5CO1A

Crystal structure of zebrafish protocadherin-19 ec3-4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
211
structure length
206
Chain Sequence
b'PVFDEPVYTVNVLENSPINTLVIDLNATDPGEVVYSFINFVSNLTKQMFKIDPKTGVITVNGVLDHEELHIHEIDVQAKDLGPNSIPAHCKVIVNVIDINDNAPEIKLLSENSEMVEVSENAPLGYVIALVRVSDNDSGANGKVQCRLQGNVPFRLNEFESFSTLLVDGRLDREQRDMYNLTILAEDSGYPPLRSSKSFAVKVTDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protocadherin-19 isoform 1
publication title Structural determinants of adhesion by Protocadherin-19 and implications for its role in epilepsy.
pubmed doi rcsb
source organism Danio rerio
molecule tags Cell adhesion
total genus 42
structure length 206
sequence length 211
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5co1A01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5co1A02
3Q2NA 1O6SB 1EDHA 2A4EA 3Q2WA 1WYJA 3PPEA 2WBXA 2OMXB 2QVFB 4ZMQA 5DZVA 3UBGA 4ZMXA 3LNIA 2X2UA 2O72A 2OMWB 2WCPA 4NUQA 5JYMA 4ZI8A 1Q1PA 3LNFA 3K6DA 3K5SA 5CZRA 4AQAB 1FF5A 4ZTEA 4NUMA 2WD0A 1L3WA 4ZMWA 5JYLA 4ZMTA 2OMVB 2YQGA 4ZMYA 3Q2VA 4ZT1A 4AK1A 4APXB 4AXWB 1NCJA 3LNGA 2A4CA 2V37A 2QVIA 1OP4A 2OMYB 3K5RA 2OMUB 4AQAA 3LNHA 2WHVA 3Q2LA 4NQQA 1ZVNA 3UBHA 3FF7A 4AQ8C 4ZMPA 4AQEB 4ZMNA 3QRBA 4ZMLA 3LNEA 4APXA 4XXWC 4AXWA 2EE0A 2OMZB 5KJ4A 3LNDA 4ZMZA 1NCIA 2OMTB 1ZXKA 4AQ8A 1SUHA 4ZMOA 4QD2E 3FF8A 3MVSA 2YSTA 3K6FA 3UBFA 5CO1A 4XXWA 4AQEA 4ZMVA 1WUZA 4OY9A 1NCHA 1NCGA 3K6IA 4NUPA
chains in the Genus database with same CATH superfamily
2DJSA 5AAWA 3QZWB 1PAZA 3TBTA 2JWYA 2I7SA 3QDMA 4PRNB 2L7EA 4K9EH 2OULB 3M88A 2HJKB 3GINA 2AMUA 3VXPA 1LMKA 4PJ7A 4CNIA 2NR6C 3LQAL 4YDVB 3ZY7A 4LSPL 4QXUH 1E65A 1QFWH 4XPGH 5E8EA 5CGTA 2BCKB 3ME0A 4O5LH 2WSKA 1U8LA 4IMKC 4JZJA 3P2BA 3IDIA 4ZMQA 3Q3GA 2X6MA 2WN3A 1TJMA 5F93C 4WJKB 1GOHA 4FCAA 2F53A 4UMSA 4WU7B 5F7EL 1FHNA 3ENEA 5DD5H 3V4UL 1KIRA 2XA8H 3QUXD 3ZKND 2WWMC 2JJSA 4UDUB 2DTML 4WJG3 1IBZA 3PREA 1HJCA 1PLCA 4QMEA 5DJCA 4ENED 2KLRA 3CK0H 4X80L 1P9MA 4YX2H 1OAKL 4NO2B 3RUGB 4PJHA 1DJZA 4OIFA 3T3MF 4AVHA 1XHHA 5T1MB 2D0GA 5GGQH 2V17L 1WISA 4QNPF 1EQWA 3OG6B 1IBDA 3RTQD 5FA3B 1JF1B 3KCWA 5T1DH 2A4CA 3D2UB 2IH3B 2CAKA 1VRSA 2JLPA 4G9FB 1MOEA 2GSIB 5DJZA 2C9VA 1A4KB 1D5BB 1R17A 4NZUH 2B9AA 3FU8A 4D9LL 2O6FA 4K5OA 1KUMA 4N2HA 4GAJL 2X38A 2UZXB 4XR8C 5DSCB 1FG2B 2EEFA 2XV0A 4XOEA 4GAGH 1AQDA 5BMFL 4G8GE 5IG7A 4HXAL 3FU9A 3BP7A 4ZPVA 4I88A 1IC5L 5AL0A 2WQAA 4I1NB 2OSWA 1F58L 1W72B 3RZCD 1UCBL 4TM9A 5EUOF 1MWAL 2YA2A 1G84A 4I9XA 4UIKH 3IJ9A 4GNKB 4GRWB 4I2XB 5J6GB 3L4YA 3WSQH 1XGYL 2R39A 2YFOA 1NGPH 3I75A 1E43A 4HJTA 4YDKL 4UZSA 1AZNA 1P1VA 4KZ0A 4ZJ9A 1KJMA 3FT3B 2F1BA 1EFQA 2E9WA 1R5IB 1XB8A 3PS6A 3T0EC 4H1LH 3BGFC 3PFUA 4AYEC 2APXA 4MBOA 4ZUWA 4HU2A 4HUVB 4FQXA 3BVXA 4FNLH 3ZW3A 4XPTH 2VL4A 4H8HA 4JPKL 3WS6A 4NQVB 5AYUL 4XP4L 1G6RA 2A0LC 3SE8L 5DJDA 3VXSD 5HDBF 2VDRL 4B7LA 2GTZA 3HR6A 3HR5B 1KEGL 1KB9J 1DL7L 4JFSA 1X5KA 2X88A 4Z7QB 1UKQA 1UFGA 4OLWH 1XX9C 1MW1A 1AKJD 4FQCL 4GAFB 1LP9E 3P4MB 3D39D 1MCNA 1UADC 4L2YA 3G08A 3DBSA 3B2XA 1HXMB 2WCSA 4OLXL 5AW7B 3UTSE 2R1WA 4JFFA 4AW7A 5HPMA 3DOHA 3QNYA 1MEXH 1SVBA 2IWGA 2ZXAA 4EVNB 2JJUA 2OM5A 3LQAC 5IB4B 5HYJD 4OZGE 3SD2A 3MZGB 4W4OC 3O8XB 1PZ5B 4M7KH 5LQBH 2AHIA 5JNYA 3FB6A 1VFBA 2BVOB 3CDZA 3Q9PA 3DXAE 1U58A 5LGJA 5KWYC 5JYMA 5H35A 5F7DA 1NC4B 4Z7AA 1NCBL 1ZV2A 1CE6A 3BVUA 2YWZA 3VRJA 4HP5A 1IEBB 4TNEA 2F1AA 3MRQA 5SX5H 3FT4A 4Z18A 3PGDB 1NUDA 1M42A 2FATH 2WNKA 1ECZA 5C07B 4PRPB 4LSQH 2BWDA 2OR8A 2K3HA 1JRHL 3V4PL 3WAKA 3N1FC 4K94L 2Y23A 4HS6A 3SB3A 4ZMAT 3ECQA 4XH2B 1UB6A 2Q8AL 4UTAH 3FOLA 4J3BA 2DMCA 1TVHA 1KELH 4Y4HB 1G1CA 4PP1D 4NWUL 4JK0D 1I7RB 4JJ5B 1MCBA 3F6LA 2BSCA 4NJ9H 2CA4A 3SIKA 1AO7D 2HLEB 4IMLA 1T1YA 4GI9A 3LN4B 3EJYD 4HUWB 2VERA 3HUJE 3FFCA 2FX8L 4GSQA 3AREC 5D7IF 5HHOA 2OS7A 3LNHA 4C8XA 2TRHA 2Y1ZA 4JN2B 1HH6B 5E6IA 4PWJA 2NXYB 4KKAC 4GLRH 4BJLA 15C8H 3U2SB 5CZKA 5CXPA 4HJIA 4AENA 6CGTA 1FV1A 1U8MB 2QQKL 3BLBA 5EU6D 2G5BA 2IBZY 3LRLA 4JDVA 3UEZA 5D9SB 1JL8A 4FMFA 1X5YA 3CFTA 1FGNH 3R06B 2OP4L 1ITCA 4EDXB 2WIIB 2DW5A 3PWLB 1CD9B 4G11A 2ZCHH 3Q8CA 1BQLH 3LHAA 1IM3B 3BUQA 5JIPA 1WT5A 1B3IA 1U3ZA 1W6WA 1MFUA 3GHBL 2ED9A 3QI9D 4LLQB 3RWCA 4KUCD 4B27A 4GOSA 4XHQA 5G55A 4LHUD 3QUZB 2VDOH 4FHBD 2JJVA 5TE6L 2BSBA 4KY1L 4F7MA 4H13C 2WWKT 4U7KA 4JBSA 2YAHA 2GJRA 3UCQA 2K9FB 4ETYA 3DMMC 3K81A 4ZO6A 3CSYB 4KVNL 1ZLUH 1I7TA 2HKFH 4JKWA 5L6YH 5I74B 2Z92B 2YPLA 3D08A 3KPSB 4FNTA 2VXSH 4YSQA 3SQOH 3O6KL 1IMHC 1KLUB 5KEZA 5F9AC 2BVTA 2FB4L 5LXGH 2VO5A 1LXMA 4GO8A 1ZT7B 3T8MA 4QDGA 4WK0B 3S4SG 5DEGA 1FPTL 1PL3A 2B5IC 4OD3H 3PDDA 3TVMC 3UJIH 4ETQA 4NQCA 1UWGL 3QDGD 4U1JB 3W9EB 4TQPA 4HGMA 3B9KB 4LHUG 1LK3L 1X9UA 2HLFC 4RMVA 1SYSA 5FXCH 4GMTL 4LCWE 2XQYA 3OPZL 3B5HA 5DD0L 2C34A 3VB8A 5SWQB 2IOIA 3FQTA 1BEXA 5F3BA 5J0BA 2F19L 4U3SA 1F41A 4FG4A 4KJWD 4KNUA 5EIIB 3RGHA 1DBML 5IROD 4WTQA 2JCCE 2AK4D 3NJHA 2ZSVA 5KSUB 3KPNB 3MODH 3CPLA 1KJ3H 2ESVE 4PWFA 4TVSa 3VW3L 3S37H 2Z7YA 3TL5A 3GSXB 2OAAA 4MJIB 3TA4D 1E28A 1FSKC 1QKZL 5GGTH 1HCYA 4JFPB 5E5MB 1YYLL 3KPRB 4IIQA 1J7VR 2VDLH 4Q2ZB 1PVHA 4CBZA 1AFVL 3PHOB 4C58B 4K94C 1HS6A 3WY4A 3PV6A 4N5ED 1CR9L 3O6ML 5E9DA 3ZL4L 5IJDC 4TRPL 1KBWA 3T1WA 3CVHB 1XGRB 4XN4A 2YUXA 4E0RB 1T2JA 1KWGA 5C2BH 2NZ9C 3L54A 4JMNA 3PG2A 5IOPA 4P5SA 4X7SL 1X5MA 1MREH 1YYMH 3M1BB 4XVTL 1S5IH 1PX3A 1MJJA 2VIRB 3ARRA 1FN4A 2N1TE 3EBHA 1BZ7A 3CD4A 3FB5B 2ATKB 1FZJB 4AL8H 3S88L 2BERA 3AXIA 3EYOA 3FTYA 3MV8B 4PRBA 5JPMC 1C16A 3CDYA 4JHZA 5KS9B 1T1WA 3N0AA 1J0IA 4XMKL 5BQDA 3VGAB 4HKXB 3CFBA 4LP5A 5GXBB 2O5XH 3CFKB 1O7DC 3LPWA 2AVFA 3ZXAC 4ZYKA 5AZUA 3IXAA 3NRFA 3VI4F 3WIIH 4HDIA 2APBA 2N4IA 5I8CA 1A6WL 1T21A 4MQ7B 1OGTA 3PJNA 3QRGL 3JV6B 5IJBC 3SDYH 2LR4A 1WWAX 5IB3A 4ZXBB 5J57B 3ZZLA 5I15L 1WBXB 4WWNA 4EN3C 1OGAD 5CD3B 4QRPB 2GHWB 5DO8A 2UY6B 2RD0A 2DIAA 3HBZA 4HK0B 1L9PA 3TV3H 5D1ZI 4MA7H 3E3QE 3GMNB 4WEEA 3K8KA 3T2QA 3C60D 4J3OF 2XG5A 4PW4A 2AQ2A 4HKBB 2VN3A 1R24B 4QRQB 1BIIB 3HC3H 1ZIAA 2YBRA 1UWXH 4X9BA 1UFUA 5EUKA 5EMYA 3TF7C 2DM7A 5F7YC 4OGYH 1EO5A 2E74C 4YNYB 4JFVA 1ACCA 2J1XA 5F72S 3FQXB 3ZHLA 2YGOA 2QL1A 3ULUF 4LSRH 3DV6B 3T1FA 4TUOB 5ENWB 3EGXB 4F8NA 2L8AA 3REWA 1E2WA 3F62A 4M48L 4U1MB 2DQHL 1NPJA 1C5CH 1A6UL 4XNYH 4PRDA 5JPNB 1ZEAH 4KROC 5J7CC 3HS0B 4TLUA 3MLSL 5JHDA 2YD6A 1EGJA 1HKLL 5LXVA 4G8GA 2QPUA 1AY1L 2R2CA 3EHBB 3RDTD 4Z23A 3FCBA 4RRPM 2IANB 1QFPA 43CAA 1B88A 2C9XA 5FKPA 3NN8B 4U1GC 3QO1B 1AQHA 4Z0BH 2AXFA 2BP0B 2VH5H 3D52A 2A73B 3RUGE 3T6ZA 3MCKB 3CH8A 3WNMA 4E5XA 5HY9B 3GMQA 2VZ3A 4X5LA 5AEAA 2X09A 1RJZB 1HZKA 3ULSB 1A3LH 2ED8A 2EVFA 3RX8A 4KUZH 2FL5A 5FUCE 4UILH 5IB5B 1QSEB 3MRKB 3MDJA 3W11C 3D06A 3ZUNC 3K1DA 4HUCA 5D7EA 4A6YB 5I1AA 2DJUA 4KZDL 3VWKD 1QLRA 3M1OA 4G9FE 5AOIA 1FCGA 3KNBA 4OD1L 5DS8A 1R3LB 2GJ6D 2OFQA 3WCYA 3QZNA 4HX1A 4JDEB 4QHMB 3OGOE 2I5YH 4PV8B 5GRVL 1RZPA 1O0VA 3K4DA 1XIWB 4M1GH 1BJ1J 4EIBA 4FFVD 1RAMA 2B7DT 3ELQA 3QAZB 5J3HD 2YC1A 4MA3A 1E7UA 5CINL 3U1SH 5K39A 4KXAA 4FKEA 3HG0A 4PP2A 4ZMOA 1H3UA 3JV0A 2QTEA 4U05A 1GYCA 2GTWA 5I1EL 1A0QH 1ACYL 1RUKH 4LEEA 5BO1H 1LEGA 1ZVHA 3B2UC 4JFEB 5EORL 4FAAB 2CM6A 4QYAA 1SQMA 1MIEL 5ESAB 2BJML 1ZHBB 1FYTA 2BVPB 3BJ91 1XB3A 1ZE3H 1V7MH 4I2XE 4NUGH 1B4RA 3MOBL 5DC9B 2CR0A 1DBKL 3DX7B 1UVQB 2VN6A 1MIML 3FT2B 4YS4A 1RLWA 1AS8A 3U36B 2EO7A 1IGIH 3P30L 1BF5A 1C12B 2IGFL 3DXAA 3L2NA 5E7BA 1GIGH 4MNHA 4ZFOB 4HKZB 2XN9A 4QT5A 1DE4A 5EC1B 1XGQB 4JPWL 1BXXA 2WBJA 5T5NF 3FS9A 5T3XE 4L8CA 3F7VA 4N0FB 1Z1WA 2WOYA 3MCLL 4X83A 4PCSA 4JFYB 1TSHA 3SPGA 2NY1B 3S8FB 4HQQL 4Z7QE 1G9NH 3QQDB 4Y1SA 3Q8AA 1AGFA 2Y4SA 1CE1H 4FXGB 1J8RA 1MUJA 5AW8B 3CFJB 4GP8B 5CEZH 5ADPL 2A5UA 1G87A 4RIRA 1GRWA 3WFZA 5C0JB 2V5SA 3ULAB 3L1EA 3MJ8B 4Z3TA 4KNQA 3GMLB 1JV2B 4NQEB 2BX5A 5GJTL 3KGRA 4JUTA 4P5MA 1Z2KA 4JM2B 1I7ZA 5IHZA 4V2CB 1Z5LA 2OMWA 5D1QA 4AM0B 1ND0A 2FTAA 1JYXA 4MD4A 4WWID 3TJHD 1DQTA 2W07A 5EBLB 2DEWX 2EKSA 5KVFH 3VDAA 3ML9A 1T0MB 4Y7MA 5GGUB 5C07E 3BFWA 3EADA 4PRPE 3GUFA 1NDGA 3CJJA 3RNKB 4I4WA 3C2AH 2AJ3A 3FUKA 4N3UA 5EOTA 4AQEB 1A3QA 1WO2A 3BESR 2X2IA 2DBLL 4JFHE 4MXWL 3TESA 5K9QI 1I1AC 1NGWB 2DQCH 1KTCA 3EOAB 2K6YA 3IDNB 4P2QD 2PXYB 3TF4A 3O4LA 4WV1C 2AI0H 1XGZA 5FWQA 4CVZA 4LSVL 4PCTA 32C2A 2V7NB 3R18A 1N8ZB 4JPQA 4HJJL 4P3DA 1DBAL 3B1TA 4MJ6B 3QORD 1J87A 5HI4D 5MEQA 2F58H 3C09B 4AV5A 3CN4A 4PBVC 1FH2A 1URIA 1HEZA 4YJZL 5D7JA 1RVFL 2B59A 4UTBH 3GMPA 3GMOA 4M02A 2Y7SA 1T0NB 2E75C 2BMKB 3S7GA 3D09A 4Y4FD 4ZQKB 4AMKH 2JLLA 1U8PB 2BNRB 4JZOA 2PCFB 3AB0B 3KYOA 2AQPA 4HIEB 2OYMA 3RPIB 3WFEL 5F3HB 1CYGA 1HAWA 43C9B 3X14B 1BD2A 4PY8I 1HWHB 1I8MB 5L0QB 4HFUL 4ISVB 1K9TA 2B16A 3NMEA 4JE0A 2VYRE 2OCCB 4RFNB 1IC1A 2X6VA 2XQ0A 3ABMB 1LEKB 1UT1A 3FN0H 4Y16A 3OZLA 3OAWA 2ESVA 4N2NA 1Q4NX 4QTIL 1TENA 3KPSE 2H45A 4WHTB 4MJ5A 4OUUB 5LCVL 2IPKB 3HVNA 3UAAA 2DYRB 1WFJA 4UV7H 3TYGH 4FQIL 4AIXA 2DLFL 5EIIG 1XBRA 1KJ2L 1TQWA 3SKOA 3B2VH 3SOBL 4KQ3L 5DJXB 4H5SA 4K2UH 1Y6KR 4KKCD 2HRHA 4XP9L 4GBXD 4ZUVB 5I1HH 2WLZA 2H0EA 3ARBD 3BEVB 3V5HA 3RFZB 4TVUA 1IE5A 4JRXD 5IT2H 4QPEA 2IWKA 1IKNC 3H1ZA 4YXLH 2B1AL 3HHSB 3I50L 4QXTB 3WL9A 1WD8A 3LD8B 4WFHD 2AJZA 3O0LA 2VLKB 4DOHE 3CMOL 3NABL 3MV7B 2MPAH 2VMFA 4Y8DC 2AC0A 4U6VH 4IBVA 1PTZA 1EHKB 2MFNA 3IDMA 3AFLA 2R27A 3F7YB 4PG2C 3JVFC 2X4SB 1SBSL 3LHPH 1N6QH 2VGLM 3DRTB 4NAQA 3PF2A 3KPRE 1SRDA 4UOW0 5GGVY 3UZQA 3H3KA 5ADOL 3A6CH 4I0PA 4X9IA 2YD1A 4WFGD 3SJVB 1IQDA 5AVQB 1MG2C 3CC5A 1F6LL 2PMZA 1DN0B 1ZDQA 3G04A 4KO6A 4DP6X 4WWKD 3EYQC 4F3FA 4ZNEA 2NY3C 1NCUA 4NM4L 3QR1A 3GXDA 3KWWA 3TO4C 5I1CH 2ZAIA 1IM9D 1Y6MR 2O4EA 4JVWA 1IC4H 4K07A 1DFBH 1FRGH 3FUMA 4BFFA 2QGEA 1M7UA 5E4OA 4X99A 3JV4A 1DVYA 2WKOA 1KACB 4U3HA 4Y1AD 4PLOB 1L6ZA 3MV8E 1KB5H 1UD3A 4H0GA 2HRPH 4JY6B 4G3YH 3VG0L 5KS9E 5AW6B 1LNUA 3W38A 2FUQA 1A6ZB 2PWGA 4GQRA 4HUXA 3GIVB 4P5TD 5E6YA 2DM3A 1XGPB 1IGML 2CGZA 2X89D 4NUJB 3TCLA 4MXQD 2FZ3B 4QXGL 3AY4A 4MWFA 5E7FA 1Q0YH 4PRNA 4YBLC 1O9VA 4P23B 3L17A 2WLKA 4NB7A 1HHJA 2VR8A 1YNTA 3PWVA 3L08A 4J3OH 3NRPA 3WNLA 3EJZD 4G42B 4LF3A 3FO0L 3IRZA 4EI0A 2ZOTA 2CBTA 3O6FB 5CBEB 3VYOA 5FEBA 4LPCA 5FYKE 4YWGH 1I1CA 4NZTH 3RKDD 1WBZB 4DP7X 1PQZA 2HMIC 1I9IH 2XI9A 3NSJA 3SDXB 5IK3B 5FYJL 4L3EA 4BKLB 4WU7A 2P5EB 4RVBA 3UBXB 4JLRB 2AANA 1YN7B 4XO5A 3HC0A 5FDWB 1MXGA 1DZ0A 1VB9A 2NNAB 3WLBB 