5CNFA

Ultrafast dynamics in myoglobin: 50 ps time delay
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
152
structure length
152
Chain Sequence
GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Direct observation of ultrafast collective motions in CO myoglobin upon ligand dissociation.
pubmed doi rcsb
molecule tags Oxygen storage
molecule keywords Myoglobin
total genus 59
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 5cnfA00
1C40A 4NI1A 3OJ1A 2EB8A 1Y83B 3QQRA 1Y0DB 2O5BX 4JYQA 1VWTB 1Y7DB 2ZFBA 3IC0B 2PEGB 3WCTD 3ZOLA 2ZLXB 1YEQA 1YE2B 3DUTA 1YMBA 1HBBB 4UIQA 1HBRA 1PBXB 1C7CA 2RAOA 2G14A 2OH9A 1CH9A 1CIKA 1O1NB 1MTKA 1VXAA 4AVEA 4NK2A 1CBMA 4PQBA 1C7BA 1LA6B 3MOUA 1Y2ZA 1Y4QB 1YE0A 4N7PB 2WTHA 3IXFA 1MNKA 1Y4FB 1A6NA 3SZKA 2OH8A 3A9MA 3HF4B 1BINA 3BCQB 1CO8A 3HHBB 1B86B 2ZFOA 1OFKA 4MQJB 1R1XA 1HBSA 5JDOE 2GTLD 5KKKA 3VRGA 1MWDA 1A01A 3PELA 2ZWJA 3NMMB 1QPWB 4H2LB 1YZIB 1X3KA 2MGKA 2W72C 3HEOA 1IT2A 3ARKA 3WCTA 2O5SX 3PT7B 2HHBB 3S48C 1MLQA 5CNBA 1QSHB 111MA 1CH4A 1JZKA 3VREA 1JF3A 2R80A 1YGFB 4SDHA 2O5OX 1YFFA 1A6GA 4PQ6A 2VLYA 2H8DB 3NMLA 2BK9A 5EE4C 1J7SB 1MTIA 2FRJX 3M38A 1LJWA 3G4WA 1HJTA 3A0GA 1Y45B 2EVKA 3BJ1B 1F5PA 1B0BA 1HLMA 2HHDA 3D1KB 3UHBA 4NI0A 1Y8HB 4N7NB 2V1EA 3S65A 2HHEB 1C7DB 102MA 4YU3B 3ECXA 1MLHA 3CIUB 3VAUA 4ODCA 2VYWA 2QMBA 1BVDA 2G3HA 1HLBA 1Y2ZB 4G1VA 1YGDB 1YHEB 5JOMA 3NG6B 2ZSOA 3IA3B 1JEBA 4HRTB 1N9HA 1Y8KB 1QXEB 1JY7A 4VHBA 3UHZA 1RQ3A 2AA1B 5F0BA 1S5XB 2PEGA 1DWSA 1VXBA 3D7OA 2HBCA 1YHRB 1JPBA 1VXCA 3D1AB 6HBWA 2B7HA 3W4UB 1Y0DA 2MGMA 1ABWB 1F63A 4MQCB 2OIFA 1J3FA 2GRHA 2QSPB 3O89A 1V4UA 2HCOB 1NEJA 2MGEA 1G09B 3OO4A 1S56A 4MQGA 3PT7A 5EUIA 2FRKX 1HBIA 2ZLUB 1HGCB 1HCOB 4X0LB 1MODA 1MLOA 1NEJB 2HCOA 3MN0A 1GCWB 4N8TA 5JDOD 3GKVA 3WCUC 2D60A 2V1GA 1Q1FA 2MYEA 3UHEA 1CG5B 3GDJB 2HBSA 1DXUB 2V1IA 1KR7A 1O1OB 1RPSA 2ZFOB 4U8UA 1TU9A 2DHBB 1SI4A 1FCSA 1B86A 1MYIA 2ZSRA 1YHUA 3EDAA 1YOHA 5HAVA 2VYZA 2YRSA 3OK5A 4N7OB 2ZS1B 3HENA 1WLAA 1HRMA 3K8BB 3OVUC 1XYEA 1SPGA 2FAMA 4N7PA 2H35B 3PIAB 1DXUA 2ZSYA 1UT0A 1UVXA 4F6GA 2D2NB 1XZ4A 1JW8A 1CQ2A 1Y35B 1V4WB 2RAOB 1C7DA 4NK1A 1VXHA 1Y0CB 2G12A 1V4XA 2ZSQA 3AQ9A 4O4ZA 1YENA 3UHHA 3WCWA 1K0YB 4MU5A 1Z8UB 2VHBA 4FWXA 1YEOA 1XY0A 1OUTB 3WCVC 3A0GB 1G08B 3GQPA 3WCVD 1O1LB 1MBNA 2VEEA 6HBWB 2IG3A 1YHRA 1KFRA 108MA 1O1MB 2KSCA 2H8DA 2G0VA 3OZWA 1FN3A 5KERB 1O1KA 3DHTB 2V1FA 1PMBA 3KMFA 1YGFA 1SPEA 105MA 3QJDA 1DXTA 5CN5A 1DM1A 1YVQA 3GQGB 4HSXA 1EWAA 1JEBB 2MGDA 3EU1A 3UHVA 1Y0AB 1LFVA 5AZQA 1YVTA 1Y7ZA 5EOHA 1J3ZB 3K9ZA 3ZJOA 1DKEA 4L2MA 1EBTA 2NSSA 1MBOA 1AJGA 2BLIA 1G08A 3GQPB 4O4TA 1LFYA 1SDLB 1XY0B 1A4FA 2XYKA 3ZJLA 3NFEA 2IN4A 1JZLA 1H1XA 2ZS1A 1IRCA 4N7OA 2ZSPA 4DC7A 1HGAA 2R1HA 3MJUA 1XXTB 1YHUB 2D2ND 2E2YA 3E55A 1RVWA 4PQCA 4ESAA 1GCVA 3DHRA 4O35A 1S0HB 2G0XA 1Y0TA 1Y09B 4M4AA 1Y46B 2BLJM 2D2NA 2W6VB 1A00A 1CG5A 1HHOA 3R0GA 5MBNA 3O7NA 1GCVB 1VRFA 3WCWD 1HDBA 2BNLA 3UGYA 3R5IB 3MJUB 1LFQB 1HACB 4MQGB 2ZLXA 1NS9A 5CNGA 3LB2A 3ONZA 3QJCB 3HRWB 2VLXA 1XQ5A 3NMMA 1GLIA 1LH1A 2LH6A 3ODQB 3QZZA 3PI4A 2FRIX 3BJ3B 2EKUA 1M6CA 1NWNA 1THBA 3RJ6A 4N8TB 2Z6NB 5SW7A 2ZLWA 1MCYA 3ONZB 4F68A 1GJNA 1CBLA 3B75B 5CN6A 1MKOB 1YVQB 3AQ8A 1S61A 1DXVB 2EB9A 4ROLB 4HRTA 1HABA 3OGBA 1IDRA 1NQPA 3G53A 5KERA 1LFLB 1MDNA 1YEUA 3ARLA 1A0UB 1UX9A 5EETA 4NXCA 1NGKA 4MQIA 2W31A 2DXMA 1YEVA 3HEPA 1Y7GB 2M6ZA 2AUOA 2NX0A 1YEOB 1EBCA 1Y4GA 1YH9B 3UHTA 1CP5A 1HGBB 1MBIA 2ZLTA 1COHB 5HLUA 1KD2B 1Y7GA 3PT8A 2LH7A 1LJWB 3E5OA 3KUNA 2V1HA 1Y4RA 2QMBB 1OR4A 2QRWA 1J3YB 5CN7A 4XS0B 2H35A 2W6XA 1SDKB 3LQDB 4N7NA 4ROMB 3PI3A 1QSHA 1J52A 1N9XA 1QI8B 4UZVA 1FSLA 2GL3A 4F6JA 2QFKA 1O16A 2D6CA 1YIEA 2ZLWB 5ILMA 4MAXA 2GRFA 2LH2A 1BZZA 1K1KA 1DUOA 3DR9A 3WR1A 2C0KA 4MQJA 5B84A 2R80B 1N9IA 3WCTC 2CMMA 2MGGA 1HCOA 3VRFA 5IKSA 1NAZA 2ZLUA 1GDKA 3WFTA 3WI8A 2HHBA 1FSXA 1YOGA 1BVCA 4OODA 1MZ0A 3TM9A 1MLRA 1NPFA 5M3SA 2R4YA 1RQ4A 1OR6A 1NXFA 2OHAA 1FHJB 1NS6B 1XZ7A 1Y0WB 5CNDA 5KDQB 4M4AB 1XZ5A 5C6EA 5F2AA 1Y5JA 1C7CB 1J41B 1RQ3B 2AA1A 3EDBA 1YEQB 1HGAB 1Y4GB 2BW9M 1AJ9A 3WCPB 2M6ZB 1MLMA 4F6FA 3AT6A 1VXGA 2DXMB 3WCUD 2HBGA 1A4FB 1MBAA 3ORDA 5KDQA 4YU4B 2D2MD 1MBDA 2ZSSA 1BUWA 3TLDA 1DXCA 2O5LX 3QZXA 2QU0B 1O1JB 1MYMA 3S65B 3UHXA 3CY5A 2R4ZA 1A0ZA 2XKGA 1CH1A 1O1PB 1A0ZB 1IRDA 1LH3A 1CO9A 1Y5KB 2QSSA 1URYA 4FH6A 1DUKA 1G09A 3OO4B 1MBCA 1CG8A 2ZS1C 4NXAA 3QM8A 4TWVA 1BZZB 2G0ZA 2QFNA 1LHSA 2GTLC 1YIHB 1C40B 2Z6SA 3H57A 3AG0A 1XQ5B 1YIEB 2HBCB 3ZHWA 1IBEA 2O5QX 1Y4PA 2H8FA 1Y7CA 1M9PB 5HLQA 2MYBA 2ZT4A 2RI4A 3OZVA 5EQMA 2HBEB 1YENB 1XZUB 1A9WE 3ASEA 1QSIB 1GDIA 2HZ2A 1Y0CA 1HDSB 3IC2A 1I3EA 5E6EA 4H2LA 3KUOA 1XZ4B 1Y46A 3HXNB 4DWTA 3LB1A 5CN8A 1RQ4B 2SPNA 4G51A 1MNOA 3AQ7A 4ESAB 1BABA 1AZIA 1HDSA 1MLLA 1SPGB 1NWIA 1D8UA 3PI1A 1Y8HA 1XZUA 5HBIA 1ITHA 1T1NA 1HSYA 3UBVA 1NZ5A 4M4BB 2QLSB 4OF9A 1BIJB 4QAUA 2MB5A 3A5GA 3BJ1A 2ZT3A 2MGLA 4F6DA 4HHBB 1MWCA 1A0UA 2DN1A 2DN2B 5HY8B 3WFWA 1N9FA 2EVPA 3GKVB 5E6EB 1O1NA 4H0BA 3ZOMA 3WCWC 1JF4A 6HBIA 4FWYA 1Y5FB 1IRDB 3PI2A 2GKMA 4KN3A 1CIOA 1YE2A 1BZ1B 1MNIA 1XZVB 3WCTB 3D17A 1VHBA 3DHTA 1G0AA 1NZ2A 3UHYA 1Y7DA 2ZFBB 1GBVB 3RGKA 1YZIA 1J40B 1THBB 2V1JA 1BZ0B 1J7YA 3ZJNA 5E83B 1A6MA 7HBIA 1ECAA 1SHRA 4IROA 1G9VB 1UFPA 3G4UA 3WCPA 5CNCA 2MGAA 1BZ1A 1ECNA 1CLSA 1EW6A 3GOUA 3UI0A 3G52A 2G0RA 2ZS0D 3SZKB 1DO4A 4KMVA 1YG5A 1DLYA 1BBBA 2GTLA 3UH7A 1DXDA 5JDOC 3KMFC 5CHRA 4ILZA 1ABSA 1Y31A 1UMOA 2D5ZA 3P5QB 5ILRA 1A00B 1MNJA 1Y0TB 4F4OB 1WMUB 5HU6B 2FALA 3D4XA 3NL7B 3ED9A 3AT6B 1YHUD 3SDNA 4BJAA 3UGZA 2O58X 2AV0A 1MYHA 3GKTA 1Y01B 1VWTA 2D2MA 1Y5JB 1R1YB 1IWHA 1SDLA 1XZ5B 1UC3A 1XZ7B 2ZSTA 1DO3A 4HBIA 2ZFOC 4NI1B 1GLIB 2BWHA 2WY4A 3HRWA 4F69A 1GBVA 5EV5A 1Y22A 1VREA 1YHUC 5EUIB 1WVPA 3PI9B 4ZVBA 1CH5A 3ARJA 2VM0A 1MYTA 4U8UC 1M9PA 4LPIA 3HC9A 1SDKA 1BJEA 1Y7CB 5EYJA 1MLKA 1ASHA 1YMAA 3WR1B 5EE4D 1DO7A 5HLXA 1QPWA 3UBCA 2W6VA 3W4UA 1QXDB 1MOHA 2W6YA 1XCHA 1L2KA 3AQ5A 1ABYB 1F5OA 1OBMA 2GLNA 1A3OA 3BJ2A 2ZS0B 1YDZB 1JY7B 1MOBA 101MA 4DWUA 1S5YB 2AURA 1HGBA 1Y8KA 4ROMA 1DO1A 3BOMB 3M3AA 3UHNA 1Y35A 1J3YA 1RQAA 1W92A 104MA 1HBAA 1DKEB 1XZ2A 4FC3B 2D5XA 1YEUB 1C7BB 3P5QA 1Y31B 3K3UA 4O1TA 1GBUA 3OO5B 1JL6A 3BOMA 2ZLVA 1HBRB 1DXVA 1VXDA 3A59B 1JP9A 3PI8A 1MLSA 3WFXA 3A5BA 1BZPA 2MGIA 1FN3B 4TWUA 3OZUA 4L7YB 1GDJA 1O1MA 4MQHA 1SHRB 4U8UB 1DWTA 1O1OA 1RPSB 3MYMA 5E83A 2BKMA 1V9QA 2XKHA 3LHBA 1OUTA 3A2GA 5D1VA 2DN3B 3QM5A 5EU2A 1HV4B 3G4VA 1Y8WB 2QSSB 1BZ6A 1NS9B 1G0BB 3D17B 1OFJA 3PI9A 2PGHB 2R50A 1NZ4A 2ZS0C 107MA 1O1JA 4C44A 2WTGA 2Z6NA 2ZS1D 1J7WB 1MOAA 1FDHG 1LHTA 1ABWA 1MYFA 2HZ1A 5ILEA 4G1BA 2V1KA 2G11A 1RVWB 1RSEA 4O2GA 1JP8A 2MGCA 1AJ9B 3UH5A 1MLUA 5ILPA 3S66A 1S6AA 4B4YA 1J41A 1U7RA 110MA 2MGHA 1A6KA 3QQQA 1FLPA 3D4XB 1OJ6A 3WTGB 1YGDA 3UH3A 1CMYB 4HRRA 1HHOB 4PNJA 1LFZA 1XZ2B 3E4NA 1DLWA 3UHRA 1GCWA 1RQAB 3PT8B 4YU3A 1LFTB 1V5HA 5EYSA 3AQ6A 1PBXA 1KD2A 3GOUB 3ZH0A 1X9FB 1FSXB 1CLSB 1Y8IB 3GYSA 2BMMA 3WCUB 3IC0A 3ZJPA 3RJNB 1YH9A 1V07A 3BJ2B 3AT5B 3NFEB 2DN3A 1OUUA 3V2ZA 1O1KB 3A5AA 2Z6TA 1YEVB 1IT3A 3UHWA 1YMCA 2B7HB 1UX8A 3GLNA 3SDHA 1Y85B 1S69A 2MYDA 5E29A 1J3ZA 1Y7ZB 1NQPB 5D5RA 4DC8A 2Z85A 4ROLA 3HYUA 4WJGA 3GYSB 1Y8IA 1O1PA 1V75B 4MBNA 3LQDA 3WCVB 3NG6A 4MXLA 5AB8A 3QJBB 4XS0A 1YCBA 5E29B 1UVYA 4FC3A 2MGBA 1HBAB 1X9FC 1BUWB 1LTWA 5CNEA 3CIUA 3ODQA 1XYEB 4M4BA 3QJCA 2ZLTB 103MA 1A3NA 3QM7A 3WCWB 2W72B 1MBSA 1LFQA 3G46A 2ZS0A 4TYXA 3G4YA 4MQIB 2ZSNA 3GQRA 1WMUA 5HU6A 3HXNA 1HBHB 1Y0WA 1X9FD 1LFZB 2D60B 4F6IA 1MYJA 3WHMA 1HBHA 1MLJA 1HBGA 1NPGA 1YOIA 2DC3A 1TESA 4C0NA 1M6MA 1HABB 2HBEA 2HBDA 2RI4B 3ZJRA 2PGHA 3UHDA 4FH7A 1MKOA 2YRSB 3H58A 3UHCA 1SWMA 1Y4PB 2R4WA 1IBEB 1UIWB 2QSPA 1Y4VA 1A01B 1LFYB 4NS2A 3ZJSA 1Y83A 4B3WA 3MJPA 1HBSB 1BZ0A 4KJTA 2VRYA 1FAWA 4MQKB 1YVTB 1Y5KA 1XZVA 3EU1B 2EKTA 4HSWA 2Z8AA 4MXKA 1HACA 1MWBA 4MBAA 1DXTB 3LB3A 2HBDB 2MBWA 2ZLVB 2VLZA 4AVDA 1Y8WA 3ZJHA 1A9WA 1GVHA 3NL7A 1HV4A 1VXFA 1V4UB 1Y4QA 2MGJA 4MQCA 1ECDA 2HBFA 2OLPA 3UHIA 1IOPA 4FWZA 1Y09A 2GNWA 3FH9B 2NRLA 3EOKB 4ODCB 4L7YA 1YG5B 112MA 3D7OB 2ZSXA 1BZRA 3AT5A 3UHGA 2VEBA 4NI0B 3PI8B 1JP6A 1S5YA 1MNHA 1A3NB 1QXEA 2GDMA 1GZXB 2GKNA 2SPOA 1NZ3A 1X9FA 1FDHA 2AV3A 5C6EB 1Y45A 1LFTA 2GRZA 1YHEA 2ZT0A 3M39A 4G51B 2GNVA 1NS6A 1AJHA 2D5XB 3EOKA 1FHJA 2NSRA 4MPMA 3LR7A 2HBFB 1CMYA 4HRRB 3WTGA 3VHBA 1Y0AA 3IC2B 1URVA 3K8BA 1Y4BA 1V75A 1MYGA 5MBAA 3VREB 3HYUB 1O1IA 1RTEA 3FS4B 1CH2A 4ZVAA 1U7SA 2MYCA 2AUQA 3MKBB 3QJEB 1MTJA 3B75A 1ABYA 1EMYA 5JGGA 5CN9A 2MHBA 1CH3A 5SW7B 1YIHA 3ZJQA 3MJPB 1J7SA 3VRGB 1QXDA 4HHBA 2MHBB 3BJ3A 5CMVA 5AZRA 4F6BA 2SPMA 1CG8B 2R4XA 1IWHB 1Y4VB 1J7WA 4WCHD 1OUUB 1BIJA 1UIWA 4JACA 1QI8A 1MLGA 1JZMA 3UHQA 3FS4A 1T1NB 3LR9A 1K0YA 3WCUA 1HGCA 5CHQA 4UURA 1Y4BB 3ECZA 1V4XB 3CY5B 3S1IA 1BABB 2HZ3A 1MLNA 2D2NC 1HDBB 3PELB 4H07A 106MA 4NZIA 3WHMB 2D2MC 2D5ZB 1NIHB 3PIAA 2MYAA 1S0HA 3D1AA 1R1XB 3GQRB 4MQHB 2D2MB 2ZSZA 1COHA 1ECOA 1HBBA 1S5XA 3S66B 3MYNA 2BLHA 2MGFA 1LH5A 2W72A 2VYYA 3A59A 2LHBA 3QMAA 3S1JA 3OO5A 4F4OA 1YE0B 1NIHA 1CQXA 3G4QA 3MBAA 2ZFOD 1LA6A 2W6WA 1LFLA 3ZJMA 1VXEA 1JWNA 109MA 4GZGA 1MGNA 1BBBB 3BA2A 1LFVB 1G0AB 4X0LA 2HHEA 3V2VA 2SPLA 1F65A 3GQGA 1I3DA 3M3BA 1JDOA 2HHDB 1Y5FA 3D1KA 4U8UD 1G0BA 1LH2A 3WFUA 3G4RA 4IROB 1CP0A 3QM9A 4YU4A 2XKIA 2DN1B 3UHUA 1RTXA 1Y85A 1J7YB 4KMWA 1DWRA 1LUEA 1J40A 1UFJA 1O1LA 3U3EA 3UHSA 2NRMA 5JGGB 2FRFA 3MKBA 3QJEA 3UH6A 1MYZA 3QM6A 1YFFB 2QLSA 1CH7A 5B85A 1MOCA 1O1IB 1HDAB 3R5IA 3ZJJA 5JDOF 1GBUB 1LH6A 1Y22B 2OHBA 1V4WA 2DN2A 1JL7A 5HY8A 1Y4RB 3DHRB 2JHOA 1R1YA 1XXTA 1GZXA 2R1HB 3E5IA 3HHBA 1H97A 1HDAA 3BCQA 1DTIA 2O5TX 3VRFB 3HF4A 2G10A 2LH3A 1YDZA 2LH5A 1A3OB 1MLFA 3LB4A 1Y4FA 5C6YA 3ZJIA 1K1KB 5CN4A 1SI4B 2DHBA 3FH9A 2O5MX 3MVCA 3GK9A 2HBSB 3GDJA 1GDLA 4IT8A 2AUPA 3QJBA 1YCAA 5CNFA 2ZT1A 3WCVA 3ECLA 2GTLB 1QSIA 1LH7A 4XDIA 1DTMA 3QJDB 4WJG1 1CPWA 3DUTB 3TM3A 2EF2A 3UHKA 2LH1A 2H8FB 2G0SA 2QU0A 2ZT2A 1G9VA 1FAWB 4MQKA 1X46A
