5CO7A

E. coli mazf form iii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
104
Chain Sequence
b'VSRYVPDMGDLIWVDFDPHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
molecule tags Hydrolase
source organism Escherichia coli
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
total genus 24
structure length 104
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5co7A00
5CKDA 4ELZC 5CR2A 1M1FA 5CKHA 5CO7A 1X75C 2C06A 4OF1A 4HKEA 5HKCA 5CCAA 3NFCA 3JRZA 5CQYA 4ME7A 3HPWA 3VUBA 4ELYC 5DLOA 5CKFA 2KMTA 4MZMA 3JSCA 5CK9A 5HK3A 4MZPA 1UB4A 4MZTA 1VUBA 5CKEA 1NE8A 5HK0A 5CKBA 3G7ZA 3TCJA 2MF2A 4MDXA 2VUBA 4VUBA 5CQXA
chains in the Genus database with same CATH superfamily
3EHQA 4BD3A 4M7DC 2WSCE 4C0FA 4HVVA 4FW1A 2QK0A 3QYGB 3O5ZA 2DD5A 2W10A 3M58A 3UWNA 1N5ZA 1VQ9A 3L2UA 2HBWA 2K5FA 4BE1A 5GAMj 3DLLA 1DJ7B 4RTWA 4LDWA 3CCRQ 2VUBA 2FZKB 3CQTA 4BY6B 3EFRA 4ELZC 3QZ5B 3M0RA 1VYVA 1KD1C 4J9DA 4XTZA 2DL3A 4FIBA 2RJCA 2IPOB 2OTLA 3PFSA 3OW2A 1EIFA 3GF5A 4DOWA 2K3XA 2L2PA 1GBRA 2FEIA 2CP2A 2DYIA 1YJWA 2RMOA 3A98A 2KXDA 2RQUA 2DF6A 4GBQA 4A54A 2AZVA 2FB7A 5DLQE 1KQSP 3UA6A 4DA4A 1UFFA 4KUIA 3UT1A 5I21A 4PL6A 3M59A 5KYUB 5ECAA 1KHIA 1YI2Q 1WQWA 5HCKA 2R5AA 2CZ0B 1TG0A 4FYYB 3CC2Q 2R58A 2EJ9A 3O8VA 4PJLA 5KYNA 1ZSZA 5KYYB 5FU7B 5D7UA 1K8AR 4ZTFA 3CCQT 1UTIA 2KBTA 2QI2A 3EFSA 5KYWB 3CC7A 4F17A 4Y92A 4M75F 2H8HA 2K9GA 2AKKA 2LT1A 3OQ5A 1YJNA 3VS0A 1VQPT 1EFNA 4C5IA 1UUEA 1H3ZA 2E70A 3PT9A 3NFCA 4O5VA 4LNPA 1PKTA 1QVGA 2EQMA 1AZGB 2DIGA 4EDUA 2EGAA 2YWWA 4A4KA 1YITA 2E10A 2LP5A 3CCST 1N8RU 3JB9I 3QJYA 3CC4T 2COWA 1SSFA 2HSEB 2JN0A 2AHJB 4R55A 1N9SA 1IHWA 1PM3A 1UG1A 1X6BA 3JCMe 2HSPA 2IIMA 4PNOA 2QA4T 2LDMA 3CCVA 1VQNQ 1IHVA 2K7AA 3OSSC 1G8XA 4MZMA 2QTXA 1G3SA 1K0XA 1TH7A 4C8QC 3NTIA 1MMDA 1NG2A 2KNBB 2MWOA 2PNIA 4M7AF 3OA6A 4C92C 4E7SA 1OQKA 2CKKA 2KI7A 3OBWA 2XDBA 1VQPA 4RTVA 2CP3A 4F7UG 4IUVA 3JCMV 2PVOB 4J7IA 4N4GA 3CCVT 3J80E 2X3XD 1Y07A 1OX9A 3M56A 4J6WA 3BDUA 2LVMA 5D6YA 1ZSZC 2PVGB 1OOTA 3Q1JA 3PNWC 1H8KA 1LJOA 2HKNA 4E2FB 1AOJA 1TS9A 4PJJA 3NHNA 2RI3A 1A0NB 1UHCA 2RF0A 2YUOA 2L5QA 4LUEA 2KRNA 2BE9B 1TU0B 4BB7A 1MNDA 1WJRA 4OMOA 1QCNA 4EPCA 3VS7A 2OI3A 4OMQA 4C92G 1QW1A 4RKUE 1ZA1B 1NYGA 1Q81U 2H3EB 1O9SA 3CC7T 2EQUA 3VS1A 2ABLA 1S72T 2JS2A 5C0MA 1XJWB 1Z9ZA 2E4HA 3EFOB 4HCBA 2M16A 3V8JA 4FYXB 4BUGA 3PVQA 3G7ZA 1QLYA 2D0QB 2B8AA 4LDVA 3PMTA 3FLGA 2M9UA 2DNUA 5GJWB 2LC4A 1ARKA 1N8RR 1CKBA 1FXXA 1GRIA 3V8KA 3RMSA 4KGVB 2VV5A 3AT1B 4N4IA 4OB2B 2FO0A 4JRPA 1VQKQ 3OYIA 3SB2A 4BI4A 4A4EA 1BCOA 4FM4B 4DEXA 2RQVA 3CPWS 3H9NA 3ASKA 1SHFA 1VQ6A 3VUBA 2QQSA 2XK0A 2WSFE 3QPHA 4OB0B 1K4US 4IKFA 1Q7YU 2CZ7B 5KYWA 3OYAA 3G1JA 1JU5C 2MWPA 3V7CA 2QDLA 2DJQA 2RPNA 4IUTA 2NUTB 2LJ3A 4PLIA 2FYKA 1TTHB 2QEXQ 1Y57A 4EIKA 4F7UE 5KCHA 3OYMA 1N6AA 5KE2A 2OX7A 4ELYC 1N27A 1I07A 1WDXA 4OMFB 1D1BA 1HSQA 4FYVB 2RJDA 3CC4Q 1K8AU 5A0GA 1Q7YR 2COZA 3TSWA 4C8QD 1BYMA 2D0NA 3LWIA 2CP7A 1NEGA 4Q5WA 2CH4W 2EKHA 1PG5B 4D8KA 3I9QA 1M5Q1 5KYUA 1P92A 1RAGB 3OYFA 1AHJB 1KD1R 3JCMJ 4JUVA 3JCMb 3QSUA 4X9CA 1WQ7A 4CI0C 2LQ8A 3JB9G 2L89A 2QDYB 1D3BA 5AT1B 4C92E 4EMKB 4M77D 2MYSA 4XU0A 3EH1A 3V7RA 2JJ9A 2RJFA 4C5GA 4RTYA 2RM4A 1Q82C 3ULRB 2V8JA 4PFPA 2DA9A 2KE9A 5DY9A 4F7UA 2KROA 4JJNK 3QKJA 2EBPA 1VQ4T 2PVDB 1SG5A 1ZQ1A 1ZX6A 2OTJA 1RAHB 2CSIA 3X28B 1YNZA 1AVZC 4LDUA 4RG8A 3BDLA 4BE2A 3EGXA 2G6FX 4J5YA 1NLOC 2MK5A 1QVGS 1ZLMA 1G2BA 3G6EA 2DEQA 1ZSZB 5KYYA 3I56Q 1EX4A 2YT6A 1R0CB 3NMZC 1D09B 2AZSA 2KDSA 2LRQA 3WVEB 2MAMA 4E7HA 4DQ2A 4JJCA 1B34B 2G3RA 2KSSA 2D8HA 3REAB 1WXTA 1ZBJA 3KUFA 4C92D 2DXBA 4RTUA 1BI2A 3HRUA 4NS5A 4HA8A 4XU3A 1WGSA 2E64A 1K9MU 2XMFA 1AWXA 2QXFA 3G6ET 2P0PA 4P5NA 2K2VA 3CD6Q 4M78C 2CZ6B 2DETA 1LOJA 3L2ZA 3RKYA 2FPDA 2ZGWA 1QMCA 5HK0A 3JCMd 3RESA 4M7DD 2CH4A 1VQ7A 2HBPA 4E7IA 4XTUA 3A1PA 5A0DA 3HSBA 2KAFA 3CMET 5GANf 1C6VX 1VQKA 4Z88A 2D8JA 1QCFA 1BI0A 2LT4A 5FU7C 5IN1A 3E9GA 2AT1B 4UC4A 1PSEA 3PVLA 5HK3A 3OYEA 1BB9A 2PQWA 3QWXX 9ATCB 2KY9A 1VA7A 4C92A 1X69A 4M75G 4DEYA 3HFNA 3TCJA 1KC8R 2X4WA 3JB9H 2JTMA 1QCOA 2E3IA 1VQKT 3VUZA 1BI3A 2P4RA 3L42A 5GMKm 1VQNA 2E12A 4ATOA 1UDLA 3BW1A 5GAN2 5GANj 5FU6C 2XKOC 2YLCA 3CCJT 4E7KA 1I0CA 3CCRT 3X20B 3SFMA 2F1LA 4FCYA 3HRSA 3JAME 2JM9A 3VYGA 1D3BB 2DTHA 1WJSA 2CP0A 1K1ZA 4ZN3A 4KGZB 4J83A 2RHIA 1UB4A 2VB6A 2YRCA 3RUXA 2YUNA 2O01E 1VIFA 2CDTA 2VGMA 2R5MA 2JZ2A 2DJZA 5GMKe 3MP1A 5EC7A 2L0AA 1G83A 4PFZA 3KFVA 1AZEA 2A28A 2QQRA 3HPWA 2Y90A 2YDLA 4BDZA 2O9VA 1MMNA 1KK7A 3CC2T 5L23A 2OTLT 1ZUYA 2X4JA 3CXCS 5IAYA 2J06A 1SPKA 4PKCC 1E6GA 3CPWA 3V8LA 3NGPA 1WZOA 1M90U 1N9RA 3L2QA 4MMLA 3G4SA 1JEGA 1U06A 2LQNA 1PC0A 2F2WA 2J05A 1HYOA 1WNLA 4DOVA 1JBMA 2QQAA 5GJVB 3CMAQ 1VQ4Q 4M77B 1HD3A 1E7OA 2RQRA 2XICA 2DE0X 3V7SA 4E47A 5GANd 3VRZA 2CGHA 3VYHB 4A4HA 3VS4A 1Q82R 4ESRA 2K5LA 1OZ2A 5LJ5f 1MMGA 2CYZB 4HCZA 1ZA2B 2CREA 1OU8A 4C5EA 4OMNA 2VXEA 3CCSQ 1VQ5A 1M9SA 1VUBA 1W6XA 1M4ZA 1KC8U 5CIUA 2F69A 1YHQA 2EQIA 4J9EA 3M0TA 3G4SQ 4CC2A 4Z02A 4M78D 2RI2A 2DO3A 1YIJA 3A8LB 1VQMT 4M7DG 2QASA 5FLXE 1VQNT 3E9FA 3TSZA 1YJNT 2BZ8A 3EFOA 2KMTA 2V8IA 3EHRA 3M55A 1NJIU 2RQTA 4CC3A 1JXOA 3D7SB 3QJ6A 1YBYA 3FJ5A 5GAN8 3HTRA 3CMEQ 3HKSA 4HKEA 4O6JA 4AT1B 2E1HA 1FMKA 4AG2C 4HT9A 3M5AA 1VIEA 5GAOn 4M77E 2DBKA 4FSSA 4Z8AA 3RNJA 4GLKA 2YUQA 3P8BB 1WXBA 2EQJA 4II1A 2W0ZA 4E7JA 4VUBA 2RO0A 3OS2A 5KH6A 2ZPIB 2ZPGB 4HCCA 5J3BA 2JTEA 5FU6B 3JCMQ 5GAN4 3FJPA 3H0IA 4BACA 4TVRA 1TOVA 3SD4A 1PSFA 1SKUB 4A63B 1J3TA 3EG9A 1PD0A 4F04B 5IH2A 1BK2A 2YLBA 1M1KU 2E5KA 4JDSA 1T0HA 4M75D 1YIJT 1UGQB 3CBMA 4JS4A 1M1FA 3LW5E 1N8RC 1X75C 2EYYA 3QIIA 4A4FA 2RHXA 4EMKA 5CAIA 3L2VA 1K73U 4PK4A 3TQ7P 4RUGA 2GNCA 1IO6A 3JB9J 5FRMA 4OMMA 5GANh 5CO7A 1Q86R 2KVQG 3OB9A 2GQVA 5CQYA 4XTYA 5FWBA 3EGUA 3CCET 5D6XA 2JXBA 1GBQA 5FWCA 4J6YA 3GOXA 1Q7YC 3HRTA 2GBQA 3QZ9B 1G5VA 4JPBW 1CSKA 3VS2A 2H3JA 2OAWA 