5CO3A

Crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in presence of dtt
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
238
structure length
229
Chain Sequence
EKIRVDIWSDIACPWCYIGKRRFESALGQFPQRDQVEVVWHSFELDPSARPLNPIAMRDGLAMKYSISPAQAQGSLDHMTQTAAQEGLEYHFDRVKLANTFLAHQLIHYAAEQGQGDAMKERLLRAYMSEGQNVNDLDTLQKLAAEVGLDAGAARAALEAGTYAQAVRYDEAQAQQLGITGVPFFVLGGKYGVSGAQAPETLLGALSQVWAEQHPAPLTMLGDGQCAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FrnE protein
publication title drFrnE Represents a Hitherto Unknown Class of Eubacterial Cytoplasmic Disulfide Oxido-Reductases.
pubmed doi rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
molecule tags Oxidoreductase
total genus 91
structure length 229
sequence length 238
ec nomenclature
pdb deposition date 2015-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5co3A01
1TDIA 3S9FA 2HZEA 4HJMA 3HVSA 1T1VA 3NIVA 4ZXGA 2CZ2A 3KEBA 3PINA 4HQSA 2HXKA 3TKSA 4F0BA 2LSTA 3DWVA 2H0HA 2FNOA 2GLRA 2DSAA 4EDZA 3QDNA 1Z5YE 4BVXA 1URMA 2X8CA 2C0GA 4IP6A 1A8LA 2OJLA 4TR1B 1WWJA 3GX8A 1A2JA 3GV1A 4BL7A 2DIYA 3FW2A 2HT9A 3GUSA 2CQ9A 2XPDA 3IHQA 5C04A 1BJXA 4WBRD 3C71A 3WD6A 3VK9A 5E59A 2I3YA 2YV7A 2EIRA 2CAIA 1QK8A 2H6ZA 2C4JA 3TKQA 13GSA 3HXSA 3FKFA 5CYYA 2E0QA 2DLXA 3GX0A 2L57A 1PRXA 4XTSA 4KCAA 4DSRA 1UA5A 5G31A 2DMMA 3HVXA 5KN3A 1WOUA 2A2SA 2X64A 2OACA 4Q5RA 4MK3A 2JZSA 5FT3A 1AIUA 3GURA 3TJKA 1YY7A 2VUPA 1H4OA 4TXOA 1PX7A 5LD0A 1X5DA 3IAS2 2LQQA 2PPTA 5IO0A 3O6TA 2FA4A 2PERA 3VPQA 1FW1A 5D9WA 4ISDA 2IMDA 1YKAA 3UL3A 4GRFA 2NDOA 2ON5A 1OC9B 1V98A 4POBA 3GN3A 1BG5A 2OBKA 4MJCA 1O85A 1XIYA 3BCKA 3A5WA 3EWLA 2CT6A 1OKTA 1EOGA 2L4QA 2YWOA 3APQA 4AJ8A 4J2FA 3CRUA 2IFQB 5CRHA 3V1WA 5LCZA 4YAVA 1H75A 2YV9A 4AGSA 5CP1A 2YZUA 4KE3A 2XBIA 3IC4A 4KUNA 5D9VA 1LU4A 4D73A 1GSEA 2ZUPA 4YQVA 4BA7A 5ECLB 5J41A 2YP6A 3UAPA 1FAAA 1F6MC 1A8YA 2Z9SA 3GTUA 5COHA 2LKUA 4ZL8A 2NTOA 1Z3EA 4IW9A 1XVWA 1FVJA 2HE3A 4K7OA 2FWEA 2F8AA 5IPHA 5JWRB 3RBTA 4J56E 3H79A 1XW6A 2GT6A 2C0DA 2GS3A 2B5YA 3KMNA 3QAWA 3FR6A 2LJAA 3FHKA 4XRAA 4YAPA 2CV4A 3GRXA 2PGTA 5AIXA 4V1Ag 3UVHA 3M0FA 2O8VB 4K7NA 1JZRA 3TRQA 1HQOA 2LRCA 4RQXA 1AQWA 4Z7XA 1SYRA 3C7MA 3J7Yb 3HJMA 3GL3A 3MSZA 2H73A 1AW9A 4XS4A 4I97A 2YOIA 3KP8A 4N10A 1X9SB 3C1RA 2WGRA 1SK2A 4EXJA 4WKWA 3N9JA 2B5EA 5DCHA 2AUVA 2HZFA 4IGJA 4AJ6A 2FD3A 1T3BA 1GTBA 1V9WA 1M7TA 5F8BA 3QR6A 2K6VA 2QC7A 1Z6NA 3RPNA 3L0HA 1TI1A 3LORA 3UEMA 1XWCA 3GA4A 3KD0A 4EDYA 3GKXA 4TN8A 2REMA 4POMA 2HLSA 5GSTA 5DJLA 3IR4A 1EGRA 2MBSA 4JZQA 3GFKA 1RQMA 2X8HA 4KAEA 3BOAA 1K0BA 3WGDA 5J4UA 2ON7A 1GTIA 2XPEA 1ZYQB 4PQIA 2VOCA 3ZRDA 1T7PB 3ERFA 3APSA 4Q5QA 3IDVA 3G7YA 3ERGA 2LEGA 5ECQB 3ZFLA 5J9BA 2CX3A 1ERWA 1WJKA 2DJ0A 5KEJA 1JZDA 3GMFA 3LEFA 4F2IA 3MDKA 5DAKB 2H1AA 2C1YA 4GSTA 2VLVA 3HJPA 2H66A 4MA9A 2O7KA 1B4QA 1HNAA 1MTCA 4DSQA 2WULA 3FY7A 2G0FA 3CXGA 3KJYA 3QD9A 4GXZA 1G7EA 5DCGA 2F8FA 1OAZA 3M1GA 5AIVA 2V6KA 4EKZA 4O5RA 4EUYA 1SKWB 2PBJA 3A2VA 3FR3A 1Z6MA 3D4MA 1FO5A 2A4VA 2RLIA 3G9BA 4HZ2A 2L5LA 2JL4A 1PMTA 5G30A 2CAQA 1N2AA 1PQNA 2LV3A 2FLSA 4PX1A 2HNLA 2B7KA 4GQCA 1A2LA 5L71A 2MYGA 5F06A 3LQ7A 4ACSA 1FVKA 3ISOA 2C3NA 3RHCA 3L9VA 4RQRA 1YEXA 2WDUA 3LGCA 4ZL9A 4G10A 1XPVA 4K0NA 4AF2A 1VGLA 1PA3A 1GTAA 5A4VA 3GH9A 2E7PA 2YN1A 4ID0A 1Y25A 1GRXA 1B48A 2VAFA 5D93A 1B9XC 2QKEA 2F51A 3IV4A 18GSA 3VLNA 1SU9A 2GGTA 4TR0A 3TUEA 4TOPA 1SJZA 4JBBA 9GSSA 5IMCA 3D6IA 2DC5A 1VF1A 2JU5A 2RUFA 2YZHA 3VWWA 1KTEA 2B1LA 4E8HA 1X9MB 2QGVA 3FZ4A 4GQFA 4OMVA 3KGKA 3RHBA 2OADA 2FY6A 4MP4A 2AV4A 5ABRA 2IJYA 1XBSA 1G6WA 3WT1A 1WP0A 2H1BA 2LTKA 5F0GA 5FHIA 3FYGA 1WE0A 3OR5A 1EEJA 2JZRA 4MABA 2R4VA 3CTFA 1GSYA 1LBKA 1G7OA 4GSSA 4K2DA 4IP1A 3ED3A 1YQ1A 4LA1A 1A0RP 4FYBA 4YH2A 2DMLA 1ZZYA 4XRDA 4NV5A 2VCTA 4NMUA 2V41A 3UBKA 3EINA 4WBJA 3I43A 4BVYA 5IPGA 4BPYA 3H1NA 4N0VA 3A2XA 2AJQB 1TTZA 3LJRA 2DJ1A 4ZBDA 4MCUA 4Q5NA 4JEDA 3VI5A 1M2AA 4LMVA 2FCHA 1SL2B 4TW5A 1EZKA 3HJOA 5DQYA 5G5EA 1OKDA 3IE3A 2YJHA 4OWYA 1ZOFA 3ZVJD 6GSSA 1TXXA 1HNBA 3U5RE 5H5RA 3CSIA 2K8SA 3O3TA 3VWVA 2B6MA 1B8XA 3GH6A 2IN3A 4KH7A 2P31A 4KDUA 1K3OA 4EO3A 3IK7A 2VIMA 3C1SA 1A24A 4RUVA 4WXTA 3WGEA 3DIEA 1U6TA 2VM2A 3M9JA 3ZITA 2FWGA 5D9XA 5GAND 1I5GA 3KIJA 2H74A 3HY2A 1HD2A 4ILFA 1FB0A 2OE3A 4O92A 2JZTA 2HRNA 1ZL9A 4RI6A 4KA0A 2CA8A 4NWYA 3EU4A 4HDEA 1F9MA 4KNDA 1J08A 1S3CA 2LS5A 3ZIVA 1QFNA 2H6YA 3HKRA 2I81A 3TKRA 4YQUA 3Q6OA 3DD3A 3IA1A 4PUFC 4POKA 2K18A 4K1FA 4NXIA 2MZCA 3H8QA 10GSA 1R4WA 2VL3A 1SENA 3KXOA 3IPZA 1MD3A 2P5QA 2L6DA 4V2LA 3DGQA 3JCML 5E4WA 1Z7PA 2M80A 3GL5A 5DQSA 2VL2C 19GSA 1W4VA 3O76A 4ZBAA 1E2YA 2R37A 1TK8B 2GTUA 1EP8A 2IMFA 1F37A 1RK4A 1PL2A 1S3AA 2VLTA 1NHOA 3ZL5A 4EVMA 3ME7A 4TR1A 5A5KA 4GSNA 1YDKA 5J9CA 2VL9A 2GQKA 1ZMAA 2GQLA 3M9KA 1K3YA 2ZCTA 1XWKA 2H8LA 1WIKA 4XHMA 3IK9A 3LG6A 1IYIA 1F3AA 1R5AA 2GDRA 4OCFA 5HR1A 1B9YC 2N5AA 2H0IA 2VD0A 2WFCA 3GHAA 2K9FA 2GZPA 4F03A 1ST9A 1VF2A 2VCWA 4V2NA 4I6XA 5F07A 5B8AA 3GIXA 2LRTA 1VRSD 4HU7A 3F6DA 3E0UA 3TDGA 3Q19A 1GUHA 1XXUA 4PGTA 4N11A 3GKMA 3BJ5A 1G0TA 2C0EA 5G1KA 4MH3A 1HNCA 2C3QA 4DSSB 3ZIJA 1ZCPA 3TJJA 4L0UA 1R7HA 2PU9C 5CAXA 5G2ZA 1IYHA 1PN9A 3US3A 1DSBA 5IMZA 1K0OA 2GZYA 3D4TA 1OC9A 3F8UA 3QCPA 1ERVA 4GWRA 2RIIA 3QAGA 3J7Yk 3ERWA 1MDIA 3ME8A 3DKSA 3EMXA 4XS6A 5EPFA 4MZWA 3ZVJA 1XOAA 3GYKA 2DJKA 3W8JA 3LYPA 4LL1B 1N8JA 4I8BA 4MZCA 2IFQA 3U6VA 2P0GA 4K8MA 4OO5A 3UMAA 4F0CA 3CSHA 2BJXA 4PNGA 1AUCA 4XS1A 3RAZA 4HS1A 2CVBA 3CTGA 2CZ3A 4RI7A 2TRXA 1JZOA 2MMAA 5HFIA 4MPGA 4OD7A 4HI7A 5KN0A 2IIYA 1QMVA 1TJDA 2GVPA 4TR3A 3HA9A 1F2EA 3L4NA 5ID2B 5ECMB 2IMIA 1WMJA 1PKWA 2V32A 1PL1A 2CVDA 6GSUA 2PVOC 3CMIA 4IHUA 1GUKA 2H75A 3HDCA 1X5CA 2VLUA 5HQPA 2VO4A 3FZ5A 4G9HA 5CRWA 1E6BA 1GNWA 4ECIA 2XHFA 2H0GA 3CSJA 5AGYA 4HU9A 2R2JA 4ZL7A 2H1GA 1A2MA 1J9BA 1SYXA 3TJBA 2GSSA 3P8WA 3QAVA 4MF5A 1YF0A 5C00A 4TRXA 3ZTLA 4OO4A 1ACVA 4K9ZA 2IMKA 2IL3A 3ZLPA 2MMOA 3QFAC 3P7XA 14GSA 3UIWA 2K8VA 2BMXA 5J5NA 3GSSA 2LNTA 1O6JA 2YWNA 4NV2A 4BWSA 5KN2A 3L9UA 4ECCA 1EGOA 4X43A 4GF0A 3GSTA 2R5GA 5GSSA 6GSTA 1DE1A 3ZMLA 1MDJA 2F9SA 3D22A 1SJ6A 5CRGA 1K0NA 1O8WA 2KHPA 5D9TA 2ALBA 2CVKA 1YZXA 1NM3A 4MF6A 5EL8A 3KMOA 4K7IA 1O81A 1PX6A 2H71A 1JLWA 2D2ZA 5IMVA 3EMPA 5DALB 4J57E 5IM9A 3I69A 2M46A 4I2TA 4POLA 4MLYA 2ES7A 5FWGA 1TRSA 4QQ7A 5ECNB 3HCZA 3DXBA 2HYXA 2YWIA 4PUAA 4JRRA 8GSSA 5DAKA 3M3MA 2VCXA 2WRTA 5DDLA 4ZB8A 1U88A 2OA7A 2N5BA 5JCUA 3D0ZA 2N5FA 3E3EA 1TI3A 3WGXA 1K0CA 3NOFA 2KP2A 4TR4A 1Q98A 4O7HA 5D8IA 5DBQA 1TK0B 4KW6A 4WF4A 3F3RA 1GSFA 5B7CA 1PD21 1JLVA 2LUSA 4XCSA 3K8NA 5A4WA 4L5LA 4TXVA 4MZBA 1VF3A 4IJIA 3EC3A 4IKHA 2FHEA 2RM6A 4HOJA 2EIQA 3L9SA 1ZYEA 1YJ6A 3A2WA 3EURA 3TRPA 2AYTA 4ULXA 3C73A 3QPMA 2E2MA 1UC7A 3IRAA 1S3DA 1QQ2A 3ZREA 1HYUA 2HZEB 4HUAA 3C8EA 1J0FA 1ERUA 2VL2A 4IVFA 1V58A 2FGXA 4MF7A 3F0IA 3FRCA 1DUGA 2LJRA 1SL0B 3KH7A 3LSZA 4N0ZA 1DBYA 2GZZA 3D5JA 3TKSE 2WZ9A 6GSYA 5CO3A 5IO2A 5INYA 5HR2A 5KN1A 1W89A 5JWOB 3F4TA 4ECBA 3I6AA 3Q74A 4ZBBA 5GAPD 1T8EB 4HEA2 2JSZA 3H4KA 1GSUA 4KCEA 2C8UA 1ABAA 4F9ZA 2B5XA 5CRDA 4V1Ap 4X1UA 1K3LA 3SBCA 1GP1A 3TJGA 2VD1A 3BD2A 3KP9A 2NPBA 4FIWA 2OE1A 2OE0A 3ZFBA 3QMXA 4K6XA 1WRYA 1C72A 4TXOB 3TB2A 2H6XA 4KGIA 2WB9A 2R3XA 2EIOA 1CQHA 3A3TA 1ML6A 4OFTA 4XIHA 1G6YA 5B8BA 1AXDA 5CREA 5AN1A 4EE0A 1SK1A 4MMMA 3AY8A 2O85A 2VCZA 1SD9A 1SK0A 4MJAA 2H70A 1X5EA 1O7UA 4OCEA 22GSA 2MMNA 3GKKA 3RPPA 4WR5A 2JADA 3UARA 4L0WA 5ECIB 1MD4A 1TW9A 2CX4A 3DVWA 1F3BA 4FYCA 4EC0A 2GT5A 2A2RA 3KTLA 2M72A 1ZGNA 2FWFA 1GH2A 2KP1A 2DIZA 2FWHA 3HD5A 2EC4A 1XWGA 7GSSA 1RW1A 1TRWA 3LXZA 3FEUA 3EVIA 5AISA 1K0MA 2DJJA 4D73B 4CDOA 1XWBA 4G2EA 1XVQA 2I4AA 4KSMA 2C80A 1I9DA 4P3YB 3GTUB 5JWQB 3FK8A 4E8EA 4ZB9A 6GSWA 20GSA 4LL4B 1TU7A 3IAM2 1U3IA 5HR0A 2H72A 1U3AA 4WETA 2DJ3A 3VWUA 4ML1A 3KCMA 3R2QA 1GTUA 1T4YA 6GSVA 2I1UA 1TP9A 4HQZA 2DBCA 4HZ4A 4IELA 2WJUA 2HSYA 3CBUA 4I5QA 1O73A 1XWAA 2VM1A 2VCQA 5G1LA 1SL1B 3FZ9A 1KBNA 4F82A 1QXHA 4XS4B 2PMTA 1JZWA 3KTBA 3SWLA 2KUCA 5GZZB 3P90A 3RDWA 2NVLA 3GNJA 1THXA 1PSQA 2TRCP 3VPTA 2V2GA 3TRXA 5D73A 3LWAA 3TKSC 5ECKB 3ZMKA 2YJ7A 1B4PA 1SJIA 2H1DA 5G5FA 2AHEA 4FO5A 3DEXA 3CRTA 4YQMA 3LYKA 2IWTA 3KM6A 2O87A 1Z7RA 3UJ1A 1BYEA 4MPFA 4MJBA 1M2BA 2DJ2A 4FYUA 2FUG2 4AJ7A 3L78A 1T4ZA 3UBLA 4PNFA 2WS2A 3F6FA 1EEMA 1M9BA 3HYPA 4V2MA 1V57A 5H5SA 1M99A 1V2AA 2IPAA 2PN8A 4NAXA 3BBYA 4PQHA 3PR8A 3Q18A 3KH9A 3F3QA 1JFUA 4G19A 1YKCA 3W6GA 3FR9A 3IXRA 5ELAA 1NW2A 2H30A 3UOMA 4GTUA 1TK5B 3APOA 2L4CA 3F9UA 5ECOB 3D21A 4WR4A 2LJKA 1XW9A 2P5RA 1FOVA 3QOUA 2LRNA 3FZAA 3MAKA 2ZNMA 4QL7A 1R26A 1M2DA 5ECRB 3IBHA 4LLRA 4N30A 4ECJA 1X9WB 4DSSA 2L6CA 5JCGA 2YCDA 1U87A 2F3MA 3I9V2 4TKYA 5IOWA 3DVXA 1TU8A 1BAYA 1BEDA 5EVOA 2GQMA 5JCWA 4MDCA 1A23A 2L5OA 1KNGA 5ENUA 1R5PA 4CHSA 4JU5A 4K0GA 1OE8A 2YPMA 4MH2A 1GLPA 4ML6A 4KX4A 1OYJA 1GSQA 4EF0A 2OKAA 4EL1A 1AQXA 2H19A 4ZILA 1TRUA 2G2QA 2I9HA 1OVNA 1CQGA 4O32A 1X0RA 11GSA 2V6OA 4KSOA 2FA8A 4GCIA 2GSRA 2GSTA 5IMAA 5J3RA 2AAWA 4FH8A 3F4RA 4X0XA 2HFDA 2RM5A 3G7IA 3EU3A 1GWCA 2B3SA 1M9AA 1JHBA 3IOSA 1GUMA 4WF5A 1VF4A 2X99A 3TGZA 2MMZA 4TVEA 4ZB6A 1AAZA 5F05A 1ILOA 1K0AA 1MDKA 2X8GA 1THOA 1FG4A 3DRNA 5ID2A 2KLXA 1GULA 5DVBA 2O89A 2XBQA 2V1MA 1O8XA 3CYNA 1SKRB 2RUEA 4HJ2A 3EYTA 3VFIA 2OBIA 1PKZA 4I2UA 1EV9A 3M8NA 5IMDA 1EWXA 2HSHA 5ELGA 3HZ4A 4PURA 4IBPA 1SKSB 3DYRA 2BTOT 1GLQA 1KEBA 3W8SA 2NBSA 1M0UA 5CNWA 1GL8A 2L59A 1BX9A 3NZNA 2J9HA 2C3TA 3PGTA 4KDYA 6GSXA 2H76A 4NHWA 3HHVA 4DEJA 5DJMA 3WT2A 4WEYA 2C0FA 3TJFA 5B6MA 1GNEA 2HRFA 4CW9A 5ECSA 2TIRA 3KZQA 2AB6A 1OC8A 1OE7A 5EY6A 1EP7A 5D96A 1NSWA 2HI7A 3PH9A 2VCVA 1GSDA 4KB3A 1EOHA 1AC1A 2YANA 17GSA 5HR3A 1GSSA 3VI7A 16GSA 4IS0A 4L5OA 1YF1A 5H5QA 1XW5A 3WYWA 4JE1A 5LNKe 3MWHA 5HFGA 2H01A 2MBTA 3GKNA 2R6KA 4BWQA 2J23A 4H86A 4IQ1A 4PQ1A 1Z9HA 4DVCA 5B6NA 1DE2A 3HVVA 4IQAA 5IMFA 5DALA 2YNXA 3G7JA 4JR4A 1EV4A 3H93A 2GSQA 2B1KA 2LNSA 3F4SA 1V40A 1NHYA 2JSYA 3N5OA 2E2GA 1LJRA 4OFMA 4MJEA 3BCIA 2IMEA 1Y6EA 2YWMA 5IOXA 1UVZA 5IIZA 1AQVA 1TOFA 4ZIJA 1QUWA 1MEKA 4IJ3A 12GSA 2PUKC 4OFNA 1PGTA 5A4UA 3E9JB 1TRVA 4IN0A 4LMWA 2QSIA 1FB6A 2LQOA 4NPBA 1ON4A 3LFLA 2JACA 1K0DA 1XZOA 4NHZA 4KDXA 2XC2A 1FHEA 5HFKA 4QL9A 1XFLA 5ECHB 1Q4JA 3EE2A 3VWXA 5IQYA 5ECPB 2WCIA 3F63A 3MNGA 1T00A 3UVTA 1OC3A 3ZZXA 1TKDB 1UN2A 3LXTA 2PWJA 4GLTA 4JR6A 4L8EA 3ZYWA 3TKPA 1BQ7A 1XOBA 3P2AA 3TOTA 3TCOA 1A0FA 1ERTA 3DMLA 1SD8A 2PVQA 1USBA 4PXOA 1YEPA 3QFBC 2B7JA 1QGVA 1WPIA 3HZ8A 1XCCA 4Q5FA 3VURA 3TOUA 2KOKA
