5CO1A

Crystal structure of zebrafish protocadherin-19 ec3-4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
211
structure length
206
Chain Sequence
PVFDEPVYTVNVLENSPINTLVIDLNATDPGEVVYSFINFVSNLTKQMFKIDPKTGVITVNGVLDHEELHIHEIDVQAKDLGPNSIPAHCKVIVNVIDINDNAPEIKLLSENSEMVEVSENAPLGYVIALVRVSDNDSGANGKVQCRLQGNVPFRLNEFESFSTLLVDGRLDREQRDMYNLTILAEDSGYPPLRSSKSFAVKVTDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protocadherin-19 isoform 1
publication title Structural determinants of adhesion by Protocadherin-19 and implications for its role in epilepsy.
pubmed doi rcsb
source organism Danio rerio
molecule tags Cell adhesion
total genus 42
structure length 206
sequence length 211
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5co1A01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5co1A02
4APXA 3K5SA 4AQAA 4ZMOA 1OP4A 2OMWB 1FF5A 4AQEA 2QVIA 3MVSA 3QRBA 4ZMZA 4ZTEA 4QD2E 2WBXA 4NUQA 4ZMTA 2X2UA 3LNHA 2WHVA 2YSTA 4APXB 4AK1A 4NQQA 4ZMVA 4ZMPA 3K5RA 4AQEB 3FF8A 1NCIA 3LNDA 1SUHA 2A4EA 3LNIA 4ZMXA 1NCGA 4AXWA 5KJ4A 4ZMQA 4ZMNA 2WD0A 4OY9A 1NCJA 3LNEA 4NUPA 4NUMA 4AXWB 2OMYB 2OMZB 1WUZA 4ZMWA 3FF7A 1EDHA 1NCHA 3LNGA 4XXWC 1Q1PA 3Q2NA 3UBGA 2EE0A 1ZXKA 3Q2VA 5JYLA 2OMTB 3Q2WA 5JYMA 1O6SB 2OMXB 4AQ8C 3K6IA 1L3WA 1WYJA 2O72A 4ZI8A 3UBFA 3LNFA 4XXWA 5DZVA 3UBHA 3K6DA 2YQGA 2V37A 1ZVNA 3K6FA 4ZT1A 2WCPA 5CZRA 2QVFB 4ZMYA 3PPEA 4AQ8A 4AQAB 3Q2LA 4ZMLA 2OMVB 2OMUB 2A4CA 5CO1A
chains in the Genus database with same CATH superfamily
3OKNB 1T4KB 2K9UA 4UZGA 1HHJA 2Y7OA 3QIBB 2JCCF 4FFWD 2XBTA 4ETYA 5FUCC 4L5FE 3O3AA 3MVSA 4NI6A 1JWMA 3QRBA 5EBGA 5KVGE 3SPCA 1LYQA 3WXWH 1YEJH 4UOJA 3IWUA 2EDWA 4X0NA 4ETQA 2ZYHA 1U3YA 5LXGL 4RWYL 5DYOB 4YGVB 2VXVL 2WO3B 2DQJL 2R0KH 4Y5XC 2GSGA 1FJ1A 1HE7A 1NUFA 3QCVL 4UBDD 2O4EA 3GSNB 5CU5A 3W9DB 5B8CB 2DIJA 2WLZA 3VFWB 4CMMA 1DQKA 4Y2DB 2MQCA 2YUVA 3QQDB 3BN9C 4AIEA 1CO1A 2APSA 4L37B 2EVIA 5C07D 4IMKC 3FTVA 3N3EA 3SO3C 4MQ7B 3UEZA 3LPOA 4B50A 2C3WA 3S9DB 5CIPA 3VXMA 2CIKA 3LD8B 1WFMA 2LLNA 1H3TA 3LCYA 3EJYC 3ME0B 4XNQB 3DV4A 3O2DL 5E2VH 5FB8B 4ZUWB 3EDFA 5C9KA 1A7PL 1FLTX 3GZPA 1DO6A 2E46A 4OQTL 4Y88A 1U93B 1NA8A 1RIVH 3S4SG 4EI6B 2J25A 2EIKB 1UB5B 5KANI 1QWUA 5EUOB 1MW1A 3IGUA 2QQKL 4OB5L 5INCA 1E4WL 1XH2A 4HUCA 4PWHA 1AO7A 4G6JH 1QG3A 5C0CA 5IMOA 1F4WH 3DO4A 3TV3L 1U9KA 1EXHA 1SRDA 2LHAA 1BJ8A 1IBFA 2V0AA 5FYJE 2G30A 3LVEA 3MYZA 3RFRA 1M3JA 4BK5A 4XP4L 2OMTB 3ZVVA 1OAUH 2A0LC 4MYPA 4CRPA 2VC2H 3CWGA 3O3DA 1YECL 1T2QH 1LP9B 2WB1A 3FTYA 5FYKD 5AVYB 1EDQA 3HKZA 1J9RA 4DP4X 1QBBA 4RMQA 2OM5A 2EICA 3QJHB 1DL7L 4J4PC 4LLVB 1ZDQA 5E08L 3UO1L 4JHAH 3EYOA 3BEWA 4PJGA 2C3XA 4IKLA 4IW4C 4LAQH 2VIRB 2XZCH 4YHYB 2XPZA 1CTNA 1D7DA 3DWTA 1SJEB 1E3XA 1A4CA 2FATH 4U4IA 2IF7A 5LCVA 4J8QA 4KNQA 5LGJA 4QRAA 2WANA 2GTWA 4ACTA 3WSQH 3MJ9H 4D7PA 3B83A 4AIXA 5C09E 1P84J 2VO8A 3FB7B 1CXIA 4OVVA 4DNLA 4GQ9H 2XT1B 2E8ZA 3GMOA 2X41A 5J11B 3S6CA 5I1EH 5GISH 1NCCH 3LN4B 1QWNA 4WFGE 5BW7C 5D5MB 2WWNA 3JVGC 5CP7B 2BSED 1XEDA 4YDJA 3IAGC 3BKCL 3KLHD 1JGEA 4K3EH 3KYMA 3P3TA 4I1NB 1AOHA 3SKNB 1L9QA 1MVUA 5E8NA 3HUJA 3UH8A 1CMOA 3SCMC 2GI7A 2XWXA 5C9JB 4GS7B 1OAQH 3FN0L 15C8L 3FU0A 2FH8A 2L7EA 2HN7A 5D1XA 1ZHBA 3WI9A 2CDGB 1CLVA 1QFUL 2CGZA 3ECQA 3WG7B 5F7WC 3T5WA 4ELMF 1JPGA 4K7PH 3T71A 3SDXA 3BP6A 1QBLH 4X4XB 1EHKB 5CJXA 4PRDB 5IB5B 3CFJA 1RXLA 1S5IL 3JVFC 4PAZA 3ARBD 2YAFA 1IZJA 4Q74A 3RQ3A 1MCEA 4N86A 1BZ8A 32C2B 3HC2A 1CK0H 1ETJA 1L9PA 2GHZA 2Q76A 2YPVL 4PB0L 1R5VA 2E3VA 1SDDA 3E6FA 3X11A 3KLKA 2OXGA 4DQOH 5PCYA 4JDZB 4LARH 5K9KA 2F53D 3L48A 4O58H 1UTDA 4Y19B 1B0IA 2GTQA 5JW5B 5HDWA 3L1GA 4X6FB 5CGTA 3T8XB 4HLEA 5I15H 2I9TB 1A7OH 1MLCB 3TS8A 2W9EH 4KHTL 3RWEA 4ZZKA 3WKML 4WWPA 3LDBC 4OGXL 4IEFB 4ZZFA 4G9FD 4DGWC 1QFWL 3CGTA 1SN0A 3M86A 3WN5B 1CDCA 4FCAA 2QSVA 1IVTA 4PP1C 4N0YH 4OCLC 2XN1A 4G8FB 4DETA 4NI3A 3HC3L 3GTNA 4RZKA 1X5GA 1X6NA 5DUBB 4U2ZA 1WICA 4AZ8B 1T6BX 5KSUA 4J7RA 1BFSA 4RZCA 1QACA 5DA4A 3UTZA 2EYSA 3QG6B 2F18A 2NY0C 4PRHE 2QZQA 4FQIL 3C60C 1KYUA 4WWKA 2YQ3A 4FQLH 3L54A 4XNBA 5GZNC 1JN6B 1K3ZA 3P0VH 4BEIA 4A2EA 1RK0A 2WM0A 4Z8FL 2OL3B 4C59B 1GIGH 1RVFL 4ECNA 2A0LD 3T4AB 1BEYH 1CE1H 2BLFA 2CQVA 3B5GA 2PMZA 4H88L 4AQ1A 1Y1DA 3ARDB 2R69H 1FHGA 2PP8A 3MV9D 4YHLH 3CVHB 4MA8L 3LB6C 1SOKA 5KVEE 3WKNA 2CD0A 4E36A 2O5XH 2NX5B 1OGTA 4DPRA 1Q4NX 5ESAB 5BQ7A 1OCCB 1KLUB 3OLGA 2AMUA 4RIRB 3WJMA 1KN2H 2FJHA 2IGFH 3FK3A 1MF2L 3AY2A 4QRPB 2DD8L 1R3IH 2VLLB 5B38G 1IL1A 1VDGA 2BIMA 4YHIA 4LCWE 3F04A 2EH8H 4O4YH 1JHTA 4WUUB 2YSSA 1RLWA 1U4EA 5JOFA 4JRWA 1WVZA 3OPZH 3EZJB 5D7LD 2P48B 4W9FC 5AG9A 1TVBA 4NCC1 3DSFL 5IFHH 2X4SB 5I71B 1U8CB 3AREA 1KCUL 3U7AA 3PV6B 4GINA 2IAND 1GPOL 3V9CA 5ICZB 4LESA 4P9HH 4QOKA 2YEZA 2BINA 2X7LA 4BK8A 4H8WH 4NN6C 1PLCA 2XG5A 1MCPH 4FQQB 1QLEB 4NC2B 2VE6A 1ZOXA 5DRZA 2WXQA 5LAPA 4HLZH 2G0KA 3B43A 1BPLB 5DJZA 2JH2A 3DX7A 2WD0A 2OQJA 1OGAB 4MJ5A 2Z31D 1EVTC 1IC5H 1ESOA 2Y06L 3U48A 3V9FA 4FYQA 3TYGL 1AZRA 4M1GH 3KR3H 2CA4A 1Z9PA 2Y2WA 3ZHNA 2XQBL 3FT9A 1ZS8A 3MRHA 4MKMA 3K71A 4P8QA 2Z91B 4I3SH 1A1OB 1VJSA 4LNRB 4PR5A 1IAOB 2IEPA 5F7YC 4WJKB 3S96B 3UABA 