3ULUH 4L5FH 4RWYH 2J8HA 3X11B 1GMEA 2NLJB 2IMNA 1SDDB 2BY3A 3NACL 4WI3A 5D93C 2NY7L 1FNSH 2FO4B 4DPAX 3HE6D 1RJYA 3KXFA 4G8FB 4RMRA 1DR9A 2EE3A 1KNOB 3PYCA 5TF0A 4AY0A 3SO3B 1JF1A 3W3BA 4KK6D 3ORJA 1A6AB 3KLKA 4J23A 3R8QA 1NFDB 3TN0B 1L9SA 5CBAB 5FHAH 5ISZB 1S7TA 2LLGA 5F3FA 3ZDXB 1K8DA 5I76B 1AR1B 1BFSA 2XWCA 3QXDA 2WINA 3K91A 2DD8H 2NSMA 2EE2A 3IFOB 2UZXA 4HWNA 1LO2L 4H8QA 1FG2A 3GS7A 4ZOAA 1Q94B 3EBIA 3OR6A 3L1GA 1UOVA 4MNQD 4AEEA 2VZTA 1SY6A 1XAUA 1DQMH 4XNQA 1EDYA 1WWWX 5LG1A 2IANE 1KENH 3VFMB 4NHUA 1I1RA 5T1LA 3L3OA 5DZOA 4KJQC 4XP6H 5I1JH 4YZFF 3L48A 2Q87A 1S8DA 4Q52A 4Y5VC 1ZTMA 1HDMB 1VFOA 4EUPH 2YD0A 3FN3A 4UT6A 3ESVF 1VACB 2AV1B 3NCJH 5E8NA 2A6JB 3WDHA 4FL4B 4P59H 3V95A 5MENB 3NIGF 3RIAF 4R7NB 2AQTA 2VKXA 2DL2A 3HLKA 5CJBA 5B38A 4K8RH 2B1OA 3VMPA 3FUEA 4XXWA 2BOBB 4NPJA 2PTTB 3JTTB 5DGQA 4Q9RL 2WPGA 2IPTH 4IEFB 4KRLB 2WVTA 4DN3H 2IV9A 2VO8A 1MJ8H 4DO6A 4MJ2A 4FQ2H 5EN2B 4YBHA 2IOMA 1J0HA 4GPVA 2AZUA 5J4MA 2APSA 3ECVA 5E99L 3AREA 4XAWH 3BD3A 3KM1A 4F15B 2IF7A 2R2HB 3QPQD 4AUJA 4N0CC 3SKJH 3FU6A 2IFGA 4OM1L 4QOKB 3TT1H 3V5DB 2CKBH 4JFEE 4AZUA 5IF0A 5ES4B 1E3FA 1KN2L 1X5AA 2XQYK 2A6DB 1C08B 3CAFA 1T5XB 1NTDA 2GSMB 4NT6B 1U92B 1OCOB 5GGVH 5GIRB 3ARDA 3N50A 4PG9B 4X6DF 3SYQA 2QSQA 5A6MA 3U79A 5DEZA 1CD1A 2JVUA 4F7CB 5HHQB 3KJ4C 2P3YA 5CGMA 1VDGA 3SDDC 1MWAA 1RURH 5I18L 3VFSA 3NSDA 2UXGA 1NC4A 3K72A 4ZOEA 1XAKA 1GC1H 3CIAA 4LBEB 3TTSA 2ICWB 2WLJA 1UB5B 1RIUH 5DLLA 2E59A 5E1HB 2LE9A 4S10A 3S8GB 3BT0A 3FH5A 1LHZA 3PWJB 5DUPH 1SHWA 3GSNL 4Y19D 1FFQA 3NUKA 4WO4D 3NESA 1UD5A 5CN2A 5AOZA 4R84A 4IOFC 4B41A 1SJMA 4LVOC 4LCIH 1DO6A 4RETB 1FL3B 1TPXC 3MLYH 3WUWA 4G6FD 3ZDZF 2YRLA 1H9DA 1G7IA 5EU5A 2DQIL 1HHHB 2EH8L 2ZKMX 4FNRA 3CVDA 3MJ9H 1GVIA 3NFSL 4O2EA 2PO6B 4RGMC 4FXKA 3LVEA 4KXBA 4EDWL 5DHMC 3VTTA 3LN4A 5TK4A 1TFPA 4M61B 4ODUB 5F70A 3VXUD 4AJWA 3TVMA 4XNDA 4TVPE 1SDAB 1TQSA 2HFEB 1G7HA 3TH3T 2XIBA 5J13B 4DK6A 1HSBA 1ET5A 1EJFA 2ADJA 2R56H 1CG9B 3NSCA 4RMTA 4ICXA 1E9PB 3FTWA 3GRWL 2IAMB 4K3DH 1KB9K 4YFLF 1MLBB 1UXMA 1WCBA 4K7PY 5DRNA 3N55A 1G7QA 3BVVA 4XP1H 5D5MA 2CRZA 3F58L 5DRWA 3PWLA 3DYMA 4PJEF 1WCQA 3VMNA 4F9PC 5B3JF 3RVUC 4X98B 2ZOKB 2FWOB 2AAVA 1CLVA 4WGKA 3BD4A 2CLVA 4YXKH 4FS0A 1G7JA 5E8PA 5HGBA 5IP4A 2PPAA 1S9XB 3EJSA 5F7WC 5FFGA 4Z7VA 2JTYA 2W80C 4LSSL 4ZTPH 1QATA 4ZMVA 5KJ7E 4ODBD 1TIUA 3S3CB 3GFUA 1NIEA 4WDIB 3REVB 3CSYA 3KEHA 5CJQH 3T08A 3MLUL 2GAZB 3P4LA 1OWRM 3Q2NA 4ZSOB 1JAEA 1NKRA 3N9GL 4B5EA 4WJ5A 1EUUA 4KDWA 2HJFB 1XR8A 1EEQA 1ZT7A 3L1OH 2V4LA 4P99A 3U30B 4A68A 1WYJA 2WZPD 2EXYC 1NGQH 4O51B 4BDVB 4QXWA 2R23A 3DIFB 5EBWB 3T65B 1CIDA 2BNRE 2VRKA 3GMRA 4YC2C 5D7HA 1L5GB 3WIFB 5IY5B 4FQPA 3LNIA 4GRLC 4FQQB 2PP8A 3OVUB 5BQ7B 4GQPH 2R4SL 4BRVA 2H3KA 4Y89A 5CJ5A 1F56A 3T3PF 3B3IA 5AB9A 4MAYD 2WD0A 3L3GB 4YDJB 1QACA 1H8LA 5CZXD 4S2SB 1R3HA 4Y9CA 1M05B 3UAJD 3T09A 4D3CL 4NKOB 5BVJA 3DETC 3LS5H 2JB5L 3BPNB 1EMTL 3KGSA 4P48A 1I9JH 3R7RA 5GRYA 2E7BA 4Q2ZA 5IVXB 3BE1L 4XPBH 4JFDD 4GUCA 2LVEA 2R4RL 3LSOB 2YXFA 4PS3A 3WNPA 3DLQR 4X6BB 5FHBL 1KIQB 2VUYA 3MRLB 2OMYB 3QK0A 4RX4D 1KLFB 1LGVA 4AUYA 4N24A 4OJAA 4AVIA 4JKMA 1I9RH 2WC7A 4YFLI 3FO1B 1V5JA 5A2KH 3DUUA 5JW4R 4I1RA 4IGBC 1OTTC 1VPOL 2A77L 3VFWA 1PAMA 4POZC 4O2FB 4AG4H 1I3RA 2OXGB 1KB3A 5ABZA 3FCSB 5J06A 4DETA 3OSVA 1NMCB 3LX9A 3DGGB 1ZS2A 3V0VA 1DEEB 3BOVA 5EDSA 3TPKA 1ETJA 1FZJA 3KLSA 5LKNA 3RBGA 1HWGB 1KZQA 2J6WA 4WFFD 5L4JA 2XETA 2O26U 3GLDA 2OMZB 3Q1SH 4FRWA 3CQPA 4MCMA 3P2TA 1BP3B 5E95B 3VXOA 1J8KA 1ERNA 3BDXA 5DQJB 4K3GA 5IB2A 4AIZA 1SM3L 5BZDB 5T5FA 2ITDB 3HZVB 2F54B 5KBLA 4HS3B 1JZ7A 3SJVE 3BSHA 5TE7H 4Z95L 5INCA 4OI9A 1QQDA 1NGYA 1T1XA 3B7RL 2NX5D 5JORA 3D39B 3FQNB 4O2CA 3U4BL 3PWPA 1MFCH 5FM8A 3MNWB 4NO0B 2J21A 2PP9A 1A02N 3X1GA 3EYSH 4KRPD 4X7FC 1JGLH 3L3IA 1DBBH 5AVXB 1MRDL 3VAEA 1KG0A 5IBLC 4G8EA 4XX1E 4TULL 1A7PH 3E9TA 2ORBH 1A5FL 1MFMA 3SPVB 4FFZL 2FSEB 3N41F 5SX4I 1T4KA 2ZONA 4MYPA 1P5VA 5T3ZH 1JPFA 3P4NA 2EIMB 3B9EA 3QEHA 3DIVA 3NTCH 4S1SH 4YK4B 2JQAA 1PDKA 4PLKD 1FAIL 3DGCR 4DGIH 4IKNA 5DZJA 4C59B 3LEXB 1ED3B 2HH0L 2RB8A 4TV3A 5KBKA 1WE5A 2E76C 3HFML 3K8MA 3PL6A 3V6BR 5KJRL 5B1JC 5B3NA 2C1OB 5C6WH 3FQXA 4NLAA 2XG4B 1I1YB 4LKCA 4QY8B 4KQ4H 4Y8AA 3LEYH 4EZJA 4YDIH 3DV6A 1CLOL 1BMGA 4Y5YA 3TNNA 4A66A 1KCVH 1UACL 4MB5A 3BFQG 4U1MA 2V7HA 3IMUA 4W68A 5D1XA 4WVRA 4JHUA 1BMWA 4L4VA 2P5WE 2ZOWA 4KKBD 3QFJE 4XNZB 5IMLA 3SDXE 3DX6A 4YVNA 4AC2A 1AO7B 3FYEB 5KBPA 4F24A 1YEFH 4LPVA 5D72H 3ARPA 3DHMA 4UI2A 2K6WA 2P5EE 4L29B 3IWVA 3RGVA 1WK0A 4QRRB 2NDGA 4CSSA 5C6TH 1CMOA 3EDDA 5I8OL 1G9EA 4IU2A 3WBDA 2PN5A 2P44B 3VFTB 3DTUB 3N40P 4IDLA 3ZKQD 3DV4A 1Q1JH 5K9KA 5FFLA 5C8JA 5F0JB 2DY2A 1RJZA 5FECA 5HBBA 3MLXH 2GSGB 4R7DB 1SOKA 1KMGA 5AYQA 4WSJA 1EERB 2VISA 1JXGA 3BPOC 3MRDA 5E8DH 2HKHH 1HCVA 1TVBB 1NFDE 1XMWA 1AYRA 1NWOA 1P7QD 3UZVA 4ODWB 4BWWA 5ISZE 1CDHA 2WZ0A 2DB8A 4GG6A 4MD5B 4MZRA 4U1KB 3QI9B 2AEPH 1RHHA 2K8QA 3V6FA 4J8QA 2ZUTA 5AD0A 5FLVA 1IGCL 2VXVL 2J12B 3L4WA 2DQEH 3KPOB 2VDKH 3FPXA 1ZHLB 2EDTA 2VJXA 3RNQB 1XBDA 1S7WA 2VQ1B 1LDSA 3QJHA 5AZ2L 3B6SB 3MCYA 5FM4A 1BGXL 3FQ4A 2GITB 4XVSH 2VDOB 1G6VK 