chains in the Genus database with same CATH superfamily
1TDIA 3S9FA 2HZEA 4HJMA 3HVSA 1T1VA 3NIVA 4ZXGA 2CZ2A 3KEBA 3PINA 4HQSA 2HXKA 3TKSA 4F0BA 2LSTA 3DWVA 2H0HA 2FNOA 2GLRA 2DSAA 4EDZA 3QDNA 1Z5YE 4BVXA 1URMA 2X8CA 2C0GA 4IP6A 1A8LA 2OJLA 4TR1B 1WWJA 3GX8A 1A2JA 3GV1A 4BL7A 2DIYA 3FW2A 2HT9A 3GUSA 2CQ9A 2XPDA 3IHQA 4CY6A 5C04A 1BJXA 4WBRD 3C71A 3WD6A 3VK9A 5E59A 2I3YA 2YV7A 2EIRA 2CAIA 1QK8A 2H6ZA 2C4JA 3TKQA 13GSA 3HXSA 3FKFA 5CYYA 2E0QA 2DLXA 3GX0A 5BMUA 2L57A 1PRXA 4XTSA 4KCAA 4DSRA 1UA5A 5G31A 2DMMA 3HVXA 5KN3A 1WOUA 2A2SA 2X64A 2OACA 4Q5RA 4MK3A 2JZSA 4K5RA 5FT3A 1AIUA 3GURA 3TJKA 1YY7A 2VUPA 1H4OA 4TXOA 1PX7A 5LD0A 1X5DA 3IAS2 2LQQA 2PPTA 5IO0A 3O6TA 2FA4A 2PERA 3VPQA 1FW1A 5D9WA 4ISDA 2IMDA 1YKAA 3UL3A 4GRFA 2NDOA 4K2XA 2ON5A 1OC9B 1V98A 4POBA 3GN3A 1BG5A 2OBKA 4MJCA 1O85A 1XIYA 3BCKA 3A5WA 3EWLA 2CT6A 1OKTA 1EOGA 2L4QA 2YWOA 3APQA 4AJ8A 4J2FA 3CRUA 2IFQB 5CRHA 3V1WA 5LCZA 4YAVA 1H75A 2YV9A 4AGSA 5CP1A 2YZUA 4KE3A 2XBIA 3IC4A 4KUNA 1PN0A 5D9VA 1LU4A 4D73A 1GSEA 2ZUPA 4YQVA 4BA7A 5ECLB 5J41A 2YP6A 3UAPA 1FAAA 1F6MC 1A8YA 2Z9SA 3GTUA 5COHA 2LKUA 2R0GA 4ZL8A 2NTOA 1Z3EA 4IW9A 1XVWA 1FVJA 2HE3A 4K7OA 2FWEA 2F8AA 5IPHA 5JWRB 3RBTA 4J56E 3H79A 1XW6A 2GT6A 2C0DA 2GS3A 2B5YA 3KMNA 3QAWA 3FR6A 2LJAA 3FHKA 4XRAA 4YAPA 2CV4A 3GRXA 2PGTA 5AIXA 4V1Ag 3UVHA 3IHGA 3M0FA 2O8VB 4K7NA 1JZRA 3TRQA 1HQOA 2LRCA 4RQXA 1AQWA 4Z7XA 1SYRA 3LW9A 3C7MA 3J7Yb 3HJMA 3GL3A 3MSZA 2H73A 1AW9A 4XS4A 4I97A 2YOIA 3KP8A 4N10A 1X9SB 3C1RA 2WGRA 1SK2A 4EXJA 4WKWA 3N9JA 2B5EA 5DCHA 2AUVA 2HZFA 4IGJA 4AJ6A 2FD3A 1T3BA 1GTBA 1V9WA 1M7TA 5F8BA 3QR6A 2K6VA 2QC7A 1Z6NA 3RPNA 3L0HA 1TI1A 3LORA 3UEMA 1XWCA 3GA4A 3KD0A 4EDYA 3GKXA 4TN8A 2REMA 4POMA 2HLSA 3A5IA 5GSTA 5DJLA 3IR4A 1EGRA 2MBSA 4JZQA 3GFKA 1RQMA 2X8HA 4KAEA 3BOAA 1K0BA 3WGDA 5J4UA 2ON7A 1GTIA 2XPEA 1ZYQB 4PQIA 2VOCA 3ZRDA 1T7PB 3ERFA 3APSA 4Q5QA 3IDVA 3G7YA 3ERGA 2LEGA 5ECQB 3ZFLA 5J9BA 4G0LA 2CX3A 1ERWA 1WJKA 2DJ0A 5KEJA 1JZDA 3GMFA 3LEFA 4F2IA 3MDKA 5DAKB 2H1AA 2C1YA 4GSTA 2VLVA 3HJPA 2H66A 4MA9A 2O7KA 1B4QA 1HNAA 1MTCA 4DSQA 2WULA 3FY7A 2G0FA 3CXGA 3KJYA 3QD9A 4GXZA 1G7EA 5DCGA 2F8FA 1OAZA 3M1GA 5AIVA 2V6KA 4EKZA 4O5RA 4EUYA 1SKWB 2PBJA 3A2VA 3FR3A 1Z6MA 3D4MA 1FO5A 2A4VA 2RLIA 3G9BA 4HZ2A 2L5LA 2JL4A 1PMTA 5G30A 2CAQA 1N2AA 1PQNA 2LV3A 2FLSA 4PX1A 2HNLA 2B7KA 4GQCA 4X4JA 1A2LA 5L71A 2MYGA 5F06A 3LQ7A 4ACSA 1FVKA 3ISOA 2C3NA 3RHCA 3L9VA 4RQRA 1YEXA 2WDUA 3EPTA 3LGCA 4ZL9A 4G10A 1XPVA 4K0NA 2QA2A 4AF2A 1VGLA 1PA3A 1GTAA 5A4VA 3GH9A 2E7PA 2YN1A 4ID0A 1Y25A 1GRXA 1B48A 2VAFA 5D93A 1B9XC 2QKEA 2F51A 3IV4A 18GSA 3VLNA 1SU9A 2GGTA 4TR0A 3TUEA 4TOPA 1SJZA 4JBBA 4HSCX 9GSSA 5IMCA 3D6IA 2DC5A 1VF1A 2JU5A 2RUFA 2YZHA 3VWWA 1KTEA 2B1LA 4E8HA 1X9MB 2QGVA 3FZ4A 4GQFA 4OMVA 3KGKA 3RHBA 2OADA 2FY6A 4MP4A 2AV4A 4KF9A 3MIXA 5ABRA 2IJYA 1XBSA 1G6WA 3WT1A 1WP0A 2H1BA 2LTKA 5F0GA 5FHIA 3FYGA 1WE0A 3OR5A 1EEJA 2JZRA 4MABA 2R4VA 3CTFA 1GSYA 1LBKA 1G7OA 4GSSA 4K2DA 4IP1A 3ED3A 1YQ1A 4LA1A 1A0RP 4FYBA 4YH2A 2DMLA 1ZZYA 4Z2TA 4XRDA 4NV5A 2VCTA 4NMUA 2V41A 3UBKA 3EINA 4WBJA 3I43A 4BVYA 5IPGA 4BPYA 3H1NA 4N0VA 3A2XA 2AJQB 1TTZA 3LJRA 2DJ1A 4ZBDA 4MCUA 4Q5NA 4JEDA 3VI5A 1M2AA 4LMVA 2FCHA 1SL2B 4TW5A 1EZKA 3HJOA 4YKFA 5DQYA 5G5EA 1OKDA 3IE3A 2YJHA 4OWYA 1ZOFA 3ZVJD 6GSSA 1TXXA 1HNBA 3U5RE 5H5RA 3CSIA 2K8SA 3O3TA 3VWVA 2B6MA 1B8XA 3GH6A 2IN3A 4KH7A 2P31A 4KDUA 1K3OA 3PPUA 3IK7A 4EO3A 2HRKA 2VIMA 3C1SA 1A24A 4RUVA 4WXTA 3WGEA 3DIEA 1U6TA 2VM2A 3M9JA 3ZITA 2FWGA 5D9XA 5GAND 1I5GA 3KIJA 2H74A 3HY2A 1HD2A 4ILFA 1FB0A 2OE3A 4O92A 2JZTA 2HRNA 1ZL9A 4RI6A 4KA0A 2CA8A 4NWYA 3EU4A 4HDEA 1F9MA 4KNDA 2R0CA 1J08A 1S3CA 2LS5A 3ZIVA 1QFNA 2H6YA 3HKRA 2I81A 3TKRA 4YQUA 3Q6OA 3DD3A 3IA1A 4PUFC 4POKA 2K18A 4K1FA 4NXIA 2MZCA 3H8QA 10GSA 1R4WA 2VL3A 1SENA 3KXOA 3IPZA 1MD3A 2P5QA 2L6DA 4V2LA 3DGQA 3JCML 5E4WA 1Z7PA 2M80A 3GL5A 2VL2C 5DQSA 19GSA 1W4VA 3O76A 4ZBAA 1E2YA 2R37A 1TK8B 2GTUA 1EP8A 2IMFA 1F37A 1RK4A 1PL2A 1S3AA 2VLTA 1NHOA 3ZL5A 4EVMA 3ME7A 4TR1A 5A5KA 2A4HA 4GSNA 1YDKA 5J9CA 2VL9A 2GQKA 1ZMAA 2GQLA 3M9KA 1K3YA 2ZCTA 1XWKA 2H8LA 1WIKA 4XHMA 3IK9A 3LG6A 1IYIA 1F3AA 1R5AA 2GDRA 4OCFA 5HR1A 1B9YC 2N5AA 2H0IA 2VD0A 2WFCA 3GHAA 2K9FA 2GZPA 4F03A 1ST9A 1VF2A 2VCWA 4V2NA 4I6XA 5F07A 5B8AA 3GIXA 2LRTA 1VRSD 4HU7A 3F6DA 3E0UA 3TDGA 3Q19A 1GUHA 1XXUA 4PGTA 4N11A 3GKMA 3BJ5A 1G0TA 2C0EA 5G1KA 4MH3A 1HNCA 2C3QA 4DSSB 3ZIJA 1ZCPA 3TJJA 4L0UA 1R7HA 2PU9C 5CAXA 5G2ZA 1IYHA 1PN9A 3US3A 1DSBA 5IMZA 1K0OA 2GZYA 3D4TA 1OC9A 3F8UA 3QCPA 1ERVA 4GWRA 2RIIA 3QAGA 3J7Yk 4G0IA 3ERWA 5KOWA 1MDIA 3ME8A 3DKSA 3EMXA 4XS6A 5EPFA 4MZWA 3ZVJA 1XOAA 3GYKA 2DJKA 4A5PA 3W8JA 3LYPA 4LL1B 1N8JA 4I8BA 4MZCA 2IFQA 3U6VA 2P0GA 4K8MA 4OO5A 3UMAA 4F0CA 3CSHA 2BJXA 4PNGA 1AUCA 4XS1A 3RAZA 4HS1A 2CVBA 3CTGA 2CZ3A 4RI7A 2TRXA 1JZOA 2MMAA 4BIKA 5HFIA 4MPGA 4OD7A 4HI7A 5KN0A 2IIYA 4CY8A 1QMVA 1TJDA 2GVPA 4TR3A 3HA9A 1F2EA 3L4NA 5ID2B 5ECMB 2IMIA 1WMJA 1PKWA 2V32A 1PL1A 2CVDA 6GSUA 2PVOC 3CMIA 4IHUA 1GUKA 2H75A 3HDCA 1X5CA 2VLUA 5HQPA 2VO4A 4G0KA 3FZ5A 4G9HA 5CRWA 1E6BA 1GNWA 4ECIA 2XHFA 2H0GA 3CSJA 5AGYA 4YKGA 4HU9A 2R2JA 4ZL7A 2H1GA 1A2MA 1J9BA 1SYXA 3HVNA 4USSA 3TJBA 2GSSA 3P8WA 3QAVA 4MF5A 1YF0A 5C00A 4TRXA 3ZTLA 4OO4A 1ACVA 4K9ZA 2IMKA 2IL3A 3ZLPA 2MMOA 3QFAC 3P7XA 14GSA 3UIWA 2K8VA 2BMXA 5J5NA 3GSSA 2LNTA 1O6JA 2YWNA 4NV2A 4BWSA 5KN2A 3L9UA 4ECCA 1EGOA 4X43A 4GF0A 3GSTA 2R5GA 5GSSA 4EIPA 6GSTA 1DE1A 3ZMLA 1MDJA 2F9SA 3D22A 1SJ6A 5CRGA 1K0NA 1O8WA 2KHPA 5D9TA 2ALBA 2CVKA 1YZXA 1NM3A 4MF6A 5EL8A 3KMOA 4K7IA 1O81A 1PX6A 2H71A 1JLWA 2D2ZA 5IMVA 3EMPA 5DALB 4J57E 5IM9A 3I69A 2M46A 4I2TA 4POLA 4MLYA 2ES7A 5FWGA 1TRSA 4QQ7A 5ECNB 3HCZA 3DXBA 2HYXA 2YWIA 4PUAA 4JRRA 8GSSA 5DAKA 1ZYNA 3M3MA 1FOHA 2VCXA 2WRTA 5DDLA 4ZB8A 3CQFA 1U88A 2OA7A 2N5BA 5JCUA 3D0ZA 2N5FA 3E3EA 1TI3A 3WGXA 1K0CA 2UZ8A 3NOFA 2KP2A 4FQUA 4TR4A 1Q98A 4O7HA 5D8IA 5DBQA 1TK0B 4KW6A 4WF4A 3F3RA 1GSFA 5B7CA 1PD21 1JLVA 2LUSA 3R3EA 4XCSA 3K8NA 5A4WA 4PTSA 4L5LA 4TXVA 4MZBA 1VF3A 4IJIA 3EC3A 4IKHA 2FHEA 2RM6A 4HOJA 2EIQA 3L9SA 1ZYEA 1YJ6A 3A2WA 3EURA 3TRPA 2AYTA 1S3RA 4ULXA 3C73A 3QPMA 2E2MA 5BRTA 1UC7A 3IRAA 1S3DA 1QQ2A 3ZREA 1HYUA 2HZEB 4HUAA 3C8EA 1J0FA 1ERUA 2VL2A 4IVFA 1V58A 2FGXA 4MF7A 3F0IA 1XG8A 3FRCA 1DUGA 2LJRA 1SL0B 3KH7A 3LSZA 4BVXB 4N0ZA 1DBYA 4Z2UA 2GZZA 3D5JA 3TKSE 2WZ9A 6GSYA 5CO3A 4BL7B 5IO2A 5INYA 5HR2A 5KN1A 1W89A 5JWOB 3F4TA 4ECBA 3I6AA 3Q74A 4ZBBA 5GAPD 1T8EB 4HEA2 2JSZA 3H4KA 1GSUA 4KCEA 2C8UA 1ABAA 4F9ZA 2B5XA 5CRDA 4V1Ap 4X1UA 1K3LA 3SBCA 1GP1A 3TJGA 2VD1A 3BD2A 3KP9A 2NPBA 4FIWA 2OE1A 2OE0A 3ZFBA 3QMXA 4K6XA 1WRYA 1C72A 4TXOB 3TB2A 2H6XA 4KGIA 2WB9A 2R3XA 2EIOA 1CQHA 3A3TA 1ML6A 4OFTA 2X49A 4XIHA 1G6YA 5B8BA 1AXDA 5CREA 5AN1A 4EE0A 1SK1A 4MMMA 3AY8A 2O85A 2VCZA 1SD9A 1SK0A 4MJAA 2H70A 1X5EA 1O7UA 4OCEA 22GSA 2MMNA 3GKKA 3RPPA 4WR5A 2JADA 3UARA 4L0WA 1TW9A 1MD4A 2CX4A 5ECIB 3DVWA 1F3BA 4FYCA 4EC0A 2GT5A 2A2RA 3KTLA 2M72A 1ZGNA 2FWFA 1GH2A 2KP1A 2DIZA 2FWHA 3HD5A 2EC4A 1XWGA 7GSSA 1RW1A 1TRWA 3LXZA 3FEUA 3EVIA 5AISA 1K0MA 2DJJA 4D73B 4CDOA 1XWBA 4G2EA 1XVQA 2I4AA 4KSMA 2C80A 1I9DA 4P3YB 3GTUB 5JWQB 3FK8A 4MNNA 4ZB9A 4E8EA 6GSWA 20GSA 4LL4B 1TU7A 3IAM2 1U3IA 5HR0A 2H72A 4O5QA 1U3AA 4WETA 2DJ3A 3VWUA 4ML1A 3KCMA 3R2QA 1GTUA 1T4YA 6GSVA 2I1UA 1TP9A 4HQZA 2DBCA 4HZ4A 4IELA 2WJUA 2HSYA 3CBUA 4I5QA 1O73A 1XWAA 2VM1A 2VCQA 5G1LA 1SL1B 3FZ9A 1KBNA 4F82A 1QXHA 4XS4B 2PMTA 1JZWA 3KTBA 3SWLA 2KUCA 5GZZB 3P90A 3RDWA 2NVLA 3GNJA 1THXA 1PSQA 2TRCP 3VPTA 2V2GA 3TRXA 5D73A 3LWAA 3TKSC 5ECKB 4O5UA 3ZMKA 2HSMA 2YJ7A 1B4PA 1SJIA 2H1DA 5G5FA 2AHEA 4FO5A 3DEXA 3CRTA 4YQMA 3LYKA 2IWTA 3KM6A 2O87A 1Z7RA 3UJ1A 1BYEA 4MPFA 4MJBA 1M2BA 2DJ2A 4FYUA 1ZYPA 2FUG2 4AJ7A 3L78A 1T4ZA 3UBLA 1M3JA 4PNFA 2WS2A 3F6FA 1EEMA 1M9BA 3HYPA 4V2MA 1V57A 5H5SA 3IC8A 1M99A 1V2AA 2IPAA 2PN8A 4NAXA 3BBYA 2A2PA 4PQHA 3PR8A 3Q18A 3KH9A 3F3QA 1JFUA 4G19A 1YKCA 3W6GA 3FR9A 2DKIA 3IXRA 5ELAA 1NW2A 2H30A 3UOMA 4GTUA 1TK5B 3APOA 2L4CA 3F9UA 5ECOB 3D21A 4WR4A 2LJKA 1XW9A 2P5RA 1FOVA 3MYDA 3QOUA 2LRNA 3FZAA 3MAKA 2ZNMA 4QL7A 1R26A 1M2DA 5ECRB 3IBHA 4LLRA 4N30A 4ECJA 1X9WB 4DSSA 2L6CA 5JCGA 2YCDA 1U87A 2F3MA 3I9V2 4TKYA 5IOWA 3DVXA 1TU8A 1BAYA 1BEDA 5EVOA 2GQMA 5JCWA 4MDCA 1A23A 2L5OA 1KNGA 5ENUA 1R5PA 4CHSA 4JU5A 4K0GA 1OE8A 2YPMA 4MH2A 1GLPA 