chains in the Genus database with same CATH superfamily
1C40A 4NI1A 3OJ1A 2EB8A 1Y83B 3QQRA 1Y0DB 2O5BX 2V8AA 4JYQA 5FVBA 1VWTB 1Y7DB 2ZFBA 3PMCA 3IC0B 2PEGB 3WCTD 3ZOLA 2ZLXB 1YEQA 1YE2B 3DUTA 1YMBA 1HBBB 4UIQA 1HBRA 1PBXB 1C7CA 2RAOA 2G14A 2OH9A 1CH9A 1CIKA 1O1NB 1MTKA 1VXAA 4AVEA 4NK2A 1CBMA 4PQBA 1C7BA 1LA6B 3MOUA 1Y2ZA 1Y4QB 1YE0A 4N7PB 2WTHA 1UVLA 4HH0A 3IXFA 1MNKA 1Y4FB 1A6NA 3SZKA 4ZIZB 2OH8A 3A9MA 3HF4B 1UVJA 1BINA 3BCQB 1CO8A 2J96A 3HHBB 1B86B 2ZFOA 1OFKA 4MQJB 1R1XA 1HBSA 5JDOE 2GTLD 5KKKA 3VRGA 1MWDA 1A01A 3KVSB 3PELA 2ZWJA 3NMMB 1QPWB 4H2LB 1YZIB 1X3KA 2MGKA 2W72C 4A8SA 3HEOA 1IT2A 3ARKA 3WCTA 2O5SX 3PT7B 2HHBB 3S48C 1MLQA 5CNBA 1QSHB 111MA 1CH4A 1JZKA 4ERVA 3VREA 1JF3A 2R80A 1YGFB 4SDHA 2O5OX 1YFFA 1ON7B 1A6GA 4PQ6A 2VLYA 5B13G 2H8DB 1HI8A 3NMLA 2BK9A 5EE4C 1J7SB 1MTIA 2FRJX 3M38A 1LJWA 3G4WA 1HJTA 3A0GA 1Y45B 2EVKA 3BJ1B 1F5PA 1B0BA 4AE1A 4ETVA 1HLMA 2HHDA 3D1KB 3UHBA 4NI0A 4LMSB 1Y8HB 4N7NB 2V1EA 3S65A 2HHEB 1C7DB 102MA 1F99B 4YU3B 3ECXA 1MLHA 3CIUB 3VAUA 4ODCA 2VYWA 2QMBA 1BVDA 2G3HA 1HLBA 1Y2ZB 2JLGA 4G1VA 1YGDB 1YHEB 1F99A 5JOMA 3NG6B 2ZSOA 3GUQA 3IA3B 1JEBA 4HRTB 1N9HA 1Y8KB 1QXEB 1JY7A 4VHBA 1UVIA 3UHZA 1RQ3A 2AA1B 5F0BA 1S5XB 2PEGA 1DWSA 1VXBA 3D7OA 2HBCA 1YHRB 1JPBA 1VXCA 2JL9A 3D1AB 6HBWA 2B7HA 3W4UB 1Y0DA 2MGMA 1ABWB 1ALLB 4MQCB 1F63A 2OIFA 1J3FA 2GRHA 2QSPB 3O89A 1V4UA 2HCOB 1NEJA 2MGEA 1G09B 3OO4A 3PMDA 1S56A 4MQGA 3PT7A 5EUIA 2FRKX 1HBIA 2ZLUB 1HGCB 1HCOB 2C7JA 4X0LB 1MODA 1MLOA 1NEJB 2HCOA 3MN0A 1GCWB 4N8TA 5JDOD 3GKVA 3WCUC 2D60A 2V1GA 1Q1FA 2MYEA 3UHEA 1CG5B 3GDJB 2HBSA 1DXUB 2V1IA 1KR7A 1O1OB 1RPSA 2ZFOB 4U8UA 1TU9A 2DHBB 1SI4A 1JBOB 1FCSA 1B86A 1CPCA 4A8MP 1MYIA 2ZSRA 1YHUA 3EDAA 1YOHA 5HAVA 2VYZA 2YRSA 3OK5A 4N7OB 2ZS1B 3HENA 1WLAA 4B02A 1HRMA 3K8BB 3OVUC 1XYEA 1SPGA 2FAMA 4N7PA 2H35B 3O18A 3PIAB 1DXUA 1LIAA 2ZSYA 1UT0A 1UVXA 4F6GA 2D2NB 1XZ4A 1JW8A 3GIOA 1CQ2A 1Y35B 2UULB 1V4WB 2RAOB 1C7DA 4NK1A 1VXHA 1Y0CB 2G12A 1V4XA 2ZSQA 3AQ9A 4O4ZA 1YENA 4Z8KA 3UHHA 3WCWA 1K0YB 4MU5A 1Z8UB 4F0UB 2VHBA 4FWXA 1YEOA 1XY0A 1OUTB 3WCVC 3A0GB 2C7KA 1HI0P 1G08B 3GQPA 3WCVD 1O1LB 1MBNA 2VEEA 6HBWB 1B8DA 2IG3A 1YHRA 1KFRA 108MA 1O1MB 2KSCA 4N6SA 2H8DA 2G0VA 3OZWA 1FN3A 5KERB 2VJTB 1O1KA 3DHTB 1XF6C 2V1FA 1PMBA 3KMFA 1YGFA 1SPEA 105MA 4ETUA 3QJDA 1DXTA 5CN5A 1UVMA 1DM1A 1YVQA 3GQGB 4HSXA 1EWAA 1JEBB 2MGDA 3EU1A 3UHVA 1Y0AB 1LFVA 5AZQA 1YVTA 1Y7ZA 5EOHA 1J3ZB 3K9ZA 3ZJOA 1DKEA 4L2MA 1EBTA 2NSSA 1MBOA 1AJGA 2BLIA 4H0MB 1G08A 3GQPB 4O4TA 1LFYA 1SDLB 1XY0B 1A4FA 2XYKA 3ZJLA 3NFEA 2IN4A 1JZLA 1H1XA 2ZS1A 1IRCA 4N7OA 2ZSPA 4DC7A 1HGAA 2R1HA 3MJUA 1XXTB 1YHUB 3E55A 2D2ND 2E2YA 1RVWA 4PQCA 4ESAA 1JBOA 1GCVA 3DHRA 4O35A 1S0HB 2G0XA 1Y0TA 1Y09B 4M4AA 1Y46B 2BLJM 2D2NA 2W6VB 1A00A 1CG5A 1LIAB 1HHOA 1KTPA 3R0GA 5MBNA 3O7NA 1GCVB 1VRFA 3WCWD 1HDBA 2BNLA 3UGYA 3R5IB 3MJUB 1LFQB 1HACB 4MQGB 2ZLXA 1NS9A 5CNGA 3LB2A 3ONZA 3QJCB 3HRWB 2VLXA 1XQ5A 3NMMA 1GLIA 1LH1A 2LH6A 3ODQB 3QZZA 1B33A 3V57B 3PI4A 2FRIX 3BJ3B 2EKUA 1M6CA 1NWNA 1THBA 3RJ6A 4N8TB 2Z6NB 5SW7A 2ZLWA 1MCYA 3ONZB 4F68A 1GJNA 1CBLA 3B75B 5CN6A 1MKOB 1YVQB 3AQ8A 1S61A 1DXVB 2EB9A 4ROLB 4HRTA 1HABA 3OGBA 4BJUA 1IDRA 1NQPA 3G53A 5KERA 1LFLB 1MDNA 1YEUA 3ARLA 1COLA 1A0UB 1UX9A 5EETA 4NXCA 1NGKA 4MQIA 2W31A 2DXMA 1YEVA 3HEPA 1Y7GB 2M6ZA 2AUOA 2NX0A 1YEOB 1EBCA 1Y4GA 1YH9B 2VJHB 3UHTA 1CP5A 1XDTT 1HGBB 1MBIA 2ZLTA 1COHB 5HLUA 1KD2B 1Y7GA 2V8AB 3PT8A 2LH7A 1LJWB 3E5OA 3KUNA 2V1HA 1Y4RA 2QMBB 1OR4A 2QRWA 1J3YB 5CN7A 4XS0B 1MDTA 2H35A 2W6XA 1SDKB 3LQDB 4PO5A 2VMLA 4N7NA 4ROMB 1HHSA 3PI3A 1QSHA 4YJJB 1J52A 1N9XA 1QI8B 4UZVA 1FSLA 2GL3A 4F6JA 2QFKA 1O16A 4BS9A 4RMPA 2D6CA 1YIEA 2ZLWB 5ILMA 4MAXA 2GRFA 2LH2A 1BZZA 1K1KA 1DUOA 3DR9A 3WR1A 1TOXA 2C0KA 4MQJA 1EYXB 5B84A 1I7YB 2R80B 1N9IA 3WCTC 2CMMA 2MGGA 1HCOA 3VRFA 5IKSA 1NAZA 2ZLUA 1GDKA 3WFTA 3WI8A 2HHBA 1FSXA 1YOGA 1BVCA 4OODA 1PHNB 4XXKA 1MZ0A 3TM9A 1MLRA 1NPFA 5M3SA 2R4YA 1RQ4A 1OR6A 1NXFA 2OHAA 1FHJB 4L1EB 1NS6B 1XZ7A 1Y0WB 5CNDA 5KDQB 4M4AB 1XZ5A 5C6EA 5F2AA 1Y5JA 2I88A 1C7CB 1J41B 1RQ3B 2AA1A 3EDBA 1YEQB 1HGAB 1Y4GB 2BW9M 4F0TA 1AJ9A 3WCPB 2M6ZB 1MLMA 4F6FA 3AT6A 1VXGA 2DXMB 2JLFA 3NUHB 3WCUD 2HBGA 1A4FB 1MBAA 3ORDA 5KDQA 4YU4B 2D2MD 1MBDA 2ZSSA 1BUWA 4ETTA 3TLDA 1DXCA 2O5LX 3QZXA 2X49A 2QU0B 1O1JB 1MYMA 3S65B 3UHXA 3CY5A 2R4ZA 4AE0A 1A0ZA 2XKGA 1CH1A 1O1PB 1A0ZB 1IRDA 1LH3A 1CO9A 1Y5KB 2QSSA 1URYA 4FH6A 1DUKA 1G09A 3OO4B 1MBCA 1CG8A 2ZS1C 4NXAA 3QM8A 4TWVA 1BZZB 2G0ZA 2QFNA 1LHSA 1B8DB 2GTLC 1YIHB 1C40B 2Z6SA 4LMXB 3H57A 3AG0A 1XQ5B 1YIEB 2HBCB 3ZHWA 1IBEA 2O5QX 1Y4PA 2H8FA 1Y7CA 1M9PB 5HLQA 2MYBA 2ZT4A 2RI4A 3OZVA 5EQMA 2HBEB 1YENB 2WCRA 1XZUB 1A9WE 3ASEA 3BRPA 1QSIB 1GDIA 2HZ2A 1Y0CA 1HDSB 3IC2A 1I3EA 5E6EA 4H2LA 1KN1B 4ERTA 3KUOA 1XZ4B 1Y46A 3HXNB 4DWTA 3LB1A 5CN8A 1RQ4B 2SPNA 4G51A 3V58A 1MNOA 3AQ7A 4ESAB 1BABA 1AZIA 1HDSA 1MLLA 1SPGB 1NWIA 1D8UA 3PI1A 1Y8HA 1XZUA 5HBIA 1ITHA 1T1NA 3O2CB 1HSYA 3UBVA 1NZ5A 4M4BB 2QLSB 4OF9A 1BIJB 4ZIZA 4QAUA 2MB5A 3A5GA 3BJ1A 2ZT3A 2MGLA 4F6DA 4HHBB 1MWCA 1A0UA 2DN1A 2DN2B 5HY8B 3WFWA 3ZTAA 1N9FA 2EVPA 3GKVB 5E6EB 1O1NA 4H0BA 3ZOMA 3WCWC 1JF4A 6HBIA 4FWYA 1Y5FB 1IRDB 3PI2A 2GKMA 4KN3A 1CIOA 1YE2A 4PO5B 1BZ1B 1MNIA 1XZVB 3WCTB 3D17A 1VHBA 3DHTA 1G0AA 1NZ2A 2VJTA 1Y7DA 2ZFBB 3UHYA 1UVNA 1GBVB 3RGKA 1YZIA 1J40B 1THBB 2V1JA 1BZ0B 1J7YA 4ESUA 3ZJNA 1ALLA 5E83B 1A6MA 7HBIA 1ECAA 1SHRA 4IROA 1G9VB 1UFPA 2UULH 3G4UA 3WCPA 5CNCA 2MGAA 1BZ1A 1ECNA 1CLSA 4Q70A 1EW6A 3GOUA 3UI0A 3G52A 2G0RA 2ZS0D 3SZKB 1DO4A 4KMVA 1YG5A 1DLYA 1BBBA 2GTLA 3UH7A 1DXDA 5JDOC 3KMFC 5CHRA 4ILZA 1ABSA 1Y31A 1KTPB 1UMOA 2D5ZA 3P5QB 5ILRA 4L1EA 1A00B 1MNJA 1Y0TB 4F4OB 1WMUB 5HU6B 2FALA 3D4XA 3NL7B 1GH0B 3ED9A 3AT6B 1YHUD 3SDNA 4BJAA 3UGZA 2O58X 3O2CA 2AV0A 1MYHA 1A87A 3GKTA 1I7YA 1Y01B 1VWTA 2D2MA 1Y5JB 1R1YB 1IWHA 4GXEA 1SDLA 3LQ9A 1XZ5B 4H0MA 1UC3A 1XZ7B 2ZSTA 1DO3A 4HBIA 2ZFOC 4NI1B 1GLIB 2BWHA 2WY4A 3HRWA 4F69A 2DKCA 1GBVA 5EV5A 1Y22A 1VREA 1YHUC 5EUIB 4GY3B 1WVPA 3PI9B 4ZVBA 1CH5A 3ARJA 2VM0A 1MYTA 4U8UC 1M9PA 4LPIA 4GY3A 3HC9A 1SDKA 1BJEA 1Y7CB 5EYJA 1MLKA 1ASHA 1YMAA 3WR1B 5EE4D 1DO7A 5HLXA 1QPWA 3UBCA 2W6VA 3W4UA 1QXDB 1MOHA 2W6YA 1XCHA 1L2KA 2UUMB 3AQ5A 1ABYB 1F5OA 1OBMA 2GLNA 1A3OA 3MWNA 3BJ2A 2ZS0B 1YDZB 1JY7B 1MOBA 101MA 4DWUA 1S5YB 2AURA 1HGBA 1Y8KA 4ROMA 1DO1A 3BOMB 1NY9A 3DBJB 3M3AA 2UUND 3UHNA 1Y35A 2UULA 1J3YA 1RQAA 1W92A 104MA 1HBAA 1DKEB 1XZ2A 4FC3B 2D5XA 1YEUB 1XG0C 1C7BB 3P5QA 1Y31B 3K3UA 4O1TA 1GBUA 3DBJA 3OO5B 1JL6A 3BOMA 2ZLVA 1HBRB 1DXVA 1VXDA 3A59B 1JP9A 3PI8A 1MLSA 3WFXA 3A5BA 1BZPA 2MGIA 1FN3B 4TWUA 3OZUA 4L7YB 1GDJA 1O1MA 4MQHA 1SHRB 4U8UB 1DWTA 1O1OA 1RPSB 3MYMA 5E83A 2BKMA 1V9QA 2XKHA 3LHBA 1OUTA 3A2GA 5D1VA 2DN3B 3QM5A 5EU2A 1HV4B 3G4VA 1Y8WB 2QSSB 1BZ6A 1NS9B 1G0BB 3D17B 1OFJA 2VJRA 3PI9A 2PGHB 2R50A 1NZ4A 2ZS0C 107MA 1CIIA 1O1JA 3VNCA 4C44A 2WTGA 2Z6NA 2ZS1D 1J7WB 1MOAA 1FDHG 3RQRA 1LHTA 1ABWA 1MYFA 2HZ1A 5ILEA 4G1BA 2V1KA 2G11A 1RVWB 1RSEA 4O2GA 1JP8A 2MGCA 1AJ9B 2UUNB 2UULD 4LM6B 3UH5A 1MLUA 5ILPA 3S66A 1S6AA 4B4YA 1J41A 1U7RA 110MA 2MGHA 1A6KA 3QQQA 1FLPA 3D4XB 1OJ6A 3WTGB 1YGDA 3UH3A 1CMYB 4HRRA 1HHOB 4PNJA 1LFZA 1XZ2B 3E4NA 1DLWA 1GCWA 1RQAB 3UHRA 3PT8B 4YU3A 1LFTB 1V5HA 1WACA 5EYSA 3AQ6A 1PBXA 1KD2A 3GOUB 1PHNA 3ZH0A 1F0LA 1X9FB 1FSXB 3BRPB 1CLSB 1Y8IB 3GYSA 2BMMA 3WCUB 3IC0A 3ZJPA 2VJHA 3RJNB 1YH9A 1V07A 3BJ2B 3AT5B 3NFEB 2DN3A 1OUUA 1EYXA 3V2ZA 1O1KB 3A5AA 2Z6TA 1YEVB 1IT3A 3UHWA 4A8WA 1YMCA 2B7HB 1UX8A 3GLNA 3SDHA 1Y85B 1S69A 2MYDA 5E29A 1J3ZA 1Y7ZB 1NQPB 5D5RA 4DC8A 2Z85A 4ROLA 3HYUA 4Z8KB 4WJGA 3GYSB 1Y8IA 1O1PA 1RH1A 1V75B 4MBNA 3LQDA 3FEWX 3WCVB 3NG6A 4MXLA 5AB8A 3QJBB 4XS0A 1YCBA 3KVSA 5E29B 1UVYA 4FC3A 2MGBA 1QGWC 1HBAB 1X9FC 1UVKA 1BUWB 1LTWA 5CNEA 3CIUA 2C7KB 1B33B 3V57A 4GXEB 3ODQA 1XYEB 4M4BA 3QJCA 4F0UA 2ZLTB 103MA 1A3NA 3QM7A 3WCWB 2W72B 3L0FA 1MBSA 1LFQA 3G46A 2ZS0A 2UUNA 4TYXA 3G4YA 1HI1A 4MQIB 2ZSNA 3GQRA 1WMUA 5HU6A 3HXNA 1HBHB 1Y0WA 1X9FD 1LFZB 2D60B 4F6IA 1MYJA 3WHMA 1HBHA 1MLJA 1HBGA 1NPGA 3O18B 1YOIA 2DC3A 1TESA 4C0NA 1M6MA 1HABB 2HBEA 2HBDA 2RI4B 3ZJRA 2PGHA 3UHDA 4FH7A 1MKOA 2YRSB 3H58A 4XXIA 3UHCA 4A8FA 1SWMA 1Y4PB 2R4WA 1IBEB 4A8OA 1UIWB 2QSPA 1Y4VA 1A01B 1LFYB 4NS2A 3ZJSA 1Y83A 2WCQA 4B3WA 3MJPA 1HBSB 4A8YA 1BZ0A 4KJTA 2VRYA 1FAWA 4MQKB 1YVTB 1Y5KA 1XZVA 3EU1B 2EKTA 4HSWA 2Z8AA 4MXKA 1HACA 1MWBA 4MBAA 1DXTB 3LB3A 2HBDB 2MBWA 2ZLVB 2VLZA 4AVDA 1Y8WA 3ZJHA 1A9WA 1GVHA 3NL7A 1HV4A 1VXFA 1V4UB 1Y4QA 2MGJA 4MQCA 5FVBM 1ECDA 2HBFA 2OLPA 3UHIA 1IOPA 4FWZA 1Y09A 2GNWA 3FH9B 2NRLA 3EOKB 4ODCB 4L7YA 1YG5B 112MA 3D7OB 2ZSXA 1BZRA 3AT5A 3UHGA 2VEBA 4NI0B 3PI8B 1JP6A 1S5YA 1MNHA 1A3NB 1QXEA 2GDMA 1GZXB 2GKNA 2SPOA 1NZ3A 1X9FA 1FDHA 2AV3A 5C6EB 1Y45A 1LFTA 2GRZA 1YHEA 