXA 3BCCE 2QJKB 3CCLP 1LTGC 1NTKK 1AQ5A 2C9NY 2FKWB 4L76A 1FOSE 2NPSA 3SFDC 1AA0A 4L74A 1T8ZA 3L74D 3H1ID 2GM4A 2FYUJ 2B87B 1KORA 2QG4A 4IOIH 3S9OA 1OW6A 3NFQA 3P8CD 2YIUB 4LGDE 1EZVI 4OVNF 1SFCA 3V6IA 2BCCG 1LGHB 1SQXE 3KXDA 4HKZH 2WWWA 4YXWH 2FYUD 2LXBA 2QJYB 1EC5A 1W2BO 2OYOA 2R3CA 1KV4A 3A2AA 3L74G 2HODB 3SFEC 1YJ9P 2Q9IA 3MTUE 1M56D 2FFDC 1M8OB 1LT9C 1BSNA 5KLIC 1N7SC 4LLHA 1DIPA 4LC1A 2D2CB 2WZ7A 3RK3E 1CI6B 1RE4C 1JTHB 2QRXA 1Q86Q 5KTBA 1ZP0C 3GHGC 2AXTH 3RK3C 3I56P 3AEFC 2FYUG 2W6JH 3V2PA 3G9RA 3VOPA 1RF1C 2IBZG 4H13C 1J1DB 2R3SA 1FZAA 3TYYA 1SLQA 2N9YB 4N3YB 3CX5H 3CCMP 3HRNA 3HE4B 2KSJA 4D6TD 2K9YA 3RBXA 1EDLA 1URQA 1S5LH 3V2NA 3NMDA 1YI2P 3LIDA 3G4SP 3F89A 2FYUK 1FJKA 2XNDH 1BGYJ 2Y0DA 3QWOC 2Q5UA 1Q90D 5B5EH 1KB9D 1IFDA 1EDIA 2ZJSE 4JF7A 4KT0J 3F5HA 5CCGC 2OARA 4GDOA 1JY3P 1M90Q 1HJ0A 1VF5C 2YKQA 3H1LE 1GU4A 3Q3DA 3BVHA 1H0TB 1HUCA 4Y28J 5CJ4A 2Q3IA 2ZVOB 4ASWA 4JYCA 1M57D 4H44D 1M7LA 5E79H 2FFDB 1KMIZ 4BRYA 1LT9B 2AXTE 5KLIB 1N7SB 1USDA 3L36A 1YJWP 2IPPA 3L72J 1QEXA 4IL6X 5KKZC 3M0AA 1Q7YQ 1SQBJ 4IFDK 3CXHD 2YO3A 2QM7A 3GHGB 1OW8A 1LTSC 3MUDA 2YNYA 2OYIA 1BGYG 1VQKP 2VRSA 1RF1B 4H13B 5DJUB 5APTA 5KJ7A 3L72D 3CX5E 3M06A 1H8AA 1DH3A 1CI6A 2C9LY 1OX3A 2NRGA 3Q5SA 1AFOA 1JTHA 2A45G 1GL2C 2I1JA 1VDFA 5B66H 1A02F 1SQVJ 1S5LE 1QLED 2JDIH 1CW5A 5AVRB 2E5YA 2AEJA 4HJGH 2PRRA 4HYTB 1SQPE 4I7ZC 2E74D 1G1JA 3B8EB 3G71P 1PP9E 4OGQC 4AUWA 4GIFA 4OH8B 3L72G 4H0LC 2NPSD 4GOFA 5CJ0A 4BXLA 1NTZD 5KLVE 1SQBG 2FXMA 3D70A 3EFGA 2PP6A 1NTMD 1VPCA 2IFNA 4U3FE 1KILE 3WU2H 1VF5B 1OVVA 4PD4D 5E79E 1SQPG 2OYHC 3M9QA 3IN6A 5AW6B 1KILC 3B5NA 1HTLC 2RH0A 1G2CB 2KLUA 1KFMA 1L4AC 1SQVG 2B89A 2YXRB 2KB7P 2QVAA 3N4XA 3GG2A 1HVVA 3CCVP 1SQBK 1X0TA 1YIJP 5KKZB 4KJMA 3H1KD 2QIWA 2MJZA 1L0NJ 2O01N 1H0TA 1GZLA 2C0WA 2HPCB 5H2FH 3LIEA 4OWFA 3A0BH 2FFDA 3L35A 5B66E 3H1JJ 1LT9A 1SQPK 3HD7C 1S1CX 5KAFH 2N1TC 3MGNA 3IF4A 1SQVK 1GL2B 2H8PD 2KS1A 5AVZB 2E75D 4RO0A 1JMBA 1BE3E 1RF0C 1RF1A 3VP9A 4XFJA 1NJIQ 3Q2YA 1QL1A 4NPFX 4I7ZB 2LXCB 2WSFH 1IK7A 3RK2D 2M8RA 3CX5I 2FYNC 1GW4A 5APYA 2Q6QA 1AVYA 4H0LB 4DCKA 1OIPA 1ZXGA 1URQD 1S3JA 3WU2E 4UB8H 3TNUB 1R8EA 1JNMA 1FBMA 1L0NG 1NU1E 1Z56A 3OA7A 2JWAA 1MV8A 1J2JB 1D7MA 1KYOI 3H1JG 4RESB 1M1KQ 3MHVA 3QH9A 2JEEA 3Q5RA 5CCHC 1EZVD 2OYHB 3T97B 1SQQE 1KILB 1IFPA 1Y8AA 3CC2P 1NTKE 2O1JA 3CD6P 4MN4C 2WSCH 1FDIA 5CCGA 3SSUA 5H2FE 3CC4P 2GUSA 2HG5D 5AVUB 3A0BE 1L0NK 2GUVA 1BCCE 3RL0C 5KAFE 2KYVA 4WY4B 4W80A 2M5AA 1SVFA 3KYQA 3LW5H 4ZMDA 3AE2C 2ZYDA 3V2RA 1HGVA 3HD7B 1R5LA 3CWBE 2R5BA 5AW0B 1VQ9P 2N1TB 3L70J 1OZHA 1W5CE 1IZNB 4DT0A 2NZ2A 4DZOA 4R4MA 1M1JC 2WITA 2D2CD 2HPCA 3L73J 3D6YA 1MFTA 1NU1K 2G8YA 2LKMA 1UIXA 2KOGA 3L70D 4UB8E 1T3UA 1UIIA 2FYNB 2WVRA 5BU8B 1FE6A 1E79H 3L73D 3TDKA 3H1IJ 2V4HA 2BCCE 5AVSB 1HWTC 1TU3F 3TK1A 3VMZA 3BRTB 3CCUP 4YPCA 2YMYA 1K9MQ 3BCCD 1OMIA 3L74E 3L70G 2IDBA 2PGDA 3TNUA 3P8CE 3AECC 3L73G 3OW2O 3HUSC 1U7JA 3B5ND 3H25A 1FZBA 2FYUE 3RL0B 3WMM0 3I55P 1NYHA 2Q3EA 2IBZE 5BVZA 4DJGA 3O8ZA 3P8MC 4XA4A 3AE4C
chains in the Genus database with same CATH topology