5I0WA 2Z35B 4DK5A 3LRLA 2CLVB 3O0RL 1G7PB 3L3OA 5E4EC 6FABH 1RZFH 5B4MD 2DWSA 1A14L 2XTSA 4OU3A 1NM4A 4QHMB 3MBXH 2K7PA 4HBCH 4OLZL 5T1DH 2J88H 3WDJA 4LCCC 5JPNC 5AQ0A 3LZFL 3ZKQD 4C83B 1I3RB 5J3HC 5F1SA 1EBAA 2XTJE 4NUJB 3NZHH 1ONQB 2YBGA 4G7YH 4YXKH 4AUYA 5J6SA 2AXFB 1J5CA 5FS5A 1XF1A 3HS0C 5EN2A 3QUYB 2YK1L 5D7IF 2N59A 1QNIA 3VFRB 2XQYG 1MI5B 4N85A 5CSZB 5DQ9B 5FW8A 2Y69B 4W9LC 2VDOL 2VDQH 3HS9A 3JWNE 5HVHC 3KPSD 1EJOH 2VLJD 1GCYA 3C08L 4NLAA 3P2TA 1MIML 3ZGIA 4LLWA 3F5WA 5JHAA 5C0FA 2RA1A 1S9KC 5FV2A 1XSJA 5EEWA 4GT7A 3CQFA 4ZDHA 2NZIA 4ZMZA 3Q2CA 3UC2A 1LO3H 1KG0B 1T2XA 2VXUL 4G8IA 5CHNB 2Y07L 3LB6D 4POZD 3FN9A 3HAEB 2QADC 2JJSA 3GRGA 5E8DH 5KS9B 2JKXA 1V3LA 3N40P 1BBJB 3L4YA 4YXHH 5TDPA 4LU5H 4Y5YB 4HIIA 4LRIC 3KMDA 1MHPH 2GITB 4HUNB 2RALA 3CXDL 3PV7A 4WHYG 5GGVL 3K3QA 4WQOA 2FEEL 4CA4A 5F3BB 3BUDA 1QFWM 3WY4A 3L1OL 1GGTA 5DD6B 4ZFOA 2AMGA 4AVHA 3A5VA 3OSVA 1UZ6F 3P3RA 5DSCB 3SBQA 4R97B 5FGSA 5DHYB 3CJJA 1J9CT 1UJ3C 3W11D 4JPIA 5HYSB 3ZE0F 1UACL 1Q94A 5AZEL 3QG7H 4GI6A 3D3VB 1JUFA 2B5IC 3LS5L 4FHJA 2P24B 5LDSA 1V7ML 3PWPB 4ZOAA 5C7ZA 1TDQA 1F8TL 3BPOB 5IMKA 3MGOA 5K93A 4OFKA 2F6AA 3S37X 3FQTA 1HNYA 5L0QC 1KPRA 3RTLA 1F42A 4GRWE 2D03H 3HE6A 5KYYA 1UWXK 5HDRA 1AIZA 3KPRD 4JO3H 2FD6H 2H32H 4RDBA 4L0YA 3OKMA 1N0LA 4JKWA 4KX9A 5TH2B 3UP6A 2CRMA 4A37A 2DQFA 1Z32X 1CLZL 3P11H 2QPUA 4TNEA 3S88L 1IGFL 4X80H 4HOXA 1NPNA 2JI3A 4HZAA 2JXMA 4WTQA 5DK2A 3QCTH 2VLMD 5CN2A 4WUKH 2F2HA 2D9CA 5E2UL 3SO3B 3P02A 4QXGL 1AR1C 4IRZH 3FCBA 5TGBA 3VGFA 1F4XL 4PFEA 3BVWA 1EAPB 1UXLA 5I74C 5EF2A 4J5VA 3MCKB 4L9LC 5T3XE 4LF3A 1E7VA 3HMXL 3L95B 4IRJA 4IJ3B 4FMFA 1ODUA 2SEBA 1CURA 2N7BA 3PP4L 3QPXH 1AGCA 4NP4H 5B39B 2WVVB 2OMBA 5J3HD 2NNRA 1EFXD 5ACZB 2GAZB 1GZQB 3DO7A 1JPFB 1H3XA 2HT2C 4JFVA 3TCLB 1BZOA 5IMMA 4KMTH 1X5FA 2GB2A 3GSQA 3BOVA 3Q6GL 5E1AB 1A7QH 4D8OA 3SPHA 3DHPA 3NCJL 2R27A 1QSEE 1U58B 2UYLA 3G6DH 4EAEA 3FQXA 5HGBB 1UADC 1HWHB 4JFYB 3EBGA 3M7FB 5CCKH 4L3EE 2AV7B 2BVTA 1S7TA 3QDJE 2VQUA 5DUML 5L7XL 2RCSH 3QFJA 4OKVA 3WNPA 2EKJA 2GUYA 4JS7A 3H4FA 4XVTH 1TJIL 3PJSA 2FZ3A 3TZVC 3EXLA 4Z3HA 1AJ7H 3KAAA 1G6RA 1LK3L 2AJXH 2ZKMX 3QRLA 2IBBA 4KKRA 5HHMD 4V2CB 1IEAA 1EVUA 2F58L 5MI0B 4MAUH 1I1FB 3CHRA 5T1KB 5JHDD 4AT6A 1IM3A 2HTKC 3BWAB 3QUMA 4XVSH 2VR9A 2QADD 3CK0H 3FC8A 2V2WB 4LCYB 2ZIDA 1EAOA 4ZOBA 4QRSA 4DFIA 3WNLA 4RFNC 4FFVD 1ZVYA 3H2PA 2DI9A 2EILB 4ZMNA 4PREB 2JKNA 3L81A 2WWMD 5SWZB 1Q1JH 3QCUL 4XXCC 5JW4N 3B8YA 4M3KB 3SCMB 3U2SB 3UYPB 5C0RH 4FQ1H 1LEKA 1SN2A 2UWEE 2XVGA 3ZKMC 2FHBA 1RUMH 4XWOD 1TCRB 3N85H 4PJIF 5TJWK 3TJEH 3BUQA 1ZLEA 2XCMC 3FTSA 2B7DT 2Z3FA 4MAYC 5I73C 2DJ4A 4GP4B 1FE8L 3SD2A 2NMSA 3MLSH 3LNGA 1E6JL 3QWOA 1KB9K 4OJCA 2YMTA 5E6ZA 2F19L 1IIIA 2V5RA 2XLLA 2YUWA 4OJYA 3V4VH 4B27A 1BXUA 2ZP0T 3QAZC 2XN9A 4PGCA 5GPRA 1C8PA 4FYSA 3MBWB 1KCSH 4NM8L 4MQTB 1F13A 5E5MA 3LH8A 3IVKB 4NKOB 4WV1B 2BSCA 1T7YA 3SGEH 5IB4B 3FB5B 3TESA 4ALAC 4LLAA 4MASA 4QKTA 3CN0A 1PCXA 3QGVA 4HS3B 4OT1H 4Y5VB 2E76C 2DQMA 1KBGH 3JUYA 3JWNG 5EDXA 1ULVA 4BIKA 1U8IB 1EXUB 2UZYA 3ZYOA 5KG9A 2D7TH 3GK8H 1EZVY 5DT1L 4F2ME 4MJ6B 1UD3A 3LXCA 4LASH 2XPGA 3C87A 3LDBB 1AR1D 4XHJC 4LQFL 2PWGA 3PDOA 2PWHA 5D2NA 2P52A 1G0XA 4AYMC 3QZOA 4QRFA 1JF6A 3DV6A 1MCNA 1WT5C 4DN3H 5ITFA 4L1TA 4BFIB 5DR5H 3EHBC 4FG6C 2J1KA 4H44C 2FQDA 2EIEA 2L4OA 5B21A 4YX2L 3LKSB 1U95B 4KAQL 5FKAB 2VDKH 3R0MA 4N2DA 1FO0L 4WKZA 3LXUX 3B9KC 2VISB 5SWSA 4EN3A 1HNGA 2NY0B 4LLYB 4JMXA 1UWGL 3C60B 2I60H 2NSQA 3FOMB 1D6VL 3V7AG 1W8EA 3ZZ1A 3C6LA 1MFBH 2CO4A 4I48A 2HT2D 4LSRH 4GKZB 4BQ9A 5KVDH 5IHUH 1R3KB 1ZY9A 5HGHA 4JFXA 5BV7C 2IQ9H 2XKSA 4K8RL 1Q0YH 4QHUB 3SKOB 2Y5TA 1OP3K 1TENA 3ZYIA 4XCNB 3O2WH 2IG2L 1RZJL 3BWSA 4JREB 3DUUA 3P9LA 2HH0L 3ZPDA 3OHXC 4URTB 2YEQA 2YUXA 3V5KB 1CDGA 2CMRL 2X3AA 3HLKA 4Q9RH 4ODSL 5F7LB 5DD3L 2J4WH 4H8VA 4Z7QB 2R7EA 4KQ4H 3ISRA 8FABB 5ESVB 1FZMA 1XIWC 5AKVA 1UT9A 4LSVH 4PJBE 5D2LF 1ZV2A 5E8OA 5ENWA 4A6YB 1OPGH 3J2PA 4RSVA 2RFXB 2P5WD 1OLZA 1QA9A 5DEFA 5E0QA 1OM3L 5MEPA 1KPUA 2H45A 4RX4D 5FHAH 2KUTA 2HTKD 3ZXAC 2DI7A 4GG6A 5DA0B 4XAWL 1ZSDA 5FYKH 2OMZB 4WO4A 5D71L 2UY6A 3HIZA 4M29A 3L1EA 1A3LL 5IF0B 1NEUA 3BGFC 4P4KC 3RGVC 4DZBA 2G3NA 5KSBE 3MLZL 2XN0A 1EUTA 1YN6A 7FABH 3QH3B 4LSSL 4WI8A 2WN2A 3OAYH 4Y1AA 2HFFA 4HIPA 4AQ8C 1GJIA 2IOMA 5BZXA 4L4TA 3ZKMD 5GGSY 2W80C 3B6SA 4LSPL 4M6AA 2PWDA 4NSKB 3WEXB 4HH9A 4MAYD 1KT2B 4JDEB 4J6IA 1E5BA 2BVQA 5F6HI 4JN1L 1UXWB 2WXNA 3GHBH 3X2QB 4TM9A 4UYQA 4DP2X 3BZEA 4NERA 3GBNL 5I1CL 4Z7UE 2OMWA 2DQIH 1R4XA 2V5YA 5D4JA 3RAJL 1FNGA 3WLWC 1Q9WA 1ACZA 2JI2A 3AAZA 2WLIA 5FHBH 1SXAA 1ORSB 2DDQH 4PJ5D 1ES0A 2A1WL 1WS7A 4OJFL 1NBZB 4UIMA 4APXA 1TJGL 1JIBA 1QKZL 1D7FA 4K5MA 1LK2A 2AJ3A 2Z0UA 5A16B 3RWCA 4EBQL 4EOWH 3N91A 5MERA 1TETH 1TZGH 3BEVB 1QSFD 1BXXA 1A6TB 3SDAB 2FO1A 2HKFL 1G7HB 4NPJA 4G80B 2QSQA 3EKCA 1YYLH 1K6QH 4LPWA 4IU2B 3IJEB 2AK1H 2KLSA 2FDBP 1MJJB 4XHJD 4AEFA 4NZTH 5I0VA 3B2DC 3EH4B 5C08D 1L9NA 1WD8A 3HC4H 4IMLA 2FR4A 3QEGL 4BXSV 4YEFA 5A43C 4WFFE 2BOCB 1HXKA 4EI5B 5FW6A 2ZX9A 3FMGL 3D1MC 3EHBD 4FG6D 4QIRA 3FCSA 1UKQA 3HB3B 1UC6A 3LNIA 5AYTA 4EI0A 3B9KD 3FNKA 3T3MB 3ZTJG 4RMVA 