3GPLA 1LVKA 3EGDB 5LJ3j 3CCUT 4AFSC 2NLUA 2BTTA 4M7AD 3OYYA 1RACB 2NUPA 3A8GB 2DMOA 2ESWA 4CC4B 2JVVA 1QWFA 2IG0A 2FVUA 3P8DA 2QGGA 4LDXA 3G71T 8AT1B 2DLPA 2D9TA 2DVJA 4N4HA 2LMJA 2DD4A 2E3HA 1KSWA 3VKIA 4B9WA 3M54A 3CMAT 1TUDA 2LX9A 2YSQA 2M0OA 3C0CA 4AG1C 1E6HA 1QP2A 2NYSA 2DM1A 5GAOl 1G3YA 4KRTA 1I5OB 3E19A 5AYFA 1UE9A 2DTOA 1RLPC 2HL3A 3JB9F 4EMKC 3CCUA 2DZ9A 1QVFA 3UDCA 3CPFA 2RB6A 1WPYA 2Y4XA 4LD9K 3PTAA 2RH2A 4OGCA 4RMOA 2HKQB 1VQMQ 4MMKA 1BIBA 1RAIB 2JTFA 1Z9QA 2EAYA 1IB8A 3CXCA 1M1KR 2EGCA 1ZBXA 4L6V5 3CCQA 1QVGP 1Y96B 2AKLA 3CMAA 3EAEA 3I55A 2BKDN 3U23A 5GAN6 2EYZA 1YCYA 4X34A 1GCQC 4LE9A 1Y0MA 2ROLA 1C1AA 2DKGA 1OZ3A 2NWMA 2CZ1B 1VQ9Q 1VQ5T 1V1CA 3I5RA 2K79A 1MUZA 4KUDK 3QBYA 2GCXA 1M1GA 1PRLC 3PIOA 1RI0A 5GAOr 5KE3A 3QDFA 4IIOA 4C8QF 2DBMA 2XHCA 1LPLA 2BZXA 1V76A 1IXDA 4X9DA 2EYXA 1TWBA 3GP8A 2GFUA 2FHDA 5HY6A 2A36A 4EMGA 3DKMA 2R57A 4JZ3A 4LUDA 2RJEA 4BI8B 4Z89A 5GAOp 2XDDA 1I4K1 2DXUA 5GANe 2V8KA 1VQ8A 1KQ1A 5CQXA 3DLMA 2A0FB 4E6RA 5CKHA 1YIJQ 1OULA 3G6EQ 3JCMh 4J9IA 2BZYA 3CC2A 3H41A 4M78E 3CD6T 4KH0B 1YFNA 1M3CA 3I35A 1OV3A 3MJXA 3CCSA 1YWPA 1M2VA 5FRNA 1ZHIA 1H3HA 2YRDA 1M2VB 5GMKh 2ECZA 5GAOq 2DL4A 2BE7D 2RD1A 4F7UF 4PJNA 3OY9A 1MNEA 4OMPA 4PLLA 3VJPA 3LH5A 1VQ4A 4QKUA 3H6ZA 1YJWQ 2DAQA 2VKNA 1QP3A 4M7AG 1RAAB 3CCEQ 3OMGA 1RLQC 3S3NA 3OBYA 2QG9B 2CP5A 1MV3A 2AK5A 2RI5A 3QHSA 3QYHB 5CKDA 3CCUQ 4E7ZA 1RAFB 1AD5A 3I55T 2LCSA 5LJ3g 1U8RA 2ZPBB 2O31A 2RQWA 2E6ZA 4ZTJA 4HCKA 4ZNXA 4PJOB 4IURA 4C0DC 3EG9B 5CKEA 3CCJQ 4JJBA 1QKXA 4ZN1A 1Q86U 1AT1B 1WJQA 5LJ5d 3CCMQ 1M90R 3L1AA 2WSEE 1PCXA 3E2UA 2A7YA 1JJ2P 3JCMg 2JMAA 4JRQA 2OTJT 1WHLA 5A2QE 2M0YA 4RTXA 3CD6A 1K8AC 3C12A 4J9HA 1RABB 1I1JA 1B7TA 2JW4A 4J6XA 2OJ2A 3EG3A 5M9OA 2O9SA 2OAUA 3GIBA 4J9BA 4J9FA 1NYFA 3LGFA 4C92F 2E6NA 1VQLQ 4AFUC 1KC8C 2MI6A 3RKXA 3GNFB 1VQ7T 5L8RE 4QVDA 1NPRA 5GMKi 1XTDA 4MZPA 3VS6A 2JT4A 2O4XA 2RK2A 2OTLQ 5IT9E 4BI3A 3ZEHA 3JCMf 4XK8E 2RK1A 2DL8A 1UHFA 2VVKA 1GCQA 1OI1A 2ZPHB 1MGQA 3CPWP 2QA4A 3OW2S 5CCAA 4IUPA 1Y96A 3MO8A 5IHIA 1K73C 3L2WA 2LTOA 5GAN3 1MMAA 3LLRA 1BIAA 1VQ9T 1VQ5Q 3LH0A 2E5QA 4XAXB 3WVDB 4C0DB 1CKAA 2VWFA 1UJYA 1PD1A 1YWOA 4L59A 2KRMA 2GGRA 1PHTA 4JLGA 1AWJA 2ED1A 3G71A 4Y91A 3MPUB 4DBQA 5KCOA 1RUWA 1H641 2E65A 2HQEA 4IUQA 4CC7A 3EH2A 2HZYA 3ZFJA 4M77A 1JXMA 3M9QA 2F5TX 5LJ3f 1VQLA 2YXYA 1WHJA 1D1AA 4FYWB 2PUKB 3MEVA 2PTKA 4GY5A 1SSHA 2ED0A 3G4ST 2IVWA 2QEXA 3QO3A 4C5HA 1WHGA 1IREB 2BIVA 3I5SA 2C0OA 1TUGB 2Y4YA 3EGDA 3A5ZB 4AFZC 1YJNQ 5GAMf 1WA7A 3MP6A 2FPFA 2AIRB 2CUBA 2CT4A 4K11A 4E7LA 2MCNA 2DVEA 1GFDA 6AT1B 1XNIA 3OYGA 1FYNA 3FC3A 4RCBA 4J8OA 1PWTA 2X51A 3I56A 4NL2A 2CSQA 3M0QA 1VYTA 1ABQA 2ZAEA 1D0YA 4D8DA 1UJ0A 1S72A 1H92A 1Y7XA 4XQ3A 5LJ5e 1HK9A 1SRMA 1YHQT 2XD0A 4IIMA 5GAN7 1KIKA 2KRSA 4ZGJB 4HXJA 2X35A 4M75E 2GF7A 1F1BB 1WYXA 3RMQA 2F2VA 4MZTA 4M78F 3WXMB 5I22A 2I0NA 2A3LA 4PJOF 3EGXB 5I2SA 3C94A 5KYXB 5KYXA 4XU2A 8ATCB 3I55Q 2VXFA 1W4SA 4KGXB 4JLIA 1VOMA 4R0KA 2LQWA 2RA2A 2DZCA 1WXUA 3JSCA 1YJ9A 3M0SA 4EMHA 1LCKA 5IHKA 4MDWA 1X2KA 1JRIA 1M1KC 3VRYA 1RADB 2HCKA 2CT3A 4PJOE 4A53A 1QVPA 4OF1A 1B3QA 4C8QE 1QQJA 1X6GA 3CC4A 1WHHA 2HEQA 4PFOA 1M8MA 1G3WA 4BY6C 2A08A 3LWHA 4C92B 2VGNA 1QKWA 2ZZDA 2LZ6B 4OGEA 4J9GA 3ZL7C 1G3TA 2COYA 1YITQ 3NTKA 1OEBA 4LD6A 1HJDA 1WHKA 2ZPFB 1BKBA 3RR6A 4M7DA 5GAMd 4OMLA 3CMEA 4BDYA 2V1RA 2NUTA 1R77A 4DBHA 5GMKl 3CCMA 5LJ3h 2LQKA 1VQLT 3LX7A 1VQ7Q 3VU3C 3QG1A 2PZ1A 1KHCA 1YJ9T 3CCLT 4M78G 4QQDA 2EKOA 3X25B 4R56A 2DILA 1WHMA 3T9NA 2LJ1A 2K3YA 2DXCA 4N0AA 1Q81C 3EG0A 3NPFA 3GNGA 2M51A 2C0TA 2O88A 4QW2A 2RHZA 4QQGA 1B07A 3P8HA 2O2OA 1VQOA 2KT8A 4C8QA 3H0HA 3MEAA 2PU9B 3TREA 4PJOA 3G71Q 4C0GA 2FRWA 2RN8A 1AWWA 4FT2A 4RTZA 1D1CA 2XDPA 3NTHA 5FROA 1JO8A 3FIFA 2DX1A 1VYUA 3FDRA 3VS3A 4B9XA 1T3LA 3JCMW 4RTTA 3VV0A 1PNJA 4Y28E 4JZ4A 1VQ6T 2GTJA 3CCEA 1M2OA 2DL7A 1ACMB 2HDAA 1KJWA 2QYZA 1BI1A 1W1FA 1X6OA 2JNGA 1VQOQ 4NL3A 3M4YA 4WTOB 2K6DA 4M75B 1NJIR 2DK3A 4PJOD 1S1NA 1WX6A 1JQQA 4F16A 1NJIC 1XOVA 2LCLA 4DBRA 5C6SA 3HL8A 3J7AF 2EQKA 3CXCP 3MCAB 4ANJA 1Y71A 4XU1A 2HAXA 3SHWA 3J81E 2JUFA 5GAN5 1IRXA 1KQ2A 4PJMA 2FPEA 2ATCB 3OYCA 3GLXA 3RIRA 3PE0A 2VASA 2MMPA 4X1VA 4CRIA 3SWNA 4KBMB 3BFMA 4B6MA 5J26A 3SWNB 1MHNA 4FL6A 1JJ2S 3CCJA 2FZCB 4M77F 3PMIA 2DEUA 1R8OB 3CBPA 2CP6A 1U1SA 1X01A 2DRMA 1OYXA 3INZA 1SHGA 4OVAA 4XTWA 3PIPA 3F70A 4M75A 1Q82U 2DYBA 4KH1B 4NOYA 1K9MR 3MHXA 1FX7A 2RNAA 1ABOA 5GAMh 1X2QA 3X26B 2YUPA 2DTIA 4QT7A 3TVTA 3RERA 4M78B 5I11A 1TUCA 1W2BS 2QQBA 4RG2A 2SEMA 1PRMC 1M90C 1KFZA 4ME7A 1Q86C 3A8MB 3MEUA 1SEMA 5LJ3e 4YTLA 2HD0A 1WI7A 1IGUA 3RBBB 1YI2T 4XTVA 3M57A 1YP5A 1M30A 3URGA 3OMCA 2EPDA 3JB9D 2GFAA 1OX8A 2V1QA 3S6WA 4M4ZA 3JCMc 2EGEA 2P4TA 2A37A 2HQHA 1YJWT 4XTXA 2MOXA 2GQIA 1UGPB 3X24B 3R6NA 3OYBA 2XU8A 1U5SA 1ZUUA 2LNHB 3OSVA 2K2MA 1M3AA 2YRVA 5CKBA 3VS5A 5EG2A 3HFOA 2MF2A 1GFCA 1QVFS 5D6WA 5IXFA 2DERA 3SEMA 2KR3A 2BUDA 3MEWA 4M7DB 5LJ5h 4ZGDB 5GMKj 2J6OA 1BU1A 1JJ2A 4ZGEB 3BE3A 1KQSS 3RKWA 3S3MA 1T3SA 3RDVA 3CCMT 2NUPB 1NEBA 4M7DE 3ZBDA 2FRYA 3JCMP 1ZUKA 2EJFA 1YCSB 2LCCA 3EG2A 1JB0E 3JV3A 2GTOA 5IHNA 1D0ZA 2OTJQ 2KYBA 4HVWA 3UPUA 2X3WD 2JM8A 1VQ6Q 1B34A 1M3BA 1NBEB 1K73R 2F2XA 7AT1B 4OP0A 3TU4K 2CS7A 5J39A 4M7AC 3OYLA 1XQHA 1I81A 3FB9A 3JCMX 4QQ6A 2EW3A 2VC8A 2P84A 1KG1A 1EZZB 4A4GA 2CUDA 2FZGB 4AMCA 3CCVQ 1KD1U 4PJOG 4C0ZA 3KXTA 4C8QG 5DLOA 1AWOA 5CK9A 1FWZA 1K9AA 2P0KA 5FW9A 1D0XA 3C4SA 1LNXA 2D1XA 2VYTA 2EWNA 3FRNA 3PGGA 3TEEA 4F14A 3CCRA 4KULA 1UECA 1ZSGA 2LNVA 4M78A 1K9MC 3S3OA 2M02A 3QUIA 3HHTB 4KT0E 2HMAA 5GAOm 1C0MA 3EG1A 1Q81R 1VQ8Q 3OYNA 3LYIA 1GCPA 3SDZA 2RHYA 2ZPEB 4D6WA 2B86A 4M75C 3KBGA 3CC7Q 3OW2P 4HT8A 2C06A 1RL2A 1S72Q 2QGFB 2O4XB 4JRKA 1OPKA 3OS0A 4PJOC 1KQSA 2FG0A 5GAMg 2EIFA 1Q95G 3M53A 5CKFA 2QQ9A 2KK4A 3OYJA 1IGQA 2JS0A 2NUZA 2KXCA 2X4XA 4LN2A 2I2LA 2QAZA 1NZ9A 3A8HB 2X9HA 2ENMA 1K76A 