1JY2N 1M7LA 2FFDB 1LT9B 1N7SB 3L36A 2IPPA 4W7ZA 3CL3D 1EQ7A 3M0AA 5APXA 4IFDK 2YO3A 3HD7D 1N7SD 4C46A 4EIJA 4WY4C 4WY4A 5APVA 2QM7A 3GHGB 1M1JB 1N73A 1N73C 1LTSC 3MUDA 2A45H 2XKMA 4W7YA 2YNYA 1JY3O 2OYIC 2OYIA 1FZEA 2VRSA 1RF1B 3L4FA 1YYCA 3VYIA 5APTA 5KJ7C 5KJ7A 2HYNA 2YKOA 5AVXB 2Z4EA 2ZXEB 1DEBA 3M06A 1H8AA 3HE5B 3BASA 4HH2A 2N1TA 1DH3A 2WT7B 1CI6A 4M3LA 2C9LY 4WB4A 1N7LA 4C7NB 1AFOA 1JTHA 2A45G 1CZQA 1IK9A 1GL2C 2I1JA 1GL2A 1VDFA 1A02F 5KLVK 3KPEA 1LTIC 3CLQA 1T2KD 3RK2B 1FDMA 2Z5HA 2YKPA 1CW5A 5AVRB 1GD2E 2HLOA 1YTZT 5AW5B 4HYTB 1OXZA 3BRVB 2WPRA 1FZCC 1GDTA 1FZCA 1URQB 2XV5A 2NPSB 1G1JA 1MZ9A 4JYBA 3B8EB 3NXSA 4N78D 2O01H 2P1JA 4AUWA 1XTCC 3II6A 3N7NA 4GIFA 5APQA 4OH8B 3SWFA 2NPSD 3V4QA 2KLVA 5CJ0A 2W6BA 3SWYA 2FXMA 5CHXA 4DOJA 1ZR4A 3EFGA 1KZUB 2PAJA 2PP6A 1VPCA 1FJPA 1ZR2A 4C7RA 1FU1A 1KFNA 1WT6A 3C9IA 3HUSB 1LTBC 2YO2A 2IFNA 5AW7B 4IFFA 5CCHA 4AYCA 1LWUA 2OYHC 2OYHA 1LTAC 3M91A 2HFED 4N6JA 2FYZA 2W27A 3M9QA 4AQRD 5CCGD 2Q7CA 1LTJB 1IO4A 3T97A 1S9KD 3V4WA 5AW6B 1KILC 1KILA 2O1KA 3B5NC 3B5NA 1HTLC 1G2CB 1KFMA 1KQLA 1JOCA 3EQ2A 5AVTB 1L4AC 1GK6A 1L4AA 5AVYB 2E42A 1MFZA 2IFMA 3R2PA 3U1CA 3HTKB 1J1EC 2KB7P 3RL0D 2I1KA 4O9BA 3VMYA 1ZN5A 1HBWA 1IC2A 5AW1B 1FZFA 1NWQA 3N4XA 3V2QA 1JUNA 3U1AA 1HVVA 1X8YA 1SQBK 1PFIA 1FAVA 1NKNA 2MJZA 3P7KA 2P7JA 2L5GB 1A02J 4GKGA 1N73B 1GZLA 3VN0A 1QL2A 2C0WA 1RY3A 3OJAB 1JY2P 4B86A 2IX7C 2HPCB 3RK3B 3LIEA 2OYIB 2HODA 1N2DC 3VTPC 2FFDA 3L35A 1LT9A 1SQPK 3HD7C 3HD7A 1JCDA 3OAKA 2WPSA 1FZGA 2JJLA 2R32A 3RK3D 2J58A 2W6AA 2N1TC 3MGNA 3M0DC 1LTTC 3M0DA 5KJ7D 1SQVK 3L37A 1GL2B 1GTWA 2H8PD 1IFJA 5AVZB 1IFIA 2M3BA 1NHLA 1X79B 1RF0C 1RF1A 1RF0A 2ZFCA 3A3YB 3VP9A 5CMZA 5AW2B 1QL1A 2J59M 1OWAA 1J1DC 1FZCB 2WSFH 1W2EA 1T2KC 1GW3A 3RK2D 3A7OA 2M8RA 1HGZA 1JY2O 4C7NA 4GT1A 5AW8B 1GW4A 5APYA 4N78E 3KDPB 3H32B 1JMMA 1SQQK 4I1LA 5APSA 1URQD 1LTGC 3CI9A 3TNUB 1JNMA 1NTKK 2CPBA 1FBMA 1AQ5A 2C9NY 2FKWB 2WSEH 3HE4A 1Z56A 3OA7A 1XTGB 1SQXK 1FOSE 1MV8A 2NPSA 1J2JB 1MUUA 1H88A 3IFMA 2C0XA 4RESB 1RE3A 2JEEA 1T8ZA 5AVVB 5CCHC 2OYHB 2GM4A 1LWUC 2N9BA 2R5DA 3E1IA 1KILB 3B5NB 1YTZI 3NFQA 3P8CD 1S9KE 4LGDE 5AW9B 1ZV8A 1NO4A 2O1JA 3G3ZA 4XE5B 1CSBA 1SFCC 1SFCA 1JO5A 3IR9A 1E5WA 1J1EB 1G1IA 1HH0A 2WSCH 4ZKPA 1KILD 1IFMA 1LGHB 5CCGA 2GUSA 2WWWA 1NOHA 2HG5D 5AVUB 1N86A 1NKZB 1L0NK 2GUVA 1JCCA 4IFMA 1ZLLA 1LTJA 3RL0C 2E43A 2KYVA 2POHA 3V5BA 4WY4B 2R3CA 4W80A 3A2AA 2HODB 4Y99C 1SVFA 3KYQA 3LW5H 3HTKA 3V2RA 2Q9IA 1HGVA 5AW4B 3MTUE 3HD7B 2FFDC 1WRGA 4WY4D 1LT9C 2XDJA 2XZRA 2R5BA 1N7SC 5AW0B 1N7SA 4LLHA 3MD0A 4LC1A 3U59A 2A45I 2N1TB 2WZ7A 2P67A 1CI6B 1RE4C 1RE4A 1JTHB 4ZKUA 2KP8A 5KTBA 4DZOA 3GHGC 1M1JC 2WITA 1M1JA 2N1TD 3GHGA 3RK3C 2HPCA 1NTZK 2XU6A 3NTNA 4KHXA 3V2PA 1NU1K 2H7HA 3VOPA 1RF1C 1GL2D 4WBAA 2LKMA 1J1DB 2KOGA 1NTMK 1T3UA 3BATA 1FZAA 3HE5A 1NAFA 1NH4A 2Z5IA 2WT7A 3TYYA 1SLQA 5BU8B 4N3YB 1IJDB 1X9VA 1IFNA 3RK2C 3UIAA 3KQGA 2H43A 3HRNA 3HE4B 3P32A 5AVSB 2KSJA 5APWA 1HJBA 2QM8A 1HWTC 1GK4A 5AVWB 3TSIA 4EOTA 5AVQB 3TK1A 3VMZA 3BRTB 1URQC 1URQA 2YMYA 3V2NA 2NPSC 3NMDA 3LIDA 3VP8A 1RE3C 2FYUK 1FJKA 2P2UA 3H32A 2XNXA 1LWUB 3MIWA 1JY3N 4I2LC 3TNUA 3A5TA 2Q5UA 5CCHD 3H6PA 3P8CE 1IFDA 1SFCB 1L4AB 4JF7A 1DX7A 3HUSC 3HUSA 2CPSA 3M9BA 1T3JA 1FOSF 3B5ND 5CCGC 2OARA 4I6MC 5BU5A 2BASA 5APUA 3I5CA 1SFCD 1JY3P 3M9HA 1L4AD 2YKQA 1L0LK 3PP5A 1H89A 1GU4A 1FZBA 3RL0B 3WMM0 1GU5A 3BVHA 5AW3B 1LTJC 1SP4A 2WTYA 3VMXA 1HUCA 5BVZA 5CJ4A 3O8ZA 1G2CA 2Q3IA 4Y99B 3P8MC 