5E5UB 2EAEA 5C0AD 2EDMA 2J8UA 5EHFA 2QPSA 1OAYL 1JVLA 3NPSC 5J6HB 5LXGH 2JB6A 4RWYH 2LAAA 4HHWA 2VXVH 4LPCA 2DQJH 1XB8A 4MCMA 4M6OL 3STLA 3CC1A 3GNML 3QCVH 4BZ2A 1YG9A 1CICC 1J8HE 5HHMB 5IVXA 4L0ZA 3BUIA 4UT9A 2ITDB 1HSBB 2IVFC 1IKNA 2LOEA 4EUPA 2AJZB 1G7JB 4QAMB 3DIVA 4DF9A 2NYKA 3IJHA 4M1DL 5I9QB 4JHBA 3DOSB 3MJGX 5I1IL 2V9UA 3T8VA 3T0AA 5FYJU 5GXBB 5DD5L 5AW3B 3GUTB 1XIWD 2WCGA 3UBXG 2VW4A 4TPRL 1BIHA 3V6ZB 2YO3A 1XF4A 1I3UA 2EDKA 5I8EB 2FT8A 3HHSB 3I6SA 3O2DH 1M05A 1JZJA 5D1ZB 4AIOA 1A7PH 4OQTH 2CKNA 4K8RD 2XZZA 1AG0A 4G7QB 4JQIL 5KOVC 3IDIB 1C16A 4PLJC 1HC1A 3DX8B 2OYMA 5SV4A 1ZHLA 2PW1A 2EDOA 2QQKH 3IMWA 2HLEB 3KEDA 4OB5H 1E4WH 5DGQA 5JNYA 5KZCB 1I53A 3W0WA 2AK4A 1UA7A 3KLDA 3RGVD 1UOLA 3TV3H 5AZ2L 4W9DC 2V37A 1AIFA 2E4TA 3MMEA 3TPKA 2PCFA 1O7SA 2V7NA 4XP4H 5EU4B 3RX8A 5JIMA 4AW7A 3HHMA 2FUQA 2PCYA 3LOWA 3UJJL 5EF0A 1YECH 1N2RA 3X12B 1BMGA 4K5OA 5F7NC 2G4GA 2EEAA 3MR9B 1DL7H 2W0FA 5E08H 2VLKE 4ZAKD 3UO1H 2X09A 4OUOA 1WS8A 2KZBA 5DI8B 1IV8A 4YGAB 5CCHE 2A7BA 1DN2A 3FRPB 3ARFD 4E41A 3IMTA 3NVQA 2ZPKL 3HZVA 3QDGD 1TZHB 4DOHE 2EEXA 1HIML 3D5OF 1G5GA 3KJ6L 1EANA 1S9VB 1J5OL 3VTAA 3A6CL 4WW2A 3X3GL 4L9LB 4EKXA 1C08A 4AUUA 5INDB 2ICWA 4JKMA 1WSST 1F56A 1MRCL 1MCDA 3BKCH 2QHLA 1AQDA 1U8JA 5DDHB 5I6PA 3L3DB 4KFZC 2ZWSA 4U1KA 1WC7A 3O8XC 3FN0H 4HXBL 15C8H 3WELA 2OMYA 4TN9A 2ZSVB 4P2RA 1QFUH 5FUOL 3V0VB 2P5EE 1AD0A 4X0KA 3EJJX 5DXWA 3L2MA 2C9UA 3K8KA 5LG6A 4HLZG 3PUUA 4FXGA 2JB5H 2BIQA 1N12A 3BAWA 1B0GA 2YPLD 5CU9A 5IHWA 4TNGA 3HUJF 3FFCE 1S5IH 1G9NC 1H8NA 1O6SA 2RQEA 4L4VB 5BZWB 4A7SA 4UQEA 1F4AA 1DBJL 3TZVB 2N4IA 3HPJB 3O6FB 3O4OC 4HMDA 2PKDA 3FSZA 2YPVH 4PB0H 5IV2A 4TS6A 1CICD 4Z7WA 3WNIA 5EZLB 4X6EA 3SBWA 3SDXF 4TQHA 5DVKA 3C9NA 1YYML 2CR6A 2F8OA 2DN7A 1JD9A 4XXDB 1CBVL 3P4OB 4C4UA 5CZVL 2BM3A 4KHTH 3FQWA 3WKMH 4OGXH 1PAZA 2YKKA 4QTHA 5KYWA 1MG3C 2ATPA 1QFWH 5GS0C 3O3EA 4NZFA 3DTDA 2BNRE 4JY5L 1YAZA 1WZAA 2SODB 1MAJA 1XDTT 2WBJA 4ZUUB 3HC3H 4BWTA 2BHUA 4WUUE 1PW3A 3DRTA 4F93B 4AITA 2EH7L 3L5WA 2H2SC 5I73B 3HZYA 4JG1L 5E1QA 1PG7X 1LWJA 4IBTA 4FQIH 3UG4A 1ZPUA 1JZ5A 3FTXA 4P06A 1BQUA 4PTTB 1LE5B 3AADB 3BP5B 1DQML 1J1PL 1KLFA 1MIEL 2B16A 2X4NA 4LPYA 5HDLA 3VA6A 4HSAC 3T3PE 1I82A 3KG5A 4ZS6C 3CD4A 2FBJL 4Z8FH 1RVFH 3A47A 4KV5E 3KXFD 2WKOA 2IXQA 3BIKA 5D1ZI 1A02N 2B59A 4H88H 1FYHB 3CMOL 3EGDB 1BX2A 1CT8B 4M48L 3ZDZF 1UATA 4LCIL 4I2XA 4MA8H 1T04B 2DL2A 3ZDYB 5K9OB 3Q5TA 4W93A 1VFAA 4OZHE 4O2EA 4GW4B 5AW7B 4JCLA 4BK5C 5AOLA 3RWDB 1EWHA 4WEBL 1CXHA 4M61A 3AG4B 2FEDC 1MF2H 2GIXA 1PDKA 1IKFL 1HX0A 1V05A 2DD8H 4PY7B 2WTRA 3S48A 4UZUA 3KGSA 3KYNB 5C07E 4BQBA 5I6XB 1NDMA 4EDWL 4AJ0A 1NJ9A 2NXYB 3J27A 1UH2A 5HYIA 2FYYB 2WAQA 1M4KA 2APBA 4XH2A 5KVDE 2JK5B 4XE0A 1B4LA 3TC9A 2FAUA 3DSFH 1T03L 4WFED 1KCUH 5F3FA 1KEGL 1GPOH 3TNMB 3G5YB 1AZUA 3VRIA 5HHOD 4OY9A 4D8PB 2DMHA 5I8OL 5LGHL 1ACYL 5D1QA 5BXFA 4S10A 5BNXD 2VW6A 3R1GL 2VQ1B 2R23A 3CLFL 3O8XD 4UTBA 5DEZA 3J7HA 2NNXA 2A4ZA 2Q8AL 1A7BA 3ZUCA 2YKLL 3CFMA 3N9GL 5F72S 1K8IB 3L5JA 5CR1A 1R24B 5ISZD 4OI7A 1ZLWH 5BRZB 3IDNB 4HKBB 4ZUSB 1MUJA 3H85A 1XGUB 4PJEB 4ZSOE 1RJYA 4E0RB 2O26U 3ZGHA 4FNTA 3ULUL 1T1WB 4MMZB 1AVAA 2Y06H 3OHXB 3FB8B 5CMAA 5FYKE 3TYGH 1R1CA 2I24N 3SQRA 3NFSL 2E86A 2B9BA 1TJHL 2FTAA 2OXHA 4FABL 1LDPL 1BFVL 2XQBH 3TA3B 4GSUA 1XIWB 4JFSA 3FH5A 1L4IA 2X6VA 2YD5A 3O0RH 1FZKA 4HEPG 5CJXC 4FA6A 1QVOA 2FGWL 3GS4A 2ZX8A 1A14H 1G4RA 2GUOB 2EZ0C 2WCPA 4PJ6A 3QFDA 4OLZH 2V8LA 3BCFA 3MGTA 4XBPA 4YZWA 4P5KA 3A24A 3LZFH 1GS8A 3QJXA 1EPFA 1PLGL 2X4RA 5E7BA 5C0JB 2W5PA 2CDEB 4HWUA 1QRNA 1JVKA 2BERA 1QHOA 5C0IB 3BGFB 4P4KB 4IKJA 3V8OA 5GS0D 4DESA 5KUKA 3FT4A 2KH2B 5L8JB 2YK1H 3M1BA 1YDPB 4W9ZA 2HB0A 4CILA 1E4XL 4NQUA 2KHAA 3KVPA 5LN8A 5EO9B 2XJKA 3AQXA 2VDOH 3VXMD 5GGUA 1E27B 2X4OB 3MV8A 1WA1X 3C08H 5ICXA 1MIMH 3MUZ1 3DX1A 4LE8A 3BDXA 3ARRA 3NFNB 4YE0A 5LB1A 2WK2A 3I9IA 4MDRA 1TTAA 5IW1B 1OLLA 1HT6A 3DTUB 1AZZC 4YHKL 2QV4A 2FO4A 3HLAA 4HC1A 5BVJB 3PP3H 3PWUA 3LRSA 4F33B 1N19A 3T0EC 4JG5A 3EYFB 2VXUH 4ORGA 4WWKC 2EO9A 1AO7D 1NGYA 5C0CD 5LLIC 2Y07H 2VERA 4XX5A 5ID1A 2Z7ZA 2Q10A 2DLGA 4R5VA 4ANKA 2EEFA 5I5JA 4AV0A 2E7HA 4CDGC 3FAXA 2F53E 3NRQA 2Q7YB 3O2VH 1BZ7B 3CXDH 5GGVH 3VXTA 1QEWB 5HY9B 4E9SA 2H26B 5DVNA 1HWGB 2OSLB 3EH1A 1T89A 1HCZA 5KUMA 1KCWA 5C2UB 4CN4A 4XI5C 3L1OH 4R3SB 1XSOA 3ABKB 3VXSB 3P9MA 3NEXA 4G9FE 1OQXA 1VHPA 2C1PB 3ZDWA 2AJUL 1UACH 5ID0B 2KDYA 1T1XA 2GBVA 5AZEH 3CXHK 43CAA 1BM7A 1E50A 1JWSB 1DE4A 4UM8A 3SPVB 4X6CE 3LS5H 3IETB 1V7MH 2J72A 4K9EC 1F8TH 4PW3A 1BAWA 2IH8A 3N1FC 4E9LA 1D5XA 4CN6A 2OMXB 1FI8C 1FZJB 3H9HB 4QGTA 3NPSB 5BOJA 4E68A 1M6UA 3MNWA 1IEHA 1FZOA 3AREC 5J12B 3FS9A 2G9KA 3QJQB 5T33L 3C2SA 3PHAA 2I07B 3C5JB 1URLA 3QZMA 3PY9A 1CICB 1CDUA 3TBSA 1NKGA 4JDVA 4W9KC 4IDJL 5IM7B 1CLZH 2K45A 2G3ZA 3S88H 5E6YA 1TMCB 3SE9L 1IGFH 2LU7A 2NRDA 2E59A 3MUHL 3MV9E 4AYEC 2NPLX 4IHOB 3HW7A 4OUUB 2PYEA 5D1XD 4AGOA 4F9PA 1QLFB 2NDGA 1HEZA 5E2UH 2XFXA 5EG6C 5B22A 3U6XS 4QXGH 4NHCL 5ANMB 1YSOA 4Y2LA 3G5ZA 3D08A 1F4XH 1WBZB 2G0LA 4XB7A 1KYOJ 2VAAB 5GS3A 1VFBB 4NYLA 2XTLA 3HMXH 3SYQA 5K33A 1ETZA 1M1SA 5FEBA 4GIOA 3PP4H 2B0SL 5IIEA 2P43B 