2ZT0A 3M39A 2YSKA 4G51B 3V58B 2GNVA 1NS6A 1AJHA 2D5XB 3EOKA 1FHJA 2NSRA 4MPMA 3LR7A 2HBFB 5AQDA 1CMYA 4HRRB 3WTGA 3VHBA 1Y0AA 3IC2B 1URVA 1ON7A 3K8BA 1Y4BA 1V75A 1MYGA 5MBAA 3VREB 4A8KA 3HYUB 1O1IA 1RTEA 3FS4B 1CH2A 4ZVAA 1U7SA 2MYCA 2AUQA 3MKBB 3QJEB 1MTJA 3B75A 1ABYA 1EMYA 5JGGA 1CPCB 2UUMA 5CN9A 4N6SB 2MHBA 1CH3A 5SW7B 1YIHA 3ZJQA 3MJPB 1J7SA 3VRGB 1QXDA 1HHTP 4HHBA 2MHBB 3BJ3A 5CMVA 5AZRA 4F6BA 2SPMA 1CG8B 2R4XA 1IWHB 1Y4VB 1J7WA 4WCHD 1OUUB 1BIJA 1UIWA 4JACA 1QI8A 1MLGA 1JZMA 3UHQA 3FS4A 1T1NB 3LR9A 4YJJA 1K0YA 3WCUA 1HGCA 5CHQA 4UURA 2VMLB 1Y4BB 3ECZA 1V4XB 3CY5B 2VJRB 3S1IA 1BABB 2HZ3A 1MLNA 2D2NC 1HDBB 5AQDM 3PELB 4H07A 106MA 4NZIA 3WHMB 2D2MC 2D5ZB 1NIHB 1HA7B 2C7LB 3PIAA 2MYAA 1S0HA 3D1AA 1R1XB 3GQRB 4MQHB 2D2MB 2ZSZA 1COHA 1ECOA 1HBBA 1S5XA 3S66B 3MYNA 2BLHA 2MGFA 1LH5A 2W72A 3L0FB 2VYYA 3A59A 2LHBA 3QMAA 3S1JA 3OO5A 1GH0A 4HH1A 4F4OA 1YE0B 1NIHA 2C7LA 1CQXA 3G4QA 3MBAA 2ZFOD 1LA6A 2W6WA 1LFLA 3ZJMA 1VXEA 1JWNA 109MA 4GZGA 1MGNA 1BBBB 3BA2A 1LFVB 1G0AB 4X0LA 2UULC 2HHEA 3V2VA 2SPLA 1F65A 4TMAB 3GQGA 1I3DA 3M3BA 2BV8B 1JDOA 2HHDB 1Y5FA 3D1KA 4U8UD 1G0BA 1LH2A 3WFUA 3G4RA 4IROB 1CP0A 1DDTA 3QM9A 4YU4A 2XKIA 2DN1B 3UHUA 4A8QA 1RTXA 1Y85A 1J7YB 4KMWA 1DWRA 1LUEA 1J40A 1UFJA 1O1LA 3U3EA 1SGKA 3UHSA 2X4AA 4RMPB 2NRMA 5JGGB 2FRFA 3MKBA 3QJEA 3UH6A 4F0TB 1MYZA 3QM6A 1YFFB 2QLSA 1CH7A 5B85A 1MOCA 1O1IB 1HDAB 3R5IA 3ZJJA 5JDOF 1GBUB 1LH6A 1Y22B 2OHBA 1V4WA 1HA7A 2DN2A 1JL7A 5HY8A 5B13A 1Y4RB 3DHRB 2JHOA 2UUMX 1R1YA 1XXTA 1GZXA 2R1HB 3E5IA 3HHBA 1H97A 1HDAA 3BCQA 1DTIA 2O5TX 3VRFB 3HF4A 2G10A 2LH3A 1YDZA 2LH5A 1A3OB 1MLFA 3LB4A 1Y4FA 5C6YA 3ZJIA 1K1KB 5CN4A 1SI4B 2DHBA 3FH9A 2O5MX 3MVCA 3GK9A 2HBSB 3GDJA 1GDLA 1KN1A 4IT8A 2AUPA 3QJBA 1YCAA 5CNFA 2ZT1A 3WCVA 3ECLA 2GTLB 1QSIA 1LH7A 4XDIA 2C7JB 1DTMA 3QJDB 4WJG1 1CPWA 2BV8A 4Q70B 3DUTB 2DKDA 3TM3A 2EF2A 3UHKA 2LH1A 2H8FB 2G0SA 2QU0A 2ZT2A 1G9VA 1FAWB 4MQKA 2DKAA 1X46A
chains in the Genus database with same CATH topology
1C40A 4NI1A 3OJ1A 2EB8A 1Y83B 3QQRA 1Y0DB 2O5BX 4JYQA 1VWTB 1Y7DB 2ZFBA 3IC0B 2PEGB 3WCTD 3ZOLA 2ZLXB 1YEQA 1YE2B 3DUTA 1YMBA 1HBBB 4UIQA 1HBRA 1PBXB 1C7CA 2RAOA 2G14A 2OH9A 1CH9A 1CIKA 1O1NB 1MTKA 1VXAA 4AVEA 4NK2A 1CBMA 4PQBA 1C7BA 1LA6B 3MOUA 1Y2ZA 1Y4QB 1YE0A 4N7PB 2WTHA 3IXFA 1MNKA 1Y4FB 1A6NA 3SZKA 2OH8A 3A9MA 3HF4B 1BINA 3BCQB 1CO8A 3HHBB 1B86B 2ZFOA 1OFKA 4MQJB 1R1XA 1HBSA 5JDOE 2GTLD 5KKKA 3VRGA 1MWDA 1A01A 3PELA 2ZWJA 3NMMB 1QPWB 4H2LB 1YZIB 1X3KA 2MGKA 2W72C 3HEOA 1IT2A 3ARKA 3WCTA 2O5SX 3PT7B 2HHBB 3S48C 1MLQA 5CNBA 1QSHB 111MA 1CH4A 1JZKA 3VREA 1JF3A 2R80A 1YGFB 4SDHA 2O5OX 1YFFA 1A6GA 4PQ6A 2VLYA 2H8DB 3NMLA 2BK9A 5EE4C 1J7SB 1MTIA 2FRJX 3M38A 1LJWA 3G4WA 1HJTA 3A0GA 1Y45B 2EVKA 3BJ1B 1F5PA 1B0BA 1HLMA 2HHDA 3D1KB 3UHBA 4NI0A 1Y8HB 4N7NB 2V1EA 3S65A 2HHEB 1C7DB 102MA 4YU3B 3ECXA 1MLHA 3CIUB 3VAUA 4ODCA 2VYWA 2QMBA 1BVDA 2G3HA 1HLBA 1Y2ZB 4G1VA 1YGDB 1YHEB 5JOMA 3NG6B 2ZSOA 3IA3B 1JEBA 4HRTB 1N9HA 1Y8KB 1QXEB 1JY7A 4VHBA 3UHZA 1RQ3A 2AA1B 5F0BA 1S5XB 2PEGA 1DWSA 1VXBA 3D7OA 2HBCA 1YHRB 1JPBA 1VXCA 3D1AB 6HBWA 2B7HA 3W4UB 1Y0DA 2MGMA 1ABWB 1F63A 4MQCB 2OIFA 1J3FA 2GRHA 2QSPB 3O89A 1V4UA 2HCOB 1NEJA 2MGEA 1G09B 3OO4A 1S56A 4MQGA 3PT7A 5EUIA 2FRKX 1HBIA 2ZLUB 1HGCB 1HCOB 4X0LB 1MODA 1MLOA 1NEJB 2HCOA 3MN0A 1GCWB 4N8TA 5JDOD 3GKVA 3WCUC 2D60A 2V1GA 1Q1FA 2MYEA 3UHEA 1CG5B 3GDJB 2HBSA 1DXUB 2V1IA 1KR7A 1O1OB 1RPSA 2ZFOB 4U8UA 1TU9A 2DHBB 1SI4A 1FCSA 1B86A 1MYIA 2ZSRA 1YHUA 3EDAA 1YOHA 5HAVA 2VYZA 2YRSA 3OK5A 4N7OB 2ZS1B 3HENA 1WLAA 1HRMA 3K8BB 3OVUC 1XYEA 1SPGA 2FAMA 4N7PA 2H35B 3PIAB 1DXUA 2ZSYA 1UT0A 1UVXA 4F6GA 2D2NB 1XZ4A 1JW8A 1CQ2A 1Y35B 1V4WB 2RAOB 1C7DA 4NK1A 1VXHA 1Y0CB 2G12A 1V4XA 2ZSQA 3AQ9A 4O4ZA 1YENA 3UHHA 3WCWA 1K0YB 4MU5A 1Z8UB 2VHBA 4FWXA 1YEOA 1XY0A 1OUTB 3WCVC 3A0GB 1G08B 3GQPA 3WCVD 1O1LB 1MBNA 2VEEA 6HBWB 2IG3A 1YHRA 1KFRA 108MA 1O1MB 2KSCA 2H8DA 2G0VA 3OZWA 1FN3A 5KERB 1O1KA 3DHTB 2V1FA 1PMBA 3KMFA 1YGFA 1SPEA 105MA 3QJDA 1DXTA 5CN5A 1DM1A 1YVQA 3GQGB 4HSXA 1EWAA 1JEBB 2MGDA 3EU1A 3UHVA 1Y0AB 1LFVA 5AZQA 1YVTA 1Y7ZA 5EOHA 1J3ZB 3K9ZA 3ZJOA 1DKEA 4L2MA 1EBTA 2NSSA 1MBOA 1AJGA 2BLIA 1G08A 3GQPB 4O4TA 1LFYA 1SDLB 1XY0B 1A4FA 2XYKA 3ZJLA 3NFEA 2IN4A 1JZLA 1H1XA 2ZS1A 1IRCA 4N7OA 2ZSPA 4DC7A 1HGAA 2R1HA 3MJUA 1XXTB 1YHUB 2D2ND 2E2YA 3E55A 1RVWA 4PQCA 4ESAA 1GCVA 3DHRA 4O35A 1S0HB 2G0XA 1Y0TA 1Y09B 4M4AA 1Y46B 2BLJM 2D2NA 2W6VB 1A00A 1CG5A 1HHOA 3R0GA 5MBNA 3O7NA 1GCVB 1VRFA 3WCWD 1HDBA 2BNLA 3UGYA 3R5IB 3MJUB 1LFQB 1HACB 4MQGB 2ZLXA 1NS9A 5CNGA 3LB2A 3ONZA 3QJCB 3HRWB 2VLXA 1XQ5A 3NMMA 1GLIA 1LH1A 2LH6A 3ODQB 3QZZA 3PI4A 2FRIX 3BJ3B 2EKUA 1M6CA 1NWNA 1THBA 3RJ6A 4N8TB 2Z6NB 5SW7A 2ZLWA 1MCYA 3ONZB 4F68A 1GJNA 1CBLA 3B75B 5CN6A 1MKOB 1YVQB 3AQ8A 1S61A 1DXVB 2EB9A 4ROLB 4HRTA 1HABA 3OGBA 1IDRA 1NQPA 3G53A 5KERA 1LFLB 1MDNA 1YEUA 3ARLA 1A0UB 1UX9A 5EETA 4NXCA 1NGKA 4MQIA 2W31A 2DXMA 1YEVA 3HEPA 1Y7GB 2M6ZA 2AUOA 2NX0A 1YEOB 1EBCA 1Y4GA 1YH9B 3UHTA 1CP5A 1HGBB 1MBIA 2ZLTA 1COHB 5HLUA 1KD2B 1Y7GA 3PT8A 2LH7A 1LJWB 3E5OA 3KUNA 2V1HA 1Y4RA 2QMBB 1OR4A 2QRWA 1J3YB 5CN7A 4XS0B 2H35A 2W6XA 1SDKB 3LQDB 4N7NA 4ROMB 3PI3A 1QSHA 1J52A 1N9XA 1QI8B 4UZVA 1FSLA 2GL3A 4F6JA 2QFKA 1O16A 2D6CA 1YIEA 2ZLWB 5ILMA 4MAXA 2GRFA 2LH2A 1BZZA 1K1KA 1DUOA 3DR9A 3WR1A 2C0KA 4MQJA 5B84A 2R80B 1N9IA 3WCTC 2CMMA 2MGGA 1HCOA 3VRFA 5IKSA 1NAZA 2ZLUA 1GDKA 3WFTA 3WI8A 2HHBA 1FSXA 1YOGA 1BVCA 4OODA 1MZ0A 3TM9A 1MLRA 1NPFA 5M3SA 2R4YA 1RQ4A 1OR6A 1NXFA 2OHAA 1FHJB 1NS6B 1XZ7A 1Y0WB 5CNDA 5KDQB 4M4AB 1XZ5A 5C6EA 5F2AA 1Y5JA 1C7CB 1J41B 1RQ3B 2AA1A 3EDBA 1YEQB 1HGAB 1Y4GB 2BW9M 1AJ9A 3WCPB 2M6ZB 1MLMA 4F6FA 3AT6A 1VXGA 2DXMB 3WCUD 2HBGA 1A4FB 1MBAA 3ORDA 5KDQA 4YU4B 2D2MD 1MBDA 2ZSSA 1BUWA 3TLDA 1DXCA 2O5LX 3QZXA 2QU0B 1O1JB 1MYMA 3S65B 3UHXA 3CY5A 2R4ZA 1A0ZA 2XKGA 1CH1A 1O1PB 1A0ZB 1IRDA 1LH3A 1CO9A 1Y5KB 2QSSA 1URYA 4FH6A 1DUKA 1G09A 3OO4B 1MBCA 1CG8A 2ZS1C 4NXAA 3QM8A 4TWVA 1BZZB 2G0ZA 2QFNA 1LHSA 2GTLC 1YIHB 1C40B 2Z6SA 3H57A 3AG0A 1XQ5B 1YIEB 2HBCB 3ZHWA 1IBEA 2O5QX 1Y4PA 2H8FA 1Y7CA 1M9PB 5HLQA 2MYBA 2ZT4A 2RI4A 3OZVA 5EQMA 2HBEB 1YENB 1XZUB 1A9WE 3ASEA 1QSIB 1GDIA 2HZ2A 1Y0CA 1HDSB 3IC2A 1I3EA 5E6EA 4H2LA 3KUOA 1XZ4B 1Y46A 3HXNB 4DWTA 3LB1A 5CN8A 1RQ4B 2SPNA 4G51A 1MNOA 3AQ7A 4ESAB 1BABA 1AZIA 1HDSA 1MLLA 1SPGB 1NWIA 1D8UA 3PI1A 1Y8HA 1XZUA 5HBIA 1ITHA 1T1NA 1HSYA 3UBVA 1NZ5A 4M4BB 2QLSB 4OF9A 1BIJB 4QAUA 2MB5A 3A5GA 3BJ1A 2ZT3A 2MGLA 4F6DA 4HHBB 1MWCA 1A0UA 2DN1A 2DN2B 5HY8B 3WFWA 1N9FA 2EVPA 3GKVB 5E6EB 1O1NA 4H0BA 3ZOMA 3WCWC 1JF4A 6HBIA 4FWYA 1Y5FB 1IRDB 3PI2A 2GKMA 4KN3A 1CIOA 1YE2A 1BZ1B 1MNIA 1XZVB 3WCTB 3D17A 1VHBA 3DHTA 1G0AA 1NZ2A 3UHYA 1Y7DA 2ZFBB 1GBVB 3RGKA 1YZIA 1J40B 1THBB 2V1JA 1BZ0B 1J7YA 3ZJNA 5E83B 1A6MA 7HBIA 1ECAA 1SHRA 4IROA 1G9VB 1UFPA 3G4UA 3WCPA 5CNCA 2MGAA 1BZ1A 1ECNA 1CLSA 1EW6A 3GOUA 3UI0A 3G52A 2G0RA 2ZS0D 3SZKB 1DO4A 4KMVA 1YG5A 1DLYA 1BBBA 2GTLA 3UH7A 1DXDA 5JDOC 3KMFC 5CHRA 4ILZA 1ABSA 1Y31A 1UMOA 2D5ZA 3P5QB 5ILRA 1A00B 1MNJA 1Y0TB 4F4OB 1WMUB 5HU6B 2FALA 3D4XA 3NL7B 3ED9A 3AT6B 1YHUD 3SDNA 4BJAA 3UGZA 2O58X 2AV0A 1MYHA 3GKTA 1Y01B 1VWTA 2D2MA 1Y5JB 1R1YB 1IWHA 1SDLA 1XZ5B 1UC3A 1XZ7B 2ZSTA 1DO3A 4HBIA 2ZFOC 4NI1B 1GLIB 2BWHA 2WY4A 3HRWA 4F69A 1GBVA 5EV5A 1Y22A 1VREA 1YHUC 5EUIB 1WVPA 3PI9B 4ZVBA 1CH5A 3ARJA 2VM0A 1MYTA 4U8UC 1M9PA 4LPIA 3HC9A 1SDKA 1BJEA 1Y7CB 5EYJA 1MLKA 1ASHA 1YMAA 3WR1B 5EE4D 1DO7A 5HLXA 1QPWA 3UBCA 2W6VA 3W4UA 1QXDB 1MOHA 2W6YA 1XCHA 1L2KA 3AQ5A 1ABYB 1F5OA 1OBMA 2GLNA 1A3OA 3BJ2A 2ZS0B 1YDZB 1JY7B 1MOBA 101MA 4DWUA 1S5YB 2AURA 1HGBA 1Y8KA 4ROMA 1DO1A 3BOMB 3M3AA 3UHNA 1Y35A 1J3YA 1RQAA 1W92A 104MA 1HBAA 1DKEB 1XZ2A 4FC3B 2D5XA 1YEUB 1C7BB 3P5QA 1Y31B 3K3UA 4O1TA 1GBUA 3OO5B 1JL6A 3BOMA 2ZLVA 1HBRB 1DXVA 1VXDA 3A59B 1JP9A 3PI8A 1MLSA 3WFXA 3A5BA 1BZPA 2MGIA 1FN3B 4TWUA 3OZUA 4L7YB 1GDJA 1O1MA 4MQHA 1SHRB 4U8UB 1DWTA 1O1OA 1RPSB 3MYMA 5E83A 2BKMA 1V9QA 2XKHA 3LHBA 1OUTA 3A2GA 5D1VA 2DN3B 3QM5A 5EU2A 1HV4B 3G4VA 1Y8WB 2QSSB 1BZ6A 1NS9B 1G0BB 3D17B 1OFJA 3PI9A 2PGHB 2R50A 1NZ4A 2ZS0C 107MA 1O1JA 4C44A 2WTGA 2Z6NA 2ZS1D 1J7WB 1MOAA 1FDHG 1LHTA 1ABWA 1MYFA 2HZ1A 5ILEA 4G1BA 2V1KA 2G11A 1RVWB 1RSEA 4O2GA 1JP8A 2MGCA 1AJ9B 3UH5A 1MLUA 5ILPA 3S66A 1S6AA 4B4YA 1J41A 1U7RA 110MA 2MGHA 1A6KA 3QQQA 1FLPA 3D4XB 1OJ6A 3WTGB 1YGDA 3UH3A 1CMYB 4HRRA 1HHOB 4PNJA 1LFZA 1XZ2B 3E4NA 1DLWA 3UHRA 1GCWA 1RQAB 3PT8B 4YU3A 1LFTB 1V5HA 5EYSA 3AQ6A 1PBXA 1KD2A 3GOUB 3ZH0A 1X9FB 1FSXB 1CLSB 1Y8IB 3GYSA 2BMMA 3WCUB 3IC0A 3ZJPA 3RJNB 1YH9A 1V07A 3BJ2B 3AT5B 3NFEB 2DN3A 1OUUA 3V2ZA 1O1KB 3A5AA 2Z6TA 1YEVB 1IT3A 3UHWA 1YMCA 2B7HB 1UX8A 3GLNA 3SDHA 1Y85B 1S69A 2MYDA 5E29A 1J3ZA 1Y7ZB 1NQPB 5D5RA 4DC8A 2Z85A 4ROLA 3HYUA 4WJGA 3GYSB 1Y8IA 1O1PA 1V75B 4MBNA 3LQDA 3WCVB 3NG6A 4MXLA 5AB8A 3QJBB 4XS0A 1YCBA 5E29B 1UVYA 4FC3A 2MGBA 1HBAB 1X9FC 1BUWB 1LTWA 5CNEA 3CIUA 3ODQA 1XYEB 4M4BA 3QJCA 2ZLTB 103MA 1A3NA 3QM7A 3WCWB 2W72B 1MBSA 1LFQA 3G46A 2ZS0A 4TYXA 3G4YA 4MQIB 2ZSNA 3GQRA 1WMUA 5HU6A 3HXNA 1HBHB 1Y0WA 1X9FD 1LFZB 2D60B 4F6IA 1MYJA 3WHMA 1HBHA 1MLJA 1HBGA 1NPGA 1YOIA 2DC3A 1TESA 4C0NA 1M6MA 1HABB 2HBEA 2HBDA 2RI4B 3ZJRA 2PGHA 3UHDA 4FH7A 1MKOA 2YRSB 3H58A 3UHCA 1SWMA 1Y4PB 2R4WA 1IBEB 1UIWB 2QSPA 1Y4VA 1A01B 1LFYB 4NS2A 3ZJSA 1Y83A 4B3WA 3MJPA 1HBSB 1BZ0A 4KJTA 2VRYA 1FAWA 4MQKB 1YVTB 1Y5KA 1XZVA 3EU1B 