4XA4A 4JYCA 2WPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW8 B;  5APY A;  3KDP B;  2XU6 A;  5AW7 B;  3NTN A;  4KHX A;  4AYC A;  5APS A;  3L36 A;  2WPQ A;  2H7H A;  2IPP A;  3TNU B;  1JNM A;  3M91 A;  2E43 A;  2W27 A;  4AQR D;  2C9N Y;  2Q7C A;  1IO4 A;  3T97 A;  1S9K D;  3V4W A;  5APX A;  3HE4 A;  3M0A A;  5AW6 B;  3HE5 A;  2YO3 A;  1G2C B;  1NAF A;  4C46 A;  1KQL A;  1FOS E;  5AVT B;  2Z5I A;  2WT7 A;  1MV8 A;  1GK6 A;  2QM7 A;  5APV A;  5AVY B;  3TYY A;  2E42 A;  1J2J B;  1SLQ A;  1MUU A;  1MFZ A;  1H88 A;  4RES B;  3VMY A;  1HBW A;  2YNY A;  5AW1 B;  1NWQ A;  5AVV B;  2VRS A;  1JUN A;  3UIA A;  1YYC A;  1X8Y A;  3KQG A;  2N9B A;  5APT A;  3VYI A;  5AVX B;  1FAV A;  2R5D A;  2ZXE B;  3HE4 B;  3P32 A;  5AVS B;  3M06 A;  1H8A A;  3HE5 B;  5APW A;  1HJB A;  2QM8 A;  3P7K A;  3NFQ A;  1GK4 A;  1HWT C;  5AVW B;  1S9K E;  2P7J A;  1A02 J;  1DH3 A;  4DZO A;  4GKG A;  5AW9 B;  2WT7 B;  4EOT A;  1CI6 A;  5AVQ B;  4M3L A;  3TK1 A;  3VMZ A;  2C9L Y;  4XE5 B;  1CSB A;  1GZL A;  3VN0 A;  4C7N B;  3IR9 A;  1CZQ A;  4B86 A;  4C7N A;  3NMD A;  1A02 F;  3LID A;  3LIE A;  1T2K D;  2P2U A;  3VTP C;  3L35 A;  2WWW A;  2Z5H A;  5AVU B;  5AVR B;  1GD2 E;  3OAK A;  4I2L C;  2WPS A;  3TNU A;  2JJL A;  3A5T A;  2R32 A;  2Q5U A;  5AW5 B;  4HYT B;  1OXZ A;  2W6A A;  3MGN A;  3M0D A;  2WPR A;  3V5B A;  2XV5 A;  2R3C A;  3L37 A;  1GTW A;  4JYB A;  3B8E B;  3A2A A;  5AVZ B;  3NXS A;  3M9B A;  4AUW A;  3HTK A;  1FOS F;  4I6M C;  5AW4 B;  2BAS A;  5APQ A;  3I5C A;  5APU A;  3SWF A;  3M9H A;  2XZR A;  3V4Q A;  2ZFC A;  2R5B A;  3A3Y B;  5AW0 B;  5CMZ A;  5AW2 B;  1H89 A;  1GU4 A;  3MD0 A;  4LC1 A;  1OWA A;  1GU5 A;  2P67 A;  5AW3 B;  1CI6 B;  1SP4 A;  2WTY A;  1T2K C;  3VMX A;  3A7O A;  1HUC A;  3O8Z A;  2Q3I A;  2KP8 A;  3P8M C;  4JYC A;  2YO2 A;  4GT1 A; 
#chains in the Genus database with same CATH topology
 1EXI A;  3H1I G;  1S72 P;  2YXQ B;  2OTJ P;  1YIT P;  3CL3 D;  1N7S D;  4C46 A;  3FWL A;  4WY4 A;  5APV A;  1N73 C;  1M1J B;  4PV1 D;  2A45 H;  3KHU A;  4W7Y A;  1JY3 O;  1PGJ A;  1YYC A;  2K1A A;  2AEF A;  1VQ5 P;  3VYI A;  5AVX B;  1GMJ A;  1JEK A;  3HE5 B;  4D6T J;  2N1T A;  2RMZ A;  1VQ8 P;  2OTL P;  2WT7 B;  2JP3 A;  4M3L A;  2W90 A;  4H13 D;  1N7L A;  4C7N B;  3JSV C;  1LTI C;  3CLQ A;  2OTK E;  3CME P;  4WWI A;  1FDM A;  3GF3 A;  3PH0 A;  2K9J B;  3AEA C;  3WUV A;  4QMA A;  1YTZ T;  5AW5 B;  1MKM A;  1OXZ A;  3BRV B;  2WPR A;  1FZC A;  2OQQ A;  3NXS A;  4N78 D;  2KI7 B;  2G3A A;  1ZRT E;  3II6 A;  3N7N A;  2KZJ A;  3AE9 C;  3SWF A;  2K88 A;  3V4Q A;  3SWY A;  1P84 H;  3GLM A;  5CHX A;  4RJT A;  1ZR4 A;  1KZU B;  1YQ3 C;  4GOE A;  1KB9 E;  1FJP A;  4C7R A;  3HUS B;  2H89 C;  1WMK A;  4IFF A;  5CCH A;  3WUU A;  3RL0 g;  4D6T G;  2E43 A;  2FYZ A;  1RHZ B;  5CCG D;  2Q7C A;  1BGY E;  2B87 A;  1S9K D;  1PL5 A;  3CCJ P;  1VF5 D;  1KQL A;  1JOC A;  3EQ2 A;  5AVT B;  1VQN P;  1PPJ D;  3HTK B;  2I1K A;  3VMY A;  1HBW A;  4IL6 H;  1IC2 A;  3H1L D;  1NWQ A;  3V2Q A;  1X8Y A;  4H44 C;  2L5G B;  1JB0 J;  1N73 B;  3CXH E;  2KNC B;  3AEE C;  1JY2 P;  4B86 A;  3RK3 B;  1OFC X;  2HOD A;  1QVF O;  5EFW B;  3A0H E;  2ZYA A;  3GMA A;  5M1B A;  2WPS A;  2JJL A;  3L72 E;  2W6A A;  2WSE J;  1PPJ G;  1LTT C;  3M0D A;  1SQB E;  3SWK A;  3L71 J;  5CBN A;  1Y9B A;  3IAO A;  1X79 B;  3RBZ A;  2ZFC A;  3A3Y B;  3CX5 D;  1EDK A;  1NTZ J;  1P84 E;  1K8A Q;  2WSS H;  3A7O A;  1NTM J;  3JCU H;  4C7N A;  3L71 D;  4GT1 A;  3H32 B;  1JMM A;  1SQV E;  4CPG A;  1YJN P;  2Y0E A;  5APS A;  3H1H J;  3CI9 A;  2WPV B;  1RQU A;  5DJT B;  1KYO D;  3HE4 A;  3CCE P;  4H0L D;  3S4R A;  2QE7 H;  1NTM E;  1KQF B;  1H88 A;  3IFM A;  1YHQ P;  5AVV B;  2RKL A;  3H1H D;  4IL6 E;  4PD4 E;  2N9B A;  4TT3 H;  2IZ1 A;  2R5D A;  1PZQ A;  1LP1 B;  3H1K J;  1L2P A;  1YTZ I;  1KC8 Q;  3L71 G;  5AW9 B;  4R4L A;  1NO4 A;  3G3Z A;  4XE5 B;  1CSB A;  1SFC C;  3Q1M A;  2Q1K A;  1G1I A;  4ZKP A;  1KIL D;  2E5T A;  1NTZ G;  2QSI A;  2ZYG A;  1N86 A;  2FXP A;  4H44 B;  2QA4 P;  1VL2 A;  4IFM A;  3D71 A;  1NTM G;  1ZLL A;  1L0L J;  2FXO A;  2KK7 A;  3TGU J;  3V5B A;  2UWJ E;  4Y99 C;  3H1H G;  3HTK A;  3CCR P;  4HB1 A;  5AW4 B;  4WY4 D;  2XZR A;  1N7S A;  4WVZ A;  2FBW C;  3MD0 A;  4U7J A;  2A45 I;  4PJ0 H;  3U59 A;  1VQ6 P;  1L0L D;  1DD4 A;  1RE4 A;  1L0N E;  3TGU D;  4L75 A;  3GHG A;  2N1T D;  3JCU E;  1NTZ K;  1YBK A;  2DW3 A;  2XU6 A;  3NTN A;  4KHX A;  4ASV A;  4BWN A;  3H1J E;  3H1K G;  1NTM K;  1NAF A;  1NH4 A;  3C1L A;  3L75 J;  4OGQ B;  3EFF K;  2L91 A;  2ZT9 D;  3RK2 C;  3UIA A;  4Z1M H;  3KQG A;  2H43 A;  1L0L G;  3P32 A;  2E76 C;  3TGU G;  3B4S A;  5GTH H;  1URQ C;  3L75 D;  3Q5P A;  1VQ7 P;  3AE8 C;  3FXE A;  1RE3 C;  3H32 A;  1VQM P;  2V7Q J;  1Y47 A;  3MIW A;  1Q82 Q;  4I2L C;  3A5T A;  5CCH D;  2Y9Z A;  3H6P A;  1SFC B;  1L4A B;  2CK3 H;  1QX8 A;  1DX7 A;  3FGA D;  3M9B A;  1T3J A;  2KSE A;  4I6M C;  5BU5 A;  2BAS A;  5APU A;  3CC7 P;  1FC2 C;  1L0L K;  1SQQ D;  2W83 C;  3PP5 A;  2B9B A;  1GU5 A;  1LTJ C;  1NTK D;  1SP4 A;  4PJ0 E;  3L75 G;  1G2C A;  4Y99 B;  2WPQ A;  2JKV A;  1EZV G;  2GA1 A;  1BCC D;  2RN0 A;  5TIS H;  1EQ7 A;  3EWK A;  1S2E A;  2A06 D;  4ZNC A;  2XKM A;  5C39 A;  3S1K A;  1VQP P;  1RQV A;  1PIX A;  2O01 J;  2IZ0 A;  3CCQ P;  2OYI C;  1FZE A;  3L4F A;  3CCS P;  5KJ7 C;  2HYN A;  2YKO A;  2ZXE B;  1DEB A;  4HH2 A;  1BDC A;  1K04 A;  3L70 E;  1FDO A;  4WB4 A;  1KD1 Q;  5GTH E;  1GL2 A;  1LJ2 A;  3KPE A;  1T2K D;  3BCC J;  3L73 E;  3RK2 B;  2YKP A;  2HLO A;  4EYY Q;  2E76 B;  2MKV A;  1RH5 B;  3E7K A;  1URQ B;  1KTM A;  1MZ9 A;  5K5G B;  1XTC C;  3USS A;  1Q81 Q;  2BCC D;  3B71 A;  2KLV A;  3H1I E;  2W6B A;  4K35 A;  3W68 A;  2K37 A;  2PAJ A;  1ZME C;  3AE6 C;  1ZR2 A;  1FU1 A;  1KFN A;  1LTB C;  1SQX J;  3D6Z A;  3LW5 J;  1KQS O;  5AW7 B;  4AYC A;  4UB6 H;  2OYH A;  3M91 A;  2HFE D;  4AQR D;  1IO4 A;  1LTJ B;  3T97 A;  3V4W A;  1KB9 H;  1KIL A;  3B5N C;  1PGO A;  5TIS E;  1GK6 A;  1L4A A;  2WMM A;  2E42 A;  1EDJ A;  3U1C A;  3BCC G;  3PHL A;  4TLF A;  4BRY B;  1J1E C;  4O9B A;  1SQX D;  3WUT A;  3KZI H;  1JUN A;  1AVO A;  3U1A A;  1PFI A;  3K5B A;  2IBZ D;  4GKG A;  4EI2 A;  5GTI H;  2IX7 C;  2OYI B;  1N2D C;  3VTP C;  1PGQ A;  3MP7 B;  3HD7 A;  1JCD A;  3RK3 D;  2I8D A;  4PV1 C;  3FX0 A;  2JR8 A;  3CXH H;  3ABV C;  3L37 A;  1SQX G;  3AEB C;  1VQO P;  1KN7 A;  2R44 A;  1IFI A;  1NHL A;  2IYP A;  3A0H H;  1RF0 A;  2K3R A;  5CMZ A;  5AW2 B;  2LR2 A;  4D6T E;  1W2E A;  1GW3 