3NCBB 2ZAIA 1TPXB 5D7LE 2WKGA 2X2UA 1DDHB 4ZNCD 3D2UA 4JJ5B 3L3OC 3N40F 1RFDL 1NEZG 2A6KB 1WPCA 2VL5A 5IROD 1FGVL 3CFKA 5LDUA 3CMGA 3Q6GH 3CV5A 4DPAX 4ZW3A 1IGML 3LPGA 3NCJH 1TKWA 5JQ6L 1KZYA 5KJ7E 2R0LL 3T6QC 2JCCE 1G94A 1YJDL 2GIMA 3H7BA 2OZ4A 3T04D 1VAHA 2VN5A 1CYWA 4B6ZA 4TLKA 1S5HB 3QNXB 5DUMH 1U8PB 2BRQA 5L7XH 3HVNA 2O6EA 3QUGA 4R7DA 4QHLB 1TJIH 4LHUB 1EIBA 3DIFA 1MXGA 1NGQL 5LO7A 4YN3A 1KPVA 3JV6A 4PUBL 3WFEL 4BUHA 1L9TA 4M02A 1LK3H 2GK0B 4FOMA 5I8KH 1H6UA 4P59L 1FNFA 2MCG1 4HSCX 2F58H 1I9EA 4WWKD 4HCGA 3K4ZA 3DBXB 4UNVA 3T6XA 2CUIA 3LVTA 1QLRA 1T7WA 2I69A 3NIGB 3RYMA 3SBPA 3IMRA 2GFBA 3OJVC 5LJYH 3QXWA 4JO1L 3HRZA 4ZFOL 4I18B 5IK3A 4PLNC 4IKNA 1P84K 1OPOA 4QXTB 3QCUH 2Z7UA 1N26A 2JJSC 2W8CA 4XI5D 4C55A 1OOWA 4WI5A 1RHFA 4HJTA 2MNJB 2BVYA 3MX0A 4TULL 3M7OA 4IDLA 4ABWA 2VQ4A 2EE2A 4MJJA 2H9GA 2OMUA 2XA8L 2NLJB 1FE8H 4AYFB 1E6JH 1PX3A 3B3IA 3ATBA 4YIQA 2F19H 5JUEL 1T22B 5AW5B 3UAJC 1XH3B 2ZYRA 3L3IB 2VABB 2VDQB 2YD2A 4HJGB 1IX2A 3D30A 1P4LB 3NTCL 3GSRA 1OARL 1F45A 4J28A 4JM4L 5E6UB 1E5YA 1XGTA 4PMFA 3MV01 3KPSE 5HYJA 1CGXA 3FQ1A 1LMIA 2VLJE 3VI4A 3EYUL 4KKAC 3BPCB 5FOBB 3ARED 3O4OB 4JFFB 5I8CA 1FH2A 1NDGB 4QOKD 1ZKAA 3BZFA 2H41A 3QYNA 2YWYA 3LSOB 1TVDA 5C0GB 1DJHA 3G6JA 3EAKA 1K4CA 5DJ8A 1MCCA 2EDRA 2YD8A 3MYJA 3HE6C 2I27N 5DT1H 2P8MB 4G71B 5DK0B 2WNWA 1Q9LB 3VRLF 1D5ZA 4OFPA 4LT7A 1BQKA 1JF1A 2J5WA 3RI5F 3TONA 4LQFH 3PPSA 4NEHB 1Z7JA 3TN0A 5C0NC 1NBCA 3NCWA 4NWUL 3GXNA 1GVIA 4HISA 3WLBB 1WCBB 3IDUA 4DFHA 1KJMA 3LKRB 4GKSA 4R2GC 2AXJA 3M17A 3U25A 1EXGA 1NGXB 1O6VA 4PGEB 4YBLB 4YX2H 4MTMA 2A6DA 1N67A 3IN2A 4KAQH 5AW2B 3RX7A 1FO0H 2JCWA 2NW2A 3D12B 3ROLA 4KROC 3VXMB 5HJGA 3VB9A 1UWGH 1W15A 4KK6D 1D6VH 4G5ZL 3GXMA 4LKCB 2R15A 4YDVA 3AC0A 3EJQA 3IAQA 4IRJC 3NH7L 2Q87A 5EN3A 5IB2A 3BGMB 1BWMA 5I17B 2BIPA 4K8RH 2H32B 4DK3A 3FCGA 4UB0L 4ELME 1HI6A 2EXYC 2WBKA 2IG2H 1RZJH 2ZUSA 3HBZA 3KPRE 3L17A 1G6RL 4JG9A 2HH0H 3NCEB 3FQ2A 1FFRA 4L23A 2CMRH 1X6LA 5CLXA 2EDYA 5DD3H 1JHKL 3MSPA 4WHCA 2C9QA 1TTBA 2OULB 3QJFA 4MHHI 4M5ZL 3QUML 1JS4A 1LMKA 2VLME 1OM3H 2BIIA 2EYRB 2HX7A 4MA7L 4Y9GA 5DJDA 1I1AA 1RU9L 4TTDD 1HJBC 2YBRB 5FO7A 5J7CC 3M46A 5GGRY 1RSYA 2BMKA 2UXVA 2AAVA 4PRAA 1C5DA 4PJGB 4XAWH 4TF4A 1U6AL 2GSIB 4R96A 5D71H 2BPBA 2LVEA 2PPAA 2R4RL 4UU9A 5G55A 1JYNA 1A3LH 4UNUA 3NEEA 3PFQA 4QF1A 3E1F1 3IJ8A 2XX0A 5HDBF 4YPJA 4JANB 3MLZH 4HK0B 3OMZA 2R59A 3OJDA 2Y7LA 2X89A 3FT3A 1KENL 1TG8A 3VGEA 5F7BA 3QISA 4LSSH 4GNKB 1P1ZB 3PAVA 3R06B 4L3FA 1PZ2A 4PWJA 1GGIL 1M71B 5H94B 3T0WA 4GG6F 3VWKB 1TQSA 4LSPH 1MJ7L 5J9PA 3ASWA 3G08B 4G70B 5HHVL 2GT9B 4JN1H 1ML0A 1PZAA 3HUJB 3NJKA 1D2PA 4NNXA 4DVBB 1FF5A 1E30A 5C7XL 2BSSA 2XIBA 1QZNA 3GBNH 3KPNA 3L2LA 4ODUB 5I1CH 3BH9A 2BVOB 3OKOA 2P42B 5DRXA 2VNCA 1N8ZA 3GLEA 3P4MA 3RAJH 2O61B 3C09C 4KKAD 3VQ2C 1LQBC 4PS3A 2QHRL 3ARVA 4L2LA 4RMBA 3NJMA 1FRGL 1NGWA 3H53A 3VD3A 1I85C 1KTRL 2A1WH 2NY3D 2F0CA 2OPCA 1TJGH 4OJFH 4P46C 3PHOA 1TVHB 1QKZH 1S8DA 5HHME 4EBQH 1BD2B 1KIPB 3IFNL 1SHSA 1OKEA 2WWKO 3HE6D 5JHDE 5DJXB 5L2KB 4AYSA 2HKFH 1YCSA 5GQBA 3TVMA 2X4QA 3X11B 2R1YB 1J12A 1B3IA 3IJ7A 3B37A 1CD1A 3DJ9A 4N3TA 5AB1A 1EEZB 3QEGH 4W9JC 1Y6KR 4PI2A 5DJCA 4Z3FA 4R2GD 2GVYA 3D34A 2D73A 4X5WB 1QBML 4U1JA 5FKPB 1WBYB 3QULB 2QELA 3RWEB 3F6LA 1E5ZA 3FMGH 4N2BA 4PS8A 4PJCA 4XBMA 4U1GC 1UM6L 1RJZB 2D3VA 4PBWD 3V6FA 3UPRA 4GO8A 1TITA 4RFEB 4KROD 3U6RB 1HHIA 5D2NC 5TF1L 2WIMA 4P2QD 3V4VB 2VLRB 1OAYH 3BW9B 3RY6C 4IRJD 1CGUA 1CLOL 4WJ5A 2ZG2A 3AJ7A 3MNMA 4PJDA 3ZMRA 3U1QA 2WW8A 5KSUB 4M6OH 1BZQK 4U6HA 1WAPA 1UXMA 3GNMH 5JDJA 3UBGA 5IEHB 2E7MA 3BKJL 3T65B 1G84A 1B9KA 1XGPB 4RZCB 4EN3C 4NO5A 3T0EB 5D96B 1FIEA 5L4FA 2EXYD 5E00A 4M1DH 3RB7A 2QPFA 3DETC 1FUNA 4ZX4A 1IEBA 3BKYL 3BX7C 2J8UF 5I1IH 1JWUA 4AEHL 1NL0L 3IXAB 1O5PA 3AG2B 5E6IA 3QI9C 4HJ1A 4PRPA 1OK0A 5DD5H 3VI3A 1IAIM 4TPRH 5I1AA 2DBLL 4L8BA 5IVXF 2E27L 3ZE2F 1EUUA 2UX6A 1K8DB 1PX4A 2BWQA 1RH8A 4ZT1A 3ZT7A 5DHMC 2CUHA 3ARGB 5J13B 1BW8A 3QFJD 2O6DA 4GP8B 3TT1L 5BQ7B 4JQIH 1DJZA 2XV6B 3ASOB 4GUPA 3US0A 5M95B 2CBMA 4FC3E 1FFOB 1GAFL 2MHAB 3I85A 3MUY1 4X99A 3DVGA 5F7KC 3AG3B 4C56E 3EO1B 3LQZA 2VDKB 5AZ2H 4QRQB 1VACA 2OP4L 1IM3D 3GSXA 2FK9A 3GKWL 5CINL 2Q2EB 2C8NA 2JIXA 2F7QA 2ZWNA 4R7VA 4K3GA 2ZP9A 4QTIL 3UJJH 1PZUB 1CDBA 4B7IA 2JVUA 1N5YL 4FAAB 1ZAGA 3C5ZA 4FD0A 3FYIB 1XXFC 1X9RA 1W0VA 2ISDA 2PYFA 2CGRL 2XZQL 3VMPA 1PQZB 4LK4A 1AKJB 2A77L 4F80A 4AC2A 2DIBA 5EZJB 2AERT 1E5CA 3MRCA 4L1BA 5MEQB 5DJYB 4X4YB 2ZPKH 4ZX3A 1N4XL 3FQRA 2VUKA 5L4IA 4GMSL 3DNKA 2GBTA 4U3SB 1HIMH 3WTYA 2X6BA 3KJ6H 4N0CD 1J5OH 3NJVA 3IBEA 4DKDC 2A74C 2XN9D 3A6CH 4V2BA 1R6VA 3NESA 4N2MA 4AJYV 3X3GH 4EXPX 2LTQC 2P5WE 4PJ7B 1Z6JT 1MRCH 3TLRA 3NT0A 5H2BB 1VKXA 2GBAA 5CBEB 1G9NH 1S7RB 3SYOA 1INEL 3QJRB 4XVOA 4NQTA 4HXBH 5HD8D 1UWFA 5MENB 2ESVA 1CG9B 4Y7MA 2DEYX 5I76B 5FUOH 4WW2F 2JJTC 1NC2B 1UUNA 1UZ6E 4OV5A 1BZ9A 4B7LA 4YSEA 4N2OA 3ZE0E 3QXUA 4Y9FA 3II2A 1G9MC 2VKXA 4G7VL 4GB9A 4YC2C 4G11A 2Y7QB 1YA5A 1EK3A 2ARWA 1CTMA 3CTTA 3HZ3A 2V33A 2GG1A 4UT9L 1DBJH 1FYTA 2EXWC 4HWZA 2UY7A 2NUPA 4GG8A 4Z7OB 2WIIB 1S4IA 1T5XB 5SWSD 1PNCA 2B77A 4YHPA 4EN3D 5I82A 3I3EA 