3DJSA 2H0FA 3P02A 4RDBA 4KMTL 4RFOH 5C08D 3LZFH 1RK1A 4TL4A 4I9WE 4TSAL 4S11A 4HZLB 5GS1C 1OLLA 5EA0H 5ESAA 5EH1A 1G43A 3TASA 4U6TA 2BVPA 4PJAA 4HW6A 4V11A 2X1PA 2YMXL 4NUPA 3VRIB 4OB5H 2CO3A 5JW4Q 5D7LA 4AJVA 3QHTC 3FT2A 4XCFL 4NAJA 2H6OA 3QDGB 1MFEL 2BVYA 2Z7UA 1IAIM 4AYBA 2EVHA 1E6OH 4KPHH 3X3GH 4TNFA 3EDKA 4R7LA 5FOJA 4FI7A 3WFDL 1R19A 2EDLA 4LCVA 2QHRL 4Z77B 4WO0A 1JD9A 1QUNA 5ALBL 1HSAB 4PJHF 1AGDB 1K2DA 1ZTXE 2EEAA 4QKTA 3TPUB 4E41D 2WKLA 3BAIA 3MA9H 1FO0H 2R83A 1F00I 3OX8A 4JFOA 1X5IA 4RZKA 5C0RL 2HWZL 3ABZA 4ODTH 1IT9H 5E4IA 3SE4C 1CURA 1J1OL 2WZ5A 35C8L 3MFFB 4FXGA 4QOKE 1HOCA 1HQ4B 3UFIA 5J89A 1UM6H 5HI5D 2DF3A 1TG8A 3IDJA 5ACLA 2Q10A 3KYNB 2B3IA 1RZIB 5TDOB 5L2KB 5CJ8A 2FGWH 3MJ8A 4RDQG 1T03L 4WI0B 4PJ9B 5JYLA 1I8UA 4X8XA 4XBPB 3UJTH 5DYOB 2VDLB 3RVXC 3VE0B 4ZS7L 9CGTA 5DRZA 5DK0B 3WXWL 1GGTA 4HBQA 3QXVA 3U4KA 5J1AA 5H37G 3IDGA 2ERJB 4JG1H 4ZZFA 4EIGB 3HI5H 2YRZA 5MERA 2CUIA 1MCWW 2G60L 3F65A 2BSRB 2VOTA 3L4UA 3OKOB 4NIYE 1URZA 1JHTA 2NYZA 1N59B 3Q48A 5DLML 1KCWA 3FL7A 4X7CC 1G9MH 2NXZD 1U6AH 1ZLWK 2BW4A 2ZP8A 2WQRA 4YEFA 4OT1L 1ML0A 2DQJL 4JKLA 3MJ7B 3ABKB 3DPBB 3NOIA 1YAZA 2BS8A 3HC2A 5EEWA 4HT1L 3CBJB 3AU0A 1X5XA 2JXMB 3EOAA 5FW7A 1EEUA 5C3LD 2FBRA 3ET9F 3VXTA 4V33A 1ZHNB 4MQSB 2V7NA 4XNUL 1ROWA 2Y3NA 1YEKH 4UT9L 4CMHC 5CM1A 2J6EA 4LAJH 1G7PB 3OXSA 4UAOB 5DJYA 1NINA 3S36L 4OLVL 4PJ8C 2J4WH 4BCYA 1SMDA 3C6LD 4PI2A 4HG4J 1HOEA 3TP4A 1ORQA 3GKWH 1SJXA 3DURA 4DP5X 1J9TA 1T0NA 1Z9MA 4F33B 3VFRA 5KSVB 3JXAA 4GXUM 2AK1L 1KYOJ 2BNRA 4OZIA 3C60B 2ITCB 1LE5A 4PG2A 2DWDA 1IGFH 4QJ5B 3ILPA 5HGAB 3UTPD 4AEHH 3QP3A 4FQJL 1LO0H 1W0VB 3MLZH 1SDYA 1DVTA 2CO2A 2I32A 5EF0A 4BZ1L 3KWTA 1D7FA 3EGDB 2EIZA 1TMQA 1VLXA 1FE8L 1RSFA 1D5MA 2O61B 1UYWH 1G7LB 4U3XA 1NJ9A 3L4TA 4S1RH 1U8HA 1WZAA 1IEAA 2CR6A 2K9UA 5FWRA 4OUUA 1AIZA 2CRMA 5L88H 5SX4H 3CCHA 1VAHA 1ZPLA 1FZOA 1AIFA 1EJOH 1NIAA 3QIBD 1AG0A 2OL3A 3J8F7 1X4YA 3KG5A 4ZTEA 1SFDA 4HUUB 5IQ9B 2ZICA 1IAIL 3B56A 4PJIE 1AGBB 3OLDA 3EIFA 2X70A 2DLIA 4JANB 1ZSDB 1GAFH 4M7ZB 4MMXC 1KYDA 3MREA 2MH4A 3H85A 2A2QT 1ZK9A 5BXFA 2OYKA 2OX5B 4PGEA 5FX3A 2ICWJ 5HJGA 4Y5XA 1KXTB 2WO2B 5FUCC 2RGSA 3C6SB 4J3WA 3B34A 3SE3A 3U6RB 3D18A 4IBSA 4KO7A 3ZTJH 1KCKA 3VWKB 1GZQA 1Z3GH 3O9WB 4HOMA 2YMOA 3BX7C 3EUDA 1PLGH 3BH9B 1TZ8A 2E9JA 1PSKH 4HAGA 5IVXE 3UBHA 2FUTA 1N6UA 2HAZA 3ARYA 4POYA 2WM0A 5JW3L 1TUPA 2Z8RA 4L18A 3DUHA 2CD0A 5EOCJ 5TDPA 3AU1A 3GEFA 4N2IA 3ZMRA 5LN8A 3O3BB 1FH5H 3FQYA 2ZWNA 1VZHA 1ZOXA 4FGMA 2X4NA 1PY9A 2W60A 1OSEA 4HC1A 2W1NA 4AEFA 1E4KC 1YC8A 3X13A 1B0GB 4JG0L 2A9NL 3CXDL 5CHNA 4H1LG 5IBTH 1BOGB 5CCHE 1QOKA 5C0IA 1EIBA 1Y0LA 2YD5A 4KKLC 3SDCD 4Y88A 4ZFGH 5LAXA 3PDOA 1CICB 1WWCA 4LMQE 5CZVH 1F4XL 3QIUD 5HDBB 2B1HL 1F90H 2YAEA 3BDYH 1VIWA 2XZCL 3WN6A 1PMYA 3W0WD 2MKLC 2P47B 2DDQH 4M6ML 1ZANL 3DO4A 3AROA 3GIVA 4M1DH 2QTVA 4Q6IB 5GZOD 1DANT 2B9BA 3VACA 2F7QA 4KI5D 3CFEB 1MFBL 4WHYG 2GK0A 3HPLA 3IU4H 5C97A 4JKPL 2FZ3A 4K3JL 2AJSH 1U2CA 2F54E 5PAZA 3SKUD 2F7IA 3LKQA 4ABQA 3SKMB 1S5HA 5JXED 1OSPH 3EYFA 3T77B 4PH8A 3TBSB 3QRFM 2PCPB 3AG3B 4HOXA 2I07B 3D39E 4JREB 5ICXA 2XPZA 3T2LA 4KV5E 1UG9A 4HYTB 4FG0A 4M62L 1CFQA 3TNMA 2P5WA 3BQUB 3QFJA 4P4KD 5IMOA 3CSTA 3PGFH 2OJ1A 4HV8B 5HGDA 5C0AD 1JPEA 4PJGA 5AVYB 3SQBA 3KLAA 1LWRA 2HFGL 5K1NA 3O8XC 1IGYB 4P2OA 2NNAA 4JM0A 4M6NH 1JZ2A 4LEOA 2HVKA 3KPMB 3KPLA 4DVRH 4JQIL 3GS4A 4PRHB 4P46D 1EJ6A 2ZTBA 5MP6L 1DUZA 1WGOA 3ISWA 1WEJL 2XV3A 4PJ5D 2YQGA 1JGVH 3MNZB 1UZ8A 2V5TA 3P11L 2DAVA 1OKEA 2A1WL 3T2NL 3FQRB 4XMUA 2OSLA 4M3KB 4XVJH 3NCYP 1RULH 3HE7D 3MNDA 3CVIL 3LKPB 3ZKSD 4XTRC 1G0XA 5ISZA 1DQVA 4PREB 5I2IB 1R33A 2H2SC 4I3SH 1NEPA 1T04B 1Q9OA 1VHPA 3RVTC 4IKKA 3CVHL 5JIMA 3F83A 1AO7E 4P2QB 1Q94A 2ADIB 5G4MA 3BUYA 1WA1X 2B39A 3FF7A 2OYLA 2CU9A 3GBDA 2NNXA 4KX7A 3THML 1I1FB 1N0LB 2NUTB 1KCRH 1KXVC 3HMXH 2E7MA 3MLVL 4HF5H 4RGNB 1BFTA 3M7OA 3LRKA 2D0HA 3U2IA 1PY4A 1HI6B 1QFOA 2H6UA 2ZX5A 3FN9A 2DQDH 4PWKA 1ONQB 2WO3B 1F8TL 3IJEB 4PJ6A 1EBAA 3AZUA 5ETUA 4IKIA 4EI6A 4OGXL 2NY6C 1HE7A 1XSKA 3MBED 4GKSA 4UYPA 4CSTA 4OGAC 4PB0H 1HT6A 1EFXA 4KVCL 5BVPH 5DA4A 2GUOA 4ES8A 3ETSA 1DQKA 3HNVL 3L3JB 1RJLA 4DEPB 1QI5A 4DH2A 1SHSA 2BM3A 4A7TA 4KK9D 4G5ZL 5DJ8B 2BLFA 4Z7OB 3RL2A 3SE9L 3V0WH 3WLWC 1MAML 1S7SA 2XYBA 3MRFA 3MRBB 3SPIA 2QZQA 1YEWA 3NEOA 1JFQH 1TZGL 3QUZC 2IQ9L 4R96A 4HAFA 4TUKH 5DJ2B 1WA2X 1D5IH 2VZUA 3RIKA 3FQWA 1WZ1L 4S1QL 5FYJU 2ZXQA 3QHFH 3K46A 4FE9A 4PHXA 4R4FL 3H7LA 5I74C 3LZOA 2Y5EA 3Q2WA 1KPUA 2VL5A 4H40A 3RDJA 3VH8A 3RWHA 1QEXA 4YHPB 1ECYA 3IFLL 4LU5H 1OOAA 4PG9A 25C8H 1FFPA 1E50A 2JQMA 4OCRL 3GRBA 4QO1A 2YD3A 2VLME 5D1ZB 3US1A 1WA0X 1BZDA 2FEEI 3EFFA 2DYSB 4MCNA 3QDGE 5ITBL 2BDNL 7PAZA 2APWA 4MD0A 2I27N 4MNGA 2VLJA 3B9KC 1QSFA 1QW9A 2WXQA 3PU7A 1VZGA 5CZRA 1ESOA 4GP4B 5E5LA 1R47A 2Q86A 3F85A 4JHWL 1ZGLM 1TZHA 3P9LB 4MMYA 3QUYB 3DSFH 3L7FA 1UKTA 4PUBL 1Y1UA 4M4RB 1A1NA 2I69A 4IRSB 1KYUA 4O00A 1SXAA 3QARA 4XVOA 3UGUA 4KITB 1CBJA 2AK4E 5JHAA 1JGUL 3C08H 5FW6A 3NAAL 4NQTA 1V3LA 4OZFA 4UU9A 4DUWA 5E08L 1HHHA 1UATA 3FSVA 3V8OA 5DZ9A 1TU2A 4ODHH 1A3RL 2BZDA 1I3GL 3D3VA 2XVBA 2XX1A 3D85B 2Z8SA 4XNMB 3MRHA 