2EKTA 4HSWA 2Z8AA 4MXKA 1HACA 1MWBA 4MBAA 1DXTB 3LB3A 2HBDB 2MBWA 2ZLVB 2VLZA 4AVDA 1Y8WA 3ZJHA 1A9WA 1GVHA 3NL7A 1HV4A 1VXFA 1V4UB 1Y4QA 2MGJA 4MQCA 1ECDA 2HBFA 2OLPA 3UHIA 1IOPA 4FWZA 1Y09A 2GNWA 3FH9B 2NRLA 3EOKB 4ODCB 4L7YA 1YG5B 112MA 3D7OB 2ZSXA 1BZRA 3AT5A 3UHGA 2VEBA 4NI0B 3PI8B 1JP6A 1S5YA 1MNHA 1A3NB 1QXEA 2GDMA 1GZXB 2GKNA 2SPOA 1NZ3A 1X9FA 1FDHA 2AV3A 5C6EB 1Y45A 1LFTA 2GRZA 1YHEA 2ZT0A 3M39A 4G51B 2GNVA 1NS6A 1AJHA 2D5XB 3EOKA 1FHJA 2NSRA 4MPMA 3LR7A 2HBFB 1CMYA 4HRRB 3WTGA 3VHBA 1Y0AA 3IC2B 1URVA 3K8BA 1Y4BA 1V75A 1MYGA 5MBAA 3VREB 3HYUB 1O1IA 1RTEA 3FS4B 1CH2A 4ZVAA 1U7SA 2MYCA 2AUQA 3MKBB 3QJEB 1MTJA 3B75A 1ABYA 1EMYA 5JGGA 5CN9A 2MHBA 1CH3A 5SW7B 1YIHA 3ZJQA 3MJPB 1J7SA 3VRGB 1QXDA 4HHBA 2MHBB 3BJ3A 5CMVA 5AZRA 4F6BA 2SPMA 1CG8B 2R4XA 1IWHB 1Y4VB 1J7WA 4WCHD 1OUUB 1BIJA 1UIWA 4JACA 1QI8A 1MLGA 1JZMA 3UHQA 3FS4A 1T1NB 3LR9A 1K0YA 3WCUA 1HGCA 5CHQA 4UURA 1Y4BB 3ECZA 1V4XB 3CY5B 3S1IA 1BABB 2HZ3A 1MLNA 2D2NC 1HDBB 3PELB 4H07A 106MA 4NZIA 3WHMB 2D2MC 2D5ZB 1NIHB 3PIAA 2MYAA 1S0HA 3D1AA 1R1XB 3GQRB 4MQHB 2D2MB 2ZSZA 1COHA 1ECOA 1HBBA 1S5XA 3S66B 3MYNA 2BLHA 2MGFA 1LH5A 2W72A 2VYYA 3A59A 2LHBA 3QMAA 3S1JA 3OO5A 4F4OA 1YE0B 1NIHA 1CQXA 3G4QA 3MBAA 2ZFOD 1LA6A 2W6WA 1LFLA 3ZJMA 1VXEA 1JWNA 109MA 4GZGA 1MGNA 1BBBB 3BA2A 1LFVB 1G0AB 4X0LA 2HHEA 3V2VA 2SPLA 1F65A 3GQGA 1I3DA 3M3BA 1JDOA 2HHDB 1Y5FA 3D1KA 4U8UD 1G0BA 1LH2A 3WFUA 3G4RA 4IROB 1CP0A 3QM9A 4YU4A 2XKIA 2DN1B 3UHUA 1RTXA 1Y85A 1J7YB 4KMWA 1DWRA 1LUEA 1J40A 1UFJA 1O1LA 3U3EA 3UHSA 2NRMA 5JGGB 2FRFA 3MKBA 3QJEA 3UH6A 1MYZA 3QM6A 1YFFB 2QLSA 1CH7A 5B85A 1MOCA 1O1IB 1HDAB 3R5IA 3ZJJA 5JDOF 1GBUB 1LH6A 1Y22B 2OHBA 1V4WA 2DN2A 1JL7A 5HY8A 1Y4RB 3DHRB 2JHOA 1R1YA 1XXTA 1GZXA 2R1HB 3E5IA 3HHBA 1H97A 1HDAA 3BCQA 1DTIA 2O5TX 3VRFB 3HF4A 2G10A 2LH3A 1YDZA 2LH5A 1A3OB 1MLFA 3LB4A 1Y4FA 5C6YA 3ZJIA 1K1KB 5CN4A 1SI4B 2DHBA 3FH9A 2O5MX 3MVCA 3GK9A 2HBSB 3GDJA 1GDLA 4IT8A 2AUPA 3QJBA 1YCAA 5CNFA 2ZT1A 3WCVA 3ECLA 2GTLB 1QSIA 1LH7A 4XDIA 1DTMA 3QJDB 4WJG1 1CPWA 3DUTB 3TM3A 2EF2A 3UHKA 2LH1A 2H8FB 2G0SA 2QU0A 2ZT2A 1G9VA 1FAWB 4MQKA 1X46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C40 A;  4NI1 A;  3OJ1 A;  2EB8 A;  1Y83 B;  3QQR A;  1Y0D B;  2O5B X;  4JYQ A;  1VWT B;  1Y7D B;  2ZFB A;  3IC0 B;  2PEG B;  3WCT D;  3ZOL A;  2ZLX B;  1YEQ A;  1YE2 B;  3DUT A;  1YMB A;  1HBB B;  4UIQ A;  1HBR A;  1PBX B;  1C7C A;  2RAO A;  2G14 A;  2OH9 A;  1CH9 A;  1CIK A;  1O1N B;  1MTK A;  1VXA A;  4AVE A;  4NK2 A;  1CBM A;  4PQB A;  1C7B A;  1LA6 B;  3MOU A;  1Y2Z A;  1Y4Q B;  1YE0 A;  4N7P B;  2WTH A;  3IXF A;  1MNK A;  1Y4F B;  1A6N A;  3SZK A;  2OH8 A;  3A9M A;  3HF4 B;  1BIN A;  3BCQ B;  1CO8 A;  3HHB B;  1B86 B;  2ZFO A;  1OFK A;  4MQJ B;  1R1X A;  1HBS A;  5JDO E;  2GTL D;  5KKK A;  3VRG A;  1MWD A;  1A01 A;  3PEL A;  2ZWJ A;  3NMM B;  1QPW B;  4H2L B;  1YZI B;  1X3K A;  2MGK A;  2W72 C;  3HEO A;  1IT2 A;  3ARK A;  3WCT A;  2O5S X;  3PT7 B;  2HHB B;  3S48 C;  1MLQ A;  5CNB A;  1QSH B;  111M A;  1CH4 A;  1JZK A;  3VRE A;  1JF3 A;  2R80 A;  1YGF B;  4SDH A;  2O5O X;  1YFF A;  1A6G A;  4PQ6 A;  2VLY A;  2H8D B;  3NML A;  2BK9 A;  5EE4 C;  1J7S B;  1MTI A;  2FRJ X;  3M38 A;  1LJW A;  3G4W A;  1HJT A;  3A0G A;  1Y45 B;  2EVK A;  3BJ1 B;  1F5P A;  1B0B A;  1HLM A;  2HHD A;  3D1K B;  3UHB A;  4NI0 A;  1Y8H B;  4N7N B;  2V1E A;  3S65 A;  2HHE B;  1C7D B;  102M A;  4YU3 B;  3ECX A;  1MLH A;  3CIU B;  3VAU A;  4ODC A;  2VYW A;  2QMB A;  1BVD A;  2G3H A;  1HLB A;  1Y2Z B;  4G1V A;  1YGD B;  1YHE B;  5JOM A;  3NG6 B;  2ZSO A;  3IA3 B;  1JEB A;  4HRT B;  1N9H A;  1Y8K B;  1QXE B;  1JY7 A;  4VHB A;  3UHZ A;  1RQ3 A;  2AA1 B;  5F0B A;  1S5X B;  2PEG A;  1DWS A;  1VXB A;  3D7O A;  2HBC A;  1YHR B;  1JPB A;  1VXC A;  3D1A B;  6HBW A;  2B7H A;  3W4U B;  1Y0D A;  2MGM A;  1ABW B;  1F63 A;  4MQC B;  2OIF A;  1J3F A;  2GRH A;  2QSP B;  3O89 A;  1V4U A;  2HCO B;  1NEJ A;  2MGE A;  1G09 B;  3OO4 A;  1S56 A;  4MQG A;  3PT7 A;  5EUI A;  2FRK X;  1HBI A;  2ZLU B;  1HGC B;  1HCO B;  4X0L B;  1MOD A;  1MLO A;  1NEJ B;  2HCO A;  3MN0 A;  1GCW B;  4N8T A;  5JDO D;  3GKV A;  3WCU C;  2D60 A;  2V1G A;  1Q1F A;  2MYE A;  3UHE A;  1CG5 B;  3GDJ B;  2HBS A;  1DXU B;  2V1I A;  1KR7 A;  1O1O B;  1RPS A;  2ZFO B;  4U8U A;  1TU9 A;  2DHB B;  1SI4 A;  1FCS A;  1B86 A;  1MYI A;  2ZSR A;  1YHU A;  3EDA A;  1YOH A;  5HAV A;  2VYZ A;  2YRS A;  3OK5 A;  4N7O B;  2ZS1 B;  3HEN A;  1WLA A;  1HRM A;  3K8B B;  3OVU C;  1XYE A;  1SPG A;  2FAM A;  4N7P A;  2H35 B;  3PIA B;  1DXU A;  2ZSY A;  1UT0 A;  1UVX A;  4F6G A;  2D2N B;  1XZ4 A;  1JW8 A;  1CQ2 A;  1Y35 B;  1V4W B;  2RAO B;  1C7D A;  4NK1 A;  1VXH A;  1Y0C B;  2G12 A;  1V4X A;  2ZSQ A;  3AQ9 A;  4O4Z A;  1YEN A;  3UHH A;  3WCW A;  1K0Y B;  4MU5 A;  1Z8U B;  2VHB A;  4FWX A;  1YEO A;  1XY0 A;  1OUT B;  3WCV C;  3A0G B;  1G08 B;  3GQP A;  3WCV D;  1O1L B;  1MBN A;  2VEE A;  6HBW B;  2IG3 A;  1YHR A;  1KFR A;  108M A;  1O1M B;  2KSC A;  2H8D A;  2G0V A;  3OZW A;  1FN3 A;  5KER B;  1O1K A;  3DHT B;  2V1F A;  1PMB A;  3KMF A;  1YGF A;  1SPE A;  105M A;  3QJD A;  1DXT A;  5CN5 A;  1DM1 A;  1YVQ A;  3GQG B;  4HSX A;  1EWA A;  1JEB B;  2MGD A;  3EU1 A;  3UHV A;  1Y0A B;  1LFV A;  5AZQ A;  1YVT A;  1Y7Z A;  5EOH A;  1J3Z B;  3K9Z A;  3ZJO A;  1DKE A;  4L2M A;  1EBT A;  2NSS A;  1MBO A;  1AJG A;  2BLI A;  1G08 A;  3GQP B;  4O4T A;  1LFY A;  1SDL B;  1XY0 B;  1A4F A;  2XYK A;  3ZJL A;  3NFE A;  2IN4 A;  1JZL A;  1H1X A;  2ZS1 A;  1IRC A;  4N7O A;  2ZSP A;  4DC7 A;  1HGA A;  2R1H A;  3MJU A;  1XXT B;  1YHU B;  2D2N D;  2E2Y A;  3E55 A;  1RVW A;  4PQC A;  4ESA A;  1GCV A;  3DHR A;  4O35 A;  1S0H B;  2G0X A;  1Y0T A;  1Y09 B;  4M4A A;  1Y46 B;  2BLJ M;  2D2N A;  2W6V B;  1A00 A;  1CG5 A;  1HHO A;  3R0G A;  5MBN A;  3O7N A;  1GCV B;  1VRF A;  3WCW D;  1HDB A;  2BNL A;  3UGY A;  3R5I B;  3MJU B;  1LFQ B;  1HAC B;  4MQG B;  2ZLX A;  1NS9 A;  5CNG A;  3LB2 A;  3ONZ A;  3QJC B;  3HRW B;  2VLX A;  1XQ5 A;  3NMM A;  1GLI A;  1LH1 A;  2LH6 A;  3ODQ B;  3QZZ A;  3PI4 A;  2FRI X;  3BJ3 B;  2EKU A;  1M6C A;  1NWN A;  1THB A;  3RJ6 A;  4N8T B;  2Z6N B;  5SW7 A;  2ZLW A;  1MCY A;  3ONZ B;  4F68 A;  1GJN A;  1CBL A;  3B75 B;  5CN6 A;  1MKO B;  1YVQ B;  3AQ8 A;  1S61 A;  1DXV B;  2EB9 A;  4ROL B;  4HRT A;  1HAB A;  3OGB A;  1IDR A;  1NQP A;  3G53 A;  5KER A;  1LFL B;  1MDN A;  1YEU A;  3ARL A;  1A0U B;  1UX9 A;  5EET A;  4NXC A;  1NGK A;  4MQI A;  2W31 A;  2DXM A;  1YEV A;  3HEP A;  1Y7G B;  2M6Z A;  2AUO A;  2NX0 A;  1YEO B;  1EBC A;  1Y4G A;  1YH9 B;  3UHT A;  1CP5 A;  1HGB B;  1MBI A;  2ZLT A;  1COH B;  5HLU A;  1KD2 B;  1Y7G A;  3PT8 A;  2LH7 A;  1LJW B;  3E5O A;  3KUN A;  2V1H A;  1Y4R A;  2QMB B;  1OR4 A;  2QRW A;  1J3Y B;  5CN7 A;  4XS0 B;  2H35 A;  2W6X A;  1SDK B;  3LQD B;  4N7N A;  4ROM B;  3PI3 A;  1QSH A;  1J52 A;  1N9X A;  1QI8 B;  4UZV A;  1FSL A;  2GL3 A;  4F6J A;  2QFK A;  1O16 A;  2D6C A;  1YIE A;  2ZLW B;  5ILM A;  4MAX A;  2GRF A;  2LH2 A;  1BZZ A;  1K1K A;  1DUO A;  3DR9 A;  3WR1 A;  2C0K A;  4MQJ A;  5B84 A;  2R80 B;  1N9I A;  3WCT C;  2CMM A;  2MGG A;  1HCO A;  3VRF A;  5IKS A;  1NAZ A;  2ZLU A;  1GDK A;  3WFT A;  3WI8 A;  2HHB A;  1FSX A;  1YOG A;  1BVC A;  4OOD A;  1MZ0 A;  3TM9 A;  1MLR A;  1NPF A;  5M3S A;  2R4Y A;  1RQ4 A;  1OR6 A;  1NXF A;  2OHA A;  1FHJ B;  1NS6 B;  1XZ7 A;  1Y0W B;  5CND A;  5KDQ B;  4M4A B;  1XZ5 A;  5C6E A;  5F2A A;  1Y5J A;  1C7C B;  1J41 B;  1RQ3 B;  2AA1 A;  3EDB A;  1YEQ B;  1HGA B;  1Y4G B;  2BW9 M;  1AJ9 A;  3WCP B;  2M6Z B;  1MLM A;  4F6F A;  3AT6 A;  1VXG A;  2DXM B;  3WCU D;  2HBG A;  1A4F B;  1MBA A;  3ORD A;  5KDQ A;  4YU4 B;  2D2M D;  1MBD A;  2ZSS A;  1BUW A;  3TLD A;  1DXC A;  2O5L X;  3QZX A;  2QU0 B;  1O1J B;  1MYM A;  3S65 B;  3UHX A;  3CY5 A;  2R4Z A;  1A0Z A;  2XKG A;  1CH1 A;  1O1P B;  1A0Z B;  1IRD A;  1LH3 A;  1CO9 A;  1Y5K B;  2QSS A;  1URY A;  4FH6 A;  1DUK A;  1G09 A;  3OO4 B;  1MBC A;  1CG8 A;  2ZS1 C;  4NXA A;  3QM8 A;  4TWV A;  1BZZ B;  2G0Z A;  2QFN A;  1LHS A;  2GTL C;  1YIH B;  1C40 B;  2Z6S A;  3H57 A;  3AG0 A;  1XQ5 B;  1YIE B;  2HBC B;  3ZHW A;  1IBE A;  2O5Q X;  1Y4P A;  2H8F A;  1Y7C A;  1M9P B;  5HLQ A;  2MYB A;  2ZT4 A;  2RI4 A;  3OZV A;  5EQM A;  2HBE B;  1YEN B;  1XZU B;  1A9W E;  3ASE A;  1QSI B;  1GDI A;  2HZ2 A;  1Y0C A;  1HDS B;  3IC2 A;  1I3E A;  5E6E A;  4H2L A;  3KUO A;  1XZ4 B;  1Y46 A;  3HXN B;  4DWT A;  3LB1 A;  5CN8 A;  1RQ4 B;  2SPN A;  4G51 A;  1MNO A;  3AQ7 A;  4ESA B;  1BAB A;  1AZI A;  1HDS A;  1MLL A;  1SPG B;  1NWI A;  1D8U A;  3PI1 A;  1Y8H A;  1XZU A;  5HBI A;  1ITH A;  1T1N A;  1HSY A;  3UBV A;  1NZ5 A;  4M4B B;  2QLS B;  4OF9 A;  1BIJ B;  4QAU A;  2MB5 A;  3A5G A;  3BJ1 A;  2ZT3 A;  2MGL A;  4F6D A;  4HHB B;  1MWC A;  1A0U A;  2DN1 A;  2DN2 B;  5HY8 B;  3WFW A;  1N9F A;  2EVP A;  3GKV B;  5E6E B;  1O1N A;  4H0B A;  3ZOM A;  3WCW C;  1JF4 A;  6HBI A;  4FWY A;  1Y5F B;  1IRD B;  3PI2 A;  2GKM A;  4KN3 A;  1CIO A;  1YE2 A;  1BZ1 B;  1MNI A;  1XZV B;  3WCT B;  3D17 A;  1VHB A;  3DHT A;  1G0A A;  1NZ2 A;  3UHY A;  1Y7D A;  2ZFB B;  1GBV B;  3RGK A;  1YZI A;  1J40 B;  1THB B;  2V1J A;  1BZ0 B;  1J7Y A;  3ZJN A;  5E83 B;  1A6M A;  7HBI A;  1ECA A;  1SHR A;  4IRO