2DKHA 4ML6A 4KX4A 1OYJA 1GSQA 4EF0A 2OKAA 4EL1A 1AQXA 2X4AA 2H19A 4ZILA 1TRUA 2G2QA 2I9HA 1OVNA 1CQGA 4O32A 1X0RA 11GSA 2V6OA 4KSOA 2FA8A 4GCIA 2GSRA 2GSTA 5IMAA 5J3RA 2AAWA 4FH8A 3FMWA 3F4RA 4X0XA 2HFDA 2RM5A 3G7IA 3EU3A 1GWCA 2B3SA 1M9AA 1JHBA 3IOSA 1GUMA 4WF5A 1VF4A 2X99A 3TGZA 2MMZA 4TVEA 4ZB6A 1AAZA 5F05A 1ILOA 1K0AA 1MDKA 2X8GA 1THOA 1FG4A 3DRNA 4Z2RA 2QA1A 5ID2A 2KLXA 1GULA 5DVBA 2O89A 2XBQA 2V1MA 1O8XA 3CYNA 1SKRB 2RUEA 4HJ2A 3EYTA 3VFIA 2OBIA 1PKZA 4I2UA 1EV9A 3M8NA 5IMDA 1EWXA 2HSHA 5ELGA 3HZ4A 4PURA 4IBPA 1SKSB 1M3IA 3DYRA 2BTOT 1GLQA 1KEBA 3W8SA 2NBSA 1M0UA 2R0PA 5CNWA 1GL8A 2L59A 1BX9A 3NZNA 2J9HA 2C3TA 3PGTA 4KDYA 6GSXA 2H76A 4NHWA 3HHVA 4DEJA 5DJMA 3WT2A 4WEYA 2C0FA 3TJFA 5B6MA 1GNEA 2HRFA 4CW9A 5ECSA 2TIRA 3KZQA 2AB6A 1OC8A 1OE7A 5EY6A 1EP7A 5D96A 1NSWA 2HI7A 3PH9A 5KOXA 2VCVA 1GSDA 4KB3A 1EOHA 1AC1A 2YANA 17GSA 5HR3A 1GSSA 3VI7A 16GSA 4IS0A 4L5OA 4BVYB 1YF1A 5H5QA 1XW5A 3WYWA 4JE1A 4EIQA 5LNKe 3MWHA 5HFGA 2H01A 2MBTA 3GKNA 2R6KA 4BWQA 2J23A 4H86A 4IQ1A 4PQ1A 1Z9HA 4DVCA 5B6NA 1DE2A 4ICYA 3HVVA 4IQAA 5IMFA 5DALA 2YNXA 3G7JA 4JR4A 1EV4A 3H93A 2GSQA 2B1KA 2LNSA 3F4SA 1V40A 1NHYA 2JSYA 3N5OA 4K5SA 2E2GA 1LJRA 4OFMA 4MJEA 3BCIA 2IMEA 1Y6EA 2YWMA 5IOXA 1UVZA 5IIZA 1AQVA 1TOFA 4ZIJA 1QUWA 1MEKA 4IJ3A 12GSA 2PUKC 4OFNA 1PGTA 5A4UA 3E9JB 1TRVA 4IN0A 4LMWA 2QSIA 1FB6A 2LQOA 4NPBA 1ON4A 3LFLA 2JACA 1K0DA 1XZOA 4NHZA 4KDXA 2XC2A 1FHEA 5HFKA 4QL9A 1XFLA 5ECHB 1Q4JA 3EE2A 3VWXA 2HRAA 5ECPB 5IQYA 2WCIA 3F63A 1PFOA 1T00A 3MNGA 3UVTA 1OC3A 3ZZXA 1TKDB 1UN2A 3LXTA 2PWJA 4GLTA 4JR6A 4L8EA 3ZYWA 3TKPA 1BQ7A 1XOBA 3P2AA 3TOTA 3TCOA 1A0FA 1ERTA 3DMLA 1SD8A 2PVQA 1USBA 4PXOA 1YEPA 3QFBC 2B7JA 1QGVA 1WPIA 3HZ8A 1XCCA 4Q5FA 3VURA 3TOUA 2KOKA
chains in the Genus database with same CATH topology
1TDIA 3S9FA 2HZEA 4HJMA 3HVSA 1T1VA 3NIVA 4ZXGA 2CZ2A 3KEBA 3PINA 4HQSA 2HXKA 3TKSA 4F0BA 2LSTA 3DWVA 2H0HA 2FNOA 2GLRA 2DSAA 4EDZA 3QDNA 1Z5YE 4BVXA 1URMA 2X8CA 2C0GA 4IP6A 1A8LA 2OJLA 4TR1B 1WWJA 3GX8A 1A2JA 3GV1A 4BL7A 2DIYA 3FW2A 2HT9A 3GUSA 2CQ9A 2XPDA 3IHQA 4CY6A 5C04A 1BJXA 4WBRD 3C71A 3WD6A 3VK9A 5E59A 2I3YA 2YV7A 2EIRA 2CAIA 1QK8A 2H6ZA 2C4JA 3TKQA 13GSA 3HXSA 3FKFA 5CYYA 2E0QA 2DLXA 3GX0A 5BMUA 2L57A 1PRXA 4XTSA 4KCAA 4DSRA 1UA5A 5G31A 2DMMA 3HVXA 5KN3A 1WOUA 2A2SA 2X64A 2OACA 4Q5RA 4MK3A 2JZSA 4K5RA 5FT3A 1AIUA 3GURA 3TJKA 1YY7A 2VUPA 1H4OA 4TXOA 1PX7A 5LD0A 1X5DA 3IAS2 2LQQA 2PPTA 5IO0A 3O6TA 2FA4A 2PERA 3VPQA 1FW1A 5D9WA 4ISDA 2IMDA 1YKAA 3UL3A 4GRFA 2NDOA 4K2XA 2ON5A 1OC9B 1V98A 4POBA 3GN3A 1BG5A 2OBKA 4MJCA 1O85A 1XIYA 3BCKA 3A5WA 3EWLA 2CT6A 1OKTA 1EOGA 2L4QA 2YWOA 3APQA 4AJ8A 4J2FA 3CRUA 2IFQB 5CRHA 3V1WA 5LCZA 4YAVA 1H75A 2YV9A 4AGSA 5CP1A 2YZUA 4KE3A 2XBIA 3IC4A 4KUNA 1PN0A 5D9VA 1LU4A 4D73A 1GSEA 2ZUPA 4YQVA 4BA7A 5ECLB 5J41A 2YP6A 3UAPA 1FAAA 1F6MC 1A8YA 2Z9SA 3GTUA 5COHA 2LKUA 2R0GA 4ZL8A 2NTOA 1Z3EA 4IW9A 1XVWA 1FVJA 2HE3A 4K7OA 2FWEA 2F8AA 5IPHA 5JWRB 3RBTA 4J56E 3H79A 1XW6A 2GT6A 2C0DA 2GS3A 2B5YA 3KMNA 3QAWA 3FR6A 2LJAA 3FHKA 4XRAA 4YAPA 2CV4A 3GRXA 2PGTA 5AIXA 4V1Ag 3UVHA 3IHGA 3M0FA 2O8VB 4K7NA 1JZRA 3TRQA 1HQOA 2LRCA 4RQXA 1AQWA 4Z7XA 1SYRA 3LW9A 3C7MA 3J7Yb 3HJMA 3GL3A 3MSZA 2H73A 1AW9A 4XS4A 4I97A 2YOIA 3KP8A 4N10A 1X9SB 3C1RA 2WGRA 1SK2A 4EXJA 4WKWA 3N9JA 2B5EA 5DCHA 2AUVA 2HZFA 4IGJA 4AJ6A 2FD3A 1T3BA 1GTBA 1V9WA 1M7TA 5F8BA 3QR6A 2K6VA 2QC7A 1Z6NA 3RPNA 3L0HA 1TI1A 3LORA 3UEMA 1XWCA 3GA4A 3KD0A 4EDYA 3GKXA 4TN8A 2REMA 4POMA 2HLSA 3A5IA 5GSTA 5DJLA 3IR4A 1EGRA 2MBSA 4JZQA 3GFKA 1RQMA 2X8HA 4KAEA 3BOAA 1K0BA 3WGDA 5J4UA 2ON7A 1GTIA 2XPEA 1ZYQB 4PQIA 2VOCA 3ZRDA 1T7PB 3ERFA 3APSA 4Q5QA 3IDVA 3G7YA 3ERGA 2LEGA 5ECQB 3ZFLA 5J9BA 4G0LA 2CX3A 1ERWA 1WJKA 2DJ0A 5KEJA 1JZDA 3GMFA 3LEFA 4F2IA 3MDKA 5DAKB 2H1AA 2C1YA 4GSTA 2VLVA 3HJPA 2H66A 4MA9A 2O7KA 1B4QA 1HNAA 1MTCA 4DSQA 2WULA 3FY7A 2G0FA 3CXGA 3KJYA 3QD9A 4GXZA 1G7EA 5DCGA 2F8FA 1OAZA 3M1GA 5AIVA 2V6KA 4EKZA 4O5RA 4EUYA 1SKWB 2PBJA 3A2VA 3FR3A 1Z6MA 3D4MA 1FO5A 2A4VA 2RLIA 3G9BA 4HZ2A 2L5LA 2JL4A 1PMTA 5G30A 2CAQA 1N2AA 1PQNA 2LV3A 2FLSA 4PX1A 2HNLA 2B7KA 4GQCA 4X4JA 1A2LA 5L71A 2MYGA 5F06A 3LQ7A 4ACSA 1FVKA 3ISOA 2C3NA 3RHCA 3L9VA 4RQRA 1YEXA 2WDUA 3EPTA 3LGCA 4ZL9A 4G10A 1XPVA 4K0NA 2QA2A 4AF2A 1VGLA 1PA3A 1GTAA 5A4VA 3GH9A 2E7PA 2YN1A 4ID0A 1Y25A 1GRXA 1B48A 2VAFA 5D93A 1B9XC 2QKEA 2F51A 3IV4A 18GSA 3VLNA 1SU9A 2GGTA 4TR0A 3TUEA 4TOPA 1SJZA 4JBBA 9GSSA 5IMCA 3D6IA 2DC5A 1VF1A 2JU5A 2RUFA 2YZHA 3VWWA 1KTEA 2B1LA 4E8HA 1X9MB 2QGVA 3FZ4A 4GQFA 4OMVA 3KGKA 3RHBA 2OADA 2FY6A 4MP4A 2AV4A 4KF9A 3MIXA 5ABRA 2IJYA 1XBSA 1G6WA 3WT1A 1WP0A 2H1BA 2LTKA 5F0GA 5FHIA 3FYGA 1WE0A 3OR5A 1EEJA 2JZRA 4MABA 2R4VA 3CTFA 1GSYA 1LBKA 1G7OA 4GSSA 4K2DA 4IP1A 3ED3A 1YQ1A 4LA1A 1A0RP 4FYBA 4YH2A 2DMLA 1ZZYA 4Z2TA 4XRDA 4NV5A 2VCTA 4NMUA 2V41A 3UBKA 3EINA 4WBJA 3I43A 4BVYA 5IPGA 4BPYA 3H1NA 4N0VA 3A2XA 2AJQB 1TTZA 3LJRA 2DJ1A 4ZBDA 4MCUA 4Q5NA 4JEDA 3VI5A 1M2AA 4LMVA 2FCHA 1SL2B 4TW5A 1EZKA 3HJOA 4YKFA 5DQYA 5G5EA 1OKDA 3IE3A 2YJHA 4OWYA 1ZOFA 3ZVJD 6GSSA 1TXXA 1HNBA 3U5RE 5H5RA 3CSIA 2K8SA 3O3TA 3VWVA 2B6MA 1B8XA 3GH6A 2IN3A 4KH7A 2P31A 4KDUA 1K3OA 3PPUA 3IK7A 4EO3A 2HRKA 2VIMA 3C1SA 1A24A 4RUVA 4WXTA 3WGEA 3DIEA 1U6TA 2VM2A 3M9JA 3ZITA 2FWGA 5D9XA 5GAND 1I5GA 3KIJA 2H74A 3HY2A 1HD2A 4ILFA 1FB0A 2OE3A 4O92A 2JZTA 2HRNA 1ZL9A 4RI6A 4KA0A 2CA8A 4NWYA 3EU4A 4HDEA 1F9MA 4KNDA 2R0CA 1J08A 1S3CA 2LS5A 3ZIVA 1QFNA 2H6YA 3HKRA 2I81A 3TKRA 4YQUA 3Q6OA 3DD3A 3IA1A 4PUFC 4POKA 2K18A 4K1FA 4NXIA 2MZCA 3H8QA 10GSA 1R4WA 2VL3A 1SENA 3KXOA 3IPZA 1MD3A 2P5QA 2L6DA 4V2LA 3DGQA 3JCML 5E4WA 1Z7PA 2M80A 3GL5A 2VL2C 5DQSA 19GSA 1W4VA 3O76A 4ZBAA 1E2YA 2R37A 1TK8B 2GTUA 1EP8A 2IMFA 1F37A 1RK4A 1PL2A 1S3AA 2VLTA 1NHOA 3ZL5A 4EVMA 3ME7A 4TR1A 5A5KA 2A4HA 4GSNA 1YDKA 5J9CA 2VL9A 2GQKA 1ZMAA 2GQLA 3M9KA 1K3YA 2ZCTA 1XWKA 2H8LA 1WIKA 4XHMA 3IK9A 3LG6A 1IYIA 1F3AA 1R5AA 2GDRA 4OCFA 5HR1A 1B9YC 2N5AA 2H0IA 2VD0A 2WFCA 3GHAA 2K9FA 2GZPA 4F03A 1ST9A 1VF2A 2VCWA 4V2NA 4I6XA 5F07A 5B8AA 3GIXA 2LRTA 1VRSD 4HU7A 3F6DA 3E0UA 3TDGA 3Q19A 1GUHA 1XXUA 4PGTA 4N11A 3GKMA 3BJ5A 1G0TA 2C0EA 5G1KA 4MH3A 1HNCA 2C3QA 4DSSB 3ZIJA 1ZCPA 3TJJA 4L0UA 1R7HA 2PU9C 5CAXA 5G2ZA 1IYHA 1PN9A 3US3A 1DSBA 5IMZA 1K0OA 2GZYA 3D4TA 1OC9A 3F8UA 3QCPA 1ERVA 4GWRA 2RIIA 3QAGA 3J7Yk 4G0IA 3ERWA 5KOWA 1MDIA 3ME8A 3DKSA 3EMXA 4XS6A 5EPFA 4MZWA 3ZVJA 1XOAA 3GYKA 2DJKA 4A5PA 3W8JA 3LYPA 4LL1B 1N8JA 4I8BA 4MZCA 2IFQA 3U6VA 2P0GA 4K8MA 4OO5A 3UMAA 4F0CA 3CSHA 2BJXA 4PNGA 1AUCA 4XS1A 3RAZA 4HS1A 2CVBA 3CTGA 2CZ3A 4RI7A 2TRXA 1JZOA 2MMAA 5HFIA 4MPGA 4OD7A 4HI7A 5KN0A 2IIYA 4CY8A 1QMVA 1TJDA 2GVPA 4TR3A 3HA9A 1F2EA 3L4NA 5ID2B 5ECMB 2IMIA 1WMJA 1PKWA 2V32A 1PL1A 2CVDA 6GSUA 2PVOC 3CMIA 4IHUA 1GUKA 2H75A 3HDCA 1X5CA 2VLUA 5HQPA 2VO4A 4G0KA 3FZ5A 4G9HA 5CRWA 1E6BA 1GNWA 4ECIA 2XHFA 2H0GA 3CSJA 5AGYA 4YKGA 4HU9A 2R2JA 4ZL7A 2H1GA 1A2MA 1J9BA 1SYXA 4USSA 3TJBA 2GSSA 3P8WA 3QAVA 4MF5A 1YF0A 5C00A 4TRXA 3ZTLA 4OO4A 1ACVA 4K9ZA 2IMKA 2IL3A 3ZLPA 2MMOA 3QFAC 3P7XA 14GSA 3UIWA 2K8VA 2BMXA 5J5NA 3GSSA 2LNTA 1O6JA 2YWNA 4NV2A 4BWSA 5KN2A 3L9UA 4ECCA 1EGOA 4X43A 4GF0A 3GSTA 2R5GA 5GSSA 4EIPA 6GSTA 1DE1A 3ZMLA 1MDJA 2F9SA 3D22A 1SJ6A 5CRGA 1K0NA 1O8WA 2KHPA 5D9TA 2ALBA 2CVKA 1YZXA 1NM3A 4MF6A 5EL8A 3KMOA 4K7IA 1O81A 1PX6A 2H71A 1JLWA 2D2ZA 5IMVA 3EMPA 5DALB 4J57E 5IM9A 3I69A 2M46A 4I2TA 4POLA 4MLYA 2ES7A 5FWGA 1TRSA 4QQ7A 5ECNB 3HCZA 3DXBA 2HYXA 2YWIA 4PUAA 4JRRA 8GSSA 5DAKA 1ZYNA 3M3MA 1FOHA 2VCXA 2WRTA 5DDLA 4ZB8A 1U88A 2OA7A 2N5BA 5JCUA 3D0ZA 2N5FA 3E3EA 1TI3A 3WGXA 1K0CA 2UZ8A 3NOFA 2KP2A 4FQUA 4TR4A 1Q98A 4O7HA 5D8IA 5DBQA 1TK0B 4KW6A 4WF4A 3F3RA 1GSFA 5B7CA 1PD21 1JLVA 2LUSA 3R3EA 4XCSA 3K8NA 5A4WA 4PTSA 4L5LA 4TXVA 4MZBA 1VF3A 4IJIA 3EC3A 4IKHA 2FHEA 2RM6A 4HOJA 2EIQA 3L9SA 1ZYEA 1YJ6A 3A2WA 3EURA 3TRPA 2AYTA 4ULXA 3C73A 3QPMA 2E2MA 5BRTA 1UC7A 3IRAA 1S3DA 1QQ2A 3ZREA 1HYUA 2HZEB 4HUAA 3C8EA 1J0FA 1ERUA 2VL2A 4IVFA 1V58A 2FGXA 4MF7A 3F0IA 3FRCA 1DUGA 2LJRA 1SL0B 3KH7A 3LSZA 4BVXB 4N0ZA 1DBYA 4Z2UA 2GZZA 3D5JA 3TKSE 2WZ9A 6GSYA 5CO3A 4BL7B 5IO2A 5INYA 5HR2A 5KN1A 1W89A 5JWOB 3F4TA 4ECBA 3I6AA 3Q74A 4ZBBA 5GAPD 1T8EB 4HEA2 2JSZA 3H4KA 1GSUA 4KCEA 2C8UA 1ABAA 4F9ZA 2B5XA 5CRDA 4V1Ap 4X1UA 1K3LA 3SBCA 1GP1A 3TJGA 2VD1A 3BD2A 3KP9A 2NPBA 4FIWA 2OE1A 2OE0A 3ZFBA 3QMXA 4K6XA 1WRYA 1C72A 4TXOB 3TB2A 2H6XA 4KGIA 2WB9A 2R3XA 2EIOA 1CQHA 3A3TA 1ML6A 4OFTA 2X49A 4XIHA 1G6YA 5B8BA 1AXDA 5CREA 5AN1A 4EE0A 1SK1A 4MMMA 3AY8A 2O85A 2VCZA 1SD9A 1SK0A 4MJAA 2H70A 1X5EA 1O7UA 4OCEA 22GSA 2MMNA 3GKKA 3RPPA 4WR5A 2JADA 3UARA 4L0WA 1TW9A 1MD4A 2CX4A 5ECIB 3DVWA 1F3BA 4FYCA 4EC0A 2GT5A 2A2RA 3KTLA 2M72A 1ZGNA 2FWFA 1GH2A 2KP1A 2DIZA 2FWHA 3HD5A 2EC4A 1XWGA 7GSSA 1RW1A 1TRWA 3LXZA 3FEUA 3EVIA 5AISA 1K0MA 2DJJA 4D73B 4CDOA 1XWBA 4G2EA 1XVQA 2I4AA 4KSMA 2C80A 1I9DA 4P3YB 3GTUB 5JWQB 3FK8A 4MNNA 4ZB9A 4E8EA 6GSWA 20GSA 4LL4B 1TU7A 3IAM2 1U3IA 5HR0A 2H72A 4O5QA 1U3AA 4WETA 2DJ3A 3VWUA 4ML1A 3KCMA 3R2QA 1GTUA 1T4YA 6GSVA 2I1UA 1TP9A 4HQZA 2DBCA 4HZ4A 4IELA 2WJUA 2HSYA 3CBUA 4I5QA 1O73A 1XWAA 2VM1A 2VCQA 5G1LA 1SL1B 3FZ9A 1KBNA 4F82A 1QXHA 4XS4B 2PMTA 1JZWA 3KTBA 3SWLA 2KUCA 5GZZB 3P90A 3RDWA 2NVLA 3GNJA 1THXA 1PSQA 2TRCP 3VPTA 2V2GA 3TRXA 5D73A 3LWAA 3TKSC 5ECKB 4O5UA 3ZMKA 2HSMA 2YJ7A 1B4PA 1SJIA 2H1DA 5G5FA 2AHEA 4FO5A 3DEXA 3CRTA 4YQMA 3LYKA 2IWTA 3KM6A 2O87A 1Z7RA 3UJ1A 