A;  1X22 A;  3PRJ A;  4JPZ B;  4RKU J;  1HGZ A;  2M3E A;  1JY2 O;  3ITK A;  5AW8 B;  4N78 E;  1U7M A;  4I1L A;  2FY8 A;  1Q2N A;  1OVR A;  3FWN A;  4UB6 E;  2CPB A;  2JWD A;  2WSE H;  2M0B A;  3AE1 C;  1HF9 A;  1XTG B;  3O6Q B;  1SQX K;  4L73 A;  1MUU A;  1ZRT D;  2C0X A;  1RE3 A;  3H1L J;  1PV3 A;  1S5L X;  3KZI E;  4EDF A;  1LWU C;  1KYO H;  3E1I A;  3B5N B;  1S9K E;  1ZV8 A;  1JO5 A;  3IR9 A;  1E5W A;  1J1E B;  1PPJ E;  5GTI E;  3W67 A;  5TJH A;  1HH0 A;  1IFM A;  2BEZ F;  2P10 A;  4PD4 H;  1JM0 A;  3AE7 C;  1NOH A;  1NKZ B;  1BGY D;  1JCC A;  2QJP C;  3GW6 A;  1LTJ A;  2SPZ A;  1ZW0 A;  2POH A;  1N8R Q;  1USE A;  1PGP A;  2JO1 A;  2IBZ I;  1NGM B;  1WRG A;  3VMA A;  2XDJ A;  4PV1 B;  3AE3 C;  2P67 A;  4ZKU A;  2KS1 B;  2Y9Y A;  4A7P A;  2KP8 A;  1M1J A;  3H1L G;  1K05 A;  3PTZ A;  3JC2 2;  1S4X A;  2J5U A;  2H7H A;  3PJS K;  1GL2 D;  4WBA A;  2KXP B;  1SQP J;  3MZW B;  1SQB D;  3BAT A;  3HE5 A;  2Z5I A;  2WT7 A;  1PP9 J;  2AEM A;  3L71 E;  3TF5 A;  1IJD B;  2H88 C;  1X9V A;  1IFN A;  5KLV J;  2E74 C;  1SS1 A;  2K9J A;  4OGQ D;  1NTZ E;  1SQP D;  1P84 D;  5APW A;  1HJB A;  2QM8 A;  3AED C;  1GK4 A;  5AVW B;  1KYO E;  1R5S A;  3TSI A;  2QEX P;  4EOT A;  5AVQ B;  5B5E E;  1PP9 D;  4U3F J;  2NPS C;  1QVG O;  1SQV D;  4JQ0 D;  3VP8 A;  1K73 Q;  2P2U A;  2XNX A;  1DD3 A;  1LWU B;  5KLV D;  3H1H E;  1JY3 N;  2ZVN B;  1LT1 A;  3O6Q A;  1AQT A;  4U3F D;  3HUS A;  2CPS A;  1FOS F;  1KB9 I;  3I5C A;  1SFC D;  3M9H A;  1L4A D;  1VQL P;  2YMK A;  2QJP B;  3GF7 A;  1H89 A;  1OVU A;  5AW3 B;  3H1K E;  1PP9 G;  2WTY A;  3VMX A;  4YTP C;  2M5A B;  2ZAE B;  4GOD A;  1JY2 N;  5KLV G;  4YXD C;  2V7Q H;  1FS0 E;  1DEE G;  4W7Z A;  2P58 A;  5APX A;  1BSH A;  1L0L E;  4U3F G;  3HD7 D;  4EIJ A;  4WY4 C;  3TGU E;  1N73 A;  4NPE A;  2KNC A;  5KAI H;  2W8Z A;  2O3J A;  1KQG B;  1BE3 J;  3CXH I;  3R4Y A;  2B88 A;  5L8R J;  1BDD A;  2Z4E A;  1OW7 A;  3BAS A;  1L0N D;  2E75 C;  1AV1 A;  1CZQ A;  1IK9 A;  5KLV K;  1BE3 D;  3H1J D;  2E74 B;  2Z5H A;  1GD2 E;  2PFX A;  1NU1 J;  4JBZ A;  2KIK A;  3AE5 C;  1FZC C;  2OGU A;  1GDT A;  2AXC A;  2XV5 A;  2Y0C A;  2NPS B;  2ZT9 C;  2E76 D;  4JYB A;  3G6E P;  1P84 I;  3L75 E;  2O01 H;  2P1J A;  5APQ A;  1T6A A;  1EZV E;  2QJK C;  1SQQ J;  1NU1 D;  3FXD A;  4DOJ A;  1NTK J;  1YQ4 C;  1EXJ A;  1WT6 A;  3C9I A;  1BE3 G;  2YO2 A;  3CMA P;  1LWU A;  2HR3 A;  1LTA C;  4N6J A;  2W27 A;  1BCC J;  1LP1 A;  2O1K A;  4PD4 I;  2YIU C;  2ITA A;  1NAY A;  1NVO A;  5AVY B;  1MFZ A;  2IFM A;  3R2P A;  3RL0 D;  1ZN5 A;  4NPD A;  5KAI E;  3CWB J;  5AW1 B;  1FZF A;  1NU1 G;  1LNQ A;  3RGU A;  2BEQ D;  1FAV A;  1NKN A;  2IYO A;  3CPW O;  3P7K A;  2P7J A;  1A02 J;  2QJY C;  2WSF J;  2WQY C;  1U57 A;  2A06 E;  3VN0 A;  3ZDM A;  1QL2 A;  1RY3 A;  2KUB A;  3OJA B;  4K3A A;  3MUD C;  1SQQ G;  3CWB D;  5CBO A;  3OAK A;  1FZG A;  1NTK G;  2R32 A;  3C8V A;  2J58 A;  2E75 B;  2KZI A;  2D2C C;  3M0D C;  5KJ7 D;  1GTW A;  1IFJ A;  2M3B A;  2BCC J;  1BCC G;  2J59 M;  3PLN A;  1OWA A;  1J1D C;  2A06 G;  1FZC B;  1AJY A;  1T2K C;  2ZT9 B;  1QGK B;  3CWB G;  3AEG C;  3KDP B;  1ZOY C;  2WSC J;  1SQQ K;  1VQ4 P;  3L74 J;  3E1R A;  2ZXX A;  3BCC E;  2QJK B;  3CCL P;  1LTG C;  1NTK K;  