3OKYA 5HDLA 3X1EA 5F6HJ 3C5ZD 1TSRA 4WNSA 1Q9KA 4AKOA 4Q9QH 2EXWD 3TZVD 2VSMB 1LP9F 4B9IA 1RXLA 3LYRA 5ESQA 2XIIA 3P40A 1CG9A 4OCWH 5LG6A 2VN4A 1G6RH 1O9ZA 5LGYA 1KCSL 4A6YL 1IM9B 3L3DB 4ATTA 4N68A 2Y1VA 3ULVD 1MLBA 2ZF8A 2QJDA 1M7IA 2VSCA 4OZGF 4L1LA 1TZIB 3PWNB 4EI5C 4Y1AB 4R90L 2Z31A 1J5HA 3F5WB 3D4CA 3HRZB 4TQEL 3QNXB 3KD4A 3O2VL 5SWSD 1XF3A 2OK0L 5L4FA 4I89A 3T6QC 3VGAC 2CCLA 1J1PL 1CLCA 1CTOA 1UD2A 1KB5B 3EXLA 1E5CA 3RTLA 3UX9B 2H32A 2G75A 1JYWA 4R0LB 5AUMB 4JFFD 3A3YB 1UJ3A 3K2UL 3QYNA 1EV2E 1MQKH 2OR9L 4NBXB 3IJYB 2AP2A 1M7DA 4LOEA 1QD0A 3WKYA 3DKHA 2BIHA 5FGSA 4I1PA 2HN7A 5M7QA 3LIZA 2UX6A 5IV2A 2R1YA 5JW5B 1KDIA 3MGTA 4HPOL 3ABLB 5GS0L 1BSIA 5D4IA 4ZXBC 5EU3B 3X17A 4ZFOL 4X7EC 1ZT1A 5T33H 3BI9X 2F7RA 4URTB 4W9ZA 4PJIA 4CKQA 1SXSA 3HUJF 3LH2L 3TBWB 2C1PA 1L5GA 3OHXB 3QUXA 4KJPD 4H8WH 2F9BT 3ARFD 3T4YB 4MB4A 2AEWA 1DSFH 5C0DA 2BW5A 4DGUA 1I8KA 3KYMA 2RQEA 3F01A 2NY2B 3Q44A 3VXMB 2Q76B 1FWXA 4JG5A 1YNLH 1G0YR 2Q2LA 3LZPA 2L4OA 3P0VH 1LO3L 4N28A 4DP4X 3RTQA 3BLKA 3NRQA 2WLIA 3IGAA 3WIHA 1CJYA 3BCFA 1OM3L 3CHXA 3N44B 2G2NA 5AW0B 5C0FB 2OV0A 4LCUA 3KYKL 2A6KA 1RZJL 5FS5A 3E8UH 2VR4A 2AQQA 3IDXH 3LNGA 3QFDA 3GNML 4UQ2A 2CJUL 3CH1B 2V5RA 5JPNC 2ZXGA 4G6AD 4X6BA 2XPGA 3JVGA 4D0DB 2ICES 1MG3C 3GO1H 1RIHL 3IKKA 3EHBC 5IKCB 2HVJA 1SLWA 2CQVA 3I3BA 3RZCA 1FLTX 1QNZH 2Q1EA 4OI7A 4XNXH 1ZGLP 3EJQA 2PNDA 2M8XA 3QIWB 3ZRFC 1J5OH 2A9BA 4UOW1 2P9RA 2EYRB 5JO5A 3F7RA 2GKIA 1NBQA 1DTUA 4X4XA 4KDTC 4M56A 1DEEA 1W0YT 4Y2NA 4M9OA 5K1JA 1QABA 4AZ8A 5IFHH 1DO5A 4EUPB 3OAZK 3D0VB 4DZBB 4RMUA 4WUUD 2IGTA 4H88H 2D3NA 2EIDA 4OAWB 4RNRA 2GFBA 2J25A 3CHOA 3GLEA 4TSBL 2LT9A 5AAMA 2JKRM 5I0XA 3P4OA 1XH0A 3NJVA 3QCUL 5CR1A 3VXSA 1ADQL 5EOQH 4J7RA 4WCYL 4OV5A 4QEGA 3VQLA 1ET7A 1NL0H 5DVOA 3M6DA 3RZWA 1WAPA 4NIKB 4GSRA 4QHLB 5E94B 5DTFA 1LD9A 1ZT4A 1A1OB 1AKJA 4KFZC 1QFHA 3D39A 4I13B 2EIEA 3HB3C 2NTSP 1XF2B 3MNWA 1AZZC 4PGBB 2EZ0D 4Z78B 3ARGD 4MQXC 3TBCA 4P5KB 5HYJA 3SDAB 1R0AH 2CKBB 2BNQB 4FLHA 2VLLB 4GQ9L 4WENB 1KT2A 3RBSA 2BC4A 1EZVX 3O6LH 3L7EB 2PCYA 3Q7JA 4N1HB 5GS0C 1NMBL 2JIXD 3CFQA 5ID1B 1FDLH 4N22A 1V3MA 1K6QH 1II4E 3TWCL 3BP6A 1CWVA 2W9DL 3KM2A 2EE6A 1BHGA 3LNFA 1MRCL 1TJGL 2FJFB 3DTXB 4GKLA 4P57B 2NY1C 4QY8A 4F57L 1SJHB 4NOBA 2ZCKH 3CTTA 4MMZA 1RIVL 3I74A 1Y18B 3RAJL 2R8SH 1REIA 1J8HB 1A2YB 3Q2CA 4H25A 5GZNC 1FYHB 2EEXA 3OKLA 4QJ4B 3TTYA 4L4TD 4HCFA 4O58L 4YHKH 2XRAL 3QS2A 3UABA 1MRFH 1GYVA 3FKUS 4L8SA 1M71B 2X42A 2ZXEB 3H9HB 4I77L 1FFNB 2N3JA 3O3EB 1RZJC 4F1ZA 5E1IA 5CEZE 2KLSA 1MW0A 4GFXA 1YNKL 4NWTL 5LGHH 4A7VA 4JFQB 3FH8A 1FL5A 4JM2C 4OZHB 2YKKA 2UYLB 1EAPB 5E2VL 3NZUA 3L3KB 4PRHE 3QZPA 1VEOA 4GFTB 4JY5L 5EU6A 3NJMA 3UG3A 1HILA 3VO0A 1BEYL 3TV8A 4B95C 2H9GA 4H44C 4HJGB 5CNHA 3V10A 1CC3A 4FABL 2YR3A 1IFHH 3H4HA 4G6ML 2VZSA 3H9SD 2YFNA 4Z3GA 4J3SA 3S4SA 2MHAA 4CADA 2E4FA 2QMJA 2QKIB 4BUQA 1FNGB 4DCQA 1AHKA 1IKFH 1S7XB 1XDTT 5KVFE 3UJJL 3QI9A 1V55B 4R5VA 2G2RA 4LHUA 4JJHA 4RGOH 4X4YA 3DSNA 3KPOA 4E42A 1CO1A 4OZ4A 4P2AA 4AQZA 3G5ZA 4P2QE 4F9LC 2B4CL 5JZ7C 3I9IA 4NI3A 1WAAE 3CE1A 2YPVA 5A3ID 4Q58C 4L8BA 4AEIL 5DZPA 1YNTF 2GITA 4A2DA 4XAKD 5CMAA 4PJXA 4XVUC 4RGNE 3NJXA 3OKMA 3AAZB 3C09C 4ZUSB 1JNNL 1MNUH 4DKFH 3IETB 2GEQA 2Y07H 3QDJD 3F2LA 2PWFA 3V2AR 2HXAA 2NNRA 2DQTL 4FKKA 5GRZA 2BP8A 1DUYB 5D2NA 1YJDL 3QXUA 5CLXA 1TQTA 1EHLL 4AYSA 1L9QA 5JQ6L 1SVCP 2C3GA 3QDGA 3BN9D 2DM2A 2IH1B 3T0BA 1BZ9B 2ICEA 3AM8A 4P2RB 3V4LA 5FB8A 3MMEB 2WTOA 5E5RB 3HZYA 1QBML 3AB0C 4F7KA 4U1NB 2Y7OA 4Z7OE 3EUUA 5EZOL 3RUGF 2E3VA 3WJJA 5HDOA 5TQ0L 3ZVVA 2X9YA 4P04A 1EGJH 4XN9A 8PAZA 3WOVA 3BKCL 2F6AA 4DEWA 2NZ1A 4P3WA 1DVFD 2CO1A 2V33A 3LEVL 3QG7L 2ODIA 2AK4A 2MKWA 4MVBD 4F2MB 5DF0A 4APQD 5JHDD 5HVFB 2Y5TB 4LARL 1XGUB 3I02A 3MLWL 3O0RL 4HIHB 2DV6A 3V7MA 3VNYA 1GKOA 5T1KD 1EHNA 2HTKD 2Y2WA 2OCFD 2W95A 3IJ8A 4DP9X 1W2KT 2PYEB 3IGUA 2HLAA 3AWEA 2X9XA 4UCFA 5DD3H 5DFVC 1YEEH 3GIZH 3A23A 2QQLH 5DEFB 2J57A 3VU2A 3EOBA 4EEEA 5CGYC 1MCJA 2CDFB 3LZNA 1CYWA 3QO0A 3RFZC 1GZPB 4X8JA 2WQUA 2QV2A 1DVUA 1TJXA 1ZXQA 2VAJA 1RU9H 1SN2A 1OCWH 1VADB 4DN4H 2NYKA 3DC0A 4FLQA 3DOSB 1OO2A 3LD8C 3D30A 5DHYB 1C7SA 2UXVA 3HLAA 2W9EH 1PEWA 3K5RA 4ZPTB 4AQAA 4AT6B 4BKSC 2XZQL 1HZHH 1H3PH 2ZIDA 1RUAL 4L37A 4ODXB 3E7JA 3SCMC 2HX8A 2DM4A 2Z4QA 3SODB 4LQ1A 3V6OE 4RAVA 3CLFL 2DQ6A 4XZ4A 4Z3HA 5TFSL 2MEJB 4HS8H 4JFTA 1QO3B 1INDH 1H0DB 3V79C 5ESVB 5F0LB 2RAMA 1VERA 4PVMA 2VQTA 4F8LA 3CN2A 4BCZA 1N7ML 2V2XB 5BUGA 2EE0A 3HJEA 2J8UB 1XO8A 1U91B 3DX2A 4PRAB 2XSKA 3KL5A 1FNEA 4CRPA 1ZHNA 3D69B 1S9VB 2NYYD 3FQ1A 4Z7QF 3ROOA 1D9KB 1N64L 4DGWC 1I85C 4MMXA 3ZGIA 2VC2H 3O41A 3NEEA 2YUZA 2B4CC 4M7LH 3AT9A 4PW3A 4KTGA 3W39A 2FR4A 4J6RH 5BZZA 3B9AA 5IW6A 2YARA 1IBHA 1OGAA 1JD7A 2X2HA 1A7NL 5E0QA 3HI1A 1OVZA 4NO5A 3WE1A 3DUSA 4FTVD 1CXIA 4Y1AE 5J5EA 3CZUB 1I7UA 2A74A 3EOTH 4HD5A 4HUMB 4GKOA 1QAWA 3HBPA 1YJDC 5F8QC 4J3OG 2AJUL 3LIUA 4IOSD 1MHEA 1GS7A 1WG3A 3TU6A 5DMIH 4B9PA 3EGDA 2XVLA 4UQDA 4O4YL 2O61A 1U41A 4P23C 3W9DA 4I85A 2C3VB 2EYTB 3RG1C 3SQRA 1NEZB 4B5ZA 4XN2A 4B9FA 1UXWA 3O6FC 5DVNA 1I4FB 1JVKA 5HHVL 3T2PA 2XKSA 3SKNB 2MIZA 2WXIA 3HMWL 2F7OA 1NUGA 2WP3O 