2V5TA 2ZAGA 1AGDA 2QSCL 3C6LD 3GSOA 2AEWA 2EDBA 1YYMH 2GI0A 3DETD 3SB3A 4FS0A 4PJ5E 3WTXA 1KXQA 1DVUA 5CIPH 1CBVH 3MUUA 5CZVH 2JF1A 3RTQA 2HSIA 1QRKA 4TQIA 4ZXBA 2DI8A 5C0BB 1OV8A 2IFFL 5DRNB 3S35X 3RL1A 4EDXA 5K9QI 1IKNC 2XNAA 4PRIB 4JY5H 3ECBB 3V5DA 1QSFE 2BHFA 4Z7WF 3ZO9A 2HYMA 5D7JC 3RWGA 1T1ZA 2HVBA 2QL1A 3A6BL 1P5UA 5FFLA 5AB9A 5KTEL 2EH7H 1V10A 1RZKL 3G7TA 1X5XA 4J3OH 5C08E 2WSKA 3MC0A 4JG1H 2R0WH 4OFQA 2JMRA 2DWDB 1RZPA 1P7QB 3ZO0A 1DQMH 1HDMB 1J1PH 1MIEH 4KO9A 4FI7A 1H6TA 4O02L 1UURA 5D7SL 3TGXA 2FBJH 4WO4D 3EG9A 4ZTPL 5EO1A 5C0AE 3ALPA 3SQBB 1HEJC 4JR9L 3CMOH 3II3A 4HUMB 3BO8A 4M48H 3ETSA 3HJ0A 3TBTA 4LCIH 3RIFK 4APQC 1BV8A 1OZTG 2ZUXA 1MJUL 2VDNL 5T3ZL 3HC0A 4E5XA 4GAFB 3H9SA 3ZDXB 4KZEL 1Q0EA 3UJIL 1MAKA 1ZK9A 2J8HA 4PVLA 4WEBH 4Y1AD 12E8L 2DEWX 5FR3A 2YHGA 3STBA 1QQDB 1HQRA 5KYYB 4L4TD 5EPMA 4KTYA 4IOFC 1IKFH 3F64A 1SDAB 4OAWA 1H0DB 1JXDA 3B7YA 4FQPA 2WKOF 3WNMA 3U6XA 4EDWH 1X9UA 2ITEA 3ABZA 3BUYB 4TLUA 2HKAA 4KU1A 5IR1A 1DUZA 4YDLC 4GY4A 1F41A 4EVNB 1H19A 2VDLL 4WI6A 1F02I 1T03H 1QW8A 4WI9A 1KEGH 1FFPA 3EOAA 1OHQA 3BZ5A 3HE7C 4ZFZA 5I8OH 5JIIA 1FH5L 5LGHH 1ACYH 4N9GA 4YZFF 5TGBB 3QEUB 4NQDA 5AVXB 1PF3A 3OR6B 4RGNC 2ARJB 4Z5RB 5FECB 1R19A 2X44D 3R1GH 4N0UE 4WW2C 3CLFH 3VDCA 1FL6A 1SLXA 3NJJA 2Z0BA 4GUQA 1XHHA 1A9BA 1UWYA 3DSNB 5AUMB 2Q8AH 3DXAA 1JI1A 1ADQA 4AGPA 2YKLH 2IADA 3FU8A 4NQSA 1P2CA 3BDYH 3N9GH 4X7FC 5HHQA 1T5KA 4PJIE 2EXSA 3BP7A 5J8OA 5C9JA 1EQWA 4LBAA 5H37A 5EEZA 1OTTD 1BIIA 2YGVA 3ULUH 5TD4A 1DBKL 5IMMB 3VH8G 4N28A 1RK1B 3NFSH 3LKNB 1OWRM 1TJHH 4Z0XA 4FABH 1XBRA 2EXWD 1LDPH 1BFVH 3AUWB 2PPFA 5IHLB 1PG7W 1REIA 4P3DA 1KBBA 3VXRB 3MRBB 1GJWA 5ECGA 1N3NA 4FXGC 5ETUB 1KBKA 2D9QB 2EKSA 3DECA 3V55A 3FONB 4YAQA 3MLPA 2XC8A 3H42L 2ENQA 2FGWH 3QDGE 4FULA 2GQHA 1JNHA 2KQNA 4MS8C 1P7KA 1UEMA 3EYVA 3L3KB 5EOQL 3ULVF 4G8EA 3NDYE 4E2OA 1PLGH 3BISA 4CSPA 4R26L 1OB1A 2ETWA 1Z66A 1KGJA 4AK1A 2HUHA 3Q13A 3DX6A 5HI4C 3SBWC 4P4RB 2X1WL 3K6SB 4UMGA 4YSAA 1Q72L 3OGCA 1MCLA 5AALA 3L1FA 4G6KL 4JFDB 4OZIA 3QORA 1X5ZA 1E4XH 1Z5LA 3IKCA 4XBEL 5G4MA 3DROA 4JRXA 1PLBA 5F88B 1DEEA 5EBWA 3BI9X 1KTLB 4F5CA 4I0CC 1ZT4A 1S9XA 3LTVA 4ATTA 1NCGA 1KB5A 1JDCA 2EDFA 4W9CC 1ZD6A 4GOSA 4EO5A 4AENA 4IKKA 1HJCA 2PLTA 4O2FB 3HR6A 2APTA 3MBEC 2WBJC 4FLSA 4PG2C 3B8SA 3KNBB 1J48A 4U7SA 3GEFA 2YPLE 2NY4C 3QEHA 4LAJH 1WAEA 2HT4C 4YHKH 2NUTA 3C09B 5CD3A 4NUPA 1M42A 3IS1X 4ENEC 1DSFL 3QT2A 3W0WD 2AK4D 4X83A 4LLDB 1HYSC 1JSYA 2XN9B 4P46B 4PGCB 5IBLC 2DYPA 3NJGA 3SJVB 3T2OA 5A6IA 1JGDA 4GSQA 4XNYH 4ZO8A 4G6ML 2BOBA 1L6XA 1AI1L 5IB1A 4OLWL 1BQLL 5EEVA 4IOFD 4U1MB 2CHNA 3Q2VA 4NIKB 2XBZA 5K5YA 4GSXA 1IFHL 3QC5X 3Q43A 2Y22A 3QHFL 5D2LE 1P6WA 2ADIB 1ITCA 1NBYA 3DRQA 3JUZA 5LBGA 2GTZA 2K70A 5ICYA 5DTFB 2UZYB 3OC5A 2AJUH 3FTWA 1F4YL 4GRLA 4E41D 1ZIBA 3OKNA 1J9QA 1T4KA 2CM5A 5DLMH 2ZCZA 2Z64C 5BUGA 4M3HA 3QIBA 3CLEL 3PF2A 5I1GL 2ZUVA 3W37A 4F20A 3ILQC 3SGJC 3CZJA 3IYLW 3Q2LA 3QZWB 2W81C 2OJEB 1CD9B 4MLSA 3HTLX 5JQHC 3OAZK 5T33H 3MV7B 1E9OA 4EXKA 3ULVL 5DYOA 3FUNA 2Y6SC 4W6WB 2QMJA 5D1QC 2COQA 4YGVA 3JV4A 3JV0A 1S3KL 3KXFE 4RDQG 4XO5A 3WFBL 3BC9A 3N43B 3FFDB 3SE9H 5A2KH 3QPKA 3GSNA 4UQCA 3R7RA 2VN3A 2W91A 3W9DA 5B8CA 3VFWA 1PVHA 2AXHA 4Y2DA 1IIKA 3U82B 1A21A 2QQLL 3FJTA 3QQDA 4LVEA 3KYKH 4P2RD 1XXDC 4I13B 4FXTA 2A6IA 1A6WL 2H6PB 1IAII 4NHCH 4OGAC 4L37A 3QI9B 5KBKA 1A6UL 1IQWL 1L6ZA 1QPKA 3FQNB 2MPVA 4F2EA 4GP5B 5EU7E 3E80A 2RTTA 3UMNA 1AGEB 3L7EB 3LN9A 4M7ZC 3G6AB 4MS8D 1FL3B 1YVLA 3ME0A 2X3CA 4XNQA 5FB8A 2B0SH 4ZUWA 5L8LB 1AOZA 3GPSA 4Q6YA 5IVNA 4PV9B 3CZLA 1U93A 4JVPA 4NQEB 1E4KA 3P3SA 3RWJB 2DQDL 1E7UA 3FPYA 5I0XA 1QA9B 1UB5A 1GOHA 4G7SB 1KPUB 3LN5A 4WFEE 5E70A 5ERWB 5EUOA 1G1OA 1RFDH 3BAXA 1I9IL 5HHOE 4UOZA 1GOGA 4H0IA 1TO4A 1YNTB 1FGVH 4WNQB 1IGMH 1WIUA 4BZYA 5JQ6H 2R0LH 1CVSC 2H0PA 2OMTA 1NOAA 1YJDH 4NKDB 4OLEA 1OGPA 2A9ML 4X5XB 1LP9A 5ISZE 3RU8L 3WMQA 1O0VA 2AANA 4QR7A 3ZZSA 1EGJA 2F7PA 2WBJD 1NGQH 1WA2X 3QJHA 1BEXA 1XMWA 2W38A 4X9IA 4BH8B 3MZGB 4L4TB 4LLVA 3WFEH 4DT2A 2NY4D 4EMZA 3P1VA 4JPSA 1CXEA 3TEUA 2A73A 4JFQB 3BVUA 4K07A 4KY1L 4P59H 4X5RA 2VIRA 3MO1B 4PY8I 2A5UA 1SJEA 1UXSB 4NRYB 4ENED 4ANXA 3PLYA 2KLRA 5B1JA 2OKMA 1JZ7A 2A74B 4RMUA 1GHFL 1RJCA 3PE9A 3VSUA 3FB7A 3S37L 1G9EA 2LTQB 4KXZH 4CKVX 2XICA 4CU7A 1FNGB 4J6RL 4JMNA 2EIMB 1B3JA 4JO1H 3BVVA 4LXFA 3LN4A 4OD3L 3CFQA 3UFIA 5D5MA 3AAZB 3ZSSA 5GGSB 1DVZA 5BVPL 1WTLA 3LEVL 1TQBC 4JNXA 4V1DA 4KI1A 5I1HL 5GGTA 4C58B 5CP3A 3GD1C 3SKNA 2AJ3B 4BSJA 3MRGB 2ZXEB 4TULH 1Q9KB 3D39A 2DQCL 3POCA 3N5AA 3VFSB 2EIZB 3JTBA 4IYKA 2XA8H 3OD3A 3H8NA 5FO9B 2CDGA 4ODWB 1T89C 1FL5B 4DPCX 4MRBA 1UH4A 3GJEB 5JUEH 2N7AA 4QRTB 4G72B 2MTPA 5I30L 4RISL 4YC2B 4IMLB 3NTCH 4IBWA 2E7DA 4JM4H 1OARH 2EDLA 3VXME 4X4XA 3EOBA 3TO2A 4PRDA 4MSWB 1E8YA 1IVLA 3EYUH 5IB5A 4R7XA 5DVLA 3PGDB 3VM7A 2Y6SD 5D1QD 3GB7B 1YY8B 32C2A 3C12A 5DZ9A 4L2YA 3FZUC 1M7UA 1O9VA 1KLGB 5J0BA 4OFYA 1W0YT 2CLZB 2DJSA 1TQVA 3QIWC 3NZ8B 4JDZA 2FL5A 1AO7E 5C0CE 3KWWB 5C6TL 1AYRA 4Y19A 1IGIL 3RB5A 3VI4F 5JW5A 4X6FA 4OGAD 1U8MB 3NA4A 3T8XA 1HH9B 2JKRM 1MLCA 4KRNA 4F15B 4YMPA 5HSFA 5EIIB 1NCDL 2LAGB 5IHZB 4L5FL 