A;  1G9V B;  1UFP A;  3G4U A;  3WCP A;  5CNC A;  2MGA A;  1BZ1 A;  1ECN A;  1CLS A;  1EW6 A;  3GOU A;  3UI0 A;  3G52 A;  2G0R A;  2ZS0 D;  3SZK B;  1DO4 A;  4KMV A;  1YG5 A;  1DLY A;  1BBB A;  2GTL A;  3UH7 A;  1DXD A;  5JDO C;  3KMF C;  5CHR A;  4ILZ A;  1ABS A;  1Y31 A;  1UMO A;  2D5Z A;  3P5Q B;  5ILR A;  1A00 B;  1MNJ A;  1Y0T B;  4F4O B;  1WMU B;  5HU6 B;  2FAL A;  3D4X A;  3NL7 B;  3ED9 A;  3AT6 B;  1YHU D;  3SDN A;  4BJA A;  3UGZ A;  2O58 X;  2AV0 A;  1MYH A;  3GKT A;  1Y01 B;  1VWT A;  2D2M A;  1Y5J B;  1R1Y B;  1IWH A;  1SDL A;  1XZ5 B;  1UC3 A;  1XZ7 B;  2ZST A;  1DO3 A;  4HBI A;  2ZFO C;  4NI1 B;  1GLI B;  2BWH A;  2WY4 A;  3HRW A;  4F69 A;  1GBV A;  5EV5 A;  1Y22 A;  1VRE A;  1YHU C;  5EUI B;  1WVP A;  3PI9 B;  4ZVB A;  1CH5 A;  3ARJ A;  2VM0 A;  1MYT A;  4U8U C;  1M9P A;  4LPI A;  3HC9 A;  1SDK A;  1BJE A;  1Y7C B;  5EYJ A;  1MLK A;  1ASH A;  1YMA A;  3WR1 B;  5EE4 D;  1DO7 A;  5HLX A;  1QPW A;  3UBC A;  2W6V A;  3W4U A;  1QXD B;  1MOH A;  2W6Y A;  1XCH A;  1L2K A;  3AQ5 A;  1ABY B;  1F5O A;  1OBM A;  2GLN A;  1A3O A;  3BJ2 A;  2ZS0 B;  1YDZ B;  1JY7 B;  1MOB A;  101M A;  4DWU A;  1S5Y B;  2AUR A;  1HGB A;  1Y8K A;  4ROM A;  1DO1 A;  3BOM B;  3M3A A;  3UHN A;  1Y35 A;  1J3Y A;  1RQA A;  1W92 A;  104M A;  1HBA A;  1DKE B;  1XZ2 A;  4FC3 B;  2D5X A;  1YEU B;  1C7B B;  3P5Q A;  1Y31 B;  3K3U A;  4O1T A;  1GBU A;  3OO5 B;  1JL6 A;  3BOM A;  2ZLV A;  1HBR B;  1DXV A;  1VXD A;  3A59 B;  1JP9 A;  3PI8 A;  1MLS A;  3WFX A;  3A5B A;  1BZP A;  2MGI A;  1FN3 B;  4TWU A;  3OZU A;  4L7Y B;  1GDJ A;  1O1M A;  4MQH A;  1SHR B;  4U8U B;  1DWT A;  1O1O A;  1RPS B;  3MYM A;  5E83 A;  2BKM A;  1V9Q A;  2XKH A;  3LHB A;  1OUT A;  3A2G A;  5D1V A;  2DN3 B;  3QM5 A;  5EU2 A;  1HV4 B;  3G4V A;  1Y8W B;  2QSS B;  1BZ6 A;  1NS9 B;  1G0B B;  3D17 B;  1OFJ A;  3PI9 A;  2PGH B;  2R50 A;  1NZ4 A;  2ZS0 C;  107M A;  1O1J A;  4C44 A;  2WTG A;  2Z6N A;  2ZS1 D;  1J7W B;  1MOA A;  1FDH G;  1LHT A;  1ABW A;  1MYF A;  2HZ1 A;  5ILE A;  4G1B A;  2V1K A;  2G11 A;  1RVW B;  1RSE A;  4O2G A;  1JP8 A;  2MGC A;  1AJ9 B;  3UH5 A;  1MLU A;  5ILP A;  3S66 A;  1S6A A;  4B4Y A;  1J41 A;  1U7R A;  110M A;  2MGH A;  1A6K A;  3QQQ A;  1FLP A;  3D4X B;  1OJ6 A;  3WTG B;  1YGD A;  3UH3 A;  1CMY B;  4HRR A;  1HHO B;  4PNJ A;  1LFZ A;  1XZ2 B;  3E4N A;  1DLW A;  3UHR A;  1GCW A;  1RQA B;  3PT8 B;  4YU3 A;  1LFT B;  1V5H A;  5EYS A;  3AQ6 A;  1PBX A;  1KD2 A;  3GOU B;  3ZH0 A;  1X9F B;  1FSX B;  1CLS B;  1Y8I B;  3GYS A;  2BMM A;  3WCU B;  3IC0 A;  3ZJP A;  3RJN B;  1YH9 A;  1V07 A;  3BJ2 B;  3AT5 B;  3NFE B;  2DN3 A;  1OUU A;  3V2Z A;  1O1K B;  3A5A A;  2Z6T A;  1YEV B;  1IT3 A;  3UHW A;  1YMC A;  2B7H B;  1UX8 A;  3GLN A;  3SDH A;  1Y85 B;  1S69 A;  2MYD A;  5E29 A;  1J3Z A;  1Y7Z B;  1NQP B;  5D5R A;  4DC8 A;  2Z85 A;  4ROL A;  3HYU A;  4WJG A;  3GYS B;  1Y8I A;  1O1P A;  1V75 B;  4MBN A;  3LQD A;  3WCV B;  3NG6 A;  4MXL A;  5AB8 A;  3QJB B;  4XS0 A;  1YCB A;  5E29 B;  1UVY A;  4FC3 A;  2MGB A;  1HBA B;  1X9F C;  1BUW B;  1LTW A;  5CNE A;  3CIU A;  3ODQ A;  1XYE B;  4M4B A;  3QJC A;  2ZLT B;  103M A;  1A3N A;  3QM7 A;  3WCW B;  2W72 B;  1MBS A;  1LFQ A;  3G46 A;  2ZS0 A;  4TYX A;  3G4Y A;  4MQI B;  2ZSN A;  3GQR A;  1WMU A;  5HU6 A;  3HXN A;  1HBH B;  1Y0W A;  1X9F D;  1LFZ B;  2D60 B;  4F6I A;  1MYJ A;  3WHM A;  1HBH A;  1MLJ A;  1HBG A;  1NPG A;  1YOI A;  2DC3 A;  1TES A;  4C0N A;  1M6M A;  1HAB B;  2HBE A;  2HBD A;  2RI4 B;  3ZJR A;  2PGH A;  3UHD A;  4FH7 A;  1MKO A;  2YRS B;  3H58 A;  3UHC A;  1SWM A;  1Y4P B;  2R4W A;  1IBE B;  1UIW B;  2QSP A;  1Y4V A;  1A01 B;  1LFY B;  4NS2 A;  3ZJS A;  1Y83 A;  4B3W A;  3MJP A;  1HBS B;  1BZ0 A;  4KJT A;  2VRY A;  1FAW A;  4MQK B;  1YVT B;  1Y5K A;  1XZV A;  3EU1 B;  2EKT A;  4HSW A;  2Z8A A;  4MXK A;  1HAC A;  1MWB A;  4MBA A;  1DXT B;  3LB3 A;  2HBD B;  2MBW A;  2ZLV B;  2VLZ A;  4AVD A;  1Y8W A;  3ZJH A;  1A9W A;  1GVH A;  3NL7 A;  1HV4 A;  1VXF A;  1V4U B;  1Y4Q A;  2MGJ A;  4MQC A;  1ECD A;  2HBF A;  2OLP A;  3UHI A;  1IOP A;  4FWZ A;  1Y09 A;  2GNW A;  3FH9 B;  2NRL A;  3EOK B;  4ODC B;  4L7Y A;  1YG5 B;  112M A;  3D7O B;  2ZSX A;  1BZR A;  3AT5 A;  3UHG A;  2VEB A;  4NI0 B;  3PI8 B;  1JP6 A;  1S5Y A;  1MNH A;  1A3N B;  1QXE A;  2GDM A;  1GZX B;  2GKN A;  2SPO A;  1NZ3 A;  1X9F A;  1FDH A;  2AV3 A;  5C6E B;  1Y45 A;  1LFT A;  2GRZ A;  1YHE A;  2ZT0 A;  3M39 A;  4G51 B;  2GNV A;  1NS6 A;  1AJH A;  2D5X B;  3EOK A;  1FHJ A;  2NSR A;  4MPM A;  3LR7 A;  2HBF B;  1CMY A;  4HRR B;  3WTG A;  3VHB A;  1Y0A A;  3IC2 B;  1URV A;  3K8B A;  1Y4B A;  1V75 A;  1MYG A;  5MBA A;  3VRE B;  3HYU B;  1O1I A;  1RTE A;  3FS4 B;  1CH2 A;  4ZVA A;  1U7S A;  2MYC A;  2AUQ A;  3MKB B;  3QJE B;  1MTJ A;  3B75 A;  1ABY A;  1EMY A;  5JGG A;  5CN9 A;  2MHB A;  1CH3 A;  5SW7 B;  1YIH A;  3ZJQ A;  3MJP B;  1J7S A;  3VRG B;  1QXD A;  4HHB A;  2MHB B;  3BJ3 A;  5CMV A;  5AZR A;  4F6B A;  2SPM A;  1CG8 B;  2R4X A;  1IWH B;  1Y4V B;  1J7W A;  4WCH D;  1OUU B;  1BIJ A;  1UIW A;  4JAC A;  1QI8 A;  1MLG A;  1JZM A;  3UHQ A;  3FS4 A;  1T1N B;  3LR9 A;  1K0Y A;  3WCU A;  1HGC A;  5CHQ A;  4UUR A;  1Y4B B;  3ECZ A;  1V4X B;  3CY5 B;  3S1I A;  1BAB B;  2HZ3 A;  1MLN A;  2D2N C;  1HDB B;  3PEL B;  4H07 A;  106M A;  4NZI A;  3WHM B;  2D2M C;  2D5Z B;  1NIH B;  3PIA A;  2MYA A;  1S0H A;  3D1A A;  1R1X B;  3GQR B;  4MQH B;  2D2M B;  2ZSZ A;  1COH A;  1ECO A;  1HBB A;  1S5X A;  3S66 B;  3MYN A;  2BLH A;  2MGF A;  1LH5 A;  2W72 A;  2VYY A;  3A59 A;  2LHB A;  3QMA A;  3S1J A;  3OO5 A;  4F4O A;  1YE0 B;  1NIH A;  1CQX A;  3G4Q A;  3MBA A;  2ZFO D;  1LA6 A;  2W6W A;  1LFL A;  3ZJM A;  1VXE A;  1JWN A;  109M A;  4GZG A;  1MGN A;  1BBB B;  3BA2 A;  1LFV B;  1G0A B;  4X0L A;  2HHE A;  3V2V A;  2SPL A;  1F65 A;  3GQG A;  1I3D A;  3M3B A;  1JDO A;  2HHD B;  1Y5F A;  3D1K A;  4U8U D;  1G0B A;  1LH2 A;  3WFU A;  3G4R A;  4IRO B;  1CP0 A;  3QM9 A;  4YU4 A;  2XKI A;  2DN1 B;  3UHU A;  1RTX A;  1Y85 A;  1J7Y B;  4KMW A;  1DWR A;  1LUE A;  1J40 A;  1UFJ A;  1O1L A;  3U3E A;  3UHS A;  2NRM A;  5JGG B;  2FRF A;  3MKB A;  3QJE A;  3UH6 A;  1MYZ A;  3QM6 A;  1YFF B;  2QLS A;  1CH7 A;  5B85 A;  1MOC A;  1O1I B;  1HDA B;  3R5I A;  3ZJJ A;  5JDO F;  1GBU B;  1LH6 A;  1Y22 B;  2OHB A;  1V4W A;  2DN2 A;  1JL7 A;  5HY8 A;  1Y4R B;  3DHR B;  2JHO A;  1R1Y A;  1XXT A;  1GZX A;  2R1H B;  3E5I A;  3HHB A;  1H97 A;  1HDA A;  3BCQ A;  1DTI A;  2O5T X;  3VRF B;  3HF4 A;  2G10 A;  2LH3 A;  1YDZ A;  2LH5 A;  1A3O B;  1MLF A;  3LB4 A;  1Y4F A;  5C6Y A;  3ZJI A;  1K1K B;  5CN4 A;  1SI4 B;  2DHB A;  3FH9 A;  2O5M X;  3MVC A;  3GK9 A;  2HBS B;  3GDJ A;  1GDL A;  4IT8 A;  2AUP A;  3QJB A;  1YCA A;  5CNF A;  2ZT1 A;  3WCV A;  3ECL A;  2GTL B;  1QSI A;  1LH7 A;  4XDI A;  1DTM A;  3QJD B;  4WJG 1;  1CPW A;  3DUT B;  3TM3 A;  2EF2 A;  3UHK A;  2LH1 A;  2H8F B;  2G0S A;  2QU0 A;  2ZT2 A;  1G9V A;  1FAW B;  4MQK A;  1X46 A; 
#chains in the Genus database with same CATH topology
 1C40 A;  4NI1 A;  3OJ1 A;  2EB8 A;  1Y83 B;  3QQR A;  1Y0D B;  2O5B X;  2V8A A;  4JYQ A;  5FVB A;  1VWT B;  1Y7D B;  2ZFB A;  3PMC A;  3IC0 B;  2PEG B;  3WCT D;  3ZOL A;  2ZLX B;  1YEQ A;  1YE2 B;  3DUT A;  1YMB A;  1HBB B;  4UIQ A;  1HBR A;  1PBX B;  1C7C A;  2RAO A;  2G14 A;  2OH9 A;  1CH9 A;  1CIK A;  1O1N B;  1MTK A;  1VXA A;  4AVE A;  4NK2 A;  1CBM A;  4PQB A;  1C7B A;  1LA6 B;  3MOU A;  1Y2Z A;  1Y4Q B;  1YE0 A;  4N7P B;  2WTH A;  1UVL A;  4HH0 A;  3IXF A;  1MNK A;  1Y4F B;  1A6N A;  3SZK A;  4ZIZ B;  2OH8 A;  3A9M A;  3HF4 B;  1UVJ A;  1BIN A;  3BCQ B;  1CO8 A;  2J96 A;  3HHB B;  1B86 B;  2ZFO A;  1OFK A;  4MQJ B;  1R1X A;  1HBS A;  5JDO E;  2GTL D;  5KKK A;  3VRG A;  1MWD A;  1A01 A;  3KVS B;  3PEL A;  2ZWJ A;  3NMM B;  1QPW B;  4H2L B;  1YZI B;  1X3K A;  2MGK A;  2W72 C;  4A8S A;  3HEO A;  1IT2 A;  3ARK A;  3WCT A;  2O5S X;  3PT7 B;  2HHB B;  3S48 C;  1MLQ A;  5CNB A;  1QSH B;  111M A;  1CH4 A;  1JZK A;  4ERV A;  3VRE A;  1JF3 A;  2R80 A;  1YGF B;  4SDH A;  2O5O X;  1YFF A;  1ON7 B;  1A6G A;  4PQ6 A;  2VLY A;  5B13 G;  2H8D B;  1HI8 A;  3NML A;  2BK9 A;  5EE4 C;  1J7S B;  1MTI A;  2FRJ X;  3M38 A;  1LJW A;  3G4W A;  1HJT A;  3A0G A;  1Y45 B;  2EVK A;  3BJ1 B;  1F5P A;  1B0B A;  4AE1 A;  4ETV A;  1HLM A;  2HHD A;  3D1K B;  3UHB A;  4NI0 A;  4LMS B;  1Y8H B;  4N7N B;  2V1E A;  3S65 A;  2HHE B;  1C7D B;  102M A;  1F99 B;  4YU3 B;  3ECX A;  1MLH A;  3CIU B;  3VAU A;  4ODC A;  2VYW A;  2QMB A;  1BVD A;  2G3H A;  1HLB A;  1Y2Z B;  2JLG A;  4G1V A;  1YGD B;  1YHE B;  1F99 A;  5JOM A;  3NG6 B;  2ZSO A;  3GUQ A;  3IA3 B;  1JEB A;  4HRT B;  1N9H A;  1Y8K B;  1QXE B;  1JY7 A;  4VHB A;  1UVI A;  3UHZ A;  1RQ3 A;  2AA1 B;  5F0B A;  1S5X B;  2PEG A;  1DWS A;  1VXB A;  3D7O A;  2HBC A;  1YHR B;  1JPB A;  1VXC A;  2JL9 A;  3D1A B;  6HBW A;  2B7H A;  3W4U B;  1Y0D A;  2MGM A;  1ABW B;  1ALL B;  4MQC B;  1F63 A;  2OIF A;  1J3F A;  2GRH A;  2QSP B;  3O89 A;  1V4U A;  2HCO B;  1NEJ A;  2MGE A;  1G09 B;  3OO4 A;  3PMD A;  1S56 A;  4MQG A;  3PT7 A;  5EUI A;  2FRK X;  1HBI A;  2ZLU B;  1HGC B;  1HCO B;  2C7J A;  4X0L B;  1MOD A;  1MLO A;  1NEJ B;  2HCO A;  3MN0 A;  1GCW B;  4N8T A;  5JDO D;  3GKV