2L3PA 4FW2A 3N5BB 1U3OA 3OS1A 2M1HA 4M7AA 4BE0A 3OYKA 2J6FA 2MIOA 5LJ3d 4F7UB 2DL5A 2EYWA 2K5IA 3MKDA 1BCMA 5GANg 2XIDA 1NPPA 3DB3A 2Z0WA 1YHQQ 4IUUA 2KQWA 2QTVA 3DB4A 4L5GA 4JJDA 1FMVA 1BBZA 3QWYA 4QVCA 1RAEB 3FEOA 2L8DA 1SF9A 2XG8D 4N0AC 1I5LA 4GLMA 3R6OA 2JOYA 5CR2A 4FSXA 2LX7A 3A8OB 1UGRB 2L3QA 3IQLA 3M0UA 1V29B 5LL6S 4WCIA 3ER0A 2ROTA 2QEXT 4QVZA 3MP8A 3H8ZA 4M7DF 3HP9A 2K4YA 5A0LA 4C8QB 1W2BA 1FMWA 2E41A 2RHUA 1AEYA 3UATA 3C95A 3UA7A 3E1SA 2KEAA 4M77C 3REBB 1M27C 3OS5A 2XI9A 1YITT 1TSFA 2L3SA 4J9CA 4OB1B 5LJ5j 1QWEA 2C0IA 4LDYA 1SRLA 2EFIA 2EJGA 5I2MA 4DBFA 3BY7A 1M8VA 1O75A 1RI9A 3CCQQ 1NM7A 1QVFP 2DIQA 2D6FA 2V26A 1TXQA 1UEBA 3OYHA 5LJ5g 3L2RA 2FL7A 1YJ9Q 3CCLQ 5CVIA 5IXBA 1X43A 2WACA 1PKSA 1WIEA 1UGSB 3GBQA 4FU6A 1X27A 3CEYA 2KT1A 3M4GA 4AFQC 1VQPQ 1IZ6A 1OU9A 4J7FA 2X4YA 2K57A 1MV0B 4ORZA 2F5KA 3JRZA 4FT4A 3SWNC 3OYDA 1OPLA 3I56T 1GXIE 4HVUA 2EVRA 1VQMA 1R0BG 2SRCA 1W70A 1YN8A 2K3BA 1NE8A 1VQ8T 4V2SA 2KGTA 4JS5A 2HNIA 1UGVA 2JMCA 2QA4Q 1I8FA 1HXDA 3AHUA 2MPXC 3META 5GAMe 2DRKA 3THKA 2LJ0A 3H0FA 2EYQA 4OB3B 3ME9A 3UF4A 2KYMA 2DXTA 4M7AB 2P0QA 3CCLA 2HL5C 1VQOT 4LXCA 2ZCFB 1W2BP 2L3RA 4MDXA 2DPPB 1U1TA 2HQXA 2J6KA 4M7AE 1WLPB 3QXEB 1WFWA 5HKCA 3M0PA 1K0SA 4WF2A 5DM7R 2PUOB 1NLPC 1YI2A 3LGLA 2J7IA 1T0JA 4JRIA 4RCCA 2DFUA 3QDRB 3CBOA 2YHTA 4M77G 1GL5A
chains in the Genus database with same CATH topology
1U1SA 2KAFA 3CMET 1X01A 1OYXA 4BD3A 5CKHA 5GANf 3INZA 1VQKA 4M7DC 4OVAA 2WSCE 4XTWA 3PIPA 4C0FA 3JCMh 1BI0A 2LT4A 3F70A 4M75A 5FU7C 1Q82U 5IN1A 3E9GA 3CC2A 4M78E 4NOYA 3CD6T 4UC4A 1PSEA 3QYGB 3MHXA 1FX7A 4M7DB 2DD5A 5GAMh 3CCSA 5HK3A 3M58A 3OYEA 3UWNA 5FRNA 1ZHIA 2PQWA 3X26B 2KY9A 1VQ9A 3L2UA 4C92A 2DTIA 5GMKh 4M75G 2K5FA 4BE1A 3HFNA 3TCJA 5GAMj 3DLLA 3RERA 2X4WA 4M78B 1DJ7B 5GAOq 3JB9H 2RD1A 2JTMA 4LDWA 2VUBA 4F7UF 1W2BS 2QQBA 4BY6B 3EFRA 4RG2A 4ELZC 3QZ5B 3OY9A 1VQKT 3VUZA 1BI3A 4PLLA 3L42A 3VJPA 5GMKm 1VQ4A 1KC8U 1KD1C 1VQNA 2E12A 1M90C 4XTZA 4FIBA 2RJCA 4ME7A 1Q86C 3H6ZA 2OTLA 2DAQA 3PFSA 3OW2A 1QP3A 3A8MB 4ATOA 4M7AG 3OMGA 3BW1A 5GAN2 1EIFA 3GF5A 3MEUA 5LJ3e 4DOWA 3S3NA 3OBYA 2K3XA 5GANj 4YTLA 2HD0A 5FU6C 2XKOC 2YLCA 3CCJT 4E7KA 1YI2T 4XTVA 3CCRT 3M57A 1YJWA 2RI5A 3QHSA 3QYHB 3URGA 3OMCA 3X20B 3SFMA 3JB9D 5CKDA 2GFAA 3HRSA 3JAME 3VYGA 4A54A 3S6WA 3I55T 5LJ3g 1D3BB 3JCMc 2DTHA 1U8RA 2FB7A 2P4TA 2ZPBB 5DLQE 1WJSA 1YJWT 4XTXA 4DA4A 3HSBA 4KUIA 3UT1A 5I21A 2E6ZA 4PL6A 4ZTJA 4ZN3A 3M59A 1UGPB 3X24B 4PJOB 3OYBA 4J83A 2XU8A 4IURA 2RHIA 1UB4A 4C0DC 1KHIA 5CKEA 3OSVA 4ZN1A 2YRVA 5CKBA 1WQWA 3RUXA 2R5AA 2CZ0B 5EG2A 1Q86U 1WJQA 5LJ5d 3HFOA 2O01E 2R58A 2WSEE 3L1AA 1VIFA 2EJ9A 2MF2A 2VGMA 3O8VA 2R5MA 2JZ2A 2A7YA 2DJZA 5GMKe 3MP1A 1QVFS 5FU7B 3JCMg 4ZTFA 5D6WA 4JRQA 2BUDA 2OTJT 3MEWA 2QQRA 5A2QE 3HPWA 5LJ5h 3CCQT 3CD6A 1K8AC 3C12A 2QI2A 3EFSA 4ZGDB 5GMKj 3CC7A 2Y90A 1JJ2A 4ZGEB 4J6XA 4BDZA 1KQSS 3RKWA 3S3MA 4M75F 5M9OA 3CCMT 3CC2T 2OTLT 2LT1A 2X4JA 3OQ5A 4M7DE 3ZBDA 3CXCS 5IAYA 1YJNA 1VQPT 2OAUA 4PKCC 4C5IA 3JCMP 2EJFA 3GIBA 2LCCA 1JB0E 3CPWA 1H3ZA 2E70A 3LGFA 3V8LA 2E6NA 3PT9A 4C92F 1M90U 1N9RA 3NFCA 3L2QA 4MMLA 1KC8C 3G4SA 2MI6A 3RKXA 3GNFB 1VQ7T 3UPUA 4O5VA 5L8RE 4QVDA 1NPRA 1QVGA 2EQMA 2DIGA 4EDUA 1B34A 4A4KA 5GMKi 1YITA 2E10A 1XTDA 4MZPA 3CCST 3JB9G 1N8RU 4OP0A 1WNLA 2O4XA 1JBMA 2RK2A 3QJYA 2CS7A 2QQAA 4BI3A 4DOVA 3ZEHA 5J39A 3CC4T 3JCMf 5IT9E 1SSFA 4XK8E 2JN0A 3OYLA 4M7AC 2AHJB 2RK1A 4R55A 1N9SA 1XQHA 1OI1A 4M77B 1I81A 2ZPHB 2XICA 3V7SA 3JCMe 4E47A 5GANd 3FB9A 1MGQA 3JCMX 4QQ6A 2VC8A 4PNOA 2CGHA 3VYHB 2QA4A 4A4HA 4A4GA 5CCAA 2QA4T 2LDMA 3CCVA 3OW2S 2K5LA 3TU4K 1OZ2A 4IUPA 4PJOG 1KD1U 1Y96A 2CYZB 3MO8A 4HCZA 4C0ZA 5LJ5f 3KXTA 1K73C 4C8QG 3L2WA 2LTOA 5DLOA 5GAN3 3LLRA 3OSSC 4C5EA 2VXEA 4MZMA 1FWZA 2QTXA 2P0KA 5CK9A 1VQ5A 1BIAA 1G3SA 1VQ9T 1M9SA 1TH7A 1VUBA 3LH0A 4C8QC 1M4ZA 2E5QA 3C4SA 3NTIA 2F69A 1LNXA 4XAXB 2MWOA 5CIUA 3WVDB 4C0DB 1YHQA 2VYTA 2EWNA 4L59A 3FRNA 3PGGA 3TEEA 3OA6A 4C92C 4M7AF 4JLGA 3CCRA 4Z02A 4M78D 3OBWA 2CKKA 4KULA 2XDBA 1VQPA 2RI2A 3G71A 2DO3A 4Y91A 3A8LB 4F7UG 5KCOA 4IUVA 1YIJA 1H641 2LNVA 2E65A 1VQMT 3JCMV 4M78A 2HQEA 4M7DG 4IUQA 2PVOB 5FLXE 1JJ2S 1K9MC 4J7IA 4N4GA 3CCVT 1VQNT 3ZFJA 4M77A 3S3OA 5LJ3f 3M9QA 2F5TX 1VQLA 3E9FA 3QUIA 3HHTB 1YJNT 3J80E 4KT0E 1Y07A 5GAOm 3M56A 4J6WA 2KMTA 3BDUA 2V8IA 2LVMA 2PUKB 3MEVA 5D6YA 4GY5A 3M55A 2PVGB 3OYNA 3LYIA 1NJIU 3Q1JA 3PNWC 3G4ST 3SDZA 2RHYA 2IVWA 3QJ6A 2QEXA 2ZPEB 1LJOA 3QO3A 4D6WA 4C5HA 1YBYA 4M75C 5GAN8 1IREB 2BIVA 3KBGA 4HT8A 2C06A 3HKSA 4HKEA 1RL2A 2Y4YA 2RI3A 4O6JA 2L5QA 3A5ZB 2E1HA 2O4XB 4JRKA 5GAMf 3MP6A 3OS0A 4BB7A 4PJOC 1KQSA 1WJRA 4HT9A 3M5AA 2EIFA 5GAMg 1VIEA 5GAOn 3M53A 4M77E 5CKFA 1KG1A 4E7LA 2DVEA 2QQ9A 4EPCA 2KK4A 4GLKA 3P8BB 1XNIA 3OYJA 4C92G 3OYGA 3FC3A 4RCBA 4J8OA 1QW1A 4RKUE 3JB9I 3I56A 2EQJA 4II1A 4NL2A 2X4XA 4E7JA 1Q81U 2I2LA 4VUBA 3CC7T 1O9SA 3A8HB 1NZ9A 2RO0A 3OS2A 2EQUA 5KH6A 1S72A 2ZPIB 1S72T 2ZPGB 1Y7XA 4XQ3A 5FU6B 5J3BA 5LJ5e 3JCMQ 1HK9A 5GAN4 3FJPA 3N5BB 1YHQT 4BACA 2XD0A 4TVRA 5C0MA 5GAN7 3OS1A 2M1HA 3SD4A 4M7AA 1PSFA 4ZGJB 2X35A 4M75E 2GF7A 4BE0A 3RMQA 3OYKA 4MZTA 4HCBA 2M16A 4M78F 3V8JA 3WXMB 5LJ3d 2YLBA 4BUGA 4F7UB 1M1KU 3G7ZA 2A3LA 4PJOF 4JDSA 2K5IA 5I2SA 4M75D 5GANg 2D0QB 3C94A 1YIJT 2XIDA 1UGQB 3CBMA 1NPPA 4JS4A 1M1FA 3DB3A 3LW5E 1N8RC 1X75C 2B8AA 4LDVA 3PMTA 3QIIA 4IUUA 4XU2A 4A4FA 2RHXA 4EMKA 2KQWA 2VXFA 3DB4A 2M9UA 3FLGA 1W4SA 4JLIA 5CAIA 3L2VA 4L5GA 2RA2A 2DZCA 1K73U 2LC4A 4QVCA 3JSCA 1FXXA 3V8KA 1YJ9A 4EMHA 3RMSA 3FEOA 4MDWA 3JB9J 2L8DA 1JRIA 2XG8D 4N0AC 5FRMA 1I5LA 1M1KC 3R6OA 2JOYA 2VV5A 4N4IA 4OB2B 4JRPA 3OYIA 4PJOE 3SB2A 5CR2A 4FSXA 4A53A 1QVPA 5CO7A 4BI4A 5GANh 4OF1A 4A4EA 2KVQG 3OB9A 2GQVA 3A8OB 1UGRB 4C8QE 4FM4B 1V29B 5CQYA 3CC4A 4XTYA 5LL6S 3CPWS 3ER0A 3ASKA 3CCET 5D6XA 2QEXT 1VQ6A 1G3WA 4QVZA 3VUBA 4BY6C 3LWHA 4J6YA 3MP8A 4C92B 3GOXA 2VGNA 3H8ZA 