1MRDL 4NWUH 3EOYG 4IEFA 4N25A 3VQ1C 1XGYL 3G6JF 3ULVD 4K71B 5D7JB 1XF3B 2PO6B 3MA9H 4D0CA 2OCCB 4F9PC 5CLTA 5KVGL 3GMNB 3WN5A 3CZEA 3NK3A 1I7UB 1NCJA 4NX0A 2F5BL 4M7JL 1A2YB 1OD9A 5GRVL 4W68A 4A1RA 4G8FA 1HSAB 4PJGE 1WFIA 4NAMA 1MFCL 5DHXB 5DUBA 1PKQB 2Z93B 3TYFB 3FQUA 3ZL1A 4AZ8A 1JDAA 1XD1A 2IPUG 5CILH 3IRCA 4G5ZH 3QG6A 4NC1C 5H4YA 2OZ4L 2CKBB 4UM9B 3NH7H 1YUKB 1C16B 2ERJC 3EYQD 1JN6A 3GRWL 1ZHLB 3GZOA 2PW1B 2J44A 5EV7A 3U4AA 4CVXB 1QRND 2QLVB 2BRRL 3RBSA 4UB0H 4YFLI 3H9YA 3W0WB 3T0VA 4MCZB 4APQB 1YY9D 4OH2A 1RIHL 1G6RH 3ARDA 4IRSC 2DWTA 4A7TA 1TTRA 3X1NA 4IIZA 3VH8B 1AZBA 3CVHA 4N4YB 1CFQB 5AD0B 3KLAB 5JZ7C 3HUJE 1JHKH 4OM0L 4EZLA 1J7VR 1BBDL 1P5VB 1UUSA 2NX5A 3O45B 4M5ZH 3UL4A 3QUMH 5ESAA 3BQVA 1KLUA 2CGYA 1IO4C 3JWDC 4RIRA 1EHXA 3NIDB 5D1XE 1N6UA 1ZSHA 3K81A 4MA7H 4QRPA 1RU9H 3MV8D 2VLLA 3OR7B 1A4JB 2Y36L 4YDLB 5AW9B 3SDXE 2BFGA 3MRKB 4CSTA 1U6AH 1V3MA 1A22B 1PYWA 2R4RH 3JYBA 3AXLA 5FYJL 1AACA 1T83A 1WZMA 3P77B 4Z7VB 1XF5B 5DRWB 3HE7B 1RMFL 1HHHB 2X4SA 5MEQA 1U8CA 3PV6A 3IS0X 5ICZA 4DGVL 2YLKA 4RGNB 2GCYB 1KENH 2NY6C 2E9BA 2ZUQC 4MNGB 1GGIH 1XF2B 4L1DA 1BVNP 3I9GL 4XN5A 1KYDA 5EF3A 1GYUA 1MJ7H 1HXYB 4FQQA 3WIHL 3U7YL 5HHVH 3BDBA 2EC8A 3FU6A 1F3DJ 3NZSA 3QDAA 3O3BB 4U49A 1ICTA 3J8F7 4XNUL 3Q9QA 2CH8A 1Z9MA 1ZJAA 3C2AL 3DX2A 2VMCA 5FCUL 1WC7B 5C7XH 1TYEB 1U91B 4HDIB 4NZDA 1IAKB 1WZKA 4A7UA 3PAYA 1OGAA 4TYUA 5EEXA 3HMWL 3K46A 1BOGB 2YD9A 3ARUA 3VGBA 2QHRH 1CL7L 4LSUL 4PHZA 1FRGH 3W3BA 1BQHB 2Z91A 1A1OA 4LNRA 4OQ1A 5DVOA 1IAOA 2ZOTA 1OSEA 1MW0A 3FZUD 1T1YA 4KJWD 4P5RA 2Z35A 4A7QA 1XT5A 1GL4B 1GOFA 2CLVA 3EYSL 3LH2L 1RULL 1VF5C 2J6EL 1LXMA 1G7PA 3IFNH 4NPYB 2KYIA 4GQRA 1YO4A 4A55A 1TLMA 4XMZA 2WSPA 1NAKL 4QHMA 3MRNB 3ZKXC 3RZCD 4C83A 2AQTA 1I3RA 4YLQT 3BVNB 3U83A 4NUJA 1ONQA 4OCWL 5IQOA 1F86A 2PYED 1I8KB 3S0PA 2YA2A 3CVBA 1U8OB 1QBMH 2AXFA 1MVYA 3X1GA 4JFZL 3SY6A 4I0KA 3RKDC 4CBPA 4Y2OB 3QUYA 1UM6H 1I1CA 3VFRA 3TN0C 4PLKC 2BP0A 2X05A 3B2MA 1YEKL 1MI5A 2ZJSL 5CSZA 3PNWB 5DQ9A 5TF1H 5KSVB 4NENB 4RMTA 1MWOA 3C8KB 3MBEB 1SHWA 3CDZB 4CAGA 3LKQB 3QQXA 1CLOH 3SE4A 3BKJH 4LPVA 2OYPA 4P99A 4OFDA 3QEQB 5CZRA 3D2UD 4PJCF 3C6SB 2Y7SA 3BJLA 1ZT1B 1L5GB 1PU0A 2OMVB 1KG0A 3BKYH 4QOKE 3B1UA 2DEXX 5CHNA 1DYZA 4RGOL 1F6LL 4AEHH 3HAEA 4DSYA 1NL0H 1OF2B 4DKTA 5JZ7D 5KS9A 1ZWIB 5L88L 1BBJA 4RESB 5BUAA 2B59B 4Y5YA 4DCQB 4PJDF 1MNUL 1TJMA 4K7PX 1OIOA 4DJMA 2DBLH 2DLFL 2E27H 2GITA 3U1PA 3KL0A 1JXJA 3UTQB 4YBHA 1VFAB 1KB3A 1SJMA 3TT1H 3C6EA 5AAWA 5F3BA 4MX7B 5DD6A 3I9PA 4F57H 1MRFL 1GAFH 2EO7A 3BESR 3EFFB 5DSCA 5DHYA 1IRAY 3CBRA 3D9AL 2WOYA 4JFEB 5HYSA 5CJ8A 3VI3F 1FV1B 4TQPA 4NDMB 4QRRB 5M94B 1FO0B 2OP4H 3D3VA 5GRWA 5D6CB 1MCWM 3GKWH 1JTOA 5KVFE 5CINH 2P24A 2NY6D 3WBDA 3PWPA 5LG1A 4H0HB 4WTWA 35C8L 5KVEL 3NRPA 4QTIH 1I1RA 3LKOB 4TVUA 1N5YH 4X6BA 3MACL 4XN7A 1SM3L 1T3FB 3Q5OA 2CALA 4IGBB 2HPOA 1SHMA 2MH4A 1XL4A 2CGRH 2XZQH 5TH2A 5FYJD 1S2EA 2A77H 4FNQA 2R23B 3VTTA 4U1LB 2ICWJ 2BWIA 1GXEA 4AYID 3FN3A 2B3IA 2M1KA 2VXQA 4YBQC 1F3DH 1NOLA 1QMUA 1N4XH 1I1YA 4KXBA 4GMSH 5D6DA 4HGKC 1KMGA 2D7PA 1E6OL 2EVJA 2QPDB 1ZDSA 4CGUB 2O5YL 2BXZA 1N6QL 1CS6A 4XXWC 1U42A 4K23L 3NK4A 5HGGS 5HYJD 4AWJC 1EAPA 5C3IA 2OSWA 4M7ZB 2DWEB 3VDAA 1EBPA 3FT1A 5DZLA 3L95A 5DZNA 2BX5A 3Q8AA 3GIVB 2D7NA 1UA6L 1INEH 1AXTL 2GPZA 2QPEB 3D25B 3KD4A 1QX1A 1T66C 1KYOK 1QVOB 3CPUA 1RZ8B 1ROWA 5B39A 2WVVA 3FT2B 4N2HA 5ACZA 2VWEC 2GAZA 5IOPB 5JXEA 1FN4B 4PRIE 1GZQA 3BMWA 2UV3A 1DJGA 1JPFA 3TCLA 2DYRB 4GBXC 1WP6A 3KM2A 3TVMC 1XQ4A 5E1AA 3WCYA 5F44A 2NY2C 3E6HB 2DM2A 1U58A 4G7VH 3TN0D 1BLNB 1G87A 5HGBA 1SYVB 5IWLC 3WTSA 5D9SB 4JFYA 4UT9H 2AV7A 4K7FB 3TL5A 4J4PA 4QNPF 2GJ6B 4Y16A 3G9VA 1OCZB 3BFWA 5DO2D 1PKOA 1DO5A 2QSCH 4P5TC 2YXVA 1C7TA 1VZHA 5CD5D 2CHXA 3EF4A 3N1MC 1I1FA 3MV11 5T1KA 4HV8B 3NABL 5IOKA 3BWAA 3BRDA 1JNJA 4XZ4A 4JCWA 5LBSA 2TSAA 3LIZA 4X4MA 1G1KA 4LCYA 1HTYA 2HJKB 3NAAL 2IFFH 1YUHB 1NFDB 3L6FB 4OCMC 3T77B 1NGYB 1TQBB 3MNDA 3N1QC 3N6YA 4G8AC 3JWOC 1YMHB 1I3GL 4BELD 1RZIB 1P1VA 2GABA 4PREA 5KJRL 5SWZA 4KOBA 3A6BH 1IC0A 3CZFB 3GXTA 4K94L 3EDEA 3K4AA 3SCMA 3U2SA 4NO0B 3QUXC 5KTEH 1RZKH 3UYPA 5E6IC 2JE8A 3VXTB 1HHGB 3P9WB 3PCYA 4PJ9B 2PW2B 1TCRA 2CLRB 1KGUA 3O6ML 3S3BB 2ZUUA 4JW3A 2W9DL 1I1AD 3SN6N 3AMLA 1O5DT 3WUWB 4DGIL 2IWGA 2FSDA 1TQCC 3G9AB 3OV6A 3ZL4L 4P23B 5IVZB 5F0LB 4HCRA 2WJ7A 4O02H 5D7SH 2O6CA 4ZFGL 1G1CA 3AY4A 4ZTPH 3MBWA 4YUEL 4KJPD 3BD4A 4JR9H 2PETA 3UAAA 4NKOA 1MJUH 4WV1A 2VDNH 4BCZA 4FQJL 5T3ZH 1FA4A 2YPKB 2ZNXA 2N0MA 5IB4A 3FB5A 1ZLVH 4ZFFB 2X89D 4MA1B 4KZEH 1V7NL 3I02B 3Q2NA 1UGKA 4IOSD 3UJIH 4HS3A 12E8H 3QIWB 4Y5VA 5L2JB 3VM5A 3N42B 3OZKA 8CGTA 2YARA 4YVUA 1U8IA 1EXUA 2EE6A 4H2AA 4MJ4A 1GJUA 2DBJA 1I7RB 4MJ6A 5E8EA 1WFOA 3OSKA 4XWGL 5LAXB 1UFUA 1BF2A 3IAPA 2I7OA 3RJQB 2VDLH 4OIAA 1I9JL 1PL3A 3E9UA 1KYAA 5JIDA 2D3LA 2DS4A 3QFJE 5F9AC 2GJPA 4OKDA 3EH5B 5EWIL 1FH5H 4BFIA 5FYLD 1X4ZA 7PAZA 1YEGL 2L7JA 1CCZA 2ZAHA 1MSPA 4F7MB 1X44A 5BZDA 5IREA 1AY1L 3O3UN 2VISA 4PS4L 4QUOA 3TPUB 4LLYA 3FOMA 2AF2A 1PEWA 3WTVA 3KWXA 1B90A 2DH3A 4NT6B 4UF7C 2ERJB 2Z9TA 5GZNA 4GKZA 4Z9KB 3VAEA 4R7NB 1R3KA 3TVMD 2DJUA 5G5DB 3VG0L 