A;  3WCU C;  2D60 A;  2V1G A;  1Q1F A;  2MYE A;  3UHE A;  1CG5 B;  3GDJ B;  2HBS A;  1DXU B;  2V1I A;  1KR7 A;  1O1O B;  1RPS A;  2ZFO B;  4U8U A;  1TU9 A;  2DHB B;  1SI4 A;  1JBO B;  1FCS A;  1B86 A;  1CPC A;  4A8M P;  1MYI A;  2ZSR A;  1YHU A;  3EDA A;  1YOH A;  5HAV A;  2VYZ A;  2YRS A;  3OK5 A;  4N7O B;  2ZS1 B;  3HEN A;  1WLA A;  4B02 A;  1HRM A;  3K8B B;  3OVU C;  1XYE A;  1SPG A;  2FAM A;  4N7P A;  2H35 B;  3O18 A;  3PIA B;  1DXU A;  1LIA A;  2ZSY A;  1UT0 A;  1UVX A;  4F6G A;  2D2N B;  1XZ4 A;  1JW8 A;  3GIO A;  1CQ2 A;  1Y35 B;  2UUL B;  1V4W B;  2RAO B;  1C7D A;  4NK1 A;  1VXH A;  1Y0C B;  2G12 A;  1V4X A;  2ZSQ A;  3AQ9 A;  4O4Z A;  1YEN A;  4Z8K A;  3UHH A;  3WCW A;  1K0Y B;  4MU5 A;  1Z8U B;  4F0U B;  2VHB A;  4FWX A;  1YEO A;  1XY0 A;  1OUT B;  3WCV C;  3A0G B;  2C7K A;  1HI0 P;  1G08 B;  3GQP A;  3WCV D;  1O1L B;  1MBN A;  2VEE A;  6HBW B;  1B8D A;  2IG3 A;  1YHR A;  1KFR A;  108M A;  1O1M B;  2KSC A;  4N6S A;  2H8D A;  2G0V A;  3OZW A;  1FN3 A;  5KER B;  2VJT B;  1O1K A;  3DHT B;  1XF6 C;  2V1F A;  1PMB A;  3KMF A;  1YGF A;  1SPE A;  105M A;  4ETU A;  3QJD A;  1DXT A;  5CN5 A;  1UVM A;  1DM1 A;  1YVQ A;  3GQG B;  4HSX A;  1EWA A;  1JEB B;  2MGD A;  3EU1 A;  3UHV A;  1Y0A B;  1LFV A;  5AZQ A;  1YVT A;  1Y7Z A;  5EOH A;  1J3Z B;  3K9Z A;  3ZJO A;  1DKE A;  4L2M A;  1EBT A;  2NSS A;  1MBO A;  1AJG A;  2BLI A;  4H0M B;  1G08 A;  3GQP B;  4O4T A;  1LFY A;  1SDL B;  1XY0 B;  1A4F A;  2XYK A;  3ZJL A;  3NFE A;  2IN4 A;  1JZL A;  1H1X A;  2ZS1 A;  1IRC A;  4N7O A;  2ZSP A;  4DC7 A;  1HGA A;  2R1H A;  3MJU A;  1XXT B;  1YHU B;  3E55 A;  2D2N D;  2E2Y A;  1RVW A;  4PQC A;  4ESA A;  1JBO A;  1GCV A;  3DHR A;  4O35 A;  1S0H B;  2G0X A;  1Y0T A;  1Y09 B;  4M4A A;  1Y46 B;  2BLJ M;  2D2N A;  2W6V B;  1A00 A;  1CG5 A;  1LIA B;  1HHO A;  1KTP A;  3R0G A;  5MBN A;  3O7N A;  1GCV B;  1VRF A;  3WCW D;  1HDB A;  2BNL A;  3UGY A;  3R5I B;  3MJU B;  1LFQ B;  1HAC B;  4MQG B;  2ZLX A;  1NS9 A;  5CNG A;  3LB2 A;  3ONZ A;  3QJC B;  3HRW B;  2VLX A;  1XQ5 A;  3NMM A;  1GLI A;  1LH1 A;  2LH6 A;  3ODQ B;  3QZZ A;  1B33 A;  3V57 B;  3PI4 A;  2FRI X;  3BJ3 B;  2EKU A;  1M6C A;  1NWN A;  1THB A;  3RJ6 A;  4N8T B;  2Z6N B;  5SW7 A;  2ZLW A;  1MCY A;  3ONZ B;  4F68 A;  1GJN A;  1CBL A;  3B75 B;  5CN6 A;  1MKO B;  1YVQ B;  3AQ8 A;  1S61 A;  1DXV B;  2EB9 A;  4ROL B;  4HRT A;  1HAB A;  3OGB A;  4BJU A;  1IDR A;  1NQP A;  3G53 A;  5KER A;  1LFL B;  1MDN A;  1YEU A;  3ARL A;  1COL A;  1A0U B;  1UX9 A;  5EET A;  4NXC A;  1NGK A;  4MQI A;  2W31 A;  2DXM A;  1YEV A;  3HEP A;  1Y7G B;  2M6Z A;  2AUO A;  2NX0 A;  1YEO B;  1EBC A;  1Y4G A;  1YH9 B;  2VJH B;  3UHT A;  1CP5 A;  1XDT T;  1HGB B;  1MBI A;  2ZLT A;  1COH B;  5HLU A;  1KD2 B;  1Y7G A;  2V8A B;  3PT8 A;  2LH7 A;  1LJW B;  3E5O A;  3KUN A;  2V1H A;  1Y4R A;  2QMB B;  1OR4 A;  2QRW A;  1J3Y B;  5CN7 A;  4XS0 B;  1MDT A;  2H35 A;  2W6X A;  1SDK B;  3LQD B;  4PO5 A;  2VML A;  4N7N A;  4ROM B;  1HHS A;  3PI3 A;  1QSH A;  4YJJ B;  1J52 A;  1N9X A;  1QI8 B;  4UZV A;  1FSL A;  2GL3 A;  4F6J A;  2QFK A;  1O16 A;  4BS9 A;  4RMP A;  2D6C A;  1YIE A;  2ZLW B;  5ILM A;  4MAX A;  2GRF A;  2LH2 A;  1BZZ A;  1K1K A;  1DUO A;  3DR9 A;  3WR1 A;  1TOX A;  2C0K A;  4MQJ A;  1EYX B;  5B84 A;  1I7Y B;  2R80 B;  1N9I A;  3WCT C;  2CMM A;  2MGG A;  1HCO A;  3VRF A;  5IKS A;  1NAZ A;  2ZLU A;  1GDK A;  3WFT A;  3WI8 A;  2HHB A;  1FSX A;  1YOG A;  1BVC A;  4OOD A;  1PHN B;  4XXK A;  1MZ0 A;  3TM9 A;  1MLR A;  1NPF A;  5M3S A;  2R4Y A;  1RQ4 A;  1OR6 A;  1NXF A;  2OHA A;  1FHJ B;  4L1E B;  1NS6 B;  1XZ7 A;  1Y0W B;  5CND A;  5KDQ B;  4M4A B;  1XZ5 A;  5C6E A;  5F2A A;  1Y5J A;  2I88 A;  1C7C B;  1J41 B;  1RQ3 B;  2AA1 A;  3EDB A;  1YEQ B;  1HGA B;  1Y4G B;  2BW9 M;  4F0T A;  1AJ9 A;  3WCP B;  2M6Z B;  1MLM A;  4F6F A;  3AT6 A;  1VXG A;  2DXM B;  2JLF A;  3NUH B;  3WCU D;  2HBG A;  1A4F B;  1MBA A;  3ORD A;  5KDQ A;  4YU4 B;  2D2M D;  1MBD A;  2ZSS A;  1BUW A;  4ETT A;  3TLD A;  1DXC A;  2O5L X;  3QZX A;  2X49 A;  2QU0 B;  1O1J B;  1MYM A;  3S65 B;  3UHX A;  3CY5 A;  2R4Z A;  4AE0 A;  1A0Z A;  2XKG A;  1CH1 A;  1O1P B;  1A0Z B;  1IRD A;  1LH3 A;  1CO9 A;  1Y5K B;  2QSS A;  1URY A;  4FH6 A;  1DUK A;  1G09 A;  3OO4 B;  1MBC A;  1CG8 A;  2ZS1 C;  4NXA A;  3QM8 A;  4TWV A;  1BZZ B;  2G0Z A;  2QFN A;  1LHS A;  1B8D B;  2GTL C;  1YIH B;  1C40 B;  2Z6S A;  4LMX B;  3H57 A;  3AG0 A;  1XQ5 B;  1YIE B;  2HBC B;  3ZHW A;  1IBE A;  2O5Q X;  1Y4P A;  2H8F A;  1Y7C A;  1M9P B;  5HLQ A;  2MYB A;  2ZT4 A;  2RI4 A;  3OZV A;  5EQM A;  2HBE B;  1YEN B;  2WCR A;  1XZU B;  1A9W E;  3ASE A;  3BRP A;  1QSI B;  1GDI A;  2HZ2 A;  1Y0C A;  1HDS B;  3IC2 A;  1I3E A;  5E6E A;  4H2L A;  1KN1 B;  4ERT A;  3KUO A;  1XZ4 B;  1Y46 A;  3HXN B;  4DWT A;  3LB1 A;  5CN8 A;  1RQ4 B;  2SPN A;  4G51 A;  3V58 A;  1MNO A;  3AQ7 A;  4ESA B;  1BAB A;  1AZI A;  1HDS A;  1MLL A;  1SPG B;  1NWI A;  1D8U A;  3PI1 A;  1Y8H A;  1XZU A;  5HBI A;  1ITH A;  1T1N A;  3O2C B;  1HSY A;  3UBV A;  1NZ5 A;  4M4B B;  2QLS B;  4OF9 A;  1BIJ B;  4ZIZ A;  4QAU A;  2MB5 A;  3A5G A;  3BJ1 A;  2ZT3 A;  2MGL A;  4F6D A;  4HHB B;  1MWC A;  1A0U A;  2DN1 A;  2DN2 B;  5HY8 B;  3WFW A;  3ZTA A;  1N9F A;  2EVP A;  3GKV B;  5E6E B;  1O1N A;  4H0B A;  3ZOM A;  3WCW C;  1JF4 A;  6HBI A;  4FWY A;  1Y5F B;  1IRD B;  3PI2 A;  2GKM A;  4KN3 A;  1CIO A;  1YE2 A;  4PO5 B;  1BZ1 B;  1MNI A;  1XZV B;  3WCT B;  3D17 A;  1VHB A;  3DHT A;  1G0A A;  1NZ2 A;  2VJT A;  1Y7D A;  2ZFB B;  3UHY A;  1UVN A;  1GBV B;  3RGK A;  1YZI A;  1J40 B;  1THB B;  2V1J A;  1BZ0 B;  1J7Y A;  4ESU A;  3ZJN A;  1ALL A;  5E83 B;  1A6M A;  7HBI A;  1ECA A;  1SHR A;  4IRO A;  1G9V B;  1UFP A;  2UUL H;  3G4U A;  3WCP A;  5CNC A;  2MGA A;  1BZ1 A;  1ECN A;  1CLS A;  4Q70 A;  1EW6 A;  3GOU A;  3UI0 A;  3G52 A;  2G0R A;  2ZS0 D;  3SZK B;  1DO4 A;  4KMV A;  1YG5 A;  1DLY A;  1BBB A;  2GTL A;  3UH7 A;  1DXD A;  5JDO C;  3KMF C;  5CHR A;  4ILZ A;  1ABS A;  1Y31 A;  1KTP B;  1UMO A;  2D5Z A;  3P5Q B;  5ILR A;  4L1E A;  1A00 B;  1MNJ A;  1Y0T B;  4F4O B;  1WMU B;  5HU6 B;  2FAL A;  3D4X A;  3NL7 B;  1GH0 B;  3ED9 A;  3AT6 B;  1YHU D;  3SDN A;  4BJA A;  3UGZ A;  2O58 X;  3O2C A;  2AV0 A;  1MYH A;  1A87 A;  3GKT A;  1I7Y A;  1Y01 B;  1VWT A;  2D2M A;  1Y5J B;  1R1Y B;  1IWH A;  4GXE A;  1SDL A;  3LQ9 A;  1XZ5 B;  4H0M A;  1UC3 A;  1XZ7 B;  2ZST A;  1DO3 A;  4HBI A;  2ZFO C;  4NI1 B;  1GLI B;  2BWH A;  2WY4 A;  3HRW A;  4F69 A;  2DKC A;  1GBV A;  5EV5 A;  1Y22 A;  1VRE A;  1YHU C;  5EUI B;  4GY3 B;  1WVP A;  3PI9 B;  4ZVB A;  1CH5 A;  3ARJ A;  2VM0 A;  1MYT A;  4U8U C;  1M9P A;  4LPI A;  4GY3 A;  3HC9 A;  1SDK A;  1BJE A;  1Y7C B;  5EYJ A;  1MLK A;  1ASH A;  1YMA A;  3WR1 B;  5EE4 D;  1DO7 A;  5HLX A;  1QPW A;  3UBC A;  2W6V A;  3W4U A;  1QXD B;  1MOH A;  2W6Y A;  1XCH A;  1L2K A;  2UUM B;  3AQ5 A;  1ABY B;  1F5O A;  1OBM A;  2GLN A;  1A3O A;  3MWN A;  3BJ2 A;  2ZS0 B;  1YDZ B;  1JY7 B;  1MOB A;  101M A;  4DWU A;  1S5Y B;  2AUR A;  1HGB A;  1Y8K A;  4ROM A;  1DO1 A;  3BOM B;  1NY9 A;  3DBJ B;  3M3A A;  2UUN D;  3UHN A;  1Y35 A;  2UUL A;  1J3Y A;  1RQA A;  1W92 A;  104M A;  1HBA A;  1DKE B;  1XZ2 A;  4FC3 B;  2D5X A;  1YEU B;  1XG0 C;  1C7B B;  3P5Q A;  1Y31 B;  3K3U A;  4O1T A;  1GBU A;  3DBJ A;  3OO5 B;  1JL6 A;  3BOM A;  2ZLV A;  1HBR B;  1DXV A;  1VXD A;  3A59 B;  1JP9 A;  3PI8 A;  1MLS A;  3WFX A;  3A5B A;  1BZP A;  2MGI A;  1FN3 B;  4TWU A;  3OZU A;  4L7Y B;  1GDJ A;  1O1M A;  4MQH A;  1SHR B;  4U8U B;  1DWT A;  1O1O A;  1RPS B;  3MYM A;  5E83 A;  2BKM A;  1V9Q A;  2XKH A;  3LHB A;  1OUT A;  3A2G A;  5D1V A;  2DN3 B;  3QM5 A;  5EU2 A;  1HV4 B;  3G4V A;  1Y8W B;  2QSS B;  1BZ6 A;  1NS9 B;  1G0B B;  3D17 B;  1OFJ A;  2VJR A;  3PI9 A;  2PGH B;  2R50 A;  1NZ4 A;  2ZS0 C;  107M A;  1CII A;  1O1J A;  3VNC A;  4C44 A;  2WTG A;  2Z6N A;  2ZS1 D;  1J7W B;  1MOA A;  1FDH G;  3RQR A;  1LHT A;  1ABW A;  1MYF A;  2HZ1 A;  5ILE A;  4G1B A;  2V1K A;  2G11 A;  1RVW B;  1RSE A;  4O2G A;  1JP8 A;  2MGC A;  1AJ9 B;  2UUN B;  2UUL D;  4LM6 B;  3UH5 A;  1MLU A;  5ILP A;  3S66 A;  1S6A A;  4B4Y A;  1J41 A;  1U7R A;  110M A;  2MGH A;  1A6K A;  3QQQ A;  1FLP A;  3D4X B;  1OJ6 A;  3WTG B;  1YGD A;  3UH3 A;  1CMY B;  4HRR A;  1HHO B;  4PNJ A;  1LFZ A;  1XZ2 B;  3E4N A;  1DLW A;  1GCW A;  1RQA B;  3UHR A;  3PT8 B;  4YU3 A;  1LFT B;  1V5H A;  1WAC A;  5EYS A;  3AQ6 A;  1PBX A;  1KD2 A;  3GOU B;  1PHN A;  3ZH0 A;  1F0L A;  1X9F B;  1FSX B;  3BRP B;  1CLS B;  1Y8I B;  3GYS A;  2BMM A;  3WCU B;  3IC0 A;  3ZJP A;  2VJH A;  3RJN B;  1YH9 A;  1V07 A;  3BJ2 B;  3AT5 B;  3NFE B;  2DN3 A;  1OUU A;  1EYX A;  3V2Z A;  1O1K B;  3A5A A;  2Z6T A;  1YEV B;  1IT3 A;  3UHW A;  4A8W A;  1YMC A;  2B7H B;  1UX8 A;  3GLN A;  3SDH A;  1Y85 B;  1S69 A;  2MYD A;  5E29 A;  1J3Z A;  1Y7Z B;  1NQP B;  5D5R A;  4DC8 A;  2Z85 A;  4ROL A;  3HYU A;  4Z8K B;  4WJG A;  3GYS B;  1Y8I A;  1O1P A;  1RH1 A;  1V75 B;  4MBN A;  3LQD A;  3FEW X;  3WCV B;  3NG6 A;  4MXL A;  5AB8 A;  3QJB B;  4XS0 A;  1YCB A;  3KVS A;  5E29 B;  1UVY A;  4FC3 A;  2MGB A;  1QGW C;  1HBA B;  1X9F C;  1UVK A;  1BUW B;  1LTW A;  5CNE A;  3CIU A;  2C7K B;  1B33 B;  3V57 A;  4GXE B;  