2QQSA 2ZZDA 2XK0A 4M7DF 2WSFE 3HP9A 3QPHA 4OB0B 4OGEA 2K4YA 5A0LA 1G3TA 1Q7YC 3HRTA 4C8QB 4IKFA 3NTKA 3QZ9B 4LD6A 1G5VA 1W2BA 1Q7YU 2CZ7B 2H3JA 2ZPFB 2E41A 3OYAA 3GPLA 1BKBA 3CCUT 5LJ3j 2MWPA 2RHUA 3V7CA 2NLUA 5GAMd 3CMEA 4M7DA 4BDYA 3C95A 4M7AD 3OYYA 4IUTA 3A8GB 4PLIA 2FYKA 5GMKl 5LJ3h 2LQKA 3CCMA 1VQLT 4F7UE 5KCHA 2JVVA 3E1SA 2IG0A 3LX7A 2FVUA 4M77C 3P8DA 1N6AA 5KE2A 3OYMA 4ELYC 1N27A 4LDXA 3OS5A 3VU3C 2XI9A 3QG1A 4OMFB 3G71T 1YITT 1KHCA 2D9TA 1YJ9T 3CCLT 4M78G 4QQDA 2EKOA 4OB1B 3X25B 2RJDA 4R56A 5LJ5j 4N4HA 1K8AU 2DD4A 5A0GA 3VKIA 3T9NA 4B9WA 4N0AA 2K3YA 2DXCA 3M54A 3CMAT 1Q81C 4LDYA 3GNGA 2EFIA 2LX9A 2M0OA 2EJGA 5I2MA 4C8QD 4QW2A 2RHZA 3BY7A 4QQGA 4XTUA 1M8VA 1O75A 3P8HA 1BYMA 3LWIA 1QP2A 1VQOA 4Q5WA 4C8QA 2D6FA 2DIQA 3MEAA 1UEBA 2PU9B 3OYHA 5GAOl 3TREA 5LJ5g 3L2RA 4PJOA 1G3YA 2FL7A 4C0GA 1M5Q1 1P92A 3E19A 5CVIA 3OYFA 5AYFA 1AHJB 2WACA 3JCMJ 2DTOA 4JUVA 1UGSB 3JCMb 4FT2A 4FU6A 3QSUA 3CEYA 3JB9F 4X9CA 1WQ7A 3M4GA 2LQ8A 4EMKC 2L89A 2XDPA 2DZ9A 3NTHA 4CI0C 3CCUA 2QDYB 1D3BA 3CPFA 5FROA 3UDCA 1QVFA 1IZ6A 2RB6A 3FIFA 3FDRA 4C92E 4B9XA 4EMKB 1WPYA 2Y4XA 4J7FA 2X4YA 2K57A 4M77D 2RH2A 3PTAA 4LD9K 4XU0A 4OGCA 4RMOA 3JCMW 3VV0A 2F5KA 3JRZA 4FT4A 4Y28E 4MMKA 1BIBA 3SWNC 3V7RA 2RJFA 3OYDA 4C5GA 1VQ6T 3I56T 2JTFA 2RM4A 3CCEA 1Q82C 2V8JA 1GXIE 2EAYA 4HCCA 5DY9A 4F7UA 1BI1A 4JJNK 3CXCA 1VQMA 1X6OA 1NE8A 2JNGA 3QKJA 1VQ8T 1VQ4T 4V2SA 1ZBXA 2PVDB 4L6V5 4NL3A 3CCQA 1ZQ1A 2OTJA 3M4YA 1Y96B 3X28B 4JS5A 3CMAA 2HNIA 3EAEA 4M75B 3I55A 4LDUA 4RG8A 3BDLA 2DK3A 4BE2A 1I8FA 1HXDA 2BKDN 3AHUA 4J5YA 4PJOD 3META 5GAMe 5GAN6 1QVGS 3G6EA 1NJIC 2DEQA 1YCYA 2EYQA 4X34A 1XOVA 2LCLA 5C6SA 4OB3B 3HL8A 2DKGA 3J7AF 3ME9A 1OZ3A 2CZ1B 2EQKA 1VQ5T 2KDSA 3MCAB 2LRQA 2DXTA 4M7AB 3WVEB 2MAMA 2P0QA 4E7HA 3QBYA 4DQ2A 3CCLA 4KUDK 2GCXA 1M1GA 1VQOT 1B34B 1Y71A 4XU1A 1RI0A 2G3RA 3PIOA 2KSSA 5KE3A 5GAOr 2HAXA 3J81E 2JUFA 2ZCFB 3KUFA 4C8QF 2L3RA 2XHCA 4C92D 2DPPB 2DXBA 5GAN5 1U1TA 4MDXA 1KQ2A 1BI2A 3HRUA 2HQXA 4NS5A 4M7AE 3QXEB 5HKCA 4HA8A 3OYCA 4WF2A 4XU3A 1WGSA 2E64A 5DM7R 2PUOB 1K9MU 3GLXA 4X9DA 3RIRA 2QXFA 3G6ET 2P0PA 3GP8A 4P5NA 2GFUA 2K2VA 2MMPA 3LGLA 2FHDA 3SWNA 4CRIA 5HY6A 1YI2A 4M78C 4EMGA 4JRIA 4RCCA 3DKMA 4KBMB 2R57A 2CZ6B 3BFMA 2RJEA 4BI8B 5J26A 5GAOp 1LOJA 1MHNA 3L2ZA 3RKYA 4FL6A 3SWNB 2ZGWA 2XDDA 1I4K1 3QDRB 2DXUA 3CBOA 2V8KA 2YHTA 4M77G 3RESA 5GANe 5HK0A 3JCMd 3CCJA 1VQ8A 4M77F 2HBPA 1VQ7A 3PMIA 4M7DD 4E7IA 1R8OB 3CBPA 1KQ1A 5A0DA 5CQXA 3DLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKD A;  4ELZ C;  5CR2 A;  1M1F A;  5CKH A;  5CO7 A;  1X75 C;  2C06 A;  4OF1 A;  4HKE A;  5HKC A;  5CCA A;  3NFC A;  3JRZ A;  5CQY A;  4ME7 A;  3HPW A;  3VUB A;  4ELY C;  5DLO A;  5CKF A;  2KMT A;  4MZM A;  3JSC A;  5CK9 A;  5HK3 A;  4MZP A;  1UB4 A;  4MZT A;  1VUB A;  5CKE A;  1NE8 A;  5HK0 A;  5CKB A;  3G7Z A;  3TCJ A;  2MF2 A;  4MDX A;  2VUB A;  4VUB A;  5CQX A; 
#chains in the Genus database with same CATH topology
 3EHQ A;  4BD3 A;  4M7D C;  2WSC E;  4C0F A;  4HVV A;  4FW1 A;  2QK0 A;  3QYG B;  3O5Z A;  2DD5 A;  2W10 A;  3M58 A;  3UWN A;  1N5Z A;  1VQ9 A;  3L2U A;  2HBW A;  2K5F A;  4BE1 A;  5GAM j;  3DLL A;  1DJ7 B;  4RTW A;  4LDW A;  3CCR Q;  2VUB A;  2FZK B;  3CQT A;  4BY6 B;  3EFR A;  4ELZ C;  3QZ5 B;  3M0R A;  1VYV A;  1KD1 C;  4J9D A;  4XTZ A;  2DL3 A;  4FIB A;  2RJC A;  2IPO B;  2OTL A;  3PFS A;  3OW2 A;  1EIF A;  3GF5 A;  4DOW A;  2K3X A;  2L2P A;  1GBR A;  2FEI A;  2CP2 A;  2DYI A;  1YJW A;  2RMO A;  3A98 A;  2KXD A;  2RQU A;  2DF6 A;  4GBQ A;  4A54 A;  2AZV A;  2FB7 A;  5DLQ E;  1KQS P;  3UA6 A;  4DA4 A;  1UFF A;  4KUI A;  3UT1 A;  5I21 A;  4PL6 A;  3M59 A;  5KYU B;  5ECA A;  1KHI A;  1YI2 Q;  1WQW A;  5HCK A;  2R5A A;  2CZ0 B;  1TG0 A;  4FYY B;  3CC2 Q;  2R58 A;  2EJ9 A;  3O8V A;  4PJL A;  5KYN A;  1ZSZ A;  5KYY B;  5FU7 B;  5D7U A;  1K8A R;  4ZTF A;  3CCQ T;  1UTI A;  2KBT A;  2QI2 A;  3EFS A;  5KYW B;  3CC7 A;  4F17 A;  4Y92 A;  4M75 F;  2H8H A;  2K9G A;  2AKK A;  2LT1 A;  3OQ5 A;  1YJN A;  3VS0 A;  1VQP T;  1EFN A;  4C5I A;  1UUE A;  1H3Z A;  2E70 A;  3PT9 A;  3NFC A;  4O5V A;  4LNP A;  1PKT A;  1QVG A;  2EQM A;  1AZG B;  2DIG A;  4EDU A;  2EGA A;  2YWW A;  4A4K A;  1YIT A;  2E10 A;  2LP5 A;  3CCS T;  1N8R U;  3JB9 I;  3QJY A;  3CC4 T;  2COW A;  1SSF A;  2HSE B;  2JN0 A;  2AHJ B;  4R55 A;  1N9S A;  1IHW A;  1PM3 A;  1UG1 A;  1X6B A;  3JCM e;  2HSP A;  2IIM A;  4PNO A;  2QA4 T;  2LDM A;  3CCV A;  1VQN Q;  1IHV A;  2K7A A;  3OSS C;  1G8X A;  4MZM A;  2QTX A;  1G3S A;  1K0X A;  1TH7 A;  4C8Q C;  3NTI A;  1MMD A;  1NG2 A;  2KNB B;  2MWO A;  2PNI A;  4M7A F;  3OA6 A;  4C92 C;  4E7S A;  1OQK A;  2CKK A;  2KI7 A;  3OBW A;  2XDB A;  1VQP A;  4RTV A;  2CP3 A;  4F7U G;  4IUV A;  3JCM V;  2PVO B;  4J7I A;  4N4G A;  3CCV T;  3J80 E;  2X3X D;  1Y07 A;  1OX9 A;  3M56 A;  4J6W A;  3BDU A;  2LVM A;  5D6Y A;  1ZSZ C;  2PVG B;  1OOT A;  3Q1J A;  3PNW C;  1H8K A;  1LJO A;  2HKN A;  4E2F B;  1AOJ A;  1TS9 A;  4PJJ A;  3NHN A;  2RI3 A;  1A0N B;  1UHC A;  2RF0 A;  2YUO A;  2L5Q A;  4LUE A;  2KRN A;  2BE9 B;  1TU0 B;  4BB7 A;  1MND A;  1WJR A;  4OMO A;  1QCN A;  4EPC A;  3VS7 A;  2OI3 A;  4OMQ A;  4C92 G;  1QW1 A;  4RKU E;  1ZA1 B;  1NYG A;  1Q81 U;  2H3E B;  1O9S A;  3CC7 T;  2EQU A;  3VS1 A;  2ABL A;  1S72 T;  2JS2 A;  5C0M A;  1XJW B;  1Z9Z A;  2E4H A;  3EFO B;  4HCB A;  2M16 A;  3V8J A;  4FYX B;  4BUG A;  3PVQ A;  3G7Z A;  1QLY A;  2D0Q B;  2B8A A;  4LDV A;  3PMT A;  3FLG A;  2M9U A;  2DNU A;  5GJW B;  2LC4 A;  1ARK A;  1N8R R;  1CKB A;  1FXX A;  1GRI A;  3V8K A;  3RMS A;  4KGV B;  2VV5 A;  3AT1 B;  4N4I A;  4OB2 B;  2FO0 A;  4JRP A;  1VQK Q;  3OYI A;  3SB2 A;  4BI4 A;  4A4E A;  1BCO A;  4FM4 B;  4DEX A;  2RQV A;  3CPW S;  3H9N A;  3ASK A;  1SHF A;  1VQ6 A;  3VUB A;  2QQS A;  2XK0 A;  2WSF E;  3QPH A;  