5GHWL 5DMYA 2NY2D 3ESVF 3GLDA 4MXQC 4IRSB 1DBKH 1DQLL 1LTXA 3MHZA 4QHUA 3SKOA 2RMNA 4XCNA 3WNOA 1G7MB 3VYOA 1ZXQA 2ZKWA 5E9DB 1E4JA 1I7TB 4UAOC 3V5KA 1GZPB 5T3XL 1XL6A 2OFQA 3IN0A 3PU7A 2OX5B 4B9GA 3BZDA 8FABA 5ESVA 1HZHL 4I87A 1JPSL 3H42H 3TBWB 1PG7L 4TUKL 4A6YA 3UAFA 1RV6X 1PEZA 2RFXA 1EMTL 5EOQH 5L6YL 3WEMA 5K9JL 1OW0A 2XN9E 1MCSA 4R26H 4W9GC 1VRSA 1SFHA 4LAQL 2XZCL 2OMZA 2IDUA 3R0NA 4KMLB 4Z3TA 3HHRB 3VRLE 3ARYA 5IF0A 1Q72H 4ZODA 1CZ8L 1TEGA 5EO0B 4G6KH 3IDXL 2ZUQB 3RBGA 3ZR5A 3RGBA 4AYDC 3ZIMA 2CUMA 3OKLB 4BZ1A 1JK9A 3QH3A 4XBEH 1PZ5B 2D3JA 4FFZA 4TVPL 5E6ID 2YMXL 4PRPD 2B3RA 3M07A 5AW1B 2YAOA 4NCC2 3Q01A 1TSHA 1DCLA 4NSKA 3QHZL 3WEXA 2VXTL 3UTTB 1QI5A 5DS8A 5E4AA 1KT2A 4JDEA 1KB9J 2GW5A 1CU4L 1UXWA 2RBLA 3HN5A 2E75C 1P5UC 4HOMA 1MREL 1MCOL 1G0YR 4I3RL 1F4HA 3HI1B 1UKSA 5D2NE 1GYVA 4OZIF 4LSQL 4JGNA 3ATDA 4ZX5A 1DSFH 4PV8B 4N2FA 4PP2A 4FKEA 3D09A 5ALCL 5F89B 1HL5A 1HCVA 4H8QA 3VFNB 4QT5B 1CIUA 1ORSA 2FH6A 5SWSE 1PAMA 5DHVB 2WUCL 2JIXD 5AENA 2C9XA 1LO0L 1NBZA 1XGTB 4G6MH 4WSKA 1GCFA 1FAKT 2Y1YA 1AI1H 4OLWH 1BQLH 1UWXH 1OZUA 3O81A 2F7RA 1BWWA 2L8AA 3C5ZD 3ZKXB 3BEVA 1IFHH 4M56A 5DHDA 1A6TA 3SDAA 3QHFH 4HW6A 1VIWA 1G7HA 4G80A 3LEYL 3L4XA 1MQKL 3BAJA 2ZYSA 3NACL 4JE4B 4IU2A 4UT7L 3IJEA 4QWWC 3S36L 1OT2A 1MJJA 3RFZC 1F4YH 1PNDA 3ECUA 4EJ1C 4AQAA 3U0WL 3EO9H 2IALB 1LM8V 3ZKNC 1TUPA 4YDIL 3DKHA 2B15A 2BOCA 3CLEH 3QDMA 4EI5A 1MFDL 3RIKA 5I1GH 3BIBX 1ADQL 4FF9A 5HDBE 4JM2C 4AJWA 4URKA 3ESMA 1L0QA 3RVVC 1KF9B 2WHVA 3IE4A 1OTSC 4H0LC 1P0SE 4E9QA 1CI3M 2DQEL 1TT6A 4A66A 3IDGB 3ULVH 4GG6E 2F61A 4HWBA 1T2JA 1G7LB 1Y18B 4LMQI 2FHFA 1S3KH 3LZNA 3WFBH 1T0OA 3BMVA 1TYRA 4WSJA 2GKIA 2ITDA 1HSBA 1NAMA 2RQ8A 3CNKA 1QUNB 2ESVD 2AJZA 1G7JA 2QQLH 2Z34A 2O1AA 4YSRA 5DC9B 4PJXB 5IB2B 4FADA 3HNVL 2NY1C 5I6OA 3DOSA 3VB8A 4UQ2B 4OCYL 1A6UH 4KMQA 1IQWH 4Y1AE 2E6QA 3GSUB 4PI0A 1SY6A 4L4TE 3KE0A 4LRIA 3ZK0A 4H40A 5EFIB 1TNNA 3GUTA 2HUEA 2TRYA 2AFNA 2XFGB 3HR5B 3V6ZA 4IIQB 4CVWA 4YHLL 2G9HA 4N0RA 5I8EA 3TEZA 2KZ1B 2H0JA 1FYTD 3FUIA 3HHSA 3KCPB 5D1ZA 2JNZA 4MJIB 3QR1A 1Z2KA 2B1AL 3IDIA 5F9DC 2DQDH 3DX8A 1KEML 4WAFA 4IBSA 1W80A 3HRPA 4XPGL 1I9IH 4GYBA 1HCYA 2YS4A 4PRAB 4ZFQA 3ML9A 1NCUA 2VDRB 1KB5L 2ZZUT 3TNNB 2WQSA 3SPIA 4QXVA 5IBUB 4AI7A 3RTQD 1F0LA 3QRGL 2EADA 4XB8A 5EU4A 4ZXBD 4Q2ZB 4G1EB 3DO3A 2HWZL 1U2CA 2NY5L 3ELQA 3RVXC 3QQ3B 1KV3A 2A9MH 4X7CC 1OB0A 1XCWA 5HVGB 3RU8H 3X12A 4AIZB 2AVGA 3K1KC 5EUOF 1YNKL 3MR9A 1TZIB 4LLQB 2XDHA 3QORC 2DV6A 3AT0A 5GGRB 4BINA 3OQ3B 4DKFL 4JBSA 2N7SA 5DI8A 4FQCL 1AS7A 1BP3B 2QGBA 2W59A 4KY1H 4TUOB 1U3HC 2Z4QB 2VR7A 3B7UX 4NRZB 1EZUA 3FRPA 4WGKA 2J2ZB 2H2PC 1Q8MA 4L8SB 4UZSA 1TZHA 2X28A 2EC9U 4TVPD 1GHFH 2BSSB 2Q3ZA 2NY5C 2XXGA 1S9YB 1LP9F 1S9VA 4F8NA 1ZV5A 4FFYL 1WUNT 2OR8A 3S37H 4KJQC 4R4FL 1N8ZB 3P4MB 4J6RH 4Z77B 3PUCA 2J8UE 4OD3H 5F7MC 4L9LA 5SX5K 5BVPH 4HYTB 3LEVH 3TTYA 2VMEA 4WWID 5I1HH 3DHJA 5DDHA 1OP5H 3ZUNC 1KJ3L 5IVXE 3ZE2E 3H9SD 3AS3A 3N0PB 1CIDA 2WQVA 4PLOB 2DQCH 4B9PA 4WGWB 2I32A 4ZMVA 2FQGA 3GUFA 1M2VB 5E5RB 3MDJA 4GBXB 2ZSVA 4YH6A 3TVMB 3V0VA 3ZKND 1U8KB 3A3YB 5DS1A 1A4KB 3CZUB 4YR6B 1H3GA 5D5MF 1FVCB 3L7FB 3MCG1 4F9LA 2F5AL 2XSKA 5BJTB 4RISH 5I30H 1OXYA 3IXTB 5CJOH 4NP9A 1JXGA 4NJ9L 3ZOAA 1HH6B 5I19L 4LLUA 1GSKA 4GRLC 1OTSD 3OBAA 3VFUB 5BZWA 4L4VA 4NKMB 3GSNL 4Y1SA 5C2BL 3QIBC 4G8GB 4FNPA 2WKLA 3FUJA 3HPJA 3O6FA 3KYAA 3QWQB 3TZVA 4NQDD 4KKBD 4H1LB 2HCZX 4HGWA 5TK2A 4GW5B 2P7TB 3TO4B 1CJYA 4D9RD 3EGXB 4P5TB 4B41A 5EZLA 1KELL 3W0WE 2AK4E 1F3JA 2B4CC 5FCSH 5C6TH 2DQHL 3DXAD 5ECJE 4AXWB 4KK9C 3L9BA 1IGIH 2CBPA 4GW1B 3W39B 2W65B 1RJLB 4BDVB 2NY1D 1VGKB 4PGZA 3N55A 4XXDA 1ZLUK 3N1PC 3P4OA 4NO5B 1NCDH 2JTYA 3WNKA 4BBWA 4L5FH 1MRDH 4NWTL 2YR3A 2YRZA 5B8CC 4RMSA 1XGYH 3CIAA 4GQZA 1BG1A 1DSYA 1RL1A 1J05B 5KVGH 3GT6A 2DICA 3SHSA 4HAGA 1JWUB 2F5BH 1F00I 4M7JH 3QUXB 3PDGA 5CZXD 1BJ1J 5E6IB 4ZUUA 5CCGE 3TWYA 1MFCH 2OJ1A 3VSTA 4AH2B 2KQMA 2YQBA 3EFOB 4M7LL 3WL9B 5EC1B 4E41E 4IBLT 3IKKA 4JQXC 3WFZA 4G5AA 5F0JB 5GS1B 2HMID 3SKJL 4FNRA 1MXDA 3JTTB 3O4LB 2OZ4H 2X3BA 4PTTA 1LE5A 2DMKA 3BP5A 4MMXA 5F9WB 3WY3A 4XR8C 1BVLB 2HKHL 4GUPB 1UH3A 3BT0A 5I24A 3CHOA 2YD7A 1NEPA 3D0VB 1E4KC 2BRRH 4AV4A 4AOFA 1EGJL 1EX0A 2LABA 1SOSA 3UGEA 4ELKB 1RIHH 3EGDA 4PV1C 1CT8A 1WHOA 3FUFA 3GSXB 1TJXA 1T04A 4F7TB 4QYAA 4WWNA 5K9OA 4OM0H 2ENPA 3QORD 3BSZL 4WJG3 1BBDH 4GW4A 3REVB 3RWDA 4JRXD 2C4FT 3BWUC 1ZVHA 3OKDB 4LO9A 4FL4C 4P2RE 3VWJC 1W0VB 1BOYA 2WXRA 4PY7A 5F9OL 4KTGA 1LJMA 4F92B 2Y36H 3KYNA 5AL0A 4HK3J 3F7YA 4PBXA 5HDQL 4NO2B 4K0OA 4KJQD 4WI0B 2FYYA 5J6GB 5FYJH 2ZKXA 4YHYC 2JK5A 1IE5A 3OMNB 1R0AL 2EIJB 1RMFH 1S78C 1TCMA 4LRNL 2ZKYA 1G9HA 4AL8C 4R4ND 3TNMA 3GTVA 3G5YA 3OX8B 3JV5A 4DGVH 4D8PA 4ZUVB 2DYPD 3E3QC 2F54B 3X3FL 4ZMXA 4XRCB 4Z7WE 3I9GH 3L3HB 2P44B 1KCLA 3F84A 2VQ1A 3T2LA 4ADJA 1AGFB 3WIHH 2WYIA 4MQSB 3U7YH 4M00A 4JRYB 4XPHL 3WXVL 5IGXL 1KC5L 4HHAB 4FTVB 4XNUH 1BM3L 2XWJB 3MFGB 3C2AH 5FCUH 1R24A 3QUKB 5TE4L 3GTTA 5BRZA 4XP6L 3VMOA 4HKBA 4J2QA 4ZUSA 2C3GA 3NA9L 3AROA 3G5VB 1XGUA 4PJEA 5DMKA 4E0RA 1BG9A 3HMWH 4GRLD 1T1WA 4MMZA 1MDTA 4PRNB 4RMWA 1E28B 3OHXA 3FB8A 3SKUD 1CL7H 1TF4A 