1OSZB 3MPCA 3EYUH 3TA3D 4IOIB 3QQ9C 4HUUA 4ANVA 5I1DB 1CZ8H 2D7NA 5B7FA 1FZKB 2P8PA 2G9HA 3RDTA 3KAAA 5KVMC 1JIBA 3JTBA 1ZSDA 3S5LA 5I19H 3QFGA 1H3WM 4OLZL 2Z93B 4YAQB 1S6NA 3NCYS 3GBLA 4O9HL 1F4YH 1NDTA 3VWJD 2WQWA 3GXMA 4UANA 2GB2A 1OM9A 3VXME 4L5FE 5IUSA 5I6MA 1E90A 5EWIH 4KU1A 4TLKA 5I6KA 1ES0B 4UV4L 4U1HB 3SO3C 5D5MF 3U6RA 1JZ6A 3GHEH 1HXYA 2BSSA 2GBVA 3CZNA 3F7PC 4RAHA 5I5JA 1TYJA 1J05B 2PW1A 2GJ6A 1X9RA 5EBMB 4MS8D 5F7KC 4RMWA 2P45B 1KV7A 1V27A 1AXIB 1S46A 3WIAA 1DLFH 2JMRA 2Y7MA 4MAZA 4ZMNA 4NP4H 5BJTA 2ZUQB 5IVZB 2C4FU 1KYOK 1HHGA 4W9KC 3WTXA 2DIEA 3RWJB 3S9DB 3OJMB 1T4WA 1SZNA 5B7EA 3B7UX 4EUPG 4Z7UA 2BFVL 2F74B 5DXWA 1T22B 5T1JA 2YD2A 5C08B 1LO4L 2VDKB 2BOLA 4UIMB 1DQLH 2I9LB 1SBBA 5K9QG 4NZ8A 2CHNA 1UQSA 3LV3A 3MBXH 3NJFA 1T20B 4YHML 4YUEH 2P8MA 5ELIA 1WH0A 3U2JA 3RE0A 1AXSA 1WTGT 1JGEA 1B2WL 3NZHH 2AEQL 5AW3B 3NGBB 2H8PA 3MGAA 3FMGH 4ERSL 1E5ZA 1CL7I 1X6LA 4ZAKB 4NKDA 4B7IA 1P7HL 2K1MA 3I9PA 1AD0B 1TJIH 2JNZA 4Q6IA 4X7DC 4LLVB 4A2HA 1UM5L 4PM1A 2EP6A 4AYDC 4YHZH 2WK2A 5T5NG 4MTMA 5J8OA 1NM4A 4NCC2 2YEZB 3FQUB 4K9EL 4X6DB 4BFNA 3NA9H 1TVDA 4EXKA 1KGIA 4QLWA 4QXUL 1WSST 1QFWL 3KGTA 4OCYH 4XHJC 4XPGL 4BQ6A 1JNJA 1B9KA 4O5LL 1P84J 5KSAB 3MYZA 3PWUA 4LOVA 2EDBA 5JTWA 3V4VA 1FO0B 4PY7A 1FZMB 3IGFA 2J71A 1TKWB 1INQA 5GHWH 2ED6A 2BNQE 1VCAA 4FLRA 1HQRB 1SJEA 1I8LC 4WU5A 2E6JA 1CLZH 4FKHA 2OMBA 3RVWC 1E6JL 5JLZA 2X4TA 3ZHNA 1CDGA 4LHJB 1TYEB 4H0IA 3UYOD 1NOFA 1BJ8A 2X4PB 2NR6D 1CF1A 4NBZB 4XMWA 2YOAA 2ZKHH 3MNZA 1W91A 1R5VA 2BNUB 1WS7A 4J3XA 4UZUA 5GGQL 3LQZB 4HFWB 4Y19E 3F00A 3KH4A 3RP1A 5L9DH 3KS0H 4A7GA 4NQDD 5T1DL 1WC7A 1MXDA 2N0KA 4ONHB 2J1ZA 3BYTA 3HG2A 4QRFA 1J8HE 1ZLWH 2B14A 3X3FH 3ZJAA 5KYXB 2OMUB 1ICTA 2YPKA 4L8DA 4NZUL 1JVOA 3MROB 4TLSA 5EO0B 2WWMD 4HWZB 5DDHA 4FX5A 2F5BH 3MV9D 1BF2A 4P2QA 2BHYA 3DVGA 2PO6C 4LVHB 3VD2A 2VITB 1HCZA 5B39G 3VXUE 1JNHA 3RWGA 4JFWA 2GT9B 4K9JA 2D7MA 3ATEA 2VABA 3QORA 1O5PA 2A9DA 4PSRA 4YL9A 2QLYA 1CFSA 4OZHE 1JZ8A 2N7SA 3KW7A 4P8QA 4ELDA 1CXKA 4YEEA 2W0FA 2Y9RT 1BX2A 2P1YA 2ZSWB 4PJEB 3L5WA 5I1IH 2W8CA 1BDYA 2D7PA 5EPMA 2XNAB 4UIKL 4LDEB 4UM9D 3AY2A 4XOAA 3WSQL 3CXHK 1NGPL 4L1DA 3T6VA 2O5NA 4Y4FA 2LLLA 3APMA 4MZ3A 1GY2A 2Y2YA 3HG1D 3Q6FB 3UBFA 4HIJA 5AKSA 2FT8A 5E2JA 4O02A 4YO0A 5BRZB 2A9AA 4NBYB 3C9NA 2YK1H 2VNCA 4FNLL 4XPTL 5AG9A 5J56B 1OGSA 3WO3B 3BGAA 1IJ9A 2AEIT 2VR7A 3F6IA 4JGJA 3UC2A 1PNDA 1INEH 1F1DA 4EZKA 3MRJB 3UPRB 3ZUCA 3KLQA 3OMIB 1J12A 3I3DA 4ICWA 3W57A 3CDGB 3HOGA 1GR7A 4KX9A 3FHQA 4OLWL 2WVVA 1DBJH 4FADA 4Z8FH 2XWBA 2YN5A 3DARA 4RQQB 5I24A 1J9QA 4XMXA 4Y0GA 4N8VG 5D2LA 8FABA 1ZHKB 2FIKB 3PP4H 1MEXL 4K9EC 4C55A 3T0ED 4Z0XA 3QIBB 4DT2A 5CIPA 1CDCA 3JYBA 4M7KL 5DR5H 1OAYL 5LQBL 4EI5A 1YAIA 3KXFD 4GBXA 2A0LD 4D7PA 2EDWA 3NCFB 5I5RA 3ARBA 1T6VN 2I60H 4JRXA 3X12B 1KC5L 3NFNB 1BM3H 4Y2OB 3MO1B 4U6HA 3T3PB 3OR7A 3P73A 3UC0H 2X7LB 3C5SA 1OP3K 3FTZA 4PBXA 1K5NB 2FWUA 4FQLH 4UBDC 3TIEA 4PY8J 3BVNB 3K2MC 1SY6H 2FATL 2H3NA 2FK9A 4LSQL 1YN6B 4GB9A 3MX0A 1ASPA 4Y2DB 4F2ME 3I6KA 1JK9B 1F0LA 3O2WH 4UTAL 4GG6F 1OTUC 4RAUA 3BPNC 4LSUH 3ECBA 4LSTL 4N0UB 1EANA 2IH8A 2G3NA 5CFAA 3CVCA 4NJ9L 2K78A 2KKQA 4UT6H 2PYEE 1D6EA 2FCBA 2Z65C 3LRHA 2OJEB 3QR2A 4H26B 4FA7B 1TEGA 3FO9A 1OAKH 1J9RA 4XBEH 2A99A 3APCA 1EVTC 1F97A 1G9HA 2B2XH 5IVNA 1IKOP 2XKNA 4WWKA 5E24E 4MRBA 2HUHA 3CBRA 2AF2A 1T6WA 1JK8B 3MNMA 3EZ8A 4LZKA 1OP9A 3VQ2C 4GW4B 5T3XH 3BAXA 1F11A 3TH4T 1CPUA 2ZJSL 4JRWA 1JCKA 4PJAF 4K5PA 5GRJH 5GGSB 4ZOCA 1FGNL 1P6FA 1HEHC 3TIDB 4D9LH 4XO3A 4GRMA 1XF4B 5LBGA 3Q06A 1W0WB 2NSQA 1GJUA 4GAJH 4N9GB 1OLZA 5IIEA 3BWAB 5EO1A 4I5BB 2ZCHL 4WW2A 4ANKA 4HIQA 4P5TA 2YSTA 4L9LB 2X89A 4HLJA 3VFUA 3ARED 3G6AB 3EYVA 2KLTA 1Z9PA 2UXFA 3GB7B 1U8IA 3L3HB 4U1SB 2VDOL 4A63A 2BSTB 2ATPB 4KKAD 4DP0X 5IESH 4JFXA 5IZ7A 2J8UE 4F80A 1GGUA 1F58H 3MUY1 1PZDA 1NC2B 1C5DA 3IFNH 1AMXA 1F6AA 4JO2H 3LZLA 5KVDL 2KDGA 2XWTA 5LVEA 5EULV 2ZXDA 2HB0A 2HKFL 4G9DB 5C3IA 1RUPH 1IAOB 5L6YL 3WG7B 4WWOA 3SOTA 3ZE1E 4YDKH 1PZCA 2VXSL 3JYCA 4UUJA 3GDCA 3SQOL 4B9ZA 1Q9LB 1BG9A 3N41B 4NKMA 1BZOA 3A6OA 5LXGL 4P4KB 1EXGA 1N5AA 4KZCA 3FCTB 1CL7H 4PS4H 1OF2B 4JQXA 1LWHA 2YSSA 4X6CB 4B0MB 5DD6B 4R2GB 1PJWA 4JM4H 3GXUB 4OD3L 1J10A 4PGCA 5IREA 2JTDA 3PIQA 4JM2F 1X4XA 5C0BD 4HWBA 3RIFK 4P46B 4KHTH 2WYTA 4YK4C 3HE6A 3QA3A 5E2UH 1R3KA 3DMMD 4ZDHB 4EKXA 2JJTC 5GISH 5JDSA 2FLBT 3S97C 5FGBA 5T3ZE 1DFXA 4LNVA 2X9ZA 4HIIB 2CNYA 3I6GB 5FO9A 4LDLB 1U8CA 3P9MA 4N6RB 4HALA 1X5ZA 1XSJA 3ZRCC 4GSXA 3UCRA 3U0TB 3MODL 1JWMB 4DQOH 3BW9A 3S37L 3BGMB 4NX0A 5AL8A 1L4IA 3U1PA 3TVMD 3DBXB 3H8NA 5GGTL 1AZCA 2VDLL 1FNAA 4XNZC 2QVIA 2V37A 4NQUA 2H2PC 3FULA 2HLFD 2ZP9A 4X4ME 2XBZA 5DK2B 4MNQA 2BY1A 2C3WA 1AE6H 3ARQA 1G1KA 2VDQH 3QEUB 5G5DA 5FO7B 4E9XA 5A7EA 2H5UA 1E27A 2FJGA 1XFPA 3PGCB 5DHEA 1H3XA 3LKNB 1JPGB 1P7KB 4PJFA 3E2HB 1KOAA 2CWRA 5C2BL 1AH1A 3STBA 1IV8A 2KL6A 1RH8A 1IZKA 3II2A 1A1MB 1OEZW 3ES6A 4GMSH 1MREL 4UTCA 2DI9A 3IN0A 1UH2A 2LGNA 1S5IL 1BJMA 5DJ6B 1IC7H 4NWUH 4AL8L 3E8VA 4NZRL 4YQXH 1MVFA 3WHE0 1TCRA 3QDMB 4BK4A 3F8UB 5TQ2H 3UDWC 3VXPB 4QRTA 1T7XA 2FX8H 5IMMA 4PJ7B 4CNIB 2V8LA 1X44A 3DX4A 2O5XL 2V9QA 