1BYEA 4MPFA 4MJBA 1M2BA 2DJ2A 4FYUA 1ZYPA 2FUG2 4AJ7A 3L78A 1T4ZA 3UBLA 4PNFA 2WS2A 3F6FA 1EEMA 1M9BA 3HYPA 4V2MA 1V57A 5H5SA 3IC8A 1M99A 1V2AA 2IPAA 2PN8A 4NAXA 3BBYA 2A2PA 4PQHA 3PR8A 3Q18A 3KH9A 3F3QA 1JFUA 4G19A 1YKCA 3W6GA 3FR9A 2DKIA 3IXRA 5ELAA 1NW2A 2H30A 3UOMA 4GTUA 1TK5B 3APOA 2L4CA 3F9UA 5ECOB 3D21A 4WR4A 2LJKA 1XW9A 2P5RA 1FOVA 3MYDA 3QOUA 2LRNA 3FZAA 3MAKA 2ZNMA 4QL7A 1R26A 1M2DA 5ECRB 3IBHA 4LLRA 4N30A 4ECJA 1X9WB 4DSSA 2L6CA 5JCGA 2YCDA 1U87A 2F3MA 3I9V2 4TKYA 5IOWA 3DVXA 1TU8A 1BAYA 1BEDA 5EVOA 2GQMA 5JCWA 4MDCA 1A23A 2L5OA 1KNGA 5ENUA 1R5PA 4CHSA 4JU5A 4K0GA 1OE8A 2YPMA 4MH2A 1GLPA 2DKHA 4ML6A 4KX4A 1OYJA 1GSQA 4EF0A 2OKAA 4EL1A 1AQXA 2X4AA 2H19A 4ZILA 1TRUA 2G2QA 2I9HA 1OVNA 1CQGA 4O32A 1X0RA 11GSA 2V6OA 4KSOA 2FA8A 4GCIA 2GSRA 2GSTA 5IMAA 5J3RA 2AAWA 4FH8A 3FMWA 3F4RA 4X0XA 2HFDA 2RM5A 3G7IA 3EU3A 1GWCA 2B3SA 1M9AA 1JHBA 3IOSA 1GUMA 4WF5A 1VF4A 2X99A 3TGZA 2MMZA 4TVEA 4ZB6A 1AAZA 5F05A 1ILOA 1K0AA 1MDKA 2X8GA 1THOA 1FG4A 3DRNA 4Z2RA 2QA1A 5ID2A 2KLXA 1GULA 5DVBA 2O89A 2XBQA 2V1MA 1O8XA 3CYNA 1SKRB 2RUEA 4HJ2A 3EYTA 3VFIA 2OBIA 1PKZA 4I2UA 1EV9A 3M8NA 5IMDA 1EWXA 2HSHA 5ELGA 3HZ4A 4PURA 4IBPA 1SKSB 3DYRA 2BTOT 1GLQA 1KEBA 3W8SA 2NBSA 1M0UA 2R0PA 5CNWA 1GL8A 2L59A 1BX9A 3NZNA 2J9HA 2C3TA 3PGTA 4KDYA 6GSXA 2H76A 4NHWA 3HHVA 4DEJA 5DJMA 3WT2A 4WEYA 2C0FA 3TJFA 5B6MA 1GNEA 2HRFA 4CW9A 5ECSA 2TIRA 3KZQA 2AB6A 1OC8A 1OE7A 5EY6A 1EP7A 5D96A 1NSWA 2HI7A 3PH9A 5KOXA 2VCVA 1GSDA 4KB3A 1EOHA 1AC1A 2YANA 17GSA 5HR3A 1GSSA 3VI7A 16GSA 4IS0A 4L5OA 4BVYB 1YF1A 5H5QA 1XW5A 3WYWA 4JE1A 4EIQA 5LNKe 3MWHA 5HFGA 2H01A 2MBTA 3GKNA 2R6KA 4BWQA 2J23A 4H86A 4IQ1A 4PQ1A 1Z9HA 4DVCA 5B6NA 1DE2A 4ICYA 3HVVA 4IQAA 5IMFA 5DALA 2YNXA 3G7JA 4JR4A 1EV4A 3H93A 2GSQA 2B1KA 2LNSA 3F4SA 1V40A 1NHYA 2JSYA 3N5OA 4K5SA 2E2GA 1LJRA 4OFMA 4MJEA 3BCIA 2IMEA 1Y6EA 2YWMA 5IOXA 1UVZA 5IIZA 1AQVA 1TOFA 4ZIJA 1QUWA 1MEKA 4IJ3A 12GSA 2PUKC 4OFNA 1PGTA 5A4UA 3E9JB 1TRVA 4IN0A 4LMWA 2QSIA 1FB6A 2LQOA 4NPBA 1ON4A 3LFLA 2JACA 1K0DA 1XZOA 4NHZA 4KDXA 2XC2A 1FHEA 5HFKA 4QL9A 1XFLA 5ECHB 1Q4JA 3EE2A 3VWXA 2HRAA 5ECPB 5IQYA 2WCIA 3F63A 3MNGA 1T00A 3UVTA 1OC3A 3ZZXA 1TKDB 1UN2A 3LXTA 2PWJA 4GLTA 4JR6A 4L8EA 3ZYWA 3TKPA 1BQ7A 1XOBA 3P2AA 3TOTA 3TCOA 1A0FA 1ERTA 3DMLA 1SD8A 2PVQA 1USBA 4PXOA 1YEPA 3QFBC 2B7JA 1QGVA 1WPIA 3HZ8A 1XCCA 4Q5FA 3VURA 3TOUA 2KOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDI A;  3S9F A;  2HZE A;  4HJM A;  3HVS A;  1T1V A;  3NIV A;  4ZXG A;  2CZ2 A;  3KEB A;  3PIN A;  4HQS A;  2HXK A;  3TKS A;  4F0B A;  2LST A;  3DWV A;  2H0H A;  2FNO A;  2GLR A;  2DSA A;  4EDZ A;  3QDN A;  1Z5Y E;  4BVX A;  1URM A;  2X8C A;  2C0G A;  4IP6 A;  1A8L A;  2OJL A;  4TR1 B;  1WWJ A;  3GX8 A;  1A2J A;  3GV1 A;  4BL7 A;  2DIY A;  3FW2 A;  2HT9 A;  3GUS A;  2CQ9 A;  2XPD A;  3IHQ A;  5C04 A;  1BJX A;  4WBR D;  3C71 A;  3WD6 A;  3VK9 A;  5E59 A;  2I3Y A;  2YV7 A;  2EIR A;  2CAI A;  1QK8 A;  2H6Z A;  2C4J A;  3TKQ A;  13GS A;  3HXS A;  3FKF A;  5CYY A;  2E0Q A;  2DLX A;  3GX0 A;  2L57 A;  1PRX A;  4XTS A;  4KCA A;  4DSR A;  1UA5 A;  5G31 A;  2DMM A;  3HVX A;  5KN3 A;  1WOU A;  2A2S A;  2X64 A;  2OAC A;  4Q5R A;  4MK3 A;  2JZS A;  5FT3 A;  1AIU A;  3GUR A;  3TJK A;  1YY7 A;  2VUP A;  1H4O A;  4TXO A;  1PX7 A;  5LD0 A;  1X5D A;  3IAS 2;  2LQQ A;  2PPT A;  5IO0 A;  3O6T A;  2FA4 A;  2PER A;  3VPQ A;  1FW1 A;  5D9W A;  4ISD A;  2IMD A;  1YKA A;  3UL3 A;  4GRF A;  2NDO A;  2ON5 A;  1OC9 B;  1V98 A;  4POB A;  3GN3 A;  1BG5 A;  2OBK A;  4MJC A;  1O85 A;  1XIY A;  3BCK A;  3A5W A;  3EWL A;  2CT6 A;  1OKT A;  1EOG A;  2L4Q A;  2YWO A;  3APQ A;  4AJ8 A;  4J2F A;  3CRU A;  2IFQ B;  5CRH A;  3V1W A;  5LCZ A;  4YAV A;  1H75 A;  2YV9 A;  4AGS A;  5CP1 A;  2YZU A;  4KE3 A;  2XBI A;  3IC4 A;  4KUN A;  5D9V A;  1LU4 A;  4D73 A;  1GSE A;  2ZUP A;  4YQV A;  4BA7 A;  5ECL B;  5J41 A;  2YP6 A;  3UAP A;  1FAA A;  1F6M C;  1A8Y A;  2Z9S A;  3GTU A;  5COH A;  2LKU A;  4ZL8 A;  2NTO A;  1Z3E A;  4IW9 A;  1XVW A;  1FVJ A;  2HE3 A;  4K7O A;  2FWE A;  2F8A A;  5IPH A;  5JWR B;  3RBT A;  4J56 E;  3H79 A;  1XW6 A;  2GT6 A;  2C0D A;  2GS3 A;  2B5Y A;  3KMN A;  3QAW A;  3FR6 A;  2LJA A;  3FHK A;  4XRA A;  4YAP A;  2CV4 A;  3GRX A;  2PGT A;  5AIX A;  4V1A g;  3UVH A;  3M0F A;  2O8V B;  4K7N A;  1JZR A;  3TRQ A;  1HQO A;  2LRC A;  4RQX A;  1AQW A;  4Z7X A;  1SYR A;  3C7M A;  3J7Y b;  3HJM A;  3GL3 A;  3MSZ A;  2H73 A;  1AW9 A;  4XS4 A;  4I97 A;  2YOI A;  3KP8 A;  4N10 A;  1X9S B;  3C1R A;  2WGR A;  1SK2 A;  4EXJ A;  4WKW A;  3N9J A;  2B5E A;  5DCH A;  2AUV A;  2HZF A;  4IGJ A;  4AJ6 A;  2FD3 A;  1T3B A;  1GTB A;  1V9W A;  1M7T A;  5F8B A;  3QR6 A;  2K6V A;  2QC7 A;  1Z6N A;  3RPN A;  3L0H A;  1TI1 A;  3LOR A;  3UEM A;  1XWC A;  3GA4 A;  3KD0 A;  4EDY A;  3GKX A;  4TN8 A;  2REM A;  4POM A;  2HLS A;  5GST A;  5DJL A;  3IR4 A;  1EGR A;  2MBS A;  4JZQ A;  3GFK A;  1RQM A;  2X8H A;  4KAE A;  3BOA A;  1K0B A;  3WGD A;  5J4U A;  2ON7 A;  1GTI A;  2XPE A;  1ZYQ B;  4PQI A;  2VOC A;  3ZRD A;  1T7P B;  3ERF A;  3APS A;  4Q5Q A;  3IDV A;  3G7Y A;  3ERG A;  2LEG A;  5ECQ B;  3ZFL A;  5J9B A;  2CX3 A;  1ERW A;  1WJK A;  2DJ0 A;  5KEJ A;  1JZD A;  3GMF A;  3LEF A;  4F2I A;  3MDK A;  5DAK B;  2H1A A;  2C1Y A;  4GST A;  2VLV A;  3HJP A;  2H66 A;  4MA9 A;  2O7K A;  1B4Q A;  1HNA A;  1MTC A;  4DSQ A;  2WUL A;  3FY7 A;  2G0F A;  3CXG A;  3KJY A;  3QD9 A;  4GXZ A;  1G7E A;  5DCG A;  2F8F A;  1OAZ A;  3M1G A;  5AIV A;  2V6K A;  4EKZ A;  4O5R A;  4EUY A;  1SKW B;  2PBJ A;  3A2V A;  3FR3 A;  1Z6M A;  3D4M A;  1FO5 A;  2A4V A;  2RLI A;  3G9B A;  4HZ2 A;  2L5L A;  2JL4 A;  1PMT A;  5G30 A;  2CAQ A;  1N2A A;  1PQN A;  2LV3 A;  2FLS A;  4PX1 A;  2HNL A;  2B7K A;  4GQC A;  1A2L A;  5L71 A;  2MYG A;  5F06 A;  3LQ7 A;  4ACS A;  1FVK A;  3ISO A;  2C3N A;  3RHC A;  3L9V A;  4RQR A;  1YEX A;  2WDU A;  3LGC A;  4ZL9 A;  4G10 A;  1XPV A;  4K0N A;  4AF2 A;  1VGL A;  1PA3 A;  1GTA A;  5A4V A;  3GH9 A;  2E7P A;  2YN1 A;  4ID0 A;  1Y25 A;  1GRX A;  1B48 A;  2VAF A;  5D93 A;  1B9X C;  2QKE A;  2F51 A;  3IV4 A;  18GS A;  3VLN A;  1SU9 A;  2GGT A;  4TR0 A;  3TUE A;  4TOP A;  1SJZ A;  4JBB A;  9GSS A;  5IMC A;  3D6I A;  2DC5 A;  1VF1 A;  2JU5 A;  2RUF A;  2YZH A;  3VWW A;  1KTE A;  2B1L A;  4E8H A;  1X9M B;  2QGV A;  3FZ4 A;  4GQF A;  4OMV A;  3KGK A;  3RHB A;  2OAD A;  2FY6 A;  4MP4 A;  2AV4 A;  5ABR A;  2IJY A;  1XBS A;  1G6W A;  3WT1 A;  1WP0 A;  2H1B A;  2LTK A;  5F0G A;  5FHI A;  3FYG A;  1WE0 A;  3OR5 A;  1EEJ A;  2JZR A;  4MAB A;  2R4V A;  3CTF A;  1GSY A;  1LBK A;  1G7O A;  4GSS A;  4K2D A;  4IP1 A;  3ED3 A;  1YQ1 A;  4LA1 A;  1A0R P;  4FYB A;  4YH2 A;  2DML A;  1ZZY A;  4XRD A;  4NV5 A;  2VCT A;  4NMU A;  2V41 A;  3UBK A;  3EIN A;  4WBJ A;  3I43 A;  4BVY A;  5IPG A;  4BPY A;  3H1N A;  4N0V A;  3A2X A;  2AJQ B;  1TTZ A;  3LJR A;  2DJ1 A;  4ZBD A;  4MCU A;  4Q5N A;  4JED A;  3VI5 A;  1M2A A;  4LMV A;  2FCH A;  1SL2 B;  4TW5 A;  1EZK A;  3HJO A;  5DQY A;  5G5E A;  1OKD A;  3IE3 A;  2YJH A;  4OWY A;  1ZOF A;  3ZVJ D;  6GSS A;  1TXX A;  1HNB A;  3U5R E;  5H5R A;  3CSI A;  2K8S A;  3O3T A;  3VWV A;  2B6M A;  1B8X A;  3GH6 A;  2IN3 A;  4KH7 A;  2P31 A;  4KDU A;  1K3O A;  4EO3 A;  3IK7 A;  2VIM A;  3C1S A;  1A24 A;  4RUV A;  4WXT A;  3WGE A;  3DIE A;  1U6T A;  2VM2 A;  3M9J A;  3ZIT A;  2FWG A;  5D9X A;  5GAN D;  1I5G A;  3KIJ A;  2H74 A;  3HY2 A;  1HD2 A;  4ILF A;  1FB0 A;  2OE3 A;  4O92 A;  2JZT A;  2HRN A;  1ZL9 A;  4RI6 A;  4KA0 A;  2CA8 A;  4NWY A;  3EU4 A;  4HDE A;  1F9M A;  4KND A;  1J08 A;  1S3C A;  2LS5 A;  3ZIV A;  1QFN A;  2H6Y A;  3HKR A;  2I81 A;  3TKR A;  4YQU A;  3Q6O A;  3DD3 A;  3IA1 A;  4PUF C;  4POK A;  2K18 A;  4K1F A;  4NXI A;  2MZC A;  3H8Q A;  10GS A;  1R4W A;  2VL3 A;  1SEN A;  3KXO A;  3IPZ A;  1MD3 A;  2P5Q A;  2L6D A;  4V2L A;  3DGQ A;  3JCM L;  5E4W A;  1Z7P A;  2M80 A;  3GL5 A;  5DQS A;  2VL2 C;  19GS A;  1W4V A;  3O76 A;  4ZBA A;  1E2Y A;  2R37 A;  1TK8 B;  2GTU A;  1EP8 A;  2IMF A;  1F37 A;  1RK4 A;  1PL2 A;  1S3A A;  2VLT A;  1NHO A;  3ZL5 A;  4EVM A;  3ME7 A;  4TR1 A;  5A5K A;  4GSN A;  1YDK A;  5J9C A;  2VL9 A;  2GQK A;  1ZMA A;  2GQL A;  3M9K A;  1K3Y A;  2ZCT A;  1XWK A;  2H8L A;  1WIK A;  4XHM A;  3IK9 A;  3LG6 A;  1IYI A;  1F3A A;  1R5A A;  2GDR A;  4OCF A;  5HR1 A;  1B9Y C;  2N5A A;  2H0I A;  2VD0 A;  2WFC A;  3GHA A;  2K9F A;  2GZP A;  4F03 A;  1ST9 A;  1VF2 A;  2VCW A;  4V2N A;  4I6X A;  5F07 A;  5B8A A;  3GIX A;  2LRT A;  1VRS D;  4HU7 A;  3F6D A;  3E0U A;  3TDG A;  3Q19 A;  1GUH A;  1XXU A;  4PGT A;  4N11 A;  3GKM A;  3BJ5 A;  1G0T A;  2C0E A;  5G1K A;  4MH3 A;  1HNC A;  2C3Q A;  4DSS B;  3ZIJ A;  1ZCP A;  3TJJ A;  4L0U A;  1R7H A;  2PU9 C;  5CAX A;  5G2Z A;  1IYH A;  1PN9 A;  3US3 A;  1DSB A;  5IMZ A;  1K0O A;  2GZY A;  3D4T A;  1OC9 A;  3F8U A;  3QCP A;  1ERV A;  4GWR A;  2RII A;  3QAG A;  3J7Y k;  3ERW A;  1MDI A;  3ME8 A;  3DKS A;  3EMX A;  4XS6 A;  5EPF A;  4MZW A;  3ZVJ A;  1XOA A;  3GYK A;  2DJK A;  3W8J A;  3LYP A;  4LL1 B;  1N8J A;  4I8B A;  4MZC A;  2IFQ A;  3U6V A;  2P0G A;  4K8M A;  4OO5 A;  3UMA A;  4F0C A;  3CSH A;  2BJX A;  4PNG A;  1AUC A;  4XS1 A;  3RAZ A;  4HS1 A;  2CVB A;  3CTG A;  2CZ3 A;  4RI7 A;  2TRX A;  1JZO A;  2MMA A;  5HFI A;  4MPG A;  4OD7 