4OB0 B;  1K4U S;  4IKF A;  1Q7Y U;  2CZ7 B;  5KYW A;  3OYA A;  3G1J A;  1JU5 C;  2MWP A;  3V7C A;  2QDL A;  2DJQ A;  2RPN A;  4IUT A;  2NUT B;  2LJ3 A;  4PLI A;  2FYK A;  1TTH B;  2QEX Q;  1Y57 A;  4EIK A;  4F7U E;  5KCH A;  3OYM A;  1N6A A;  5KE2 A;  2OX7 A;  4ELY C;  1N27 A;  1I07 A;  1WDX A;  4OMF B;  1D1B A;  1HSQ A;  4FYV B;  2RJD A;  3CC4 Q;  1K8A U;  5A0G A;  1Q7Y R;  2COZ A;  3TSW A;  4C8Q D;  1BYM A;  2D0N A;  3LWI A;  2CP7 A;  1NEG A;  4Q5W A;  2CH4 W;  2EKH A;  1PG5 B;  4D8K A;  3I9Q A;  1M5Q 1;  5KYU A;  1P92 A;  1RAG B;  3OYF A;  1AHJ B;  1KD1 R;  3JCM J;  4JUV A;  3JCM b;  3QSU A;  4X9C A;  1WQ7 A;  4CI0 C;  2LQ8 A;  3JB9 G;  2L89 A;  2QDY B;  1D3B A;  5AT1 B;  4C92 E;  4EMK B;  4M77 D;  2MYS A;  4XU0 A;  3EH1 A;  3V7R A;  2JJ9 A;  2RJF A;  4C5G A;  4RTY A;  2RM4 A;  1Q82 C;  3ULR B;  2V8J A;  4PFP A;  2DA9 A;  2KE9 A;  5DY9 A;  4F7U A;  2KRO A;  4JJN K;  3QKJ A;  2EBP A;  1VQ4 T;  2PVD B;  1SG5 A;  1ZQ1 A;  1ZX6 A;  2OTJ A;  1RAH B;  2CSI A;  3X28 B;  1YNZ A;  1AVZ C;  4LDU A;  4RG8 A;  3BDL A;  4BE2 A;  3EGX A;  2G6F X;  4J5Y A;  1NLO C;  2MK5 A;  1QVG S;  1ZLM A;  1G2B A;  3G6E A;  2DEQ A;  1ZSZ B;  5KYY A;  3I56 Q;  1EX4 A;  2YT6 A;  1R0C B;  3NMZ C;  1D09 B;  2AZS A;  2KDS A;  2LRQ A;  3WVE B;  2MAM A;  4E7H A;  4DQ2 A;  4JJC A;  1B34 B;  2G3R A;  2KSS A;  2D8H A;  3REA B;  1WXT A;  1ZBJ A;  3KUF A;  4C92 D;  2DXB A;  4RTU A;  1BI2 A;  3HRU A;  4NS5 A;  4HA8 A;  4XU3 A;  1WGS A;  2E64 A;  1K9M U;  2XMF A;  1AWX A;  2QXF A;  3G6E T;  2P0P A;  4P5N A;  2K2V A;  3CD6 Q;  4M78 C;  2CZ6 B;  2DET A;  1LOJ A;  3L2Z A;  3RKY A;  2FPD A;  2ZGW A;  1QMC A;  5HK0 A;  3JCM d;  3RES A;  4M7D D;  2CH4 A;  1VQ7 A;  2HBP A;  4E7I A;  4XTU A;  3A1P A;  5A0D A;  3HSB A;  2KAF A;  3CME T;  5GAN f;  1C6V X;  1VQK A;  4Z88 A;  2D8J A;  1QCF A;  1BI0 A;  2LT4 A;  5FU7 C;  5IN1 A;  3E9G A;  2AT1 B;  4UC4 A;  1PSE A;  3PVL A;  5HK3 A;  3OYE A;  1BB9 A;  2PQW A;  3QWX X;  9ATC B;  2KY9 A;  1VA7 A;  4C92 A;  1X69 A;  4M75 G;  4DEY A;  3HFN A;  3TCJ A;  1KC8 R;  2X4W A;  3JB9 H;  2JTM A;  1QCO A;  2E3I A;  1VQK T;  3VUZ A;  1BI3 A;  2P4R A;  3L42 A;  5GMK m;  1VQN A;  2E12 A;  4ATO A;  1UDL A;  3BW1 A;  5GAN 2;  5GAN j;  5FU6 C;  2XKO C;  2YLC A;  3CCJ T;  4E7K A;  1I0C A;  3CCR T;  3X20 B;  3SFM A;  2F1L A;  4FCY A;  3HRS A;  3JAM E;  2JM9 A;  3VYG A;  1D3B B;  2DTH A;  1WJS A;  2CP0 A;  1K1Z A;  4ZN3 A;  4KGZ B;  4J83 A;  2RHI A;  1UB4 A;  2VB6 A;  2YRC A;  3RUX A;  2YUN A;  2O01 E;  1VIF A;  2CDT A;  2VGM A;  2R5M A;  2JZ2 A;  2DJZ A;  5GMK e;  3MP1 A;  5EC7 A;  2L0A A;  1G83 A;  4PFZ A;  3KFV A;  1AZE A;  2A28 A;  2QQR A;  3HPW A;  2Y90 A;  2YDL A;  4BDZ A;  2O9V A;  1MMN A;  1KK7 A;  3CC2 T;  5L23 A;  2OTL T;  1ZUY A;  2X4J A;  3CXC S;  5IAY A;  2J06 A;  1SPK A;  4PKC C;  1E6G A;  3CPW A;  3V8L A;  3NGP A;  1WZO A;  1M90 U;  1N9R A;  3L2Q A;  4MML A;  3G4S A;  1JEG A;  1U06 A;  2LQN A;  1PC0 A;  2F2W A;  2J05 A;  1HYO A;  1WNL A;  4DOV A;  1JBM A;  2QQA A;  5GJV B;  3CMA Q;  1VQ4 Q;  4M77 B;  1HD3 A;  1E7O A;  2RQR A;  2XIC A;  2DE0 X;  3V7S A;  4E47 A;  5GAN d;  3VRZ A;  2CGH A;  3VYH B;  4A4H A;  3VS4 A;  1Q82 R;  4ESR A;  2K5L A;  1OZ2 A;  5LJ5 f;  1MMG A;  2CYZ B;  4HCZ A;  1ZA2 B;  2CRE A;  1OU8 A;  4C5E A;  4OMN A;  2VXE A;  3CCS Q;  1VQ5 A;  1M9S A;  1VUB A;  1W6X A;  1M4Z A;  1KC8 U;  5CIU A;  2F69 A;  1YHQ A;  2EQI A;  4J9E A;  3M0T A;  3G4S Q;  4CC2 A;  4Z02 A;  4M78 D;  2RI2 A;  2DO3 A;  1YIJ A;  3A8L B;  1VQM T;  4M7D G;  2QAS A;  5FLX E;  1VQN T;  3E9F A;  3TSZ A;  1YJN T;  2BZ8 A;  3EFO A;  2KMT A;  2V8I A;  3EHR A;  3M55 A;  1NJI U;  2RQT A;  4CC3 A;  1JXO A;  3D7S B;  3QJ6 A;  1YBY A;  3FJ5 A;  5GAN 8;  3HTR A;  3CME Q;  3HKS A;  4HKE A;  4O6J A;  4AT1 B;  2E1H A;  1FMK A;  4AG2 C;  4HT9 A;  3M5A A;  1VIE A;  5GAO n;  4M77 E;  2DBK A;  4FSS A;  4Z8A A;  3RNJ A;  4GLK A;  2YUQ A;  3P8B B;  1WXB A;  2EQJ A;  4II1 A;  2W0Z A;  4E7J A;  4VUB A;  2RO0 A;  3OS2 A;  5KH6 A;  2ZPI B;  2ZPG B;  4HCC A;  5J3B A;  2JTE A;  5FU6 B;  3JCM Q;  5GAN 4;  3FJP A;  3H0I A;  4BAC A;  4TVR A;  1TOV A;  3SD4 A;  1PSF A;  1SKU B;  4A63 B;  1J3T A;  3EG9 A;  1PD0 A;  4F04 B;  5IH2 A;  1BK2 A;  2YLB A;  1M1K U;  2E5K A;  4JDS A;  1T0H A;  4M75 D;  1YIJ T;  1UGQ B;  3CBM A;  4JS4 A;  1M1F A;  3LW5 E;  1N8R C;  1X75 C;  2EYY A;  3QII A;  4A4F A;  2RHX A;  4EMK A;  5CAI A;  3L2V A;  1K73 U;  4PK4 A;  3TQ7 P;  4RUG A;  2GNC A;  1IO6 A;  3JB9 J;  5FRM A;  4OMM A;  5GAN h;  5CO7 A;  1Q86 R;  2KVQ G;  3OB9 A;  2GQV A;  5CQY A;  4XTY A;  5FWB A;  3EGU A;  3CCE T;  5D6X A;  2JXB A;  1GBQ A;  5FWC A;  4J6Y A;  3GOX A;  1Q7Y C;  3HRT A;  2GBQ A;  3QZ9 B;  1G5V A;  4JPB W;  1CSK A;  3VS2 A;  2H3J A;  2OAW A;  3GPL A;  1LVK A;  3EGD B;  5LJ3 j;  3CCU T;  4AFS C;  2NLU A;  2BTT A;  4M7A D;  3OYY A;  1RAC B;  2NUP A;  3A8G B;  2DMO A;  2ESW A;  4CC4 B;  2JVV A;  1QWF A;  2IG0 A;  2FVU A;  3P8D A;  2QGG A;  4LDX A;  3G71 T;  8AT1 B;  2DLP A;  2D9T A;  2DVJ A;  4N4H A;  2LMJ A;  2DD4 A;  2E3H A;  1KSW A;  3VKI A;  4B9W A;  3M54 A;  3CMA T;  1TUD A;  2LX9 A;  2YSQ A;  2M0O A;  3C0C A;  4AG1 C;  1E6H A;  1QP2 A;  2NYS A;  2DM1 A;  5GAO l;  1G3Y A;  4KRT A;  1I5O B;  3E19 A;  5AYF A;  1UE9 A;  2DTO A;  1RLP C;  2HL3 A;  3JB9 F;  4EMK C;  3CCU A;  2DZ9 A;  1QVF A;  3UDC A;  3CPF A;  2RB6 A;  1WPY A;  2Y4X A;  4LD9 K;  3PTA A;  2RH2 A;  4OGC A;  4RMO A;  2HKQ B;  1VQM Q;  4MMK A;  1BIB A;  1RAI B;  2JTF A;  1Z9Q A;  2EAY A;  1IB8 A;  3CXC A;  1M1K R;  2EGC A;  1ZBX A;  4L6V 5;  3CCQ A;  1QVG P;  1Y96 B;  2AKL A;  3CMA A;  3EAE A;  3I55 A;  2BKD N;  3U23 A;  5GAN 6;  2EYZ A;  1YCY A;  4X34 A;  1GCQ C;  4LE9 A;  1Y0M A;  2ROL A;  1C1A A;  2DKG A;  1OZ3 A;  2NWM A;  2CZ1 B;  1VQ9 Q;  1VQ5 T;  