5IB3B 1HKFA 1NCHA 1FNHA 4LSUH 2DQTL 4OD2B 3QIBD 2AS5M 1MKFA 4JPVL 1AYOA 3TA3A 5CKAA 2EUXA 4TQ8A 3SDDB 1SLVA 1CDJA 3EYSH 1LD9B 3LH2H 4Q89A 1RULH 5FGCB 4ONFL 3MJ9A 3L4CA 5A6LA 1TQTA 3Q2WA 2GUOA 1NAKH 4CJ0A 4F58L 4KK9D 3VD1A 4XN9A 5FWQA 5C0JA 4WHTB 1IT9L 2CDEA 4IK7A 1RZGB 1UA3A 1N64L 5C0IA 4P4KA 2XXFA 1NC4B 4YHZL 1BAFL 2YQGA 4Y9CA 4Y2DD 2E7CA 4I2XE 4BQ8A 2WVTA 2X9ZA 4X7DC 2OK0L 4OZ4A 4JFZH 2D0HA 4PCTA 3CHQA 1YDPA 4AQ8A 3FSWA 5E94A 3V79C 2WLHA 1YEKH 2ZJSH 4YZFE 3ECVA 4ZW6A 5EO9A 3RWGB 3FHAA 1XR8B 2OL3L 1BJ1H 1E27A 2VR8A 2X4OA 4DP1X 4LFHD 3KL5A 2VRAA 3TJHD 3NFNA 4L1LA 5IQLA 3MQIA 2LVCA 1ZMYA 4XO3A 1QHPA 5IW1A 1NANH 2FJUB 3RLSA 1NGPL 4PJAB 5BVJA 4F8TA 3KYOB 2CCLA 4JPKL 1JPTL 3EYFA 4Y4KB 4RGOH 5D1QE 5DD0L 3VSVA 4ZMPA 2A6JB 2E7LC 4M9PA 5L88H 1MNUH 4PJFB 4Y4HB 2DLFH 1ROCA 2YC1B 2Q7YA 1MFNA 3H54A 1BZ7A 3BD5A 3TIEB 1QEWA 5HY9A 4F8QA 2OSLA 3BLPX 2BY3A 1ET5A 2IH3B 4NKIL 4R3SA 3NEOA 1HQRB 3RFZB 1HZLA 5FA4A 5BS0B 1MRFH 3VXSA 1SDYA 3V5HB 3ULVE 5KS9F 2C1PA 2ZUWA 3R4RA 3D9AH 4D9LL 3SY0B 5ID0A 1RP8A 3GJFH 1DVQA 4WDIB 1JWSA 3SPVA 1QLEL 4Z1PA 4JM2B 3IETA 4JKNA 35C8H 1OM9A 4CVUA 4N26A 2V6HA 4Z7NF 2OMXA 1YMMB 4XBGB 1IGJB 3RIFF 1FFPB 1FZJA 3H9HA 1T83C 3MACH 4AEEA 1KWKA 4U6YB 1P7BA 2EACA 1SM3H 3SOBL 3ZTJH 2VZ3A 3H1ZA 1L3NA 4QO1B 3QYCA 2I07A 3C5JA 4RAUA 4A7VA 4CKQA 5LGKA 2L04A 2EDEA 2RJMA 1QRNE 5TDNB 4TUJB 2JELL 4AVIA 1EERB 1FL6B 5IM7A 1KYFA 2R69A 3D39D 4OGQC 3LXBA 4FHKA 4KK8C 2ZWKA 3L9YA 2APVA 1TQWA 2FJSA 4IBZA 4IHOA 5EBMB 3MRDB 1O7DC 4ERSH 1E6OH 1H6EA 3GQFA 3PQYB 2O5YH 5ANMA 1N6QH 4K23H 4DTGL 4DP8X 2XJLA 2MCAA 1WBZA 1A66A 2VAAA 3MV8E 1GC1C 2HJFA 1ZE3H 3FUMA 1F18A 2OV0A 3VXQB 1NZRA 5KAQG 5IBTL 3DUHA 2JKLA 2J4WL 4TL5A 1UA6H 1AXTH 2MCMA 3FKUS 3GBDA 4O5LL 4S1QL 2DMCA 3U9WA 1DDHA 4Z23A 4OFYD 4JJ5A 1NMBL 1A3QA 4AGLA 1JF5A 2XZAL 2GY7B 2A6KA 3U0WH 3U7WL 5IY5B 2YA1A 3GWJA 4Y19D 5E4IA 3LYRA 3CH8A 2NYYD 4QD2E 1OCOB 4TNVK 4N1HB 5AW0B 5GRXG 3QA3B 5CS7A 3V6OA 4KXZI 5CXPA 3ZTEA 5LGYA 2IGLA 3R7QA 3ARPA 1S5HA 3QNXA 1U8PA 2NZ9C 3OXRB 4QHLA 3DVIA 4PWFA 2PABA 3A4AA 3D7PA 4LHUA 4QHKI 5BOPA 4ZNEA 5JHLA 4N2LA 4OLXL 1U3HB 4HUVA 4I1RA 2GK0A 2A4EA 1M9WA 5E5LA 5EIQA 3MRIB 5BO1L 1ED3B 5CEXB 1IU1A 2FJFB 4RGMB 5AEAA 3DBXA 2ZUTA 3SE4C 3NABH 4WFHD 4Q6IB 5DF0A 5DC2A 3D0LA 2FT7A 2NCMA 3VXUB 2AABL 3PYCA 4FKHA 4N8CL 1CGVA 4Y9EA 1IBZA 1WBXB 2H1LM 4I18A 1I3GH 2EEBA 2LFEA 2N0KA 3ARDD 3KJ4B 4MNQB 4MKTA 4NZRL 2JKWA 4HIXL 2LR4A 4JFOB 2H3NB 4QXTA 1DVTA 3DHMA 1MHEB 5KJRH 4K94H 4POUB 4ZUTB 1XSKA 5EB9A 4NUGL 4ZBJA 1R3JB 2NX5D 3K7UA 4BH7B 5T1LB 2PYEE 1PX8A 4RQQB 3O6MH 1CGSL 4MJ2A 2W9DH 2NLJA 4QRPD 3CXHJ 3SOTA 4AYFA 4DGIH 2WTOA 5F9JB 1NBYB 5FPIA 3ZL4H 3U0TB 1WGOA 3VGAB 5AAWC 3FOLB 3MREB 1T22A 1ZT7B 1XH3A 3L3IA 4GLRH 2VABA 2X6MA 4NBZB 4YUEH 4R97C 4C47A 1P4LA 4BK4A 4N8VG 3QJZA 2WP3O 4A7GA 4FQJH 1TZAA 3BPCA 5FOBA 2VO5A 4JFFA 2VXQL 1OWWA 3H2WA 3IJYB 4MQXC 4WWOA 1NDGA 5DQJB 1OAKL 3UBHA 5I66B 1V7NH 3LSOA 5C0GA 3H3BC 1PPIA 1A4AA 3BPOC 4KPHL 4NAJA 4BRJA 3VFMB 1VEMA 1AHWC 4I0PB 3RDJA 2V7HB 3RVUC 1WWBX 1BVOA 4KK8D 1NPUA 3OMAB 1E9OB 3HBGA 5E03A 4S1DC 4GI9A 1CDHA 3IE9A 5I26A 4OZGB 3T1FB 2P8MA 5DK0A 3JV4B 4N24A 2H7WA 2OAAA 2C1OB 1Q9LA 2WWOA 4XWGH 1KV7A 5GJTL 2PTTB 3L45A 3NIFB 2X1XR 3LQAC 1U8NB 1JMZA 3E1ZA 1WO2A 1I9JH 1OGAD 4XVUD 5I0YA 2MJWA 1GGYA 3FW6A 3T6ZA 2A6IB 1KCVL 1WCBA 2JSFA 3WLBA 3LKRA 4R9HA 5D6DC 4KKCC 5EWIH 1NGXA 4GRWH 3S34L 1YEGH 3S98A 1HCFX 4PGEA 4FX5A 2J12B 2CJSA 3H9ZA 1Z9SB 4GRMB 2IO5A 2IAMB 1AY1H 1K3IA 4PS4H 1VZGA 4KX8A 4XMPL 4HUXB 5HJDA 4N2IA 1A6AB 4LKCA 2HG0A 3VFTB 1BLIA 4IJ3C 5HYQB 2G5BB 1FIGL 3VG0H 3BGMA 5GHWH 4PG9B 1BMZA 5I17A 3LN5B 3DX9B 3VXPB 3VGGA 1DQLH 3IDMB 1W72B 2H32A 5JXEC 2YN5A 2C3HA 2RD0A 5BZZA 1OQOA 2NZ9D 3PABB 5T3XH 5I1JL 1V27A 3QUYD 4ONHB 2YFOA 4FL4B 1HZHH 4WI4A 1JPSH 3VWJB 1PG7H 4TUKH 5LBSL 3SDCC 3LIZL 1MI5D 2Y0SA 1DZBA 3CSTA 2EYRA 1EMTH 3QIUB 5L6YH 3G04B 4LPTA 2YBRA 3CQPA 4IRZA 5EU6A 5K9JH 3Q1EA 3DDFA 2F08A 2A73B 4Y16C 4ADIA 2GSIA 2WLJA 5HYJE 1ZLWK 4LP5A 4PYHA 3VI4E 2EIBA 3K0WA 4Z7QF 1CZ8H 4G3YL 3CFBB 2YFNA 2HVJB 1XGZA 5MI0C 4JANA 3IDXH 5JYLA 3ZE1B 4HK0A 2EE9A 3G6JE 3GYRA 3V0GA 3D4YA 4KUZL 4UWQB 4DWHA 4YLBA 1P1ZA 3R06A 1HOCB 4TVPH 2YMXH 2E9WA 1M71A 5H94A 3ZHLA 4IBYA 3VWKA 3BAIA 3PREA 3QHZH 4V1DB 4ZI8A 2HVKB 2VXTH 4X6DB 3G08A 3HBQA 5EBLB 2DLTA 2GT9A 1CU4H 3APFA 4ANWA 4HMCA 2A2QT 3P40A 3D39B 4DVBA 3NSYA 1DP0A 2YIHA 1MREH 1R75A 5J56B 1MCOH 4I3RH 5FAAA 3E8UL 5EZIL 4ODUA 5FO8B 4LSQH 2J1WA 4J3VA 2BVOA 4HWNA 3OZ9L 2O61A 2FSEB 5ALCH 4XMKL 5E1IA 4E9YA 3UAEA 5I0ZA 4FXKC 5DJ6A 2ZTBA 1UZ8B 3D3VD 5BQDA 1I9RL 2WQUA 4MQXD 4RRPG 2VJ0A 3NSXA 4ZS7L 2WUCH 2JB5L 4U2YA 1LO0H 3PWPD 3AY4C 3F8UB 3CE1A 3EOBB 3TO2B 2UXTA 1TVHA 4DH2A 1VLXA 1S9WB 1BD2A 1KIPA 1AD9B 2DTML 4S1DD 4WV1C 4YO0A 5DJXA 5L2KA 1U41A 5JIPA 4NM4L 1ACCA 1QD0A 2BZ7A 3LEYH 1MQKH 5TTRA 1NWPA 3NACH 3IK2A 2R1YA 4UT7H 3S36H 2AJVL 2MIZA 2AQRA 4Y5VC 2FL5B 5I6NA 2K4WA 1MWAB 4PJHB 9PCYA 1EEZA 3BN9D 4JFWA 3U79A 5F7UA 5KN5B 1CC3A 3VU1A 4YDIH 1II4E 4X5WA 4B5ZA 3OWEA 1I8IA 1H3WM 1MFDH 1WBYA 3QULA 1CFVL 5FKPA 1ADQH 3E8VA 1V5JA 4AQZA 1RJZA 3CC5B 2Q6WB 4U3XA 4RFEA 4AUJA 4D0CB 3U6RA 4FG4A 2DQEH<