3ODQ A;  1XYE B;  4M4B A;  3QJC A;  4F0U A;  2ZLT B;  103M A;  1A3N A;  3QM7 A;  3WCW B;  2W72 B;  3L0F A;  1MBS A;  1LFQ A;  3G46 A;  2ZS0 A;  2UUN A;  4TYX A;  3G4Y A;  1HI1 A;  4MQI B;  2ZSN A;  3GQR A;  1WMU A;  5HU6 A;  3HXN A;  1HBH B;  1Y0W A;  1X9F D;  1LFZ B;  2D60 B;  4F6I A;  1MYJ A;  3WHM A;  1HBH A;  1MLJ A;  1HBG A;  1NPG A;  3O18 B;  1YOI A;  2DC3 A;  1TES A;  4C0N A;  1M6M A;  1HAB B;  2HBE A;  2HBD A;  2RI4 B;  3ZJR A;  2PGH A;  3UHD A;  4FH7 A;  1MKO A;  2YRS B;  3H58 A;  4XXI A;  3UHC A;  4A8F A;  1SWM A;  1Y4P B;  2R4W A;  1IBE B;  4A8O A;  1UIW B;  2QSP A;  1Y4V A;  1A01 B;  1LFY B;  4NS2 A;  3ZJS A;  1Y83 A;  2WCQ A;  4B3W A;  3MJP A;  1HBS B;  4A8Y A;  1BZ0 A;  4KJT A;  2VRY A;  1FAW A;  4MQK B;  1YVT B;  1Y5K A;  1XZV A;  3EU1 B;  2EKT A;  4HSW A;  2Z8A A;  4MXK A;  1HAC A;  1MWB A;  4MBA A;  1DXT B;  3LB3 A;  2HBD B;  2MBW A;  2ZLV B;  2VLZ A;  4AVD A;  1Y8W A;  3ZJH A;  1A9W A;  1GVH A;  3NL7 A;  1HV4 A;  1VXF A;  1V4U B;  1Y4Q A;  2MGJ A;  4MQC A;  5FVB M;  1ECD A;  2HBF A;  2OLP A;  3UHI A;  1IOP A;  4FWZ A;  1Y09 A;  2GNW A;  3FH9 B;  2NRL A;  3EOK B;  4ODC B;  4L7Y A;  1YG5 B;  112M A;  3D7O B;  2ZSX A;  1BZR A;  3AT5 A;  3UHG A;  2VEB A;  4NI0 B;  3PI8 B;  1JP6 A;  1S5Y A;  1MNH A;  1A3N B;  1QXE A;  2GDM A;  1GZX B;  2GKN A;  2SPO A;  1NZ3 A;  1X9F A;  1FDH A;  2AV3 A;  5C6E B;  1Y45 A;  1LFT A;  2GRZ A;  1YHE A;  2ZT0 A;  3M39 A;  2YSK A;  4G51 B;  3V58 B;  2GNV A;  1NS6 A;  1AJH A;  2D5X B;  3EOK A;  1FHJ A;  2NSR A;  4MPM A;  3LR7 A;  2HBF B;  5AQD A;  1CMY A;  4HRR B;  3WTG A;  3VHB A;  1Y0A A;  3IC2 B;  1URV A;  1ON7 A;  3K8B A;  1Y4B A;  1V75 A;  1MYG A;  5MBA A;  3VRE B;  4A8K A;  3HYU B;  1O1I A;  1RTE A;  3FS4 B;  1CH2 A;  4ZVA A;  1U7S A;  2MYC A;  2AUQ A;  3MKB B;  3QJE B;  1MTJ A;  3B75 A;  1ABY A;  1EMY A;  5JGG A;  1CPC B;  2UUM A;  5CN9 A;  4N6S B;  2MHB A;  1CH3 A;  5SW7 B;  1YIH A;  3ZJQ A;  3MJP B;  1J7S A;  3VRG B;  1QXD A;  1HHT P;  4HHB A;  2MHB B;  3BJ3 A;  5CMV A;  5AZR A;  4F6B A;  2SPM A;  1CG8 B;  2R4X A;  1IWH B;  1Y4V B;  1J7W A;  4WCH D;  1OUU B;  1BIJ A;  1UIW A;  4JAC A;  1QI8 A;  1MLG A;  1JZM A;  3UHQ A;  3FS4 A;  1T1N B;  3LR9 A;  4YJJ A;  1K0Y A;  3WCU A;  1HGC A;  5CHQ A;  4UUR A;  2VML B;  1Y4B B;  3ECZ A;  1V4X B;  3CY5 B;  2VJR B;  3S1I A;  1BAB B;  2HZ3 A;  1MLN A;  2D2N C;  1HDB B;  5AQD M;  3PEL B;  4H07 A;  106M A;  4NZI A;  3WHM B;  2D2M C;  2D5Z B;  1NIH B;  1HA7 B;  2C7L B;  3PIA A;  2MYA A;  1S0H A;  3D1A A;  1R1X B;  3GQR B;  4MQH B;  2D2M B;  2ZSZ A;  1COH A;  1ECO A;  1HBB A;  1S5X A;  3S66 B;  3MYN A;  2BLH A;  2MGF A;  1LH5 A;  2W72 A;  3L0F B;  2VYY A;  3A59 A;  2LHB A;  3QMA A;  3S1J A;  3OO5 A;  1GH0 A;  4HH1 A;  4F4O A;  1YE0 B;  1NIH A;  2C7L A;  1CQX A;  3G4Q A;  3MBA A;  2ZFO D;  1LA6 A;  2W6W A;  1LFL A;  3ZJM A;  1VXE A;  1JWN A;  109M A;  4GZG A;  1MGN A;  1BBB B;  3BA2 A;  1LFV B;  1G0A B;  4X0L A;  2UUL C;  2HHE A;  3V2V A;  2SPL A;  1F65 A;  4TMA B;  3GQG A;  1I3D A;  3M3B A;  2BV8 B;  1JDO A;  2HHD B;  1Y5F A;  3D1K A;  4U8U D;  1G0B A;  1LH2 A;  3WFU A;  3G4R A;  4IRO B;  1CP0 A;  1DDT A;  3QM9 A;  4YU4 A;  2XKI A;  2DN1 B;  3UHU A;  4A8Q A;  1RTX A;  1Y85 A;  1J7Y B;  4KMW A;  1DWR A;  1LUE A;  1J40 A;  1UFJ A;  1O1L A;  3U3E A;  1SGK A;  3UHS A;  2X4A A;  4RMP B;  2NRM A;  5JGG B;  2FRF A;  3MKB A;  3QJE A;  3UH6 A;  4F0T B;  1MYZ A;  3QM6 A;  1YFF B;  2QLS A;  1CH7 A;  5B85 A;  1MOC A;  1O1I B;  1HDA B;  3R5I A;  3ZJJ A;  5JDO F;  1GBU B;  1LH6 A;  1Y22 B;  2OHB A;  1V4W A;  1HA7 A;  2DN2 A;  1JL7 A;  5HY8 A;  5B13 A;  1Y4R B;  3DHR B;  2JHO A;  2UUM X;  1R1Y A;  1XXT A;  1GZX A;  2R1H B;  3E5I A;  3HHB A;  1H97 A;  1HDA A;  3BCQ A;  1DTI A;  2O5T X;  3VRF B;  3HF4 A;  2G10 A;  2LH3 A;  1YDZ A;  2LH5 A;  1A3O B;  1MLF A;  3LB4 A;  1Y4F A;  5C6Y A;  3ZJI A;  1K1K B;  5CN4 A;  1SI4 B;  2DHB A;  3FH9 A;  2O5M X;  3MVC A;  3GK9 A;  2HBS B;  3GDJ A;  1GDL A;  1KN1 A;  4IT8 A;  2AUP A;  3QJB A;  1YCA A;  5CNF A;  2ZT1 A;  3WCV A;  3ECL A;  2GTL B;  1QSI A;  1LH7 A;  4XDI A;  2C7J B;  1DTM A;  3QJD B;  4WJG 1;  1CPW A;  2BV8 A;  4Q70 B;  3DUT B;  2DKD A;  3TM3 A;  2EF2 A;  3UHK A;  2LH1 A;  2H8F B;  2G0S A;  2QU0 A;  2ZT2 A;  1G9V A;  1FAW B;  4MQK A;  2DKA A;  1X46 A; 
#chains in the Genus database with same CATH homology
 1C40 A;  4NI1 A;  3OJ1 A;  2EB8 A;  1Y83 B;  3QQR A;  1Y0D B;  2O5B X;  4JYQ A;  1VWT B;  1Y7D B;  2ZFB A;  3IC0 B;  2PEG B;  3WCT D;  3ZOL A;  2ZLX B;  1YEQ A;  1YE2 B;  3DUT A;  1YMB A;  1HBB B;  4UIQ A;  1HBR A;  1PBX B;  1C7C A;  2RAO A;  2G14 A;  2OH9 A;  1CH9 A;  1CIK A;  1O1N B;  1MTK A;  1VXA A;  4AVE A;  4NK2 A;  1CBM A;  4PQB A;  1C7B A;  1LA6 B;  3MOU A;  1Y2Z A;  1Y4Q B;  1YE0 A;  4N7P B;  2WTH A;  3IXF A;  1MNK A;  1Y4F B;  1A6N A;  3SZK A;  2OH8 A;  3A9M A;  3HF4 B;  1BIN A;  3BCQ B;  1CO8 A;  3HHB B;  1B86 B;  2ZFO A;  1OFK A;  4MQJ B;  1R1X A;  1HBS A;  5JDO E;  2GTL D;  5KKK A;  3VRG A;  1MWD A;  1A01 A;  3PEL A;  2ZWJ A;  3NMM B;  1QPW B;  4H2L B;  1YZI B;  1X3K A;  2MGK A;  2W72 C;  3HEO A;  1IT2 A;  3ARK A;  3WCT A;  2O5S X;  3PT7 B;  2HHB B;  3S48 C;  1MLQ A;  5CNB A;  1QSH B;  111M A;  1CH4 A;  1JZK A;  3VRE A;  1JF3 A;  2R80 A;  1YGF B;  4SDH A;  2O5O X;  1YFF A;  1A6G A;  4PQ6 A;  2VLY A;  2H8D B;  3NML A;  2BK9 A;  5EE4 C;  1J7S B;  1MTI A;  2FRJ X;  3M38 A;  1LJW A;  3G4W A;  1HJT A;  3A0G A;  1Y45 B;  2EVK A;  3BJ1 B;  1F5P A;  1B0B A;  1HLM A;  2HHD A;  3D1K B;  3UHB A;  4NI0 A;  1Y8H B;  4N7N B;  2V1E A;  3S65 A;  2HHE B;  1C7D B;  102M A;  4YU3 B;  3ECX A;  1MLH A;  3CIU B;  3VAU A;  4ODC A;  2VYW A;  2QMB A;  1BVD A;  2G3H A;  1HLB A;  1Y2Z B;  4G1V A;  1YGD B;  1YHE B;  5JOM A;  3NG6 B;  2ZSO A;  3IA3 B;  1JEB A;  4HRT B;  1N9H A;  1Y8K B;  1QXE B;  1JY7 A;  4VHB A;  3UHZ A;  1RQ3 A;  2AA1 B;  5F0B A;  1S5X B;  2PEG A;  1DWS A;  1VXB A;  3D7O A;  2HBC A;  1YHR B;  1JPB A;  1VXC A;  3D1A B;  6HBW A;  2B7H A;  3W4U B;  1Y0D A;  2MGM A;  1ABW B;  1F63 A;  4MQC B;  2OIF A;  1J3F A;  2GRH A;  2QSP B;  3O89 A;  1V4U A;  2HCO B;  1NEJ A;  2MGE A;  1G09 B;  3OO4 A;  1S56 A;  4MQG A;  3PT7 A;  5EUI A;  2FRK X;  1HBI A;  2ZLU B;  1HGC B;  1HCO B;  4X0L B;  1MOD A;  1MLO A;  1NEJ B;  2HCO A;  3MN0 A;  1GCW B;  4N8T A;  5JDO D;  3GKV A;  3WCU C;  2D60 A;  2V1G A;  1Q1F A;  2MYE A;  3UHE A;  1CG5 B;  3GDJ B;  2HBS A;  1DXU B;  2V1I A;  1KR7 A;  1O1O B;  1RPS A;  2ZFO B;  4U8U A;  1TU9 A;  2DHB B;  1SI4 A;  1FCS A;  1B86 A;  1MYI A;  2ZSR A;  1YHU A;  3EDA A;  1YOH A;  5HAV A;  2VYZ A;  2YRS A;  3OK5 A;  4N7O B;  2ZS1 B;  3HEN A;  1WLA A;  1HRM A;  3K8B B;  3OVU C;  1XYE A;  1SPG A;  2FAM A;  4N7P A;  2H35 B;  3PIA B;  1DXU A;  2ZSY A;  1UT0 A;  1UVX A;  4F6G A;  2D2N B;  1XZ4 A;  1JW8 A;  1CQ2 A;  1Y35 B;  1V4W B;  2RAO B;  1C7D A;  4NK1 A;  1VXH A;  1Y0C B;  2G12 A;  1V4X A;  2ZSQ A;  3AQ9 A;  4O4Z A;  1YEN A;  3UHH A;  3WCW A;  1K0Y B;  4MU5 A;  1Z8U B;  2VHB A;  4FWX A;  1YEO A;  1XY0 A;  1OUT B;  3WCV C;  3A0G B;  1G08 B;  3GQP A;  3WCV D;  1O1L B;  1MBN A;  2VEE A;  6HBW B;  2IG3 A;  1YHR A;  1KFR A;  108M A;  1O1M B;  2KSC A;  2H8D A;  2G0V A;  3OZW A;  1FN3 A;  5KER B;  1O1K A;  3DHT B;  2V1F A;  1PMB A;  3KMF A;  1YGF A;  1SPE A;  105M A;  3QJD A;  1DXT A;  5CN5 A;  1DM1 A;  1YVQ A;  3GQG B;  4HSX A;  1EWA A;  1JEB B;  2MGD A;  3EU1 A;  3UHV A;  1Y0A B;  1LFV A;  5AZQ A;  1YVT A;  1Y7Z A;  5EOH A;  1J3Z B;  3K9Z A;  3ZJO A;  1DKE A;  4L2M A;  1EBT A;  2NSS A;  1MBO A;  1AJG A;  2BLI A;  1G08 A;  3GQP B;  4O4T A;  1LFY A;  1SDL B;  1XY0 B;  1A4F A;  2XYK A;  3ZJL A;  3NFE A;  2IN4 A;  1JZL A;  1H1X A;  2ZS1 A;  1IRC A;  4N7O A;  2ZSP A;  4DC7 A;  1HGA A;  2R1H A;  3MJU A;  1XXT B;  1YHU B;  2D2N D;  2E2Y A;  3E55 A;  1RVW A;  4PQC A;  4ESA A;  1GCV A;  3DHR A;  4O35 A;  1S0H B;  2G0X A;  1Y0T A;  1Y09 B;  4M4A A;  1Y46 B;  2BLJ M;  2D2N A;  2W6V B;  1A00 A;  1CG5 A;  1HHO A;  3R0G A;  5MBN A;  3O7N A;  1GCV B;  1VRF A;  3WCW D;  1HDB A;  2BNL A;  3UGY A;  3R5I B;  3MJU B;  1LFQ B;  1HAC B;  4MQG B;  2ZLX A;  1NS9 A;  5CNG A;  3LB2 A;  3ONZ A;  3QJC B;  3HRW B;  2VLX A;  1XQ5 A;  3NMM A;  1GLI A;  1LH1 A;  2LH6 A;  3ODQ B;  3QZZ A;  3PI4 A;  2FRI X;  3BJ3 B;  2EKU A;  1M6C A;  1NWN A;  1THB A;  3RJ6 A;  4N8T B;  2Z6N B;  5SW7 A;  2ZLW A;  1MCY A;  3ONZ B;  4F68 A;  1GJN A;  1CBL A;  3B75 B;  5CN6 A;  1MKO B;  1YVQ B;  3AQ8 A;  1S61 A;  1DXV B;  2EB9 A;  4ROL B;  4HRT A;  1HAB A;  3OGB A;  1IDR A;  1NQP A;  3G53 A;  5KER A;  1LFL B;  1MDN A;  1YEU A;  3ARL A;  1A0U B;  1UX9 A;  5EET A;  4NXC A;  1NGK A;  4MQI A;  2W31 A;  2DXM A;  1YEV A;  3HEP A;  1Y7G B;  2M6Z A;  2AUO A;  2NX0 A;  1YEO B;  1EBC A;  1Y4G A;  1YH9 B;  3UHT A;  1CP5 A;  1HGB B;  1MBI A;  2ZLT A;  1COH B;  5HLU A;  1KD2 B;  1Y7G A;  3PT8 A;  2LH7 A;  1LJW B;  3E5O A;  3KUN A;  2V1H A;  1Y4R A;  2QMB B;  1OR4 A;  2QRW A;  1J3Y B;  5CN7 A;  4XS0 B;  2H35 A;  2W6X A;  1SDK B;  3LQD B;  4N7N A;  4ROM B;  3PI3 A;  1QSH A;  1J52 A;  1N9X A;  1QI8 B;  4UZV A;  1FSL A;  2GL3 A;  4F6J A;  2QFK A;  1O16 A;  2D6C A;  1YIE A;  2ZLW B;  5ILM A;  4MAX A;  2GRF A;  2LH2 A;  1BZZ A;  1K1K A;  1DUO