3GWJA 5E8EB 3QQ4B 3ME0B 2EJ1A 2EUVA 1HL5A 1U8LB 1WBYA 2Z34A 2NZ9D 3HBGA 4JZJB 3IDIB 3GUTA 1ANUA 3Q3GB 5IQ7H 3TM6A 3WIIL 4IS6A 3UTTD 3JWOL 5C08E 5L8JB 3RB7A 3SBQA 4IIZA 4M1CC 3N0PB 2F53B 4HMDA 5IHUH 2EEDA 4M43H 1BXAA 1JXKA 4OLYH 3FO2A 2H0PA 3SDYL 1AXTH 3AACA 2HPOA 4D0CA 3PAUA 2AGJH 5DJCB 5DMKA 2HFFA 3HEIB 4IBZA 3TV3L 2WJ7A 4PJHB 1J48A 2ZG3A 1ZGLA 3V0EA 1OD9A 4G7SB 4ODVH 5I28A 5INDB 3MA7A 4OQTL 2P8LA 1SEBB 2QVFB 3GTTA 3HC3L 3VXRD 1IVTA 3CG8A 2IWFA 4OJDH 3UEQA 5I1GL 4KAQH 3BUDA 4BA8A 5BS0D 2IADA 1L9TA 3RY6A 4KVNH 2XFXA 3OKKB 5IJKC 4OGYL 1T66C 5DJZB 3QEGH 4J3UA 4Y19A 1U8KA 2G3XA 4WO4A 4CC4C 3A22A 1PZ3A 3C75A 4ZFFB 2FB4H 4X6DE 2COVD 5IROC 2O5YL 2BWIA 2D0FA 2IC2A 1AHMA 1JDAA 4EN3D 5D96B 1CXHA 1YC7A 3MUJA 4LSRL 3K6SA 1GGIH 1JNLH 1AQDB 2QVTA 1SLUA 2NSXA 2ZAGA 1GW0A 5IG7B 4LRIC 1U8NA 3BP7B 4ZPVB 2NCMA 4XNYL 2P42B 1JG9A 1JZHA 1M71A 1ZEAL 2XTLA 3P69A 2WLMA 2NY0C 4BYHA 4G8AC 2Q7AA 3F7LA 4PJ9C 3BWUF 3VXUA 3U82B 2QDWA 3OPZH 1M2VA 3IJ7A 3GSWA 4CW1A 2GK2A 4J4PC 3RB5A 2F19H 1KJMB 2WXMA 2ERJC 1FFTB 1DBMH 2VH5L 4QF1A 5IUCA 2RFXB 3CZLA 5T5FH 2G0LA 4GG8A 2FQGA 4ZUWB 4WFED 4KXDA 5TJWK 3N3EA 1A3LL 2V0AA 4DESA 4MDJA 4KUZL 1F1AA 2QFRA 1JERA 1QKZH 3BMWA 2DQGH 1YYLH 1G6RB 4GIAA 5DJDB 5E51A 4OFVA 4N87A 3T0VA 3TCXA 1JSYA 4KROD 2PPEA 2GTZB 3M07A 2Z8VC 3O6MH 4N90D 1CBVH 3DPDA 5KJ4A 2I5YL 1KFAH 3WI9A 4AL8C 4M1GL 1IEHA 3G08B 2YQBA 1KN4H 5HPMB 2R1WB 4JFFB 3D05A 3QNYB 1XCWA 4NM8H 3U1SL 4QD2E 1FVEA 4YLCA 3SY0A 3NCWA 3CZJA 3CPUA 1GMIA 5DC4B 2FBOJ 4UAOC 1RUKL 4XVTH 1K8IA 4V2BA 5B3JE 1JWUA 4PJEE 5JNYB 3FB6B 3W11D 1VFBB 4DP2X 3CDZB 4YDMA 1U58B 5LGJB 2BRQA 3JWOC 4YBQC 4NUGL 3KBPA 5H35B 3M46A 3BIAX 5F7DB 2WZPA 4PJGF 1B90A 3CC1A 4ENZA 1CE6B 2VUKA 3GPSA 5E4EB 2Q8BH 4HIXH 3VRJB 3SCMA 1QI3A 3MRQB 1IGIL 1EDHA 1BZ9A 3FT4B 2X1WL 1GIGL 4J1UA 1XEUA 2X4QA 1WFIA 5BRZE 2PABA 3UTPE 1SXNA 3W2DH 3JUZA 5LWYH 4XPAH 2BSED 4HS6B 4DZ8A 1U0QA 3B2UD 4ADJA 2XXFA 1RKRA 3FOLB 5EC2A 1TVHB 1FBIH 4MAYA 4N8CL 3QEQD 1NFDF 3OAYK 1G9NL 4DSYA 4IMLB 1ODAA 2OPCA 2DBJA 3AADB 3UAJA 1T1YB 5BOJA 4TTDC 2AAAA 4OKDA 1IFGA 5CEZL 1TQCC 1BMZA 3VG9C 5HHOB 1SXCA 5IR1A 5E6IB 4JFDA 5DEJA 2RTTA 1OK0A 4L3AA 1CD0A 3LH8A 4AENB 1FV1B 3DECA 3QYCA 4RX4A 3U4AA 2G5BB 2NQ3A 4JDVB 3WO4B 1RI8A 4WSKA 3WHXB 4IRZA 1AS6A 2FDBP 4M7ZC 1EX0A 2ADGA 4IBQA 3TT3H 2ZX9A 3T3PE 3WFCH 2FSDA 3ZTJG 3NZ8A 3CFIC 1JPTH 3ZGHA 1K3IA 1QEWB 5CLTA 4GY4A 4PJDA 1KXQA 1MCLA 3RWCB 4XNAA 3HPJB 4U7SA 2FT7A 4NC0B 1RZGA 7FABH 1MFNA 3T4AA 5CP3A 4WNQA 5KVGH 1GOFA 2VLRA 2H6PA 3WFHA 1IAKA 4F7MB 5B8CA 2PTVA 3O9WC 5ANMA 1LJMA 5A1AA 1P6WA 3B1UA 3GDBA 3QRBA 3VDBA 2XVKA 1EXUA 5ESVA 1I7TB 4U1IA 4WI5A 2Y5QA 2YPLB 5TE4H 2DQCL 2Z7ZA 3FQ2A 12E8H 4W70A 2AI0L 5I5MA 5FKAA 2GW5A 3FSWA 4HWEH 2NX5A 2JSFA 3PNWA 4Q14A 3T6WA 2F58L 2FNBA 1HWWA 4Y9EA 2E9IA 1E8XA 3GBMH 3VRLE 2AV7A 4NQCB 5SWZD 1Y07A 4ETQB 2OW6A 3VTAA 3US0A 4UTBL 3HBQA 4FJZA 2ZD0A 1UOWA 1SYSB 1PZUB 1CICC 4MDIB 4M6OH 3DI3B 4QTHA 1E8YA 1I1AD 1THCA 3DX8A 3FQTB 7CGTA 4WEBH 5F3BB 1GHFH 5DHDA 5A2LH 3ZT5A 4U3SB 5CINH 1KTDA 2DH2A 3OKDA 3HAEA 2R7EA 4GUQA 2ZSVB 3ASNB 3DYPA 3CPLB 2EE9A 1NAMA 2YQ2A 3IVKA 2LVCA 4K5MA 3L9EA 4BA0A 3MJWA 1E28B 1OY3B 4TVPH 4L3FA 4FN0A 1H5BB 3NSFA 2C3HA 4R83A 3B2MA 1RL1A 2BJMH 4IIQB 5IFAH 1NEZA 2XYCA 3FN0L 1HFUA 1H8SA 1O7SA 3PV6B 5E9DB 4HJ1A 5CEYA 1MIMH 4JREC 5IEHA 2B15A 1OARH 3BQUC 3WYRA 3TYGL 2DZEA 1G9NC 4WTZG 2A9MH 4X6CE 1A65A 2CUAA 4W9JC 4HK3J 3KLDA 3B2VL 3VSVA 4HHAA 4K2UL 3WDIA 5IOPB 3I2CH 3QVAA 3H0TA 3KEDA 3LN5B 5I1HL 5IOKA 1XL6A 5IT2L 3R4RA 4KMQA 4HPHA 4XGZA 3D4ZA 1MJJB 2P49B 1FN4B 4YXLL 1BZ7B 4HQQH 3S0PA 3EYOB 1PX8A 1KBVA 4PRBB 4F37K 1C16B 2VWEE 2QR0B 4G6KH 1T1WB 2MPAL 4URKA 4WHCA 1NBVH 4C4UA 1KIUA 3N2JA 4U6VL 4ELMA 1EXHA 5KANG 2J6EH 5BUPA 1P7QA 1X9QA 1YEIH 4ZUTA 1D2OA 1GPOH 4JB9H 3LHPL 4ZYKB 3IXAB 3S35X 4AQ8C 4ZMPA 4ORGB 2XU9A 4DKAA 3FTSA 4HDIB 1UD6A 2CHWA 3CSGA 2F1EA 3LNEA 2Y06L 3A6CL 3BC9A 5I8CB 1T21B 4JN1H 1XTMA 1OGTB 2WB1A 1WHPA 4KNSA 4Q6YA 2F74A 4KXCA 1YCSA 5A6IA 1CCZA 4JVPA 2JKNA 5C08A 4OVVA 2KH2B 3BSZA 3ZQ9A 5KZCB 1SLVA 4RGNC 1QSZA 1TO4A 3QDJB 3JWDH 4B9CA 4D8PA 2X4RA 5I1CL 2XG5B 3BP5A 1DFBL 1FRGL 4K7PX 4R4BA 2YBRB 1A3ZA 5EUKB 2YD4A 1QRND 1NANI 2DBLH 4PJIF 1N8OE 4MXWH 1IVLA 1KB5L 2ZUXA 4G3YL 4BQCA 3QDME 3D12B 3UP6A 4TUUA 1UC6A 3JT2A 1OE3A 4IU3A 3STZA 5IGXH 2WWKO 4NPYA 4L0PB 4PJ7E 2X6UA 4PWEA 1AZBA 4Y4KC 4L1HA 3T1FB 1BQHA 2OL3H 1X5LA 3EYQD 2NY3D 3REWB 1Q0YL 1IIKA 2OMTA 4E41A 3LRGA 3K6NA 4FYSA 1RVFH 3IPBA 1T83A 4X8CA 3TO2A 4PRDB 5FDYA 5ICZB 4X5PA 2IO5A 1BVKA 4JEGB 1RHFA 5JHDB 2O30A 5I17A 3KW8A 4AYID 1NGXA 3BAEH 3SBRA 3BHBA 2HSIA 3E38A 4G8GB 4NZTL 1H15A 1CK0H 1KGCE 1L7TL 3GBNH 1NDMA 3IB4A 4PAZA 1EJ8A 5D70H 3A4FA 5IVXF 43CAB 3LZQA 3QJZA 3ZTEA 4RFEA 1UUNA 1LK2A 4PRID 3I6LD 5IW1A 3ZBMA 3WFEH 5D1ZC 3UIYA 4E5XB 1HQRA 3ULUL 3GMQB 3OPUA 3MCG1 4L5FL 4RWYL 2FL5B 1OF0A 2MQCA 2R69A 1FNSL 4IRJC 5I1AB 1M1XA 2BVUA 2ENJA 1MAJA 1QLRB 3FRPB 4KWUA 2RR3A 5IWLC 3KNBB 5DS8B 3QUYC 4HX1B 4HFWA 1G5GA 4GAAA 2CGRH 4JO4H 4IRSC 2DIJA 2HRLA 2HMID 2H1XA 1U93A 3CZSA 4HC1H 2AERT 4Y9FA 5FUOL 3U1QA 2ZE0A 3V6OC 2DLFH 2YC1B 3LKOA 4MA3B 1WGVA 3U7WH 4DK3A 5K39B 4W9DC 4PP2B 