A;  4HI7 A;  5KN0 A;  2IIY A;  1QMV A;  1TJD A;  2GVP A;  4TR3 A;  3HA9 A;  1F2E A;  3L4N A;  5ID2 B;  5ECM B;  2IMI A;  1WMJ A;  1PKW A;  2V32 A;  1PL1 A;  2CVD A;  6GSU A;  2PVO C;  3CMI A;  4IHU A;  1GUK A;  2H75 A;  3HDC A;  1X5C A;  2VLU A;  5HQP A;  2VO4 A;  3FZ5 A;  4G9H A;  5CRW A;  1E6B A;  1GNW A;  4ECI A;  2XHF A;  2H0G A;  3CSJ A;  5AGY A;  4HU9 A;  2R2J A;  4ZL7 A;  2H1G A;  1A2M A;  1J9B A;  1SYX A;  3TJB A;  2GSS A;  3P8W A;  3QAV A;  4MF5 A;  1YF0 A;  5C00 A;  4TRX A;  3ZTL A;  4OO4 A;  1ACV A;  4K9Z A;  2IMK A;  2IL3 A;  3ZLP A;  2MMO A;  3QFA C;  3P7X A;  14GS A;  3UIW A;  2K8V A;  2BMX A;  5J5N A;  3GSS A;  2LNT A;  1O6J A;  2YWN A;  4NV2 A;  4BWS A;  5KN2 A;  3L9U A;  4ECC A;  1EGO A;  4X43 A;  4GF0 A;  3GST A;  2R5G A;  5GSS A;  6GST A;  1DE1 A;  3ZML A;  1MDJ A;  2F9S A;  3D22 A;  1SJ6 A;  5CRG A;  1K0N A;  1O8W A;  2KHP A;  5D9T A;  2ALB A;  2CVK A;  1YZX A;  1NM3 A;  4MF6 A;  5EL8 A;  3KMO A;  4K7I A;  1O81 A;  1PX6 A;  2H71 A;  1JLW A;  2D2Z A;  5IMV A;  3EMP A;  5DAL B;  4J57 E;  5IM9 A;  3I69 A;  2M46 A;  4I2T A;  4POL A;  4MLY A;  2ES7 A;  5FWG A;  1TRS A;  4QQ7 A;  5ECN B;  3HCZ A;  3DXB A;  2HYX A;  2YWI A;  4PUA A;  4JRR A;  8GSS A;  5DAK A;  3M3M A;  2VCX A;  2WRT A;  5DDL A;  4ZB8 A;  1U88 A;  2OA7 A;  2N5B A;  5JCU A;  3D0Z A;  2N5F A;  3E3E A;  1TI3 A;  3WGX A;  1K0C A;  3NOF A;  2KP2 A;  4TR4 A;  1Q98 A;  4O7H A;  5D8I A;  5DBQ A;  1TK0 B;  4KW6 A;  4WF4 A;  3F3R A;  1GSF A;  5B7C A;  1PD2 1;  1JLV A;  2LUS A;  4XCS A;  3K8N A;  5A4W A;  4L5L A;  4TXV A;  4MZB A;  1VF3 A;  4IJI A;  3EC3 A;  4IKH A;  2FHE A;  2RM6 A;  4HOJ A;  2EIQ A;  3L9S A;  1ZYE A;  1YJ6 A;  3A2W A;  3EUR A;  3TRP A;  2AYT A;  4ULX A;  3C73 A;  3QPM A;  2E2M A;  1UC7 A;  3IRA A;  1S3D A;  1QQ2 A;  3ZRE A;  1HYU A;  2HZE B;  4HUA A;  3C8E A;  1J0F A;  1ERU A;  2VL2 A;  4IVF A;  1V58 A;  2FGX A;  4MF7 A;  3F0I A;  3FRC A;  1DUG A;  2LJR A;  1SL0 B;  3KH7 A;  3LSZ A;  4N0Z A;  1DBY A;  2GZZ A;  3D5J A;  3TKS E;  2WZ9 A;  6GSY A;  5CO3 A;  5IO2 A;  5INY A;  5HR2 A;  5KN1 A;  1W89 A;  5JWO B;  3F4T A;  4ECB A;  3I6A A;  3Q74 A;  4ZBB A;  5GAP D;  1T8E B;  4HEA 2;  2JSZ A;  3H4K A;  1GSU A;  4KCE A;  2C8U A;  1ABA A;  4F9Z A;  2B5X A;  5CRD A;  4V1A p;  4X1U A;  1K3L A;  3SBC A;  1GP1 A;  3TJG A;  2VD1 A;  3BD2 A;  3KP9 A;  2NPB A;  4FIW A;  2OE1 A;  2OE0 A;  3ZFB A;  3QMX A;  4K6X A;  1WRY A;  1C72 A;  4TXO B;  3TB2 A;  2H6X A;  4KGI A;  2WB9 A;  2R3X A;  2EIO A;  1CQH A;  3A3T A;  1ML6 A;  4OFT A;  4XIH A;  1G6Y A;  5B8B A;  1AXD A;  5CRE A;  5AN1 A;  4EE0 A;  1SK1 A;  4MMM A;  3AY8 A;  2O85 A;  2VCZ A;  1SD9 A;  1SK0 A;  4MJA A;  2H70 A;  1X5E A;  1O7U A;  4OCE A;  22GS A;  2MMN A;  3GKK A;  3RPP A;  4WR5 A;  2JAD A;  3UAR A;  4L0W A;  5ECI B;  1MD4 A;  1TW9 A;  2CX4 A;  3DVW A;  1F3B A;  4FYC A;  4EC0 A;  2GT5 A;  2A2R A;  3KTL A;  2M72 A;  1ZGN A;  2FWF A;  1GH2 A;  2KP1 A;  2DIZ A;  2FWH A;  3HD5 A;  2EC4 A;  1XWG A;  7GSS A;  1RW1 A;  1TRW A;  3LXZ A;  3FEU A;  3EVI A;  5AIS A;  1K0M A;  2DJJ A;  4D73 B;  4CDO A;  1XWB A;  4G2E A;  1XVQ A;  2I4A A;  4KSM A;  2C80 A;  1I9D A;  4P3Y B;  3GTU B;  5JWQ B;  3FK8 A;  4E8E A;  4ZB9 A;  6GSW A;  20GS A;  4LL4 B;  1TU7 A;  3IAM 2;  1U3I A;  5HR0 A;  2H72 A;  1U3A A;  4WET A;  2DJ3 A;  3VWU A;  4ML1 A;  3KCM A;  3R2Q A;  1GTU A;  1T4Y A;  6GSV A;  2I1U A;  1TP9 A;  4HQZ A;  2DBC A;  4HZ4 A;  4IEL A;  2WJU A;  2HSY A;  3CBU A;  4I5Q A;  1O73 A;  1XWA A;  2VM1 A;  2VCQ A;  5G1L A;  1SL1 B;  3FZ9 A;  1KBN A;  4F82 A;  1QXH A;  4XS4 B;  2PMT A;  1JZW A;  3KTB A;  3SWL A;  2KUC A;  5GZZ B;  3P90 A;  3RDW A;  2NVL A;  3GNJ A;  1THX A;  1PSQ A;  2TRC P;  3VPT A;  2V2G A;  3TRX A;  5D73 A;  3LWA A;  3TKS C;  5ECK B;  3ZMK A;  2YJ7 A;  1B4P A;  1SJI A;  2H1D A;  5G5F A;  2AHE A;  4FO5 A;  3DEX A;  3CRT A;  4YQM A;  3LYK A;  2IWT A;  3KM6 A;  2O87 A;  1Z7R A;  3UJ1 A;  1BYE A;  4MPF A;  4MJB A;  1M2B A;  2DJ2 A;  4FYU A;  2FUG 2;  4AJ7 A;  3L78 A;  1T4Z A;  3UBL A;  4PNF A;  2WS2 A;  3F6F A;  1EEM A;  1M9B A;  3HYP A;  4V2M A;  1V57 A;  5H5S A;  1M99 A;  1V2A A;  2IPA A;  2PN8 A;  4NAX A;  3BBY A;  4PQH A;  3PR8 A;  3Q18 A;  3KH9 A;  3F3Q A;  1JFU A;  4G19 A;  1YKC A;  3W6G A;  3FR9 A;  3IXR A;  5ELA A;  1NW2 A;  2H30 A;  3UOM A;  4GTU A;  1TK5 B;  3APO A;  2L4C A;  3F9U A;  5ECO B;  3D21 A;  4WR4 A;  2LJK A;  1XW9 A;  2P5R A;  1FOV A;  3QOU A;  2LRN A;  3FZA A;  3MAK A;  2ZNM A;  4QL7 A;  1R26 A;  1M2D A;  5ECR B;  3IBH A;  4LLR A;  4N30 A;  4ECJ A;  1X9W B;  4DSS A;  2L6C A;  5JCG A;  2YCD A;  1U87 A;  2F3M A;  3I9V 2;  4TKY A;  5IOW A;  3DVX A;  1TU8 A;  1BAY A;  1BED A;  5EVO A;  2GQM A;  5JCW A;  4MDC A;  1A23 A;  2L5O A;  1KNG A;  5ENU A;  1R5P A;  4CHS A;  4JU5 A;  4K0G A;  1OE8 A;  2YPM A;  4MH2 A;  1GLP A;  4ML6 A;  4KX4 A;  1OYJ A;  1GSQ A;  4EF0 A;  2OKA A;  4EL1 A;  1AQX A;  2H19 A;  4ZIL A;  1TRU A;  2G2Q A;  2I9H A;  1OVN A;  1CQG A;  4O32 A;  1X0R A;  11GS A;  2V6O A;  4KSO A;  2FA8 A;  4GCI A;  2GSR A;  2GST A;  5IMA A;  5J3R A;  2AAW A;  4FH8 A;  3F4R A;  4X0X A;  2HFD A;  2RM5 A;  3G7I A;  3EU3 A;  1GWC A;  2B3S A;  1M9A A;  1JHB A;  3IOS A;  1GUM A;  4WF5 A;  1VF4 A;  2X99 A;  3TGZ A;  2MMZ A;  4TVE A;  4ZB6 A;  1AAZ A;  5F05 A;  1ILO A;  1K0A A;  1MDK A;  2X8G A;  1THO A;  1FG4 A;  3DRN A;  5ID2 A;  2KLX A;  1GUL A;  5DVB A;  2O89 A;  2XBQ A;  2V1M A;  1O8X A;  3CYN A;  1SKR B;  2RUE A;  4HJ2 A;  3EYT A;  3VFI A;  2OBI A;  1PKZ A;  4I2U A;  1EV9 A;  3M8N A;  5IMD A;  1EWX A;  2HSH A;  5ELG A;  3HZ4 A;  4PUR A;  4IBP A;  1SKS B;  3DYR A;  2BTO T;  1GLQ A;  1KEB A;  3W8S A;  2NBS A;  1M0U A;  5CNW A;  1GL8 A;  2L59 A;  1BX9 A;  3NZN A;  2J9H A;  2C3T A;  3PGT A;  4KDY A;  6GSX A;  2H76 A;  4NHW A;  3HHV A;  4DEJ A;  5DJM A;  3WT2 A;  4WEY A;  2C0F A;  3TJF A;  5B6M A;  1GNE A;  2HRF A;  4CW9 A;  5ECS A;  2TIR A;  3KZQ A;  2AB6 A;  1OC8 A;  1OE7 A;  5EY6 A;  1EP7 A;  5D96 A;  1NSW A;  2HI7 A;  3PH9 A;  2VCV A;  1GSD A;  4KB3 A;  1EOH A;  1AC1 A;  2YAN A;  17GS A;  5HR3 A;  1GSS A;  3VI7 A;  16GS A;  4IS0 A;  4L5O A;  1YF1 A;  5H5Q A;  1XW5 A;  3WYW A;  4JE1 A;  5LNK e;  3MWH A;  5HFG A;  2H01 A;  2MBT A;  3GKN A;  2R6K A;  4BWQ A;  2J23 A;  4H86 A;  4IQ1 A;  4PQ1 A;  1Z9H A;  4DVC A;  5B6N A;  1DE2 A;  3HVV A;  4IQA A;  5IMF A;  5DAL A;  2YNX A;  3G7J A;  4JR4 A;  1EV4 A;  3H93 A;  2GSQ A;  2B1K A;  2LNS A;  3F4S A;  1V40 A;  1NHY A;  2JSY A;  3N5O A;  2E2G A;  1LJR A;  4OFM A;  4MJE A;  3BCI A;  2IME A;  1Y6E A;  2YWM A;  5IOX A;  1UVZ A;  5IIZ A;  1AQV A;  1TOF A;  4ZIJ A;  1QUW A;  1MEK A;  4IJ3 A;  12GS A;  2PUK C;  4OFN A;  1PGT A;  5A4U A;  3E9J B;  1TRV A;  4IN0 A;  4LMW A;  2QSI A;  1FB6 A;  2LQO A;  4NPB A;  1ON4 A;  3LFL A;  2JAC A;  1K0D A;  1XZO A;  4NHZ A;  4KDX A;  2XC2 A;  1FHE A;  5HFK A;  4QL9 A;  1XFL A;  5ECH B;  1Q4J A;  3EE2 A;  3VWX A;  5IQY A;  5ECP B;  2WCI A;  3F63 A;  3MNG A;  1T00 A;  3UVT A;  1OC3 A;  3ZZX A;  1TKD B;  1UN2 A;  3LXT A;  2PWJ A;  4GLT A;  4JR6 A;  4L8E A;  3ZYW A;  3TKP A;  1BQ7 A;  1XOB A;  3P2A A;  3TOT A;  3TCO A;  1A0F A;  1ERT A;  3DML A;  1SD8 A;  2PVQ A;  1USB A;  4PXO A;  1YEP A;  3QFB C;  2B7J A;  1QGV A;  1WPI A;  3HZ8 A;  1XCC A;  4Q5F A;  3VUR A;  3TOU A;  2KOK A; 
#chains in the Genus database with same CATH topology
 1TDI A;  3S9F A;  2HZE A;  4HJM A;  3HVS A;  1T1V A;  3NIV A;  4ZXG A;  2CZ2 A;  3KEB A;  3PIN A;  4HQS A;  2HXK A;  3TKS A;  4F0B A;  2LST A;  3DWV A;  2H0H A;  2FNO A;  2GLR A;  2DSA A;  4EDZ A;  3QDN A;  1Z5Y E;  4BVX A;  1URM A;  2X8C A;  2C0G A;  4IP6 A;  1A8L A;  2OJL A;  4TR1 B;  1WWJ A;  3GX8 A;  1A2J A;  3GV1 A;  4BL7 A;  2DIY A;  3FW2 A;  2HT9 A;  3GUS A;  2CQ9 A;  2XPD A;  3IHQ A;  4CY6 A;  5C04 A;  1BJX A;  4WBR D;  3C71 A;  3WD6 A;  3VK9 A;  5E59 A;  2I3Y A;  2YV7 A;  2EIR A;  2CAI A;  1QK8 A;  2H6Z A;  2C4J A;  3TKQ A;  13GS A;  3HXS A;  3FKF A;  5CYY A;  2E0Q A;  2DLX A;  3GX0 A;  5BMU A;  2L57 A;  1PRX A;  4XTS A;  4KCA A;  4DSR A;  1UA5 A;  5G31 A;  2DMM A;  3HVX A;  5KN3 A;  1WOU A;  2A2S A;  2X64 A;  2OAC A;  4Q5R A;  4MK3 A;  2JZS A;  4K5R A;  5FT3 A;  1AIU A;  3GUR A;  3TJK A;  1YY7 A;  2VUP A;  1H4O A;  4TXO A;  1PX7 A;  5LD0 A;  1X5D A;  3IAS 2;  2LQQ A;  2PPT A;  5IO0 A;  3O6T A;  2FA4 A;  2PER A;  3VPQ A;  1FW1 A;  5D9W A;  4ISD A;  2IMD A;  1YKA A;  3UL3 A;  4GRF A;  2NDO A;  4K2X A;  2ON5 A;  1OC9 B;  1V98 A;  4POB A;  3GN3 A;  1BG5 A;  2OBK A;  4MJC A;  1O85 A;  1XIY A;  3BCK A;  3A5W A;  3EWL A;  2CT6 A;  1OKT A;  1EOG A;  2L4Q A;  2YWO A;  3APQ A;  4AJ8 A;  4J2F A;  3CRU A;  2IFQ B;  5CRH A;  3V1W A;  5LCZ A;  4YAV A;  1H75 A;  2YV9 A;  4AGS A;  5CP1 A;  2YZU A;  4KE3 A;  2XBI A;  3IC4 A;  4KUN A;  1PN0 A;  5D9V A;  1LU4 A;  4D73 A;  1GSE A;  2ZUP A;  4YQV A;  4BA7 A;  5ECL B;  5J41 A;  2YP6 A;  3UAP A;  1FAA A;  1F6M C;  1A8Y A;  2Z9S A;  3GTU A;  5COH A;  2LKU A;  2R0G A;  4ZL8 A;  2NTO A;  1Z3E A;  4IW9 A;  1XVW A;  1FVJ A;  2HE3 A;  4K7O A;  2FWE A;  2F8A A;  5IPH A;  5JWR B;  3RBT A;  4J56 E;  3H79 A;  1XW6 A;  2GT6 A;  2C0D A;  2GS3 A;  2B5Y A;  3KMN A;  3QAW A;  3FR6 A;  2LJA A;  3FHK A;  4XRA A;  4YAP A;  2CV4 A;  3GRX A;  2PGT A;  5AIX A;  