1AQ5 A;  2C9N Y;  2FKW B;  4L76 A;  1FOS E;  2NPS A;  3SFD C;  1AA0 A;  4L74 A;  1T8Z A;  3L74 D;  3H1I D;  2GM4 A;  2FYU J;  2B87 B;  1KOR A;  2QG4 A;  4IOI H;  3S9O A;  1OW6 A;  3NFQ A;  3P8C D;  2YIU B;  4LGD E;  1EZV I;  4OVN F;  1SFC A;  3V6I A;  2BCC G;  1LGH B;  1SQX E;  3KXD A;  4HKZ H;  2WWW A;  4YXW H;  2FYU D;  2LXB A;  2QJY B;  1EC5 A;  1W2B O;  2OYO A;  2R3C A;  1KV4 A;  3A2A A;  3L74 G;  2HOD B;  3SFE C;  1YJ9 P;  2Q9I A;  3MTU E;  1M56 D;  2FFD C;  1M8O B;  1LT9 C;  1BSN A;  5KLI C;  1N7S C;  4LLH A;  1DIP A;  4LC1 A;  2D2C B;  2WZ7 A;  3RK3 E;  1CI6 B;  1RE4 C;  1JTH B;  2QRX A;  1Q86 Q;  5KTB A;  1ZP0 C;  3GHG C;  2AXT H;  3RK3 C;  3I56 P;  3AEF C;  2FYU G;  2W6J H;  3V2P A;  3G9R A;  3VOP A;  1RF1 C;  2IBZ G;  4H13 C;  1J1D B;  2R3S A;  1FZA A;  3TYY A;  1SLQ A;  2N9Y B;  4N3Y B;  3CX5 H;  3CCM P;  3HRN A;  3HE4 B;  2KSJ A;  4D6T D;  2K9Y A;  3RBX A;  1EDL A;  1URQ A;  1S5L H;  3V2N A;  3NMD A;  1YI2 P;  3LID A;  3G4S P;  3F89 A;  2FYU K;  1FJK A;  2XND H;  1BGY J;  2Y0D A;  3QWO C;  2Q5U A;  1Q90 D;  5B5E H;  1KB9 D;  1IFD A;  1EDI A;  2ZJS E;  4JF7 A;  4KT0 J;  3F5H A;  5CCG C;  2OAR A;  4GDO A;  1JY3 P;  1M90 Q;  1HJ0 A;  1VF5 C;  2YKQ A;  3H1L E;  1GU4 A;  3Q3D A;  3BVH A;  1H0T B;  1HUC A;  4Y28 J;  5CJ4 A;  2Q3I A;  2ZVO B;  4ASW A;  4JYC A;  1M57 D;  4H44 D;  1M7L A;  5E79 H;  2FFD B;  1KMI Z;  4BRY A;  1LT9 B;  2AXT E;  5KLI B;  1N7S B;  1USD A;  3L36 A;  1YJW P;  2IPP A;  3L72 J;  1QEX A;  4IL6 X;  5KKZ C;  3M0A A;  1Q7Y Q;  1SQB J;  4IFD K;  3CXH D;  2YO3 A;  2QM7 A;  3GHG B;  1OW8 A;  1LTS C;  3MUD A;  2YNY A;  2OYI A;  1BGY G;  1VQK P;  2VRS A;  1RF1 B;  4H13 B;  5DJU B;  5APT A;  5KJ7 A;  3L72 D;  3CX5 E;  3M06 A;  1H8A A;  1DH3 A;  1CI6 A;  2C9L Y;  1OX3 A;  2NRG A;  3Q5S A;  1AFO A;  1JTH A;  2A45 G;  1GL2 C;  2I1J A;  1VDF A;  5B66 H;  1A02 F;  1SQV J;  1S5L E;  1QLE D;  2JDI H;  1CW5 A;  5AVR B;  2E5Y A;  2AEJ A;  4HJG H;  2PRR A;  4HYT B;  1SQP E;  4I7Z C;  2E74 D;  1G1J A;  3B8E B;  3G71 P;  1PP9 E;  4OGQ C;  4AUW A;  4GIF A;  4OH8 B;  3L72 G;  4H0L C;  2NPS D;  4GOF A;  5CJ0 A;  4BXL A;  1NTZ D;  5KLV E;  1SQB G;  2FXM A;  3D70 A;  3EFG A;  2PP6 A;  1NTM D;  1VPC A;  2IFN A;  4U3F E;  1KIL E;  3WU2 H;  1VF5 B;  1OVV A;  4PD4 D;  5E79 E;  1SQP G;  2OYH C;  3M9Q A;  3IN6 A;  5AW6 B;  1KIL C;  3B5N A;  1HTL C;  2RH0 A;  1G2C B;  2KLU A;  1KFM A;  1L4A C;  1SQV G;  2B89 A;  2YXR B;  2KB7 P;  2QVA A;  3N4X A;  3GG2 A;  1HVV A;  3CCV P;  1SQB K;  1X0T A;  1YIJ P;  5KKZ B;  4KJM A;  3H1K D;  2QIW A;  2MJZ A;  1L0N J;  2O01 N;  1H0T A;  1GZL A;  2C0W A;  2HPC B;  5H2F H;  3LIE A;  4OWF A;  3A0B H;  2FFD A;  3L35 A;  5B66 E;  3H1J J;  1LT9 A;  1SQP K;  3HD7 C;  1S1C X;  5KAF H;  2N1T C;  3MGN A;  3IF4 A;  1SQV K;  1GL2 B;  2H8P D;  2KS1 A;  5AVZ B;  2E75 D;  4RO0 A;  1JMB A;  1BE3 E;  1RF0 C;  1RF1 A;  3VP9 A;  4XFJ A;  1NJI Q;  3Q2Y A;  1QL1 A;  4NPF X;  4I7Z B;  2LXC B;  2WSF H;  1IK7 A;  3RK2 D;  2M8R A;  3CX5 I;  2FYN C;  1GW4 A;  5APY A;  2Q6Q A;  1AVY A;  4H0L B;  4DCK A;  1OIP A;  1ZXG A;  1URQ D;  1S3J A;  3WU2 E;  4UB8 H;  3TNU B;  1R8E A;  1JNM A;  1FBM A;  1L0N G;  1NU1 E;  1Z56 A;  3OA7 A;  2JWA A;  1MV8 A;  1J2J B;  1D7M A;  