2J3SA 2DD8L 2CGYA 3GJFA 2GTWB 4IKJA 3S2CA 4AYGA 4HSQA 1GYUA 3BXNA 1LEGB 2TAAA 1RZKH 3ZQXA 1MY5A 2JFCA 2I9TA 5C0CD 5IQNA 1DQML 1FYTB 4LGRB 1OQXA 4DO4A 3CUPB 4DVBA 1J88A 1M9WA 3JZYA 3FU0A 1KENL 2O5ZH 1CFNA 2R0ZH 1H6TA 3OKNA 4XP6L 5I1JL 3C6LA 3IF1B 4KV5F 3INUH 2CHDA 4JPIA 1JN6A 4HBCH 4LGSB 3DXAB 3ULVE 4M8VA 4KI1A 4MNHB 2HA1A 2XX0A 2VC2B 2XN9B 3FHAA 4QT5B 1DE4B 1OCRB 3LB6C 1XCXA 4JAMA 2WBJB 3D34A 2O93L 3BKMH 2Z3FA 1UGKA 4P59L 3AS1A 3MKGA 4L8CB 3CMGA 4X5XA 4XCYA 3HRZC 1ASOA 4K8RL 5GJSH 4M8RA 2R2BA 1JPSH 2F15A 3HN5A 3MHZA 2AXJA 1J9SA 4BFBD 5FF6A 5H8DA 2IALA 2IPTL 3AS3A 4DN3L 5LN4A 2J5WA 1AGFB 3KHOA 4FQ2L 4XO9A 3W37A 4KJQD 1MUJB 2VR3A 4JFFE 4R0LC 4TLTA 2Y25A 4A38A 5IM7A 3QG6A 4RIRB 4XAWL 1O6SB 4G7VH 3IRPX 3T0XA 2YAOA 3AC0A 1MHHA 3SKJL 1U36A 2QFPA 4U6YA 3TT1L 2GBAA 3MXVH 2ZXCA 4K55A 4BWUA 4L23A 4P2OD 4P5MB 3BKJH 3RIFF 4J3OC 4OBRA 4MXVE 5EZIH 1JS4A 4AYFB 4ZW5A 1I7ZB 2WGNB 5JIIA 3TEZA 1GSMA 5IHZB 3C5JA 3L5JA 5IVOA 3UBGA 1M2OA 3M45A 1XH2A 3QH3A 1Z5LB 2OMWB 5D1QB 1ND0B 1QBAA 4MD4B 2VKWA 3U46A 2W07B 5HVHB 3OHXC 3WJLC 2EKSB 4D9RE 4Y2OA 3MO1A 1SF5A 1E9OA 4JQVC 1GC1L 1NDGB 3AABA 4X7TA 2NY2C 4I4WB 3ULUC 1K5NA 4H1LA 2AJ3B 2O6PA 4N0CD 4P9HH 5D55A 4ELKA 2W94A 4XBMA 2X5PA 5DUPL 2XIDA 5EOTB 5F96H 3NFPA 3RFRA 3KPPA 4AX3A 3IK2A 1HESA 1PZ2A 2IMMA 5B1KA 1OGPA 4ACTA 3DOIA 4LCIL 1ID2A 2Q9OA 4DAGH 3MLYL 5FCUH 3O4LB 2E7HA 3DX1A 4G1MA 4TN9A 4CVZB 4ZD3H 4BFIA 1TOXA 4NGHH 1QP1A 3ZL1A 32C2B 5ID0A 4KUCF 3SDDD 5HHOE 2C26A 4P3DB 5C7XH 5MEQB 1MNNA 5FYJD 5EDXA 1A6VH 1HEZB 2OLDA 2DKSA 3QULA 5AOJA 5D7JB 2VMCA 3QJXA 4WNJA 3IN2A 1VFMA 2B59B 4FYQA 4TPRH 5FYLL 5CILL 3CHPA 3G9AB 3GMPB 3GMOB 1EHAA 3EG9A 4PJXF 4X6FA 3C8KA 1IILE 1YPZA 2QZ5A 3IMWA 4IOFD 3QIWC 4K3DL 5FOBA 4AXWA 4JZOB 1EZVY 3SDCA 4YSAA 3O11A 1KDJA 4F7PA 4XP1L 4GO6B 4JPSA 1EEYA 3QIUA 4IJTA 1OAUH 3BIBX 1BD2B 4WI6A 4AW4A 4I5BA 3T8VA 4F2FA 4U4BA 5DJAA 1YEDA 1U8QA 3W0WA 4DFIA 4GI6A 3PXHA 3K6FA 5KW9H 2J1YA 2PW2B 2BHZA 4Y16B 4U1SA 2ESVB 2N59A 4K8RC 5KTEH 4WI8A 3CIQA 1A7RH 4MJ5B 4G8IA 5JXEA 5CJQL 5DVLA 4OIIH 3UL4A 2VMJA 5MEPA 1LL1A 3IU3A 1K4CB 1DJIA 5F6HI 1KJVA 1NANH 3DVFA 3EO0A 4NQCE 1D2PA 1KTKE 3R19A 4P4KA 3RVUD 3V5HB 3DNKA 2NDFA 5C0AA 2GY7B 4JKNA 1QSFD 3PPEA 3SDAC 2CH8A 4IK7A 1NGQL 1WVZA 3WL9B 2AJZB 2FLMA 5TH2A 2X05A 4OZFH 4YSPA 2ZWYA 1FVCA 4JZNB 4BBWA 5IFJA 1ACZA 1Q1PA 5C09D 1PG7X 1JE6A 3IDMB 3SGJA 4FMKA 1X6NA 4PJ5A 4MJ4A 1NMAH 4BE6A 5EOCH 2JQZA 4YHLH 4OM1H 2IG2H 4PS8A 4KZEH 3HE7A 3IAPA 1GC1C 4JO3H 4WI2A 4KTEH 3UZQB 2CRIA 4LO9A 4XZUA 3DRQA 1A8ZA 2XFGB 1O6VA 4YPJA 1ACXA 4RH4A 1DANU 2EXYD 3BGMA 2BOCA 4I0PB 2JKWA 3EOYG 3LS5L 1IQDB 2JKSA 3LKSA 3NVQA 3S3BB 4QRAA 2WLYA 3CC5B 1HVXA 4NI6A 5HYSG 1RPKA 1UT2A 2IDFA 3G04B 4XPBL 1NCWH 5EU7E 5I16A 1MCEA 4F3FB 3CFNA 2EACA 2VMEA 4GRLD 3ETBJ 3KWWB 5I1DA 3D33A 4KTDH 3UO8B 1HNFA 3QCVH 4AQ1A 1I9RL 3WTUA 4LPTA 2ADFH 2XQBH 3MRGA 5DUBA 4X99B 1ZWIA 3JV4B 3ZYJA 5LDUA 2Q6WA 3LCYA 1F3DJ 4RISH 4AG4L 1MH5A 2DYPA 2H32H 3GHPA 5D6DA 3IJHA 1LNUB 3FFDA 4PQXA 3DETD 3ZDYB 4HUXB 4CC4A 3MBEA 4KQ0A 3TCLB 3H9SE 3NJLA 2E27H 3J2PA 3HG1B 4I7ZC 5FV1L 4MWFB 2QKIC 1Q0EA 1X5FA 4EDWH 3Q1SL 3C87A 3LIZH 3ZRSA 1HHJB 1JGDA 1YNTB 2W88A 4TSCL 3PWVB 1J0KA 1J5IA 1CGTA 3NA4A 4LF3B 3SBPA 2VZOA 4QHUA 2ZXBA 4GUOA 4A04A 3VI3A 4OCLC 3QQ4A 2F2HA 5GSRA 1NLDL 4IGBD 1OTTD 2VXTL 1PQZB 1S7VA 3EF7A 4POZD 5TE7L 1WPCA 1FVDA 3CLWA 4XAKE 5H94A 4L3EB 3LRSA 1FGVH 1KGYE 3WMQA 1DVXA 2CHZA 1MFCL 4FI6A 1S3KH 3QDJE 4GJTB 3HC0B 2QDVA 3T0EB 3BGFB 4OFYD 5KYWA 1ZV5A 4NQXA 3EYSL 1JGLL 1DBBL 5E0FA 3PUUA 1OW0A 3VGFA 3WIHH 4DGVH 1A7PL 3CDCA 1RJYB 3KXFB 4XN1A 3AG1B 1T80A 5E8OA 5I71C 3DDGA 2K7PA 5INDA 4R8WH 5T3ZL 2XICA 4AKPA 1SEBA 4B9GA 4S1SL 5IMKA 2C9RA 1KLGB 4PN6A 2XBDA 3D0AA 1VESA 4DGIL 3AXLA 3OKKA 1OP3H 1DDHA 1N2RA 1OOWA 3HW7A 1S7TB 1K8DB 1AHWC 3B43A 3UTSD 3K6DA 4OIAA 3UG4A 4XMPH 4E5XG 3GPEA 1WUNT 5AVUB 3QXDB 2WINB 1D5XA 4ZFFA 4D2NA 5C0NC 2MOVA 4JRYA 3EO9H 4KQ4L 3LEYL 2KPWA 4YDIL 5FO8A 5AW4B 5IBLD 5JHDE 3PP3K 3OR6B 4ONFH 3TWYA 4PCKA 3DO7A 3J7HA 4D9QD 4TQIA 2VSKB 3JZ7A 4XCCH 3RU8H 4F58H 4XNQB 2C9PA 1BXUA 5HYIA 4RBPK 2WYZA 4IHBA 4NHUB 1EUTA 2J7LA 3L3OB 5T1LB 2Y1AA 1U33A 3FBQA 3K2IA 5D72L 2IDCA 5A43C 3C5ZA 1S8DB 3KJ6H 5HYQA 3TZVA 5IEKA 2CKNA 2H7WA 4WK4B 2YRBA 5C6TL 4MX7A 3VYPA 4XPFH 2Z7WA 5E8NB 5DWUH 2QGDA 4MJHA 2LW3A 2IV8A 1JWSA 2RFXA 1Q1JL 5B38B 4R97C 5BV7H 3U0PA 3CLEL 2YD7A 3MLXL 2ZCLH 5JOFA 4OQTA 2JF1A 5E8DL 1RQ5A 1OV8A 3FOMB 5KYUA 3I84A 3UGXA 5F9OH 5I73B 3CXFA 2R0WL 5SWSA 1BECA 1E5AA 1O5DT 3MRIA 5BZWA 2AEPL 1KYAA 3MXWH 3AREB 5EEYA 4OD2A 4Q9BA 4AGLA 2DQEL 2VDPL 2YGPA 5IF0B 3WNKA 3A21A 5A40E 2W0KA 6PCYA 1QPPA 1KBKA 1FYTE 1K4DA 3ARDB 5EEVA 2DN7A 2P80D 4XB3A 4XVSL 3G5YA 4RFOL 1D9KC 1CYXA 2G4EA 2KUTA 3FSAA 1B9ZA 2ICCA 2P48B 1CD1B 1A6TA 2ROYA 2XTJB 4NN5C 1MF2H 1U2HA 5EA0L 1MWAB 1OZTG 1U3HC 3VFSB 4QLRA 3PJSA 2X0UA 1RCYA 4XMVA 2XN9E 2IEPA 3K72B 1NLBH 4OB5L 1P4BH 2BIQA 2WW8A 2WNWA 2V2WB 3D6GA 3WEXA 2FEDC 1SM3H 3BP4A 4PWHA 3AWGA 5ICYA 3ARFA 3A6BH 4KPHL 3X3GL 3QDAA 4PIBA 2V2TA 4E9SA 4PVLA 1I3UA 3GZPA 1B6DA 4QYOA 3WUWB 1C9SA 3N85L 3U4BH 1G7IB 5EU5B 2E47A 1FC1A 1MI5D 2VR9A 4J8RA 5EUOA 4CC0A 4TOYH 4A