1V1C A;  3I5R A;  2K79 A;  1MUZ A;  4KUD K;  3QBY A;  2GCX A;  1M1G A;  1PRL C;  3PIO A;  1RI0 A;  5GAO r;  5KE3 A;  3QDF A;  4IIO A;  4C8Q F;  2DBM A;  2XHC A;  1LPL A;  2BZX A;  1V76 A;  1IXD A;  4X9D A;  2EYX A;  1TWB A;  3GP8 A;  2GFU A;  2FHD A;  5HY6 A;  2A36 A;  4EMG A;  3DKM A;  2R57 A;  4JZ3 A;  4LUD A;  2RJE A;  4BI8 B;  4Z89 A;  5GAO p;  2XDD A;  1I4K 1;  2DXU A;  5GAN e;  2V8K A;  1VQ8 A;  1KQ1 A;  5CQX A;  3DLM A;  2A0F B;  4E6R A;  5CKH A;  1YIJ Q;  1OUL A;  3G6E Q;  3JCM h;  4J9I A;  2BZY A;  3CC2 A;  3H41 A;  4M78 E;  3CD6 T;  4KH0 B;  1YFN A;  1M3C A;  3I35 A;  1OV3 A;  3MJX A;  3CCS A;  1YWP A;  1M2V A;  5FRN A;  1ZHI A;  1H3H A;  2YRD A;  1M2V B;  5GMK h;  2ECZ A;  5GAO q;  2DL4 A;  2BE7 D;  2RD1 A;  4F7U F;  4PJN A;  3OY9 A;  1MNE A;  4OMP A;  4PLL A;  3VJP A;  3LH5 A;  1VQ4 A;  4QKU A;  3H6Z A;  1YJW Q;  2DAQ A;  2VKN A;  1QP3 A;  4M7A G;  1RAA B;  3CCE Q;  3OMG A;  1RLQ C;  3S3N A;  3OBY A;  2QG9 B;  2CP5 A;  1MV3 A;  2AK5 A;  2RI5 A;  3QHS A;  3QYH B;  5CKD A;  3CCU Q;  4E7Z A;  1RAF B;  1AD5 A;  3I55 T;  2LCS A;  5LJ3 g;  1U8R A;  2ZPB B;  2O31 A;  2RQW A;  2E6Z A;  4ZTJ A;  4HCK A;  4ZNX A;  4PJO B;  4IUR A;  4C0D C;  3EG9 B;  5CKE A;  3CCJ Q;  4JJB A;  1QKX A;  4ZN1 A;  1Q86 U;  1AT1 B;  1WJQ A;  5LJ5 d;  3CCM Q;  1M90 R;  3L1A A;  2WSE E;  1PCX A;  3E2U A;  2A7Y A;  1JJ2 P;  3JCM g;  2JMA A;  4JRQ A;  2OTJ T;  1WHL A;  5A2Q E;  2M0Y A;  4RTX A;  3CD6 A;  1K8A C;  3C12 A;  4J9H A;  1RAB B;  1I1J A;  1B7T A;  2JW4 A;  4J6X A;  2OJ2 A;  3EG3 A;  5M9O A;  2O9S A;  2OAU A;  3GIB A;  4J9B A;  4J9F A;  1NYF A;  3LGF A;  4C92 F;  2E6N A;  1VQL Q;  4AFU C;  1KC8 C;  2MI6 A;  3RKX A;  3GNF B;  1VQ7 T;  5L8R E;  4QVD A;  1NPR A;  5GMK i;  1XTD A;  4MZP A;  3VS6 A;  2JT4 A;  2O4X A;  2RK2 A;  2OTL Q;  5IT9 E;  4BI3 A;  3ZEH A;  3JCM f;  4XK8 E;  2RK1 A;  2DL8 A;  1UHF A;  2VVK A;  1GCQ A;  1OI1 A;  2ZPH B;  1MGQ A;  3CPW P;  2QA4 A;  3OW2 S;  5CCA A;  4IUP A;  1Y96 A;  3MO8 A;  5IHI A;  1K73 C;  3L2W A;  2LTO A;  5GAN 3;  1MMA A;  3LLR A;  1BIA A;  1VQ9 T;  1VQ5 Q;  3LH0 A;  2E5Q A;  4XAX B;  3WVD B;  4C0D B;  1CKA A;  2VWF A;  1UJY A;  1PD1 A;  1YWO A;  4L59 A;  2KRM A;  2GGR A;  1PHT A;  4JLG A;  1AWJ A;  2ED1 A;  3G71 A;  4Y91 A;  3MPU B;  4DBQ A;  5KCO A;  1RUW A;  1H64 1;  2E65 A;  2HQE A;  4IUQ A;  4CC7 A;  3EH2 A;  2HZY A;  3ZFJ A;  4M77 A;  1JXM A;  3M9Q A;  2F5T X;  5LJ3 f;  1VQL A;  2YXY A;  1WHJ A;  1D1A A;  4FYW B;  2PUK B;  3MEV A;  2PTK A;  4GY5 A;  1SSH A;  2ED0 A;  3G4S T;  2IVW A;  2QEX A;  3QO3 A;  4C5H A;  1WHG A;  1IRE B;  2BIV A;  3I5S A;  2C0O A;  1TUG B;  2Y4Y A;  3EGD A;  3A5Z B;  4AFZ C;  1YJN Q;  5GAM f;  1WA7 A;  3MP6 A;  2FPF A;  2AIR B;  2CUB A;  2CT4 A;  4K11 A;  4E7L A;  2MCN A;  2DVE A;  1GFD A;  6AT1 B;  1XNI A;  3OYG A;  1FYN A;  3FC3 A;  4RCB A;  4J8O A;  1PWT A;  2X51 A;  3I56 A;  4NL2 A;  2CSQ A;  3M0Q A;  1VYT A;  1ABQ A;  2ZAE A;  1D0Y A;  4D8D A;  1UJ0 A;  1S72 A;  1H92 A;  1Y7X A;  4XQ3 A;  5LJ5 e;  1HK9 A;  1SRM A;  1YHQ T;  2XD0 A;  4IIM A;  5GAN 7;  1KIK A;  2KRS A;  4ZGJ B;  4HXJ A;  2X35 A;  4M75 E;  2GF7 A;  1F1B B;  1WYX A;  3RMQ A;  2F2V A;  4MZT A;  4M78 F;  3WXM B;  5I22 A;  2I0N A;  2A3L A;  4PJO F;  3EGX B;  5I2S A;  3C94 A;  5KYX B;  5KYX A;  4XU2 A;  8ATC B;  3I55 Q;  2VXF A;  1W4S A;  4KGX B;  4JLI A;  1VOM A;  4R0K A;  2LQW A;  2RA2 A;  2DZC A;  1WXU A;  3JSC A;  1YJ9 A;  3M0S A;  4EMH A;  1LCK A;  5IHK A;  4MDW A;  1X2K A;  1JRI A;  1M1K C;  3VRY A;  1RAD B;  2HCK A;  2CT3 A;  4PJO E;  4A53 A;  1QVP A;  4OF1 A;  1B3Q A;  4C8Q E;  1QQJ A;  1X6G A;  3CC4 A;  1WHH A;  2HEQ A;  4PFO A;  1M8M A;  1G3W A;  4BY6 C;  2A08 A;  3LWH A;  4C92 B;  2VGN A;  1QKW A;  2ZZD A;  2LZ6 B;  4OGE A;  4J9G A;  3ZL7 C;  1G3T A;  2COY A;  1YIT Q;  3NTK A;  1OEB A;  4LD6 A;  1HJD A;  1WHK A;  2ZPF B;  1BKB A;  3RR6 A;  4M7D A;  5GAM d;  4OML A;  3CME A;  4BDY A;  2V1R A;  2NUT A;  1R77 A;  4DBH A;  5GMK l;  3CCM A;  5LJ3 h;  2LQK A;  1VQL T;  3LX7 A;  1VQ7 Q;  3VU3 C;  3QG1 A;  2PZ1 A;  1KHC A;  1YJ9 T;  3CCL T;  4M78 G;  4QQD A;  2EKO A;  3X25 B;  4R56 A;  2DIL A;  1WHM A;  3T9N A;  2LJ1 A;  2K3Y A;  2DXC A;  4N0A A;  1Q81 C;  3EG0 A;  3NPF A;  3GNG A;  2M51 A;  2C0T A;  2O88 A;  4QW2 A;  2RHZ A;  4QQG A;  1B07 A;  3P8H A;  2O2O A;  1VQO A;  2KT8 A;  4C8Q A;  3H0H A;  3MEA A;  2PU9 B;  3TRE A;  4PJO A;  3G71 Q;  4C0G A;  2FRW A;  2RN8 A;  1AWW A;  4FT2 A;  4RTZ A;  1D1C A;  2XDP A;  3NTH A;  5FRO A;  1JO8 A;  3FIF A;  2DX1 A;  1VYU A;  3FDR A;  3VS3 A;  4B9X A;  1T3L A;  3JCM W;  4RTT A;  3VV0 A;  1PNJ A;  4Y28 E;  4JZ4 A;  1VQ6 T;  2GTJ A;  3CCE A;  1M2O A;  2DL7 A;  1ACM B;  2HDA A;  1KJW A;  2QYZ A;  1BI1 A;  1W1F A;  1X6O A;  2JNG A;  1VQO Q;  4NL3 A;  3M4Y A;  4WTO B;  2K6D A;  4M75 B;  1NJI R;  2DK3 A;  4PJO D;  1S1N A;  1WX6 A;  1JQQ A;  4F16 A;  1NJI C;  1XOV A;  2LCL A;  4DBR A;  5C6S A;  3HL8 A;  3J7A F;  2EQK A;  3CXC P;  3MCA B;  4ANJ A;  1Y71 A;  4XU1 A;  2HAX A;  3SHW A;  3J81 E;  2JUF A;  5GAN 5;  1IRX A;  1KQ2 A;  4PJM A;  2FPE A;  2ATC B;  3OYC A;  3GLX A;  3RIR A;  3PE0 A;  2VAS A;  2MMP A;  4X1V A;  4CRI A;  3SWN A;  4KBM B;  3BFM A;  4B6M A;  5J26 A;  3SWN B;  1MHN A;  4FL6 A;  1JJ2 S;  3CCJ A;  2FZC B;  4M77 F;  3PMI A;  2DEU A;  1R8O B;  3CBP A;  2CP6 A;  1U1S A;  1X01 A;  2DRM A;  1OYX A;  3INZ A;  1SHG A;  4OVA A;  4XTW A;  3PIP A;  3F70 A;  4M75 A;  1Q82 U;  2DYB A;  4KH1 B;  4NOY A;  1K9M R;  3MHX A;  1FX7 A;  2RNA A;  1ABO A;  5GAM h;  1X2Q A;  3X26 B;  2YUP A;  2DTI A;  4QT7 A;  3TVT A;  3RER A;  4M78 B;  5I11 A;  1TUC A;  1W2B S;  2QQB A;  4RG2 A;  2SEM A;  1PRM C;  1M90 C;  1KFZ A;  4ME7 A;  1Q86 C;  3A8M B;  3MEU A;  1SEM A;  5LJ3 e;  4YTL A;  2HD0 A;  1WI7 A;  1IGU A;  3RBB B;  