1KYO I;  3H1J G;  4RES B;  1M1K Q;  3MHV A;  3QH9 A;  2JEE A;  3Q5R A;  5CCH C;  1EZV D;  2OYH B;  3T97 B;  1SQQ E;  1KIL B;  1IFP A;  1Y8A A;  3CC2 P;  1NTK E;  2O1J A;  3CD6 P;  4MN4 C;  2WSC H;  1FDI A;  5CCG A;  3SSU A;  5H2F E;  3CC4 P;  2GUS A;  2HG5 D;  5AVU B;  3A0B E;  1L0N K;  2GUV A;  1BCC E;  3RL0 C;  5KAF E;  2KYV A;  4WY4 B;  4W80 A;  2M5A A;  1SVF A;  3KYQ A;  3LW5 H;  4ZMD A;  3AE2 C;  2ZYD A;  3V2R A;  1HGV A;  3HD7 B;  1R5L A;  3CWB E;  2R5B A;  5AW0 B;  1VQ9 P;  2N1T B;  3L70 J;  1OZH A;  1W5C E;  1IZN B;  4DT0 A;  2NZ2 A;  4DZO A;  4R4M A;  1M1J C;  2WIT A;  2D2C D;  2HPC A;  3L73 J;  3D6Y A;  1MFT A;  1NU1 K;  2G8Y A;  2LKM A;  1UIX A;  2KOG A;  3L70 D;  4UB8 E;  1T3U A;  1UII A;  2FYN B;  2WVR A;  5BU8 B;  1FE6 A;  1E79 H;  3L73 D;  3TDK A;  3H1I J;  2V4H A;  2BCC E;  5AVS B;  1HWT C;  1TU3 F;  3TK1 A;  3VMZ A;  3BRT B;  3CCU P;  4YPC A;  2YMY A;  1K9M Q;  3BCC D;  1OMI A;  3L74 E;  3L70 G;  2IDB A;  2PGD A;  3TNU A;  3P8C E;  3AEC C;  3L73 G;  3OW2 O;  3HUS C;  1U7J A;  3B5N D;  3H25 A;  1FZB A;  2FYU E;  3RL0 B;  3WMM 0;  3I55 P;  1NYH A;  2Q3E A;  2IBZ E;  5BVZ A;  4DJG A;  3O8Z A;  3P8M C;  4XA4 A;  3AE4 C; 
#chains in the Genus database with same CATH homology
 1JY2 N;  1M7L A;  2FFD B;  1LT9 B;  1N7S B;  3L36 A;  2IPP A;  4W7Z A;  3CL3 D;  1EQ7 A;  3M0A A;  5APX A;  4IFD K;  2YO3 A;  3HD7 D;  1N7S D;  4C46 A;  4EIJ A;  4WY4 C;  4WY4 A;  5APV A;  2QM7 A;  3GHG B;  1M1J B;  1N73 A;  1N73 C;  1LTS C;  3MUD A;  2A45 H;  2XKM A;  4W7Y A;  2YNY A;  1JY3 O;  2OYI C;  2OYI A;  1FZE A;  2VRS A;  1RF1 B;  3L4F A;  1YYC A;  3VYI A;  5APT A;  5KJ7 C;  5KJ7 A;  2HYN A;  2YKO A;  5AVX B;  2Z4E A;  2ZXE B;  1DEB A;  3M06 A;  1H8A A;  3HE5 B;  3BAS A;  4HH2 A;  2N1T A;  1DH3 A;  2WT7 B;  1CI6 A;  4M3L A;  2C9L Y;  4WB4 A;  1N7L A;  4C7N B;  1AFO A;  1JTH A;  2A45 G;  1CZQ A;  1IK9 A;  1GL2 C;  2I1J A;  1GL2 A;  1VDF A;  1A02 F;  5KLV K;  3KPE A;  1LTI C;  3CLQ A;  1T2K D;  3RK2 B;  1FDM A;  2Z5H A;  2YKP A;  1CW5 A;  5AVR B;  1GD2 E;  2HLO A;  1YTZ T;  5AW5 B;  4HYT B;  1OXZ A;  3BRV B;  2WPR A;  1FZC C;  1GDT A;  1FZC A;  1URQ B;  2XV5 A;  2NPS B;  1G1J A;  1MZ9 A;  4JYB A;  3B8E B;  3NXS A;  4N78 D;  2O01 H;  2P1J A;  4AUW A;  1XTC C;  3II6 A;  3N7N A;  4GIF A;  5APQ A;  4OH8 B;  3SWF A;  2NPS D;  3V4Q A;  2KLV A;  5CJ0 A;  2W6B A;  3SWY A;  2FXM A;  5CHX A;  4DOJ A;  1ZR4 A;  3EFG A;  1KZU B;  2PAJ A;  2PP6 A;  1VPC A;  1FJP A;  1ZR2 A;  4C7R A;  1FU1 A;  1KFN A;  1WT6 A;  3C9I A;  3HUS B;  1LTB C;  2YO2 A;  2IFN A;  5AW7 B;  4IFF A;  5CCH A;  4AYC A;  1LWU A;  2OYH C;  2OYH A;  1LTA C;  3M91 A;  2HFE D;  4N6J A;  2FYZ A;  2W27 A;  3M9Q A;  4AQR D;  5CCG D;  2Q7C A;  1LTJ B;  1IO4 A;  3T97 A;  1S9K D;  3V4W A;  5AW6 B;  1KIL C;  1KIL A;  2O1K A;  3B5N C;  3B5N A;  1HTL C;  1G2C B;  1KFM A;  1KQL A;  1JOC A;  3EQ2 A;  5AVT B;  1L4A C;  1GK6 A;  1L4A A;  5AVY B;  2E42 A;  1MFZ A;  2IFM A;  3R2P A;  3U1C A;  3HTK B;  1J1E C;  2KB7 P;  3RL0 D;  2I1K A;  4O9B A;  3VMY A;  1ZN5 A;  1HBW A;  1IC2 A;  5AW1 B;  1FZF A;  1NWQ A;  3N4X A;  3V2Q A;  1JUN A;  3U1A A;  1HVV A;  1X8Y A;  1SQB K;  1PFI A;  1FAV A;  1NKN A;  2MJZ A;  3P7K A;  2P7J A;  2L5G B;  1A02 