4V1A g;  3UVH A;  3IHG A;  3M0F A;  2O8V B;  4K7N A;  1JZR A;  3TRQ A;  1HQO A;  2LRC A;  4RQX A;  1AQW A;  4Z7X A;  1SYR A;  3LW9 A;  3C7M A;  3J7Y b;  3HJM A;  3GL3 A;  3MSZ A;  2H73 A;  1AW9 A;  4XS4 A;  4I97 A;  2YOI A;  3KP8 A;  4N10 A;  1X9S B;  3C1R A;  2WGR A;  1SK2 A;  4EXJ A;  4WKW A;  3N9J A;  2B5E A;  5DCH A;  2AUV A;  2HZF A;  4IGJ A;  4AJ6 A;  2FD3 A;  1T3B A;  1GTB A;  1V9W A;  1M7T A;  5F8B A;  3QR6 A;  2K6V A;  2QC7 A;  1Z6N A;  3RPN A;  3L0H A;  1TI1 A;  3LOR A;  3UEM A;  1XWC A;  3GA4 A;  3KD0 A;  4EDY A;  3GKX A;  4TN8 A;  2REM A;  4POM A;  2HLS A;  3A5I A;  5GST A;  5DJL A;  3IR4 A;  1EGR A;  2MBS A;  4JZQ A;  3GFK A;  1RQM A;  2X8H A;  4KAE A;  3BOA A;  1K0B A;  3WGD A;  5J4U A;  2ON7 A;  1GTI A;  2XPE A;  1ZYQ B;  4PQI A;  2VOC A;  3ZRD A;  1T7P B;  3ERF A;  3APS A;  4Q5Q A;  3IDV A;  3G7Y A;  3ERG A;  2LEG A;  5ECQ B;  3ZFL A;  5J9B A;  4G0L A;  2CX3 A;  1ERW A;  1WJK A;  2DJ0 A;  5KEJ A;  1JZD A;  3GMF A;  3LEF A;  4F2I A;  3MDK A;  5DAK B;  2H1A A;  2C1Y A;  4GST A;  2VLV A;  3HJP A;  2H66 A;  4MA9 A;  2O7K A;  1B4Q A;  1HNA A;  1MTC A;  4DSQ A;  2WUL A;  3FY7 A;  2G0F A;  3CXG A;  3KJY A;  3QD9 A;  4GXZ A;  1G7E A;  5DCG A;  2F8F A;  1OAZ A;  3M1G A;  5AIV A;  2V6K A;  4EKZ A;  4O5R A;  4EUY A;  1SKW B;  2PBJ A;  3A2V A;  3FR3 A;  1Z6M A;  3D4M A;  1FO5 A;  2A4V A;  2RLI A;  3G9B A;  4HZ2 A;  2L5L A;  2JL4 A;  1PMT A;  5G30 A;  2CAQ A;  1N2A A;  1PQN A;  2LV3 A;  2FLS A;  4PX1 A;  2HNL A;  2B7K A;  4GQC A;  4X4J A;  1A2L A;  5L71 A;  2MYG A;  5F06 A;  3LQ7 A;  4ACS A;  1FVK A;  3ISO A;  2C3N A;  3RHC A;  3L9V A;  4RQR A;  1YEX A;  2WDU A;  3EPT A;  3LGC A;  4ZL9 A;  4G10 A;  1XPV A;  4K0N A;  2QA2 A;  4AF2 A;  1VGL A;  1PA3 A;  1GTA A;  5A4V A;  3GH9 A;  2E7P A;  2YN1 A;  4ID0 A;  1Y25 A;  1GRX A;  1B48 A;  2VAF A;  5D93 A;  1B9X C;  2QKE A;  2F51 A;  3IV4 A;  18GS A;  3VLN A;  1SU9 A;  2GGT A;  4TR0 A;  3TUE A;  4TOP A;  1SJZ A;  4JBB A;  4HSC X;  9GSS A;  5IMC A;  3D6I A;  2DC5 A;  1VF1 A;  2JU5 A;  2RUF A;  2YZH A;  3VWW A;  1KTE A;  2B1L A;  4E8H A;  1X9M B;  2QGV A;  3FZ4 A;  4GQF A;  4OMV A;  3KGK A;  3RHB A;  2OAD A;  2FY6 A;  4MP4 A;  2AV4 A;  4KF9 A;  3MIX A;  5ABR A;  2IJY A;  1XBS A;  1G6W A;  3WT1 A;  1WP0 A;  2H1B A;  2LTK A;  5F0G A;  5FHI A;  3FYG A;  1WE0 A;  3OR5 A;  1EEJ A;  2JZR A;  4MAB A;  2R4V A;  3CTF A;  1GSY A;  1LBK A;  1G7O A;  4GSS A;  4K2D A;  4IP1 A;  3ED3 A;  1YQ1 A;  4LA1 A;  1A0R P;  4FYB A;  4YH2 A;  2DML A;  1ZZY A;  4Z2T A;  4XRD A;  4NV5 A;  2VCT A;  4NMU A;  2V41 A;  3UBK A;  3EIN A;  4WBJ A;  3I43 A;  4BVY A;  5IPG A;  4BPY A;  3H1N A;  4N0V A;  3A2X A;  2AJQ B;  1TTZ A;  3LJR A;  2DJ1 A;  4ZBD A;  4MCU A;  4Q5N A;  4JED A;  3VI5 A;  1M2A A;  4LMV A;  2FCH A;  1SL2 B;  4TW5 A;  1EZK A;  3HJO A;  4YKF A;  5DQY A;  5G5E A;  1OKD A;  3IE3 A;  2YJH A;  4OWY A;  1ZOF A;  3ZVJ D;  6GSS A;  1TXX A;  1HNB A;  3U5R E;  5H5R A;  3CSI A;  2K8S A;  3O3T A;  3VWV A;  2B6M A;  1B8X A;  3GH6 A;  2IN3 A;  4KH7 A;  2P31 A;  4KDU A;  1K3O A;  3PPU A;  3IK7 A;  4EO3 A;  2HRK A;  2VIM A;  3C1S A;  1A24 A;  4RUV A;  4WXT A;  3WGE A;  3DIE A;  1U6T A;  2VM2 A;  3M9J A;  3ZIT A;  2FWG A;  5D9X A;  5GAN D;  1I5G A;  3KIJ A;  2H74 A;  3HY2 A;  1HD2 A;  4ILF A;  1FB0 A;  2OE3 A;  4O92 A;  2JZT A;  2HRN A;  1ZL9 A;  4RI6 A;  4KA0 A;  2CA8 A;  4NWY A;  3EU4 A;  4HDE A;  1F9M A;  4KND A;  2R0C A;  1J08 A;  1S3C A;  2LS5 A;  3ZIV A;  1QFN A;  2H6Y A;  3HKR A;  2I81 A;  3TKR A;  4YQU A;  3Q6O A;  3DD3 A;  3IA1 A;  4PUF C;  4POK A;  2K18 A;  4K1F A;  4NXI A;  2MZC A;  3H8Q A;  10GS A;  1R4W A;  2VL3 A;  1SEN A;  3KXO A;  3IPZ A;  1MD3 A;  2P5Q A;  2L6D A;  4V2L A;  3DGQ A;  3JCM L;  5E4W A;  1Z7P A;  2M80 A;  3GL5 A;  2VL2 C;  5DQS A;  19GS A;  1W4V A;  3O76 A;  4ZBA A;  1E2Y A;  2R37 A;  1TK8 B;  2GTU A;  1EP8 A;  2IMF A;  1F37 A;  1RK4 A;  1PL2 A;  1S3A A;  2VLT A;  1NHO A;  3ZL5 A;  4EVM A;  3ME7 A;  4TR1 A;  5A5K A;  2A4H A;  4GSN A;  1YDK A;  5J9C A;  2VL9 A;  2GQK A;  1ZMA A;  2GQL A;  3M9K A;  1K3Y A;  2ZCT A;  1XWK A;  2H8L A;  1WIK A;  4XHM A;  3IK9 A;  3LG6 A;  1IYI A;  1F3A A;  1R5A A;  2GDR A;  4OCF A;  5HR1 A;  1B9Y C;  2N5A A;  2H0I A;  2VD0 A;  2WFC A;  3GHA A;  2K9F A;  2GZP A;  4F03 A;  1ST9 A;  1VF2 A;  2VCW A;  4V2N A;  4I6X A;  5F07 A;  5B8A A;  3GIX A;  2LRT A;  1VRS D;  4HU7 A;  3F6D A;  3E0U A;  3TDG A;  3Q19 A;  1GUH A;  1XXU A;  4PGT A;  4N11 A;  3GKM A;  3BJ5 A;  1G0T A;  2C0E A;  5G1K A;  4MH3 A;  1HNC A;  2C3Q A;  4DSS B;  3ZIJ A;  1ZCP A;  3TJJ A;  4L0U A;  1R7H A;  2PU9 C;  5CAX A;  5G2Z A;  1IYH A;  1PN9 A;  3US3 A;  1DSB A;  5IMZ A;  1K0O A;  2GZY A;  3D4T A;  1OC9 A;  3F8U A;  3QCP A;  1ERV A;  4GWR A;  2RII A;  3QAG A;  3J7Y k;  4G0I A;  3ERW A;  5KOW A;  1MDI A;  3ME8 A;  3DKS A;  3EMX A;  4XS6 A;  5EPF A;  4MZW A;  3ZVJ A;  1XOA A;  3GYK A;  2DJK A;  4A5P A;  3W8J A;  3LYP A;  4LL1 B;  1N8J A;  4I8B A;  4MZC A;  2IFQ A;  3U6V A;  2P0G A;  4K8M A;  4OO5 A;  3UMA A;  4F0C A;  3CSH A;  2BJX A;  4PNG A;  1AUC A;  4XS1 A;  3RAZ A;  4HS1 A;  2CVB A;  3CTG A;  2CZ3 A;  4RI7 A;  2TRX A;  1JZO A;  2MMA A;  4BIK A;  5HFI A;  4MPG A;  4OD7 A;  4HI7 A;  5KN0 A;  2IIY A;  4CY8 A;  1QMV A;  1TJD A;  2GVP A;  4TR3 A;  3HA9 A;  1F2E A;  3L4N A;  5ID2 B;  5ECM B;  2IMI A;  1WMJ A;  1PKW A;  2V32 A;  1PL1 A;  2CVD A;  6GSU A;  2PVO C;  3CMI A;  4IHU A;  1GUK A;  2H75 A;  3HDC A;  1X5C A;  2VLU A;  5HQP A;  2VO4 A;  4G0K A;  3FZ5 A;  4G9H A;  5CRW A;  1E6B A;  1GNW A;  4ECI A;  2XHF A;  2H0G A;  3CSJ A;  5AGY A;  4YKG A;  4HU9 A;  2R2J A;  4ZL7 A;  2H1G A;  1A2M A;  1J9B A;  1SYX A;  3HVN A;  4USS A;  3TJB A;  2GSS A;  3P8W A;  3QAV A;  4MF5 A;  1YF0 A;  5C00 A;  4TRX A;  3ZTL A;  4OO4 A;  1ACV A;  4K9Z A;  2IMK A;  2IL3 A;  3ZLP A;  2MMO A;  3QFA C;  3P7X A;  14GS A;  3UIW A;  2K8V A;  2BMX A;  5J5N A;  3GSS A;  2LNT A;  1O6J A;  2YWN A;  4NV2 A;  4BWS A;  5KN2 A;  3L9U A;  4ECC A;  1EGO A;  4X43 A;  4GF0 A;  3GST A;  2R5G A;  5GSS A;  4EIP A;  6GST A;  1DE1 A;  3ZML A;  1MDJ A;  2F9S A;  3D22 A;  1SJ6 A;  5CRG A;  1K0N A;  1O8W A;  2KHP A;  5D9T A;  2ALB A;  2CVK A;  1YZX A;  1NM3 A;  4MF6 A;  5EL8 A;  3KMO A;  4K7I A;  1O81 A;  1PX6 A;  2H71 A;  1JLW A;  2D2Z A;  5IMV A;  3EMP A;  5DAL B;  4J57 E;  5IM9 A;  3I69 A;  2M46 A;  4I2T A;  4POL A;  4MLY A;  2ES7 A;  5FWG A;  1TRS A;  4QQ7 A;  5ECN B;  3HCZ A;  3DXB A;  2HYX A;  2YWI A;  4PUA A;  4JRR A;  8GSS A;  5DAK A;  1ZYN A;  3M3M A;  1FOH A;  2VCX A;  2WRT A;  5DDL A;  4ZB8 A;  3CQF A;  1U88 A;  2OA7 A;  2N5B A;  5JCU A;  3D0Z A;  2N5F A;  3E3E A;  1TI3 A;  3WGX A;  1K0C A;  2UZ8 A;  3NOF A;  2KP2 A;  4FQU A;  4TR4 A;  1Q98 A;  4O7H A;  5D8I A;  5DBQ A;  1TK0 B;  4KW6 A;  4WF4 A;  3F3R A;  1GSF A;  5B7C A;  1PD2 1;  1JLV A;  2LUS A;  3R3E A;  4XCS A;  3K8N A;  5A4W A;  4PTS A;  4L5L A;  4TXV A;  4MZB A;  1VF3 A;  4IJI A;  3EC3 A;  4IKH A;  2FHE A;  2RM6 A;  4HOJ A;  2EIQ A;  3L9S A;  1ZYE A;  1YJ6 A;  3A2W A;  3EUR A;  3TRP A;  2AYT A;  1S3R A;  4ULX A;  3C73 A;  3QPM A;  2E2M A;  5BRT A;  1UC7 A;  3IRA A;  1S3D A;  1QQ2 A;  3ZRE A;  1HYU A;  2HZE B;  4HUA A;  3C8E A;  1J0F A;  1ERU A;  2VL2 A;  4IVF A;  1V58 A;  2FGX A;  4MF7 A;  3F0I A;  1XG8 A;  3FRC A;  1DUG A;  2LJR A;  1SL0 B;  3KH7 A;  3LSZ A;  4BVX B;  4N0Z A;  1DBY A;  4Z2U A;  2GZZ A;  3D5J A;  3TKS E;  2WZ9 A;  6GSY A;  5CO3 A;  4BL7 B;  5IO2 A;  5INY A;  5HR2 A;  5KN1 A;  1W89 A;  5JWO B;  3F4T A;  4ECB A;  3I6A A;  3Q74 A;  4ZBB A;  5GAP D;  1T8E B;  4HEA 2;  2JSZ A;  3H4K A;  1GSU A;  4KCE A;  2C8U A;  1ABA A;  4F9Z A;  2B5X A;  5CRD A;  4V1A p;  4X1U A;  1K3L A;  3SBC A;  1GP1 A;  3TJG A;  2VD1 A;  3BD2 A;  3KP9 A;  2NPB A;  4FIW A;  2OE1 A;  2OE0 A;  3ZFB A;  3QMX A;  4K6X A;  1WRY A;  1C72 A;  4TXO B;  3TB2 A;  2H6X A;  4KGI A;  2WB9 A;  2R3X A;  2EIO A;  1CQH A;  3A3T A;  1ML6 A;  4OFT A;  2X49 A;  4XIH A;  1G6Y A;  5B8B A;  1AXD A;  5CRE A;  5AN1 A;  4EE0 A;  1SK1 A;  4MMM A;  3AY8 A;  2O85 A;  2VCZ A;  1SD9 A;  1SK0 A;  4MJA A;  2H70 A;  1X5E A;  1O7U A;  4OCE A;  22GS A;  2MMN A;  3GKK A;  3RPP A;  4WR5 A;  2JAD A;  3UAR A;  4L0W A;  1TW9 A;  1MD4 A;  2CX4 A;  5ECI B;  3DVW A;  1F3B A;  4FYC A;  4EC0 A;  2GT5 A;  2A2R A;  3KTL A;  2M72 A;  1ZGN A;  2FWF A;  1GH2 A;  2KP1 A;  2DIZ A;  2FWH A;  3HD5 A;  2EC4 A;  1XWG A;  7GSS A;  1RW1 A;  1TRW A;  3LXZ A;  3FEU A;  3EVI A;  5AIS A;  1K0M A;  2DJJ A;  4D73 B;  4CDO A;  1XWB A;  4G2E A;  1XVQ A;  2I4A A;  4KSM A;  2C80 A;  1I9D A;  4P3Y B;  3GTU B;  5JWQ B;  3FK8 A;  4MNN A;  4ZB9 A;  4E8E A;  6GSW A;  20GS A;  4LL4 B;  1TU7 A;  3IAM 2;  1U3I A;  5HR0 A;  2H72 A;  4O5Q A;  1U3A A;  4WET A;  2DJ3 A;  3VWU A;  4ML1 A;  3KCM A;  3R2Q A;  1GTU A;  1T4Y A;  6GSV A;  2I1U A;  1TP9 A;  4HQZ A;  2DBC A;  4HZ4 A;  4IEL A;  2WJU A;  2HSY A;  3CBU A;  4I5Q A;  1O73 A;  1XWA A;  2VM1 A;  2VCQ A;  5G1L A;  1SL1 B;  3FZ9 A;  1KBN A;  4F82 A;  1QXH A;  4XS4 B;  2PMT A;  1JZW A;  3KTB A;  3SWL A;  2KUC A;  5GZZ B;  3P90 A;  3RDW A;  2NVL A;  3GNJ A;  1THX A;  1PSQ A;  2TRC P;  3VPT A;  2V2G A;  3TRX A;  5D73 A;  3LWA A;  3TKS C;  5ECK B;  4O5U A;  3ZMK A;  2HSM A;  2YJ7 A;  1B4P A;  1SJI A;  2H1D A;  