A;  3DR9 A;  3WR1 A;  2C0K A;  4MQJ A;  5B84 A;  2R80 B;  1N9I A;  3WCT C;  2CMM A;  2MGG A;  1HCO A;  3VRF A;  5IKS A;  1NAZ A;  2ZLU A;  1GDK A;  3WFT A;  3WI8 A;  2HHB A;  1FSX A;  1YOG A;  1BVC A;  4OOD A;  1MZ0 A;  3TM9 A;  1MLR A;  1NPF A;  5M3S A;  2R4Y A;  1RQ4 A;  1OR6 A;  1NXF A;  2OHA A;  1FHJ B;  1NS6 B;  1XZ7 A;  1Y0W B;  5CND A;  5KDQ B;  4M4A B;  1XZ5 A;  5C6E A;  5F2A A;  1Y5J A;  1C7C B;  1J41 B;  1RQ3 B;  2AA1 A;  3EDB A;  1YEQ B;  1HGA B;  1Y4G B;  2BW9 M;  1AJ9 A;  3WCP B;  2M6Z B;  1MLM A;  4F6F A;  3AT6 A;  1VXG A;  2DXM B;  3WCU D;  2HBG A;  1A4F B;  1MBA A;  3ORD A;  5KDQ A;  4YU4 B;  2D2M D;  1MBD A;  2ZSS A;  1BUW A;  3TLD A;  1DXC A;  2O5L X;  3QZX A;  2QU0 B;  1O1J B;  1MYM A;  3S65 B;  3UHX A;  3CY5 A;  2R4Z A;  1A0Z A;  2XKG A;  1CH1 A;  1O1P B;  1A0Z B;  1IRD A;  1LH3 A;  1CO9 A;  1Y5K B;  2QSS A;  1URY A;  4FH6 A;  1DUK A;  1G09 A;  3OO4 B;  1MBC A;  1CG8 A;  2ZS1 C;  4NXA A;  3QM8 A;  4TWV A;  1BZZ B;  2G0Z A;  2QFN A;  1LHS A;  2GTL C;  1YIH B;  1C40 B;  2Z6S A;  3H57 A;  3AG0 A;  1XQ5 B;  1YIE B;  2HBC B;  3ZHW A;  1IBE A;  2O5Q X;  1Y4P A;  2H8F A;  1Y7C A;  1M9P B;  5HLQ A;  2MYB A;  2ZT4 A;  2RI4 A;  3OZV A;  5EQM A;  2HBE B;  1YEN B;  1XZU B;  1A9W E;  3ASE A;  1QSI B;  1GDI A;  2HZ2 A;  1Y0C A;  1HDS B;  3IC2 A;  1I3E A;  5E6E A;  4H2L A;  3KUO A;  1XZ4 B;  1Y46 A;  3HXN B;  4DWT A;  3LB1 A;  5CN8 A;  1RQ4 B;  2SPN A;  4G51 A;  1MNO A;  3AQ7 A;  4ESA B;  1BAB A;  1AZI A;  1HDS A;  1MLL A;  1SPG B;  1NWI A;  1D8U A;  3PI1 A;  1Y8H A;  1XZU A;  5HBI A;  1ITH A;  1T1N A;  1HSY A;  3UBV A;  1NZ5 A;  4M4B B;  2QLS B;  4OF9 A;  1BIJ B;  4QAU A;  2MB5 A;  3A5G A;  3BJ1 A;  2ZT3 A;  2MGL A;  4F6D A;  4HHB B;  1MWC A;  1A0U A;  2DN1 A;  2DN2 B;  5HY8 B;  3WFW A;  1N9F A;  2EVP A;  3GKV B;  5E6E B;  1O1N A;  4H0B A;  3ZOM A;  3WCW C;  1JF4 A;  6HBI A;  4FWY A;  1Y5F B;  1IRD B;  3PI2 A;  2GKM A;  4KN3 A;  1CIO A;  1YE2 A;  1BZ1 B;  1MNI A;  1XZV B;  3WCT B;  3D17 A;  1VHB A;  3DHT A;  1G0A A;  1NZ2 A;  3UHY A;  1Y7D A;  2ZFB B;  1GBV B;  3RGK A;  1YZI A;  1J40 B;  1THB B;  2V1J A;  1BZ0 B;  1J7Y A;  3ZJN A;  5E83 B;  1A6M A;  7HBI A;  1ECA A;  1SHR A;  4IRO A;  1G9V B;  1UFP A;  3G4U A;  3WCP A;  5CNC A;  2MGA A;  1BZ1 A;  1ECN A;  1CLS A;  1EW6 A;  3GOU A;  3UI0 A;  3G52 A;  2G0R A;  2ZS0 D;  3SZK B;  1DO4 A;  4KMV A;  1YG5 A;  1DLY A;  1BBB A;  2GTL A;  3UH7 A;  1DXD A;  5JDO C;  3KMF C;  5CHR A;  4ILZ A;  1ABS A;  1Y31 A;  1UMO A;  2D5Z A;  3P5Q B;  5ILR A;  1A00 B;  1MNJ A;  1Y0T B;  4F4O B;  1WMU B;  5HU6 B;  2FAL A;  3D4X A;  3NL7 B;  3ED9 A;  3AT6 B;  1YHU D;  3SDN A;  4BJA A;  3UGZ A;  2O58 X;  2AV0 A;  1MYH A;  3GKT A;  1Y01 B;  1VWT A;  2D2M A;  1Y5J B;  1R1Y B;  1IWH A;  1SDL A;  1XZ5 B;  1UC3 A;  1XZ7 B;  2ZST A;  1DO3 A;  4HBI A;  2ZFO C;  4NI1 B;  1GLI B;  2BWH A;  2WY4 A;  3HRW A;  4F69 A;  1GBV A;  5EV5 A;  1Y22 A;  1VRE A;  1YHU C;  5EUI B;  1WVP A;  3PI9 B;  4ZVB A;  1CH5 A;  3ARJ A;  2VM0 A;  1MYT A;  4U8U C;  1M9P A;  4LPI A;  3HC9 A;  1SDK A;  1BJE A;  1Y7C B;  5EYJ A;  1MLK A;  1ASH A;  1YMA A;  3WR1 B;  5EE4 D;  1DO7 A;  5HLX A;  1QPW A;  3UBC A;  2W6V A;  3W4U A;  1QXD B;  1MOH A;  2W6Y A;  1XCH A;  1L2K A;  3AQ5 A;  1ABY B;  1F5O A;  1OBM A;  2GLN A;  1A3O A;  3BJ2 A;  2ZS0 B;  1YDZ B;  1JY7 B;  1MOB A;  101M A;  4DWU A;  1S5Y B;  2AUR A;  1HGB A;  1Y8K A;  4ROM A;  1DO1 A;  3BOM B;  3M3A A;  3UHN A;  1Y35 A;  1J3Y A;  1RQA A;  1W92 A;  104M A;  1HBA A;  1DKE B;  1XZ2 A;  4FC3 B;  2D5X A;  1YEU B;  1C7B B;  3P5Q A;  1Y31 B;  3K3U A;  4O1T A;  1GBU A;  3OO5 B;  1JL6 A;  3BOM A;  2ZLV A;  1HBR B;  1DXV A;  1VXD A;  3A59 B;  1JP9 A;  3PI8 A;  1MLS A;  3WFX A;  3A5B A;  1BZP A;  2MGI A;  1FN3 B;  4TWU A;  3OZU A;  4L7Y B;  1GDJ A;  1O1M A;  4MQH A;  1SHR B;  4U8U B;  1DWT A;  1O1O A;  1RPS B;  3MYM A;  5E83 A;  2BKM A;  1V9Q A;  2XKH A;  3LHB A;  1OUT A;  3A2G A;  5D1V A;  2DN3 B;  3QM5 A;  5EU2 A;  1HV4 B;  3G4V A;  1Y8W B;  2QSS B;  1BZ6 A;  1NS9 B;  1G0B B;  3D17 B;  1OFJ A;  3PI9 A;  2PGH B;  2R50 A;  1NZ4 A;  2ZS0 C;  107M A;  1O1J A;  4C44 A;  2WTG A;  2Z6N A;  2ZS1 D;  1J7W B;  1MOA A;  1FDH G;  1LHT A;  1ABW A;  1MYF A;  2HZ1 A;  5ILE A;  4G1B A;  2V1K A;  2G11 A;  1RVW B;  1RSE A;  4O2G A;  1JP8 A;  2MGC A;  1AJ9 B;  3UH5 A;  1MLU A;  5ILP A;  3S66 A;  1S6A A;  4B4Y A;  1J41 A;  1U7R A;  110M A;  2MGH A;  1A6K A;  3QQQ A;  1FLP A;  3D4X B;  1OJ6 A;  3WTG B;  1YGD A;  3UH3 A;  1CMY B;  4HRR A;  1HHO B;  4PNJ A;  1LFZ A;  1XZ2 B;  3E4N A;  1DLW A;  3UHR A;  1GCW A;  1RQA B;  3PT8 B;  4YU3 A;  1LFT B;  1V5H A;  5EYS A;  3AQ6 A;  1PBX A;  1KD2 A;  3GOU B;  3ZH0 A;  1X9F B;  1FSX B;  1CLS B;  1Y8I B;  3GYS A;  2BMM A;  3WCU B;  3IC0 A;  3ZJP A;  3RJN B;  1YH9 A;  1V07 A;  3BJ2 B;  3AT5 B;  3NFE B;  2DN3 A;  1OUU A;  3V2Z A;  1O1K B;  3A5A A;  2Z6T A;  1YEV B;  1IT3 A;  3UHW A;  1YMC A;  2B7H B;  1UX8 A;  3GLN A;  3SDH A;  1Y85 B;  1S69 A;  2MYD A;  5E29 A;  1J3Z A;  1Y7Z B;  1NQP B;  5D5R A;  4DC8 A;  2Z85 A;  4ROL A;  3HYU A;  4WJG A;  3GYS B;  1Y8I A;  1O1P A;  1V75 B;  4MBN A;  3LQD A;  3WCV B;  3NG6 A;  4MXL A;  5AB8 A;  3QJB B;  4XS0 A;  1YCB A;  5E29 B;  1UVY A;  4FC3 A;  2MGB A;  1HBA B;  1X9F C;  1BUW B;  1LTW A;  5CNE A;  3CIU A;  3ODQ A;  1XYE B;  4M4B A;  3QJC A;  2ZLT B;  103M A;  1A3N A;  3QM7 A;  3WCW B;  2W72 B;  1MBS A;  1LFQ A;  3G46 A;  2ZS0 A;  4TYX A;  3G4Y A;  4MQI B;  2ZSN A;  3GQR A;  1WMU A;  5HU6 A;  3HXN A;  1HBH B;  1Y0W A;  1X9F D;  1LFZ B;  2D60 B;  4F6I A;  1MYJ A;  3WHM A;  1HBH A;  1MLJ A;  1HBG A;  1NPG A;  1YOI A;  2DC3 A;  1TES A;  4C0N A;  1M6M A;  1HAB B;  2HBE A;  2HBD A;  2RI4 B;  3ZJR A;  2PGH A;  3UHD A;  4FH7 A;  1MKO A;  2YRS B;  3H58 A;  3UHC A;  1SWM A;  1Y4P B;  2R4W A;  1IBE B;  1UIW B;  2QSP A;  1Y4V A;  1A01 B;  1LFY B;  4NS2 A;  3ZJS A;  1Y83 A;  4B3W A;  3MJP A;  1HBS B;  1BZ0 A;  4KJT A;  2VRY A;  1FAW A;  4MQK B;  1YVT B;  1Y5K A;  1XZV A;  3EU1 B;  2EKT A;  4HSW A;  2Z8A A;  4MXK A;  1HAC A;  1MWB A;  4MBA A;  1DXT B;  3LB3 A;  2HBD B;  2MBW A;  2ZLV B;  2VLZ A;  4AVD A;  1Y8W A;  3ZJH A;  1A9W A;  1GVH A;  3NL7 A;  1HV4 A;  1VXF A;  1V4U B;  1Y4Q A;  2MGJ A;  4MQC A;  1ECD A;  2HBF A;  2OLP A;  3UHI A;  1IOP A;  4FWZ A;  1Y09 A;  2GNW A;  3FH9 B;  2NRL A;  3EOK B;  4ODC B;  4L7Y A;  1YG5 B;  112M A;  3D7O B;  2ZSX A;  1BZR A;  3AT5 A;  3UHG A;  2VEB A;  4NI0 B;  3PI8 B;  1JP6 A;  1S5Y A;  1MNH A;  1A3N B;  1QXE A;  2GDM A;  1GZX B;  2GKN A;  2SPO A;  1NZ3 A;  1X9F A;  1FDH A;  2AV3 A;  5C6E B;  1Y45 A;  1LFT A;  2GRZ A;  1YHE A;  2ZT0 A;  3M39 A;  4G51 B;  2GNV A;  1NS6 A;  1AJH A;  2D5X B;  3EOK A;  1FHJ A;  2NSR A;  4MPM A;  3LR7 A;  2HBF B;  1CMY A;  4HRR B;  3WTG A;  3VHB A;  1Y0A A;  3IC2 B;  1URV A;  3K8B A;  1Y4B A;  1V75 A;  1MYG A;  5MBA A;  3VRE B;  3HYU B;  1O1I A;  1RTE A;  3FS4 B;  1CH2 A;  4ZVA A;  1U7S A;  2MYC A;  2AUQ A;  3MKB B;  3QJE B;  1MTJ A;  3B75 A;  1ABY A;  1EMY A;  5JGG A;  5CN9 A;  2MHB A;  1CH3 A;  5SW7 B;  1YIH A;  3ZJQ A;  3MJP B;  1J7S A;  3VRG B;  1QXD A;  4HHB A;  2MHB B;  3BJ3 A;  5CMV A;  5AZR A;  4F6B A;  2SPM A;  1CG8 B;  2R4X A;  1IWH B;  1Y4V B;  1J7W A;  4WCH D;  1OUU B;  1BIJ A;  1UIW A;  4JAC A;  1QI8 A;  1MLG A;  1JZM A;  3UHQ A;  3FS4 A;  1T1N B;  3LR9 A;  1K0Y A;  3WCU A;  1HGC A;  5CHQ A;  4UUR A;  1Y4B B;  3ECZ A;  1V4X B;  3CY5 B;  3S1I A;  1BAB B;  2HZ3 A;  1MLN A;  2D2N C;  1HDB B;  3PEL B;  4H07 A;  106M A;  4NZI A;  3WHM B;  2D2M C;  2D5Z B;  1NIH B;  3PIA A;  2MYA A;  1S0H A;  3D1A A;  1R1X B;  3GQR B;  4MQH B;  2D2M B;  2ZSZ A;  1COH A;  1ECO A;  1HBB A;  1S5X A;  3S66 B;  3MYN A;  2BLH A;  2MGF A;  1LH5 A;  2W72 A;  2VYY A;  3A59 A;  2LHB A;  3QMA A;  3S1J A;  3OO5 A;  4F4O A;  1YE0 B;  1NIH A;  1CQX A;  3G4Q A;  3MBA A;  2ZFO D;  1LA6 A;  2W6W A;  1LFL A;  3ZJM A;  1VXE A;  1JWN A;  109M A;  4GZG A;  1MGN A;  1BBB B;  3BA2 A;  1LFV B;  1G0A B;  4X0L A;  2HHE A;  3V2V A;  2SPL A;  1F65 A;  3GQG A;  1I3D A;  3M3B A;  1JDO A;  2HHD B;  1Y5F A;  3D1K A;  4U8U D;  1G0B A;  1LH2 A;  3WFU A;  3G4R A;  4IRO B;  1CP0 A;  3QM9 A;  4YU4 A;  2XKI A;  2DN1 B;  3UHU A;  1RTX A;  1Y85 A;  1J7Y B;  4KMW A;  1DWR A;  1LUE A;  1J40 A;  1UFJ A;  1O1L A;  3U3E A;  3UHS A;  2NRM A;  5JGG B;  2FRF A;  3MKB A;  3QJE A;  3UH6 A;  1MYZ A;  3QM6 A;  1YFF B;  2QLS A;  1CH7 A;  5B85 A;  1MOC A;  1O1I B;  1HDA B;  3R5I A;  3ZJJ A;  5JDO F;  1GBU B;  1LH6 A;  1Y22 B;  2OHB A;  1V4W A;  2DN2 A;  1JL7 A;  5HY8 A;  1Y4R B;  3DHR B;  2JHO A;  1R1Y A;  1XXT A;  1GZX A;  2R1H B;  3E5I A;  3HHB A;  1H97 A;  1HDA A;  3BCQ A;  1DTI A;  2O5T X;  3VRF B;  3HF4 A;  2G10 A;  2LH3 A;  1YDZ A;  2LH5 A;  1A3O B;  1MLF A;  3LB4 A;  1Y4F A;  5C6Y A;  3ZJI A;  1K1K B;  5CN4 A;  1SI4 B;  2DHB A;  3FH9 A;  2O5M X;  3MVC A;  3GK9 A;  2HBS B;  3GDJ A;  1GDL A;  4IT8 A;  2AUP A;  3QJB A;  1YCA A;  5CNF A;  2ZT1 A;  3WCV A;  3ECL A;  2GTL B;  1QSI A;  1LH7 A;  4XDI A;  1DTM A;  3QJD B;  4WJG 1;  1CPW A;  3DUT B;  3TM3 A;  2EF2 A;  3UHK A;  2LH1 A;  2H8F B;  2G0S A;  2QU0 A;  2ZT2 A;  1G9V A;  1FAW B;  4MQK A;  1X46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...