J;  4GKG A;  1N73 B;  1GZL A;  3VN0 A;  1QL2 A;  2C0W A;  1RY3 A;  3OJA B;  1JY2 P;  4B86 A;  2IX7 C;  2HPC B;  3RK3 B;  3LIE A;  2OYI B;  2HOD A;  1N2D C;  3VTP C;  2FFD A;  3L35 A;  1LT9 A;  1SQP K;  3HD7 C;  3HD7 A;  1JCD A;  3OAK A;  2WPS A;  1FZG A;  2JJL A;  2R32 A;  3RK3 D;  2J58 A;  2W6A A;  2N1T C;  3MGN A;  3M0D C;  1LTT C;  3M0D A;  5KJ7 D;  1SQV K;  3L37 A;  1GL2 B;  1GTW A;  2H8P D;  1IFJ A;  5AVZ B;  1IFI A;  2M3B A;  1NHL A;  1X79 B;  1RF0 C;  1RF1 A;  1RF0 A;  2ZFC A;  3A3Y B;  3VP9 A;  5CMZ A;  5AW2 B;  1QL1 A;  2J59 M;  1OWA A;  1J1D C;  1FZC B;  2WSF H;  1W2E A;  1T2K C;  1GW3 A;  3RK2 D;  3A7O A;  2M8R A;  1HGZ A;  1JY2 O;  4C7N A;  4GT1 A;  5AW8 B;  1GW4 A;  5APY A;  4N78 E;  3KDP B;  3H32 B;  1JMM A;  1SQQ K;  4I1L A;  5APS A;  1URQ D;  1LTG C;  3CI9 A;  3TNU B;  1JNM A;  1NTK K;  2CPB A;  1FBM A;  1AQ5 A;  2C9N Y;  2FKW B;  2WSE H;  3HE4 A;  1Z56 A;  3OA7 A;  1XTG B;  1SQX K;  1FOS E;  1MV8 A;  2NPS A;  1J2J B;  1MUU A;  1H88 A;  3IFM A;  2C0X A;  4RES B;  1RE3 A;  2JEE A;  1T8Z A;  5AVV B;  5CCH C;  2OYH B;  2GM4 A;  1LWU C;  2N9B A;  2R5D A;  3E1I A;  1KIL B;  3B5N B;  1YTZ I;  3NFQ A;  3P8C D;  1S9K E;  4LGD E;  5AW9 B;  1ZV8 A;  1NO4 A;  2O1J A;  3G3Z A;  4XE5 B;  1CSB A;  1SFC C;  1SFC A;  1JO5 A;  3IR9 A;  1E5W A;  1J1E B;  1G1I A;  1HH0 A;  2WSC H;  4ZKP A;  1KIL D;  1IFM A;  1LGH B;  5CCG A;  2GUS A;  2WWW A;  1NOH A;  2HG5 D;  5AVU B;  1N86 A;  1NKZ B;  1L0N K;  2GUV A;  1JCC A;  4IFM A;  1ZLL A;  1LTJ A;  3RL0 C;  2E43 A;  2KYV A;  2POH A;  3V5B A;  4WY4 B;  2R3C A;  4W80 A;  3A2A A;  2HOD B;  4Y99 C;  1SVF A;  3KYQ A;  3LW5 H;  3HTK A;  3V2R A;  2Q9I A;  1HGV A;  5AW4 B;  3MTU E;  3HD7 B;  2FFD C;  1WRG A;  4WY4 D;  1LT9 C;  2XDJ A;  2XZR A;  2R5B A;  1N7S C;  5AW0 B;  1N7S A;  4LLH A;  3MD0 A;  4LC1 A;  3U59 A;  2A45 I;  2N1T B;  2WZ7 A;  2P67 A;  1CI6 B;  1RE4 C;  1RE4 A;  1JTH B;  4ZKU A;  2KP8 A;  5KTB A;  4DZO A;  3GHG C;  1M1J C;  2WIT A;  1M1J A;  2N1T D;  3GHG A;  3RK3 C;  2HPC A;  1NTZ K;  2XU6 A;  3NTN A;  4KHX A;  3V2P A;  1NU1 K;  2H7H A;  3VOP A;  1RF1 C;  1GL2 D;  4WBA A;  2LKM A;  1J1D B;  2KOG A;  1NTM K;  1T3U A;  3BAT A;  1FZA A;  3HE5 A;  1NAF A;  1NH4 A;  2Z5I A;  2WT7 A;  3TYY A;  1SLQ A;  5BU8 B;  4N3Y B;  1IJD B;  1X9V A;  1IFN A;  3RK2 C;  3UIA A;  3KQG A;  2H43 A;  3HRN A;  3HE4 B;  3P32 A;  5AVS B;  2KSJ A;  5APW A;  1HJB A;  2QM8 A;  1HWT C;  1GK4 A;  5AVW B;  3TSI A;  4EOT A;  5AVQ B;  3TK1 A;  3VMZ A;  3BRT B;  1URQ C;  1URQ A;  2YMY A;  3V2N A;  2NPS C;  3NMD A;  3LID A;  3VP8 A;  1RE3 C;  2FYU K;  1FJK A;  2P2U A;  3H32 A;  2XNX A;  1LWU B;  3MIW A;  1JY3 N;  4I2L C;  3TNU A;  3A5T A;  2Q5U A;  5CCH D;  3H6P A;  3P8C E;  1IFD A;  1SFC B;  1L4A B;  4JF7 A;  1DX7 A;  3HUS C;  3HUS A;  2CPS A;  3M9B A;  1T3J A;  1FOS F;  3B5N D;  5CCG C;  2OAR A;  4I6M C;  5BU5 A;  2BAS A;  5APU A;  3I5C A;  1SFC D;  1JY3 P;  3M9H A;  1L4A D;  2YKQ A;  1L0L K;  3PP5 A;  1H89 A;  1GU4 A;  1FZB A;  3RL0 B;  3WMM 0;  1GU5 A;  3BVH A;  5AW3 B;  1LTJ C;  1SP4 A;  2WTY A;  3VMX A;  1HUC A;  5BVZ A;  5CJ4 A;  3O8Z A;  1G2C A;  2Q3I A;  4Y99 B;  3P8M C;  4XA4 A;  4JYC A;  2WPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...