5G5F A;  2AHE A;  4FO5 A;  3DEX A;  3CRT A;  4YQM A;  3LYK A;  2IWT A;  3KM6 A;  2O87 A;  1Z7R A;  3UJ1 A;  1BYE A;  4MPF A;  4MJB A;  1M2B A;  2DJ2 A;  4FYU A;  1ZYP A;  2FUG 2;  4AJ7 A;  3L78 A;  1T4Z A;  3UBL A;  1M3J A;  4PNF A;  2WS2 A;  3F6F A;  1EEM A;  1M9B A;  3HYP A;  4V2M A;  1V57 A;  5H5S A;  3IC8 A;  1M99 A;  1V2A A;  2IPA A;  2PN8 A;  4NAX A;  3BBY A;  2A2P A;  4PQH A;  3PR8 A;  3Q18 A;  3KH9 A;  3F3Q A;  1JFU A;  4G19 A;  1YKC A;  3W6G A;  3FR9 A;  2DKI A;  3IXR A;  5ELA A;  1NW2 A;  2H30 A;  3UOM A;  4GTU A;  1TK5 B;  3APO A;  2L4C A;  3F9U A;  5ECO B;  3D21 A;  4WR4 A;  2LJK A;  1XW9 A;  2P5R A;  1FOV A;  3MYD A;  3QOU A;  2LRN A;  3FZA A;  3MAK A;  2ZNM A;  4QL7 A;  1R26 A;  1M2D A;  5ECR B;  3IBH A;  4LLR A;  4N30 A;  4ECJ A;  1X9W B;  4DSS A;  2L6C A;  5JCG A;  2YCD A;  1U87 A;  2F3M A;  3I9V 2;  4TKY A;  5IOW A;  3DVX A;  1TU8 A;  1BAY A;  1BED A;  5EVO A;  2GQM A;  5JCW A;  4MDC A;  1A23 A;  2L5O A;  1KNG A;  5ENU A;  1R5P A;  4CHS A;  4JU5 A;  4K0G A;  1OE8 A;  2YPM A;  4MH2 A;  1GLP A;  2DKH A;  4ML6 A;  4KX4 A;  1OYJ A;  1GSQ A;  4EF0 A;  2OKA A;  4EL1 A;  1AQX A;  2X4A A;  2H19 A;  4ZIL A;  1TRU A;  2G2Q A;  2I9H A;  1OVN A;  1CQG A;  4O32 A;  1X0R A;  11GS A;  2V6O A;  4KSO A;  2FA8 A;  4GCI A;  2GSR A;  2GST A;  5IMA A;  5J3R A;  2AAW A;  4FH8 A;  3FMW A;  3F4R A;  4X0X A;  2HFD A;  2RM5 A;  3G7I A;  3EU3 A;  1GWC A;  2B3S A;  1M9A A;  1JHB A;  3IOS A;  1GUM A;  4WF5 A;  1VF4 A;  2X99 A;  3TGZ A;  2MMZ A;  4TVE A;  4ZB6 A;  1AAZ A;  5F05 A;  1ILO A;  1K0A A;  1MDK A;  2X8G A;  1THO A;  1FG4 A;  3DRN A;  4Z2R A;  2QA1 A;  5ID2 A;  2KLX A;  1GUL A;  5DVB A;  2O89 A;  2XBQ A;  2V1M A;  1O8X A;  3CYN A;  1SKR B;  2RUE A;  4HJ2 A;  3EYT A;  3VFI A;  2OBI A;  1PKZ A;  4I2U A;  1EV9 A;  3M8N A;  5IMD A;  1EWX A;  2HSH A;  5ELG A;  3HZ4 A;  4PUR A;  4IBP A;  1SKS B;  1M3I A;  3DYR A;  2BTO T;  1GLQ A;  1KEB A;  3W8S A;  2NBS A;  1M0U A;  2R0P A;  5CNW A;  1GL8 A;  2L59 A;  1BX9 A;  3NZN A;  2J9H A;  2C3T A;  3PGT A;  4KDY A;  6GSX A;  2H76 A;  4NHW A;  3HHV A;  4DEJ A;  5DJM A;  3WT2 A;  4WEY A;  2C0F A;  3TJF A;  5B6M A;  1GNE A;  2HRF A;  4CW9 A;  5ECS A;  2TIR A;  3KZQ A;  2AB6 A;  1OC8 A;  1OE7 A;  5EY6 A;  1EP7 A;  5D96 A;  1NSW A;  2HI7 A;  3PH9 A;  5KOX A;  2VCV A;  1GSD A;  4KB3 A;  1EOH A;  1AC1 A;  2YAN A;  17GS A;  5HR3 A;  1GSS A;  3VI7 A;  16GS A;  4IS0 A;  4L5O A;  4BVY B;  1YF1 A;  5H5Q A;  1XW5 A;  3WYW A;  4JE1 A;  4EIQ A;  5LNK e;  3MWH A;  5HFG A;  2H01 A;  2MBT A;  3GKN A;  2R6K A;  4BWQ A;  2J23 A;  4H86 A;  4IQ1 A;  4PQ1 A;  1Z9H A;  4DVC A;  5B6N A;  1DE2 A;  4ICY A;  3HVV A;  4IQA A;  5IMF A;  5DAL A;  2YNX A;  3G7J A;  4JR4 A;  1EV4 A;  3H93 A;  2GSQ A;  2B1K A;  2LNS A;  3F4S A;  1V40 A;  1NHY A;  2JSY A;  3N5O A;  4K5S A;  2E2G A;  1LJR A;  4OFM A;  4MJE A;  3BCI A;  2IME A;  1Y6E A;  2YWM A;  5IOX A;  1UVZ A;  5IIZ A;  1AQV A;  1TOF A;  4ZIJ A;  1QUW A;  1MEK A;  4IJ3 A;  12GS A;  2PUK C;  4OFN A;  1PGT A;  5A4U A;  3E9J B;  1TRV A;  4IN0 A;  4LMW A;  2QSI A;  1FB6 A;  2LQO A;  4NPB A;  1ON4 A;  3LFL A;  2JAC A;  1K0D A;  1XZO A;  4NHZ A;  4KDX A;  2XC2 A;  1FHE A;  5HFK A;  4QL9 A;  1XFL A;  5ECH B;  1Q4J A;  3EE2 A;  3VWX A;  2HRA A;  5ECP B;  5IQY A;  2WCI A;  3F63 A;  1PFO A;  1T00 A;  3MNG A;  3UVT A;  1OC3 A;  3ZZX A;  1TKD B;  1UN2 A;  3LXT A;  2PWJ A;  4GLT A;  4JR6 A;  4L8E A;  3ZYW A;  3TKP A;  1BQ7 A;  1XOB A;  3P2A A;  3TOT A;  3TCO A;  1A0F A;  1ERT A;  3DML A;  1SD8 A;  2PVQ A;  1USB A;  4PXO A;  1YEP A;  3QFB C;  2B7J A;  1QGV A;  1WPI A;  3HZ8 A;  1XCC A;  4Q5F A;  3VUR A;  3TOU A;  2KOK A; 
#chains in the Genus database with same CATH homology
 1TDI A;  3S9F A;  2HZE A;  4HJM A;  3HVS A;  1T1V A;  3NIV A;  4ZXG A;  2CZ2 A;  3KEB A;  3PIN A;  4HQS A;  2HXK A;  3TKS A;  4F0B A;  2LST A;  3DWV A;  2H0H A;  2FNO A;  2GLR A;  2DSA A;  4EDZ A;  3QDN A;  1Z5Y E;  4BVX A;  1URM A;  2X8C A;  2C0G A;  4IP6 A;  1A8L A;  2OJL A;  4TR1 B;  1WWJ A;  3GX8 A;  1A2J A;  3GV1 A;  4BL7 A;  2DIY A;  3FW2 A;  2HT9 A;  3GUS A;  2CQ9 A;  2XPD A;  3IHQ A;  4CY6 A;  5C04 A;  1BJX A;  4WBR D;  3C71 A;  3WD6 A;  3VK9 A;  5E59 A;  2I3Y A;  2YV7 A;  2EIR A;  2CAI A;  1QK8 A;  2H6Z A;  2C4J A;  3TKQ A;  13GS A;  3HXS A;  3FKF A;  5CYY A;  2E0Q A;  2DLX A;  3GX0 A;  5BMU A;  2L57 A;  1PRX A;  4XTS A;  4KCA A;  4DSR A;  1UA5 A;  5G31 A;  2DMM A;  3HVX A;  5KN3 A;  1WOU A;  2A2S A;  2X64 A;  2OAC A;  4Q5R A;  4MK3 A;  2JZS A;  4K5R A;  5FT3 A;  1AIU A;  3GUR A;  3TJK A;  1YY7 A;  2VUP A;  1H4O A;  4TXO A;  1PX7 A;  5LD0 A;  1X5D A;  3IAS 2;  2LQQ A;  2PPT A;  5IO0 A;  3O6T A;  2FA4 A;  2PER A;  3VPQ A;  1FW1 A;  5D9W A;  4ISD A;  2IMD A;  1YKA A;  3UL3 A;  4GRF A;  2NDO A;  4K2X A;  2ON5 A;  1OC9 B;  1V98 A;  4POB A;  3GN3 A;  1BG5 A;  2OBK A;  4MJC A;  1O85 A;  1XIY A;  3BCK A;  3A5W A;  3EWL A;  2CT6 A;  1OKT A;  1EOG A;  2L4Q A;  2YWO A;  3APQ A;  4AJ8 A;  4J2F A;  3CRU A;  2IFQ B;  5CRH A;  3V1W A;  5LCZ A;  4YAV A;  1H75 A;  2YV9 A;  4AGS A;  5CP1 A;  2YZU A;  4KE3 A;  2XBI A;  3IC4 A;  4KUN A;  1PN0 A;  5D9V A;  1LU4 A;  4D73 A;  1GSE A;  2ZUP A;  4YQV A;  4BA7 A;  5ECL B;  5J41 A;  2YP6 A;  3UAP A;  1FAA A;  1F6M C;  1A8Y A;  2Z9S A;  3GTU A;  5COH A;  2LKU A;  2R0G A;  4ZL8 A;  2NTO A;  1Z3E A;  4IW9 A;  1XVW A;  1FVJ A;  2HE3 A;  4K7O A;  2FWE A;  2F8A A;  5IPH A;  5JWR B;  3RBT A;  4J56 E;  3H79 A;  1XW6 A;  2GT6 A;  2C0D A;  2GS3 A;  2B5Y A;  3KMN A;  3QAW A;  3FR6 A;  2LJA A;  3FHK A;  4XRA A;  4YAP A;  2CV4 A;  3GRX A;  2PGT A;  5AIX A;  4V1A g;  3UVH A;  3IHG A;  3M0F A;  2O8V B;  4K7N A;  1JZR A;  3TRQ A;  1HQO A;  2LRC A;  4RQX A;  1AQW A;  4Z7X A;  1SYR A;  3LW9 A;  3C7M A;  3J7Y b;  3HJM A;  3GL3 A;  3MSZ A;  2H73 A;  1AW9 A;  4XS4 A;  4I97 A;  2YOI A;  3KP8 A;  4N10 A;  1X9S B;  3C1R A;  2WGR A;  1SK2 A;  4EXJ A;  4WKW A;  3N9J A;  2B5E A;  5DCH A;  2AUV A;  2HZF A;  4IGJ A;  4AJ6 A;  2FD3 A;  1T3B A;  1GTB A;  1V9W A;  1M7T A;  5F8B A;  3QR6 A;  2K6V A;  2QC7 A;  1Z6N A;  3RPN A;  3L0H A;  1TI1 A;  3LOR A;  3UEM A;  1XWC A;  3GA4 A;  3KD0 A;  4EDY A;  3GKX A;  4TN8 A;  2REM A;  4POM A;  2HLS A;  3A5I A;  5GST A;  5DJL A;  3IR4 A;  1EGR A;  2MBS A;  4JZQ A;  3GFK A;  1RQM A;  2X8H A;  4KAE A;  3BOA A;  1K0B A;  3WGD A;  5J4U A;  2ON7 A;  1GTI A;  2XPE A;  1ZYQ B;  4PQI A;  2VOC A;  3ZRD A;  1T7P B;  3ERF A;  3APS A;  4Q5Q A;  3IDV A;  3G7Y A;  3ERG A;  2LEG A;  5ECQ B;  3ZFL A;  5J9B A;  4G0L A;  2CX3 A;  1ERW A;  1WJK A;  2DJ0 A;  5KEJ A;  1JZD A;  3GMF A;  3LEF A;  4F2I A;  3MDK A;  5DAK B;  2H1A A;  2C1Y A;  4GST A;  2VLV A;  3HJP A;  2H66 A;  4MA9 A;  2O7K A;  1B4Q A;  1HNA A;  1MTC A;  4DSQ A;  2WUL A;  3FY7 A;  2G0F A;  3CXG A;  3KJY A;  3QD9 A;  4GXZ A;  1G7E A;  5DCG A;  2F8F A;  1OAZ A;  3M1G A;  5AIV A;  2V6K A;  4EKZ A;  4O5R A;  4EUY A;  1SKW B;  2PBJ A;  3A2V A;  3FR3 A;  1Z6M A;  3D4M A;  1FO5 A;  2A4V A;  2RLI A;  3G9B A;  4HZ2 A;  2L5L A;  2JL4 A;  1PMT A;  5G30 A;  2CAQ A;  1N2A A;  1PQN A;  2LV3 A;  2FLS A;  4PX1 A;  2HNL A;  2B7K A;  4GQC A;  4X4J A;  1A2L A;  5L71 A;  2MYG A;  5F06 A;  3LQ7 A;  4ACS A;  1FVK A;  3ISO A;  2C3N A;  3RHC A;  3L9V A;  4RQR A;  1YEX A;  2WDU A;  3EPT A;  3LGC A;  4ZL9 A;  4G10 A;  1XPV A;  4K0N A;  2QA2 A;  4AF2 A;  1VGL A;  1PA3 A;  1GTA A;  5A4V A;  3GH9 A;  2E7P A;  2YN1 A;  4ID0 A;  1Y25 A;  1GRX A;  1B48 A;  2VAF A;  5D93 A;  1B9X C;  2QKE A;  2F51 A;  3IV4 A;  18GS A;  3VLN A;  1SU9 A;  2GGT A;  4TR0 A;  3TUE A;  4TOP A;  1SJZ A;  4JBB A;  9GSS A;  5IMC A;  3D6I A;  2DC5 A;  1VF1 A;  2JU5 A;  2RUF A;  2YZH A;  3VWW A;  1KTE A;  2B1L A;  4E8H A;  1X9M B;  2QGV A;  3FZ4 A;  4GQF A;  4OMV A;  3KGK A;  3RHB A;  2OAD A;  2FY6 A;  4MP4 A;  2AV4 A;  4KF9 A;  3MIX A;  5ABR A;  2IJY A;  1XBS A;  1G6W A;  3WT1 A;  1WP0 A;  2H1B A;  2LTK A;  5F0G A;  5FHI A;  3FYG A;  1WE0 A;  3OR5 A;  1EEJ A;  2JZR A;  4MAB A;  2R4V A;  3CTF A;  1GSY A;  1LBK A;  1G7O A;  4GSS A;  4K2D A;  4IP1 A;  3ED3 A;  1YQ1 A;  4LA1 A;  1A0R P;  4FYB A;  4YH2 A;  2DML A;  1ZZY A;  4Z2T A;  4XRD A;  4NV5 A;  2VCT A;  4NMU A;  2V41 A;  3UBK A;  3EIN A;  4WBJ A;  3I43 A;  4BVY A;  5IPG A;  4BPY A;  3H1N A;  4N0V A;  3A2X A;  2AJQ B;  1TTZ A;  3LJR A;  2DJ1 A;  4ZBD A;  4MCU A;  4Q5N A;  4JED A;  3VI5 A;  1M2A A;  4LMV A;  2FCH A;  1SL2 B;  4TW5 A;  1EZK A;  3HJO A;  4YKF A;  5DQY A;  5G5E A;  1OKD A;  3IE3 A;  2YJH A;  4OWY A;  1ZOF A;  3ZVJ D;  6GSS A;  1TXX A;  1HNB A;  3U5R E;  5H5R A;  3CSI A;  2K8S A;  3O3T A;  3VWV A;  2B6M A;  1B8X A;  3GH6 A;  2IN3 A;  4KH7 A;  2P31 A;  4KDU A;  1K3O A;  3PPU A;  3IK7 A;  4EO3 A;  2HRK A;  2VIM A;  3C1S A;  1A24 A;  4RUV A;  4WXT A;  3WGE A;  3DIE A;  1U6T A;  2VM2 A;  3M9J A;  3ZIT A;  2FWG A;  5D9X A;  5GAN D;  1I5G A;  3KIJ A;  2H74 A;  3HY2 A;  1HD2 A;  4ILF A;  1FB0 A;  2OE3 A;  4O92 A;  2JZT A;  2HRN A;  1ZL9 A;  4RI6 A;  4KA0 A;  2CA8 A;  4NWY A;  3EU4 A;  4HDE A;  1F9M A;  4KND A;  2R0C A;  1J08 A;  1S3C A;  2LS5 A;  3ZIV A;  1QFN A;  2H6Y A;  3HKR A;  2I81 A;  3TKR A;  4YQU A;  3Q6O A;  3DD3 A;  3IA1 A;  4PUF C;  4POK A;  2K18 A;  4K1F A;  4NXI A;  2MZC A;  3H8Q A;  10GS A;  1R4W A;  2VL3 