1YI2 T;  4XTV A;  3M57 A;  1YP5 A;  1M30 A;  3URG A;  3OMC A;  2EPD A;  3JB9 D;  2GFA A;  1OX8 A;  2V1Q A;  3S6W A;  4M4Z A;  3JCM c;  2EGE A;  2P4T A;  2A37 A;  2HQH A;  1YJW T;  4XTX A;  2MOX A;  2GQI A;  1UGP B;  3X24 B;  3R6N A;  3OYB A;  2XU8 A;  1U5S A;  1ZUU A;  2LNH B;  3OSV A;  2K2M A;  1M3A A;  2YRV A;  5CKB A;  3VS5 A;  5EG2 A;  3HFO A;  2MF2 A;  1GFC A;  1QVF S;  5D6W A;  5IXF A;  2DER A;  3SEM A;  2KR3 A;  2BUD A;  3MEW A;  4M7D B;  5LJ5 h;  4ZGD B;  5GMK j;  2J6O A;  1BU1 A;  1JJ2 A;  4ZGE B;  3BE3 A;  1KQS S;  3RKW A;  3S3M A;  1T3S A;  3RDV A;  3CCM T;  2NUP B;  1NEB A;  4M7D E;  3ZBD A;  2FRY A;  3JCM P;  1ZUK A;  2EJF A;  1YCS B;  2LCC A;  3EG2 A;  1JB0 E;  3JV3 A;  2GTO A;  5IHN A;  1D0Z A;  2OTJ Q;  2KYB A;  4HVW A;  3UPU A;  2X3W D;  2JM8 A;  1VQ6 Q;  1B34 A;  1M3B A;  1NBE B;  1K73 R;  2F2X A;  7AT1 B;  4OP0 A;  3TU4 K;  2CS7 A;  5J39 A;  4M7A C;  3OYL A;  1XQH A;  1I81 A;  3FB9 A;  3JCM X;  4QQ6 A;  2EW3 A;  2VC8 A;  2P84 A;  1KG1 A;  1EZZ B;  4A4G A;  2CUD A;  2FZG B;  4AMC A;  3CCV Q;  1KD1 U;  4PJO G;  4C0Z A;  3KXT A;  4C8Q G;  5DLO A;  1AWO A;  5CK9 A;  1FWZ A;  1K9A A;  2P0K A;  5FW9 A;  1D0X A;  3C4S A;  1LNX A;  2D1X A;  2VYT A;  2EWN A;  3FRN A;  3PGG A;  3TEE A;  4F14 A;  3CCR A;  4KUL A;  1UEC A;  1ZSG A;  2LNV A;  4M78 A;  1K9M C;  3S3O A;  2M02 A;  3QUI A;  3HHT B;  4KT0 E;  2HMA A;  5GAO m;  1C0M A;  3EG1 A;  1Q81 R;  1VQ8 Q;  3OYN A;  3LYI A;  1GCP A;  3SDZ A;  2RHY A;  2ZPE B;  4D6W A;  2B86 A;  4M75 C;  3KBG A;  3CC7 Q;  3OW2 P;  4HT8 A;  2C06 A;  1RL2 A;  1S72 Q;  2QGF B;  2O4X B;  4JRK A;  1OPK A;  3OS0 A;  4PJO C;  1KQS A;  2FG0 A;  5GAM g;  2EIF A;  1Q95 G;  3M53 A;  5CKF A;  2QQ9 A;  2KK4 A;  3OYJ A;  1IGQ A;  2JS0 A;  2NUZ A;  2KXC A;  2X4X A;  4LN2 A;  2I2L A;  2QAZ A;  1NZ9 A;  3A8H B;  2X9H A;  2ENM A;  1K76 A;  2L3P A;  4FW2 A;  3N5B B;  1U3O A;  3OS1 A;  2M1H A;  4M7A A;  4BE0 A;  3OYK A;  2J6F A;  2MIO A;  5LJ3 d;  4F7U B;  2DL5 A;  2EYW A;  2K5I A;  3MKD A;  1BCM A;  5GAN g;  2XID A;  1NPP A;  3DB3 A;  2Z0W A;  1YHQ Q;  4IUU A;  2KQW A;  2QTV A;  3DB4 A;  4L5G A;  4JJD A;  1FMV A;  1BBZ A;  3QWY A;  4QVC A;  1RAE B;  3FEO A;  2L8D A;  1SF9 A;  2XG8 D;  4N0A C;  1I5L A;  4GLM A;  3R6O A;  2JOY A;  5CR2 A;  4FSX A;  2LX7 A;  3A8O B;  1UGR B;  2L3Q A;  3IQL A;  3M0U A;  1V29 B;  5LL6 S;  4WCI A;  3ER0 A;  2ROT A;  2QEX T;  4QVZ A;  3MP8 A;  3H8Z A;  4M7D F;  3HP9 A;  2K4Y A;  5A0L A;  4C8Q B;  1W2B A;  1FMW A;  2E41 A;  2RHU A;  1AEY A;  3UAT A;  3C95 A;  3UA7 A;  3E1S A;  2KEA A;  4M77 C;  3REB B;  1M27 C;  3OS5 A;  2XI9 A;  1YIT T;  1TSF A;  2L3S A;  4J9C A;  4OB1 B;  5LJ5 j;  1QWE A;  2C0I A;  4LDY A;  1SRL A;  2EFI A;  2EJG A;  5I2M A;  4DBF A;  3BY7 A;  1M8V A;  1O75 A;  1RI9 A;  3CCQ Q;  1NM7 A;  1QVF P;  2DIQ A;  2D6F A;  2V26 A;  1TXQ A;  1UEB A;  3OYH A;  5LJ5 g;  3L2R A;  2FL7 A;  1YJ9 Q;  3CCL Q;  5CVI A;  5IXB A;  1X43 A;  2WAC A;  1PKS A;  1WIE A;  1UGS B;  3GBQ A;  4FU6 A;  1X27 A;  3CEY A;  2KT1 A;  3M4G A;  4AFQ C;  1VQP Q;  1IZ6 A;  1OU9 A;  4J7F A;  2X4Y A;  2K57 A;  1MV0 B;  4ORZ A;  2F5K A;  3JRZ A;  4FT4 A;  3SWN C;  3OYD A;  1OPL A;  3I56 T;  1GXI E;  4HVU A;  2EVR A;  1VQM A;  1R0B G;  2SRC A;  1W70 A;  1YN8 A;  2K3B A;  1NE8 A;  1VQ8 T;  4V2S A;  2KGT A;  4JS5 A;  2HNI A;  1UGV A;  2JMC A;  2QA4 Q;  1I8F A;  1HXD A;  3AHU A;  2MPX C;  3MET A;  5GAM e;  2DRK A;  3THK A;  2LJ0 A;  3H0F A;  2EYQ A;  4OB3 B;  3ME9 A;  3UF4 A;  2KYM A;  2DXT A;  4M7A B;  2P0Q A;  3CCL A;  2HL5 C;  1VQO T;  4LXC A;  2ZCF B;  1W2B P;  2L3R A;  4MDX A;  2DPP B;  1U1T A;  2HQX A;  2J6K A;  4M7A E;  1WLP B;  3QXE B;  1WFW A;  5HKC A;  3M0P A;  1K0S A;  4WF2 A;  5DM7 R;  2PUO B;  1NLP C;  1YI2 A;  3LGL A;  2J7I A;  1T0J A;  4JRI A;  4RCC A;  2DFU A;  3QDR B;  3CBO A;  2YHT A;  4M77 G;  1GL5 A; 
#chains in the Genus database with same CATH homology
 1U1S A;  2KAF A;  3CME T;  1X01 A;  1OYX A;  4BD3 A;  5CKH A;  5GAN f;  3INZ A;  1VQK A;  4M7D C;  4OVA A;  2WSC E;  4XTW A;  3PIP A;  4C0F A;  3JCM h;  1BI0 A;  2LT4 A;  3F70 A;  4M75 A;  5FU7 C;  1Q82 U;  5IN1 A;  3E9G A;  3CC2 A;  4M78 E;  4NOY A;  3CD6 T;  4UC4 A;  1PSE A;  3QYG B;  3MHX A;  1FX7 A;  4M7D B;  2DD5 A;  5GAM h;  3CCS A;  5HK3 A;  3M58 A;  3OYE A;  3UWN A;  5FRN A;  1ZHI A;  2PQW A;  3X26 B;  2KY9 A;  1VQ9 A;  3L2U A;  4C92 A;  2DTI A;  5GMK h;  4M75 G;  2K5F A;  4BE1 A;  3HFN A;  3TCJ A;  5GAM j;  3DLL A;  3RER A;  2X4W A;  4M78 B;  1DJ7 B;  5GAO q;  3JB9 H;  2RD1 A;  2JTM A;  4LDW A;  2VUB A;  4F7U F;  1W2B S;  2QQB A;  4BY6 B;  3EFR A;  4RG2 A;  4ELZ C;  3QZ5 B;  3OY9 A;  1VQK T;  3VUZ A;  1BI3 A;  4PLL A;  3L42 A;  3VJP A;  5GMK m;  1VQ4 A;  1KC8 U;  1KD1 C;  1VQN A;  2E12 A;  1M90 C;  4XTZ A;  4FIB A;  2RJC A;  4ME7 A;  1Q86 C;  3H6Z A;  2OTL A;  2DAQ A;  3PFS A;  3OW2 A;  1QP3 A;  3A8M B;  4ATO A;  4M7A G;  3OMG A;  3BW1 A;  5GAN 2;  1EIF A;  3GF5 A;  3MEU A;  5LJ3 e;  4DOW A;  3S3N A;  3OBY A;  2K3X A;  5GAN j;  4YTL A;  2HD0 A;  5FU6 C;  2XKO C;  2YLC A;  3CCJ T;  4E7K A;  1YI2 T;  4XTV A;  3CCR T;  3M57 A;  1YJW A;  2RI5 A;  3QHS A;  3QYH B;  3URG A;  3OMC A;  3X20 B;  3SFM A;  3JB9 D;  5CKD A;  2GFA A;  3HRS A;  3JAM E;  3VYG A;  4A54 A;  3S6W A;  3I55 T;  5LJ3 g;  1D3B B;  3JCM c;  2DTH A;  1U8R A;  2FB7 A;  2P4T A;  2ZPB B;  5DLQ E;  1WJS A;  1YJW T;  4XTX A;  4DA4 A;  3HSB A;  4KUI A;  3UT1 A;  5I21 A;  2E6Z A;  4PL6 A;  4ZTJ A;  4ZN3 A;  3M59 A;  1UGP B;  3X24 B;  4PJO B;  3OYB A;  4J83 A;  2XU8 A;  4IUR A;  2RHI A;  1UB4 A;  4C0D C;  1KHI A;  5CKE A;  3OSV A;  4ZN1 A;  2YRV A;  5CKB A;  1WQW A;  3RUX A;  2R5A A;  2CZ0 B;  5EG2 A;  1Q86 U;  1WJQ A;  5LJ5 d;  3HFO A;  2O01 E;  2R58 A;  2WSE E;  3L1A A;  1VIF A;  2EJ9 A;  2MF2 A;  2VGM