A;  1SEN A;  3KXO A;  3IPZ A;  1MD3 A;  2P5Q A;  2L6D A;  4V2L A;  3DGQ A;  3JCM L;  5E4W A;  1Z7P A;  2M80 A;  3GL5 A;  2VL2 C;  5DQS A;  19GS A;  1W4V A;  3O76 A;  4ZBA A;  1E2Y A;  2R37 A;  1TK8 B;  2GTU A;  1EP8 A;  2IMF A;  1F37 A;  1RK4 A;  1PL2 A;  1S3A A;  2VLT A;  1NHO A;  3ZL5 A;  4EVM A;  3ME7 A;  4TR1 A;  5A5K A;  2A4H A;  4GSN A;  1YDK A;  5J9C A;  2VL9 A;  2GQK A;  1ZMA A;  2GQL A;  3M9K A;  1K3Y A;  2ZCT A;  1XWK A;  2H8L A;  1WIK A;  4XHM A;  3IK9 A;  3LG6 A;  1IYI A;  1F3A A;  1R5A A;  2GDR A;  4OCF A;  5HR1 A;  1B9Y C;  2N5A A;  2H0I A;  2VD0 A;  2WFC A;  3GHA A;  2K9F A;  2GZP A;  4F03 A;  1ST9 A;  1VF2 A;  2VCW A;  4V2N A;  4I6X A;  5F07 A;  5B8A A;  3GIX A;  2LRT A;  1VRS D;  4HU7 A;  3F6D A;  3E0U A;  3TDG A;  3Q19 A;  1GUH A;  1XXU A;  4PGT A;  4N11 A;  3GKM A;  3BJ5 A;  1G0T A;  2C0E A;  5G1K A;  4MH3 A;  1HNC A;  2C3Q A;  4DSS B;  3ZIJ A;  1ZCP A;  3TJJ A;  4L0U A;  1R7H A;  2PU9 C;  5CAX A;  5G2Z A;  1IYH A;  1PN9 A;  3US3 A;  1DSB A;  5IMZ A;  1K0O A;  2GZY A;  3D4T A;  1OC9 A;  3F8U A;  3QCP A;  1ERV A;  4GWR A;  2RII A;  3QAG A;  3J7Y k;  4G0I A;  3ERW A;  5KOW A;  1MDI A;  3ME8 A;  3DKS A;  3EMX A;  4XS6 A;  5EPF A;  4MZW A;  3ZVJ A;  1XOA A;  3GYK A;  2DJK A;  4A5P A;  3W8J A;  3LYP A;  4LL1 B;  1N8J A;  4I8B A;  4MZC A;  2IFQ A;  3U6V A;  2P0G A;  4K8M A;  4OO5 A;  3UMA A;  4F0C A;  3CSH A;  2BJX A;  4PNG A;  1AUC A;  4XS1 A;  3RAZ A;  4HS1 A;  2CVB A;  3CTG A;  2CZ3 A;  4RI7 A;  2TRX A;  1JZO A;  2MMA A;  5HFI A;  4MPG A;  4OD7 A;  4HI7 A;  5KN0 A;  2IIY A;  4CY8 A;  1QMV A;  1TJD A;  2GVP A;  4TR3 A;  3HA9 A;  1F2E A;  3L4N A;  5ID2 B;  5ECM B;  2IMI A;  1WMJ A;  1PKW A;  2V32 A;  1PL1 A;  2CVD A;  6GSU A;  2PVO C;  3CMI A;  4IHU A;  1GUK A;  2H75 A;  3HDC A;  1X5C A;  2VLU A;  5HQP A;  2VO4 A;  4G0K A;  3FZ5 A;  4G9H A;  5CRW A;  1E6B A;  1GNW A;  4ECI A;  2XHF A;  2H0G A;  3CSJ A;  5AGY A;  4YKG A;  4HU9 A;  2R2J A;  4ZL7 A;  2H1G A;  1A2M A;  1J9B A;  1SYX A;  4USS A;  3TJB A;  2GSS A;  3P8W A;  3QAV A;  4MF5 A;  1YF0 A;  5C00 A;  4TRX A;  3ZTL A;  4OO4 A;  1ACV A;  4K9Z A;  2IMK A;  2IL3 A;  3ZLP A;  2MMO A;  3QFA C;  3P7X A;  14GS A;  3UIW A;  2K8V A;  2BMX A;  5J5N A;  3GSS A;  2LNT A;  1O6J A;  2YWN A;  4NV2 A;  4BWS A;  5KN2 A;  3L9U A;  4ECC A;  1EGO A;  4X43 A;  4GF0 A;  3GST A;  2R5G A;  5GSS A;  4EIP A;  6GST A;  1DE1 A;  3ZML A;  1MDJ A;  2F9S A;  3D22 A;  1SJ6 A;  5CRG A;  1K0N A;  1O8W A;  2KHP A;  5D9T A;  2ALB A;  2CVK A;  1YZX A;  1NM3 A;  4MF6 A;  5EL8 A;  3KMO A;  4K7I A;  1O81 A;  1PX6 A;  2H71 A;  1JLW A;  2D2Z A;  5IMV A;  3EMP A;  5DAL B;  4J57 E;  5IM9 A;  3I69 A;  2M46 A;  4I2T A;  4POL A;  4MLY A;  2ES7 A;  5FWG A;  1TRS A;  4QQ7 A;  5ECN B;  3HCZ A;  3DXB A;  2HYX A;  2YWI A;  4PUA A;  4JRR A;  8GSS A;  5DAK A;  1ZYN A;  3M3M A;  1FOH A;  2VCX A;  2WRT A;  5DDL A;  4ZB8 A;  1U88 A;  2OA7 A;  2N5B A;  5JCU A;  3D0Z A;  2N5F A;  3E3E A;  1TI3 A;  3WGX A;  1K0C A;  2UZ8 A;  3NOF A;  2KP2 A;  4FQU A;  4TR4 A;  1Q98 A;  4O7H A;  5D8I A;  5DBQ A;  1TK0 B;  4KW6 A;  4WF4 A;  3F3R A;  1GSF A;  5B7C A;  1PD2 1;  1JLV A;  2LUS A;  3R3E A;  4XCS A;  3K8N A;  5A4W A;  4PTS A;  4L5L A;  4TXV A;  4MZB A;  1VF3 A;  4IJI A;  3EC3 A;  4IKH A;  2FHE A;  2RM6 A;  4HOJ A;  2EIQ A;  3L9S A;  1ZYE A;  1YJ6 A;  3A2W A;  3EUR A;  3TRP A;  2AYT A;  4ULX A;  3C73 A;  3QPM A;  2E2M A;  5BRT A;  1UC7 A;  3IRA A;  1S3D A;  1QQ2 A;  3ZRE A;  1HYU A;  2HZE B;  4HUA A;  3C8E A;  1J0F A;  1ERU A;  2VL2 A;  4IVF A;  1V58 A;  2FGX A;  4MF7 A;  3F0I A;  3FRC A;  1DUG A;  2LJR A;  1SL0 B;  3KH7 A;  3LSZ A;  4BVX B;  4N0Z A;  1DBY A;  4Z2U A;  2GZZ A;  3D5J A;  3TKS E;  2WZ9 A;  6GSY A;  5CO3 A;  4BL7 B;  5IO2 A;  5INY A;  5HR2 A;  5KN1 A;  1W89 A;  5JWO B;  3F4T A;  4ECB A;  3I6A A;  3Q74 A;  4ZBB A;  5GAP D;  1T8E B;  4HEA 2;  2JSZ A;  3H4K A;  1GSU A;  4KCE A;  2C8U A;  1ABA A;  4F9Z A;  2B5X A;  5CRD A;  4V1A p;  4X1U A;  1K3L A;  3SBC A;  1GP1 A;  3TJG A;  2VD1 A;  3BD2 A;  3KP9 A;  2NPB A;  4FIW A;  2OE1 A;  2OE0 A;  3ZFB A;  3QMX A;  4K6X A;  1WRY A;  1C72 A;  4TXO B;  3TB2 A;  2H6X A;  4KGI A;  2WB9 A;  2R3X A;  2EIO A;  1CQH A;  3A3T A;  1ML6 A;  4OFT A;  2X49 A;  4XIH A;  1G6Y A;  5B8B A;  1AXD A;  5CRE A;  5AN1 A;  4EE0 A;  1SK1 A;  4MMM A;  3AY8 A;  2O85 A;  2VCZ A;  1SD9 A;  1SK0 A;  4MJA A;  2H70 A;  1X5E A;  1O7U A;  4OCE A;  22GS A;  2MMN A;  3GKK A;  3RPP A;  4WR5 A;  2JAD A;  3UAR A;  4L0W A;  1TW9 A;  1MD4 A;  2CX4 A;  5ECI B;  3DVW A;  1F3B A;  4FYC A;  4EC0 A;  2GT5 A;  2A2R A;  3KTL A;  2M72 A;  1ZGN A;  2FWF A;  1GH2 A;  2KP1 A;  2DIZ A;  2FWH A;  3HD5 A;  2EC4 A;  1XWG A;  7GSS A;  1RW1 A;  1TRW A;  3LXZ A;  3FEU A;  3EVI A;  5AIS A;  1K0M A;  2DJJ A;  4D73 B;  4CDO A;  1XWB A;  4G2E A;  1XVQ A;  2I4A A;  4KSM A;  2C80 A;  1I9D A;  4P3Y B;  3GTU B;  5JWQ B;  3FK8 A;  4MNN A;  4ZB9 A;  4E8E A;  6GSW A;  20GS A;  4LL4 B;  1TU7 A;  3IAM 2;  1U3I A;  5HR0 A;  2H72 A;  4O5Q A;  1U3A A;  4WET A;  2DJ3 A;  3VWU A;  4ML1 A;  3KCM A;  3R2Q A;  1GTU A;  1T4Y A;  6GSV A;  2I1U A;  1TP9 A;  4HQZ A;  2DBC A;  4HZ4 A;  4IEL A;  2WJU A;  2HSY A;  3CBU A;  4I5Q A;  1O73 A;  1XWA A;  2VM1 A;  2VCQ A;  5G1L A;  1SL1 B;  3FZ9 A;  1KBN A;  4F82 A;  1QXH A;  4XS4 B;  2PMT A;  1JZW A;  3KTB A;  3SWL A;  2KUC A;  5GZZ B;  3P90 A;  3RDW A;  2NVL A;  3GNJ A;  1THX A;  1PSQ A;  2TRC P;  3VPT A;  2V2G A;  3TRX A;  5D73 A;  3LWA A;  3TKS C;  5ECK B;  4O5U A;  3ZMK A;  2HSM A;  2YJ7 A;  1B4P A;  1SJI A;  2H1D A;  5G5F A;  2AHE A;  4FO5 A;  3DEX A;  3CRT A;  4YQM A;  3LYK A;  2IWT A;  3KM6 A;  2O87 A;  1Z7R A;  3UJ1 A;  1BYE A;  4MPF A;  4MJB A;  1M2B A;  2DJ2 A;  4FYU A;  1ZYP A;  2FUG 2;  4AJ7 A;  3L78 A;  1T4Z A;  3UBL A;  4PNF A;  2WS2 A;  3F6F A;  1EEM A;  1M9B A;  3HYP A;  4V2M A;  1V57 A;  5H5S A;  3IC8 A;  1M99 A;  1V2A A;  2IPA A;  2PN8 A;  4NAX A;  3BBY A;  2A2P A;  4PQH A;  3PR8 A;  3Q18 A;  3KH9 A;  3F3Q A;  1JFU A;  4G19 A;  1YKC A;  3W6G A;  3FR9 A;  2DKI A;  3IXR A;  5ELA A;  1NW2 A;  2H30 A;  3UOM A;  4GTU A;  1TK5 B;  3APO A;  2L4C A;  3F9U A;  5ECO B;  3D21 A;  4WR4 A;  2LJK A;  1XW9 A;  2P5R A;  1FOV A;  3MYD A;  3QOU A;  2LRN A;  3FZA A;  3MAK A;  2ZNM A;  4QL7 A;  1R26 A;  1M2D A;  5ECR B;  3IBH A;  4LLR A;  4N30 A;  4ECJ A;  1X9W B;  4DSS A;  2L6C A;  5JCG A;  2YCD A;  1U87 A;  2F3M A;  3I9V 2;  4TKY A;  5IOW A;  3DVX A;  1TU8 A;  1BAY A;  1BED A;  5EVO A;  2GQM A;  5JCW A;  4MDC A;  1A23 A;  2L5O A;  1KNG A;  5ENU A;  1R5P A;  4CHS A;  4JU5 A;  4K0G A;  1OE8 A;  2YPM A;  4MH2 A;  1GLP A;  2DKH A;  4ML6 A;  4KX4 A;  1OYJ A;  1GSQ A;  4EF0 A;  2OKA A;  4EL1 A;  1AQX A;  2X4A A;  2H19 A;  4ZIL A;  1TRU A;  2G2Q A;  2I9H A;  1OVN A;  1CQG A;  4O32 A;  1X0R A;  11GS A;  2V6O A;  4KSO A;  2FA8 A;  4GCI A;  2GSR A;  2GST A;  5IMA A;  5J3R A;  2AAW A;  4FH8 A;  3FMW A;  3F4R A;  4X0X A;  2HFD A;  2RM5 A;  3G7I A;  3EU3 A;  1GWC A;  2B3S A;  1M9A A;  1JHB A;  3IOS A;  1GUM A;  4WF5 A;  1VF4 A;  2X99 A;  3TGZ A;  2MMZ A;  4TVE A;  4ZB6 A;  1AAZ A;  5F05 A;  1ILO A;  1K0A A;  1MDK A;  2X8G A;  1THO A;  1FG4 A;  3DRN A;  4Z2R A;  2QA1 A;  5ID2 A;  2KLX A;  1GUL A;  5DVB A;  2O89 A;  2XBQ A;  2V1M A;  1O8X A;  3CYN A;  1SKR B;  2RUE A;  4HJ2 A;  3EYT A;  3VFI A;  2OBI A;  1PKZ A;  4I2U A;  1EV9 A;  3M8N A;  5IMD A;  1EWX A;  2HSH A;  5ELG A;  3HZ4 A;  4PUR A;  4IBP A;  1SKS B;  3DYR A;  2BTO T;  1GLQ A;  1KEB A;  3W8S A;  2NBS A;  1M0U A;  2R0P A;  5CNW A;  1GL8 A;  2L59 A;  1BX9 A;  3NZN A;  2J9H A;  2C3T A;  3PGT A;  4KDY A;  6GSX A;  2H76 A;  4NHW A;  3HHV A;  4DEJ A;  5DJM A;  3WT2 A;  4WEY A;  2C0F A;  3TJF A;  5B6M A;  1GNE A;  2HRF A;  4CW9 A;  5ECS A;  2TIR A;  3KZQ A;  2AB6 A;  1OC8 A;  1OE7 A;  5EY6 A;  1EP7 A;  5D96 A;  1NSW A;  2HI7 A;  3PH9 A;  5KOX A;  2VCV A;  1GSD A;  4KB3 A;  1EOH A;  1AC1 A;  2YAN A;  17GS A;  5HR3 A;  1GSS A;  3VI7 A;  16GS A;  4IS0 A;  4L5O A;  4BVY B;  1YF1 A;  5H5Q A;  1XW5 A;  3WYW A;  4JE1 A;  4EIQ A;  5LNK e;  3MWH A;  5HFG A;  2H01 A;  2MBT A;  3GKN A;  2R6K A;  4BWQ A;  2J23 A;  4H86 A;  4IQ1 A;  4PQ1 A;  1Z9H A;  4DVC A;  5B6N A;  1DE2 A;  4ICY A;  3HVV A;  4IQA A;  5IMF A;  5DAL A;  2YNX A;  3G7J A;  4JR4 A;  1EV4 A;  3H93 A;  2GSQ A;  2B1K A;  2LNS A;  3F4S A;  1V40 A;  1NHY A;  2JSY A;  3N5O A;  4K5S A;  2E2G A;  1LJR A;  4OFM A;  4MJE A;  3BCI A;  2IME A;  1Y6E A;  2YWM A;  5IOX A;  1UVZ A;  5IIZ A;  1AQV A;  1TOF A;  4ZIJ A;  1QUW A;  1MEK A;  4IJ3 A;  12GS A;  2PUK C;  4OFN A;  1PGT A;  5A4U A;  3E9J B;  1TRV A;  4IN0 A;  4LMW A;  2QSI A;  1FB6 A;  2LQO A;  4NPB A;  1ON4 A;  3LFL A;  2JAC A;  1K0D A;  1XZO A;  4NHZ A;  4KDX A;  2XC2 A;  1FHE A;  5HFK A;  4QL9 A;  1XFL A;  5ECH B;  1Q4J A;  3EE2 A;  3VWX A;  2HRA A;  5ECP B;  5IQY A;  2WCI A;  3F63 A;  3MNG A;  1T00 A;  3UVT A;  1OC3 A;  3ZZX A;  1TKD B;  1UN2 A;  3LXT A;  2PWJ A;  4GLT A;  4JR6 A;  4L8E A;  3ZYW A;  3TKP A;  1BQ7 A;  1XOB A;  3P2A A;  3TOT A;  3TCO A;  1A0F A;  1ERT A;  3DML A;  1SD8 A;  2PVQ A;  1USB A;  4PXO A;  1YEP A;  3QFB C;  2B7J A;  1QGV A;  1WPI A;  3HZ8 A;  1XCC A;  4Q5F A;  3VUR A;  3TOU A;  2KOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...