A;  3O8V A;  2R5M A;  2JZ2 A;  2A7Y A;  2DJZ A;  5GMK e;  3MP1 A;  1QVF S;  5FU7 B;  3JCM g;  4ZTF A;  5D6W A;  4JRQ A;  2BUD A;  2OTJ T;  3MEW A;  2QQR A;  5A2Q E;  3HPW A;  5LJ5 h;  3CCQ T;  3CD6 A;  1K8A C;  3C12 A;  2QI2 A;  3EFS A;  4ZGD B;  5GMK j;  3CC7 A;  2Y90 A;  1JJ2 A;  4ZGE B;  4J6X A;  4BDZ A;  1KQS S;  3RKW A;  3S3M A;  4M75 F;  5M9O A;  3CCM T;  3CC2 T;  2OTL T;  2LT1 A;  2X4J A;  3OQ5 A;  4M7D E;  3ZBD A;  3CXC S;  5IAY A;  1YJN A;  1VQP T;  2OAU A;  4PKC C;  4C5I A;  3JCM P;  2EJF A;  3GIB A;  2LCC A;  1JB0 E;  3CPW A;  1H3Z A;  2E70 A;  3LGF A;  3V8L A;  2E6N A;  3PT9 A;  4C92 F;  1M90 U;  1N9R A;  3NFC A;  3L2Q A;  4MML A;  1KC8 C;  3G4S A;  2MI6 A;  3RKX A;  3GNF B;  1VQ7 T;  3UPU A;  4O5V A;  5L8R E;  4QVD A;  1NPR A;  1QVG A;  2EQM A;  2DIG A;  4EDU A;  1B34 A;  4A4K A;  5GMK i;  1YIT A;  2E10 A;  1XTD A;  4MZP A;  3CCS T;  3JB9 G;  1N8R U;  4OP0 A;  1WNL A;  2O4X A;  1JBM A;  2RK2 A;  3QJY A;  2CS7 A;  2QQA A;  4BI3 A;  4DOV A;  3ZEH A;  5J39 A;  3CC4 T;  3JCM f;  5IT9 E;  1SSF A;  4XK8 E;  2JN0 A;  3OYL A;  4M7A C;  2AHJ B;  2RK1 A;  4R55 A;  1N9S A;  1XQH A;  1OI1 A;  4M77 B;  1I81 A;  2ZPH B;  2XIC A;  3V7S A;  3JCM e;  4E47 A;  5GAN d;  3FB9 A;  1MGQ A;  3JCM X;  4QQ6 A;  2VC8 A;  4PNO A;  2CGH A;  3VYH B;  2QA4 A;  4A4H A;  4A4G A;  5CCA A;  2QA4 T;  2LDM A;  3CCV A;  3OW2 S;  2K5L A;  3TU4 K;  1OZ2 A;  4IUP A;  4PJO G;  1KD1 U;  1Y96 A;  2CYZ B;  3MO8 A;  4HCZ A;  4C0Z A;  5LJ5 f;  3KXT A;  1K73 C;  4C8Q G;  3L2W A;  2LTO A;  5DLO A;  5GAN 3;  3LLR A;  3OSS C;  4C5E A;  2VXE A;  4MZM A;  1FWZ A;  2QTX A;  2P0K A;  5CK9 A;  1VQ5 A;  1BIA A;  1G3S A;  1VQ9 T;  1M9S A;  1TH7 A;  1VUB A;  3LH0 A;  4C8Q C;  1M4Z A;  2E5Q A;  3C4S A;  3NTI A;  2F69 A;  1LNX A;  4XAX B;  2MWO A;  5CIU A;  3WVD B;  4C0D B;  1YHQ A;  2VYT A;  2EWN A;  4L59 A;  3FRN A;  3PGG A;  3TEE A;  3OA6 A;  4C92 C;  4M7A F;  4JLG A;  3CCR A;  4Z02 A;  4M78 D;  3OBW A;  2CKK A;  4KUL A;  2XDB A;  1VQP A;  2RI2 A;  3G71 A;  2DO3 A;  4Y91 A;  3A8L B;  4F7U G;  5KCO A;  4IUV A;  1YIJ A;  1H64 1;  2LNV A;  2E65 A;  1VQM T;  3JCM V;  4M78 A;  2HQE A;  4M7D G;  4IUQ A;  2PVO B;  5FLX E;  1JJ2 S;  1K9M C;  4J7I A;  4N4G A;  3CCV T;  1VQN T;  3ZFJ A;  4M77 A;  3S3O A;  5LJ3 f;  3M9Q A;  2F5T X;  1VQL A;  3E9F A;  3QUI A;  3HHT B;  1YJN T;  3J80 E;  4KT0 E;  1Y07 A;  5GAO m;  3M56 A;  4J6W A;  2KMT A;  3BDU A;  2V8I A;  2LVM A;  2PUK B;  3MEV A;  5D6Y A;  4GY5 A;  3M55 A;  2PVG B;  3OYN A;  3LYI A;  1NJI U;  3Q1J A;  3PNW C;  3G4S T;  3SDZ A;  2RHY A;  2IVW A;  3QJ6 A;  2QEX A;  2ZPE B;  1LJO A;  3QO3 A;  4D6W A;  4C5H A;  1YBY A;  4M75 C;  5GAN 8;  1IRE B;  2BIV A;  3KBG A;  4HT8 A;  2C06 A;  3HKS A;  4HKE A;  1RL2 A;  2Y4Y A;  2RI3 A;  4O6J A;  2L5Q A;  3A5Z B;  2E1H A;  2O4X B;  4JRK A;  5GAM f;  3MP6 A;  3OS0 A;  4BB7 A;  4PJO C;  1KQS A;  1WJR A;  4HT9 A;  3M5A A;  2EIF A;  5GAM g;  1VIE A;  5GAO n;  3M53 A;  4M77 E;  5CKF A;  1KG1 A;  4E7L A;  2DVE A;  2QQ9 A;  4EPC A;  2KK4 A;  4GLK A;  3P8B B;  1XNI A;  3OYJ A;  4C92 G;  3OYG A;  3FC3 A;  4RCB A;  4J8O A;  1QW1 A;  4RKU E;  3JB9 I;  3I56 A;  2EQJ A;  4II1 A;  4NL2 A;  2X4X A;  4E7J A;  1Q81 U;  2I2L A;  4VUB A;  3CC7 T;  1O9S A;  3A8H B;  1NZ9 A;  2RO0 A;  3OS2 A;  2EQU A;  5KH6 A;  1S72 A;  2ZPI B;  1S72 T;  2ZPG B;  1Y7X A;  4XQ3 A;  5FU6 B;  5J3B A;  5LJ5 e;  3JCM Q;  1HK9 A;  5GAN 4;  3FJP A;  3N5B B;  1YHQ T;  4BAC A;  2XD0 A;  4TVR A;  5C0M A;  5GAN 7;  3OS1 A;  2M1H A;  3SD4 A;  4M7A A;  1PSF A;  4ZGJ B;  2X35 A;  4M75 E;  2GF7 A;  4BE0 A;  3RMQ A;  3OYK A;  4MZT A;  4HCB A;  2M16 A;  4M78 F;  3V8J A;  3WXM B;  5LJ3 d;  2YLB A;  4BUG A;  4F7U B;  1M1K U;  3G7Z A;  2A3L A;  4PJO F;  4JDS A;  2K5I A;  5I2S A;  4M75 D;  5GAN g;  2D0Q B;  3C94 A;  1YIJ T;  2XID A;  1UGQ B;  3CBM A;  1NPP A;  4JS4 A;  1M1F A;  3DB3 A;  3LW5 E;  1N8R C;  1X75 C;  2B8A A;  4LDV A;  3PMT A;  3QII A;  4IUU A;  4XU2 A;  4A4F A;  2RHX A;  4EMK A;  2KQW A;  2VXF A;  3DB4 A;  2M9U A;  3FLG A;  1W4S A;  4JLI A;  5CAI A;  3L2V A;  4L5G A;  2RA2 A;  2DZC A;  1K73 U;  2LC4 A;  4QVC A;  3JSC A;  1FXX A;  3V8K A;  1YJ9 A;  4EMH A;  3RMS A;  3FEO A;  4MDW A;  3JB9 J;  2L8D A;  1JRI A;  2XG8 D;  4N0A C;  5FRM A;  1I5L A;  1M1K C;  3R6O A;  2JOY A;  2VV5 A;  4N4I A;  4OB2 B;  4JRP A;  3OYI A;  4PJO E;  3SB2 A;  5CR2 A;  4FSX A;  4A53 A;  1QVP A;  5CO7 A;  4BI4 A;  5GAN h;  4OF1 A;  4A4E A;  2KVQ G;  3OB9 A;  2GQV A;  3A8O B;  1UGR B;  4C8Q E;  4FM4 B;  1V29 B;  5CQY A;  3CC4 A;  4XTY A;  5LL6 S;  3CPW S;  3ER0 A;  3ASK A;  3CCE T;  5D6X A;  2QEX T;  1VQ6 A;  1G3W A;  4QVZ A;  3VUB A;  4BY6 C;  3LWH A;  4J6Y A;  3MP8 A;  4C92 B;  3GOX A;  2VGN A;  3H8Z A;  2QQS A;  2ZZD A;  2XK0 A;  4M7D F;  2WSF E;  3HP9 A;  3QPH A;  4OB0 B;  4OGE A;  2K4Y A;  5A0L A;  1G3T A;  1Q7Y C;  3HRT A;  4C8Q B;  4IKF A;  3NTK A;  3QZ9 B;  4LD6 A;  1G5V A;  1W2B A;  1Q7Y U;  2CZ7 B;  2H3J A;  2ZPF B;  2E41 A;  3OYA A;  3GPL A;  1BKB A;  3CCU T;  5LJ3 j;  2MWP A;  2RHU A;  3V7C A;  2NLU A;  5GAM d;  3CME A;  4M7D A;  4BDY A;  3C95 A;  4M7A D;  3OYY A;  4IUT A;  3A8G B;  4PLI A;  2FYK A;  5GMK l;  5LJ3 h;  2LQK A;  3CCM A;  1VQL T;  4F7U E;  5KCH A;  2JVV A;  3E1S A;  2IG0 A;  3LX7 A;  2FVU A;  4M77 C;  3P8D A;  1N6A A;  5KE2 A;  3OYM A;  4ELY C;  1N27 A;  4LDX A;  3OS5 A;  3VU3 C;  2XI9 A;  3QG1 A;  4OMF B;  3G71 T;  1YIT T;  1KHC A;  2D9T A;  1YJ9 T;  3CCL T;  4M78 G;  4QQD A;  2EKO A;  4OB1 B;  3X25 B;  2RJD A;  4R56 A;  5LJ5 j;  4N4H A;  1K8A U;  2DD4 A;  5A0G A;  3VKI A;  3T9N A;  4B9W A;  4N0A A;  2K3Y A;  2DXC A;  3M54 A;  3CMA T;  1Q81 C;  4LDY A;  3GNG A;  2EFI A;  2LX9 A;  2M0O A;  2EJG A;  5I2M A;  4C8Q D;  4QW2 A;  2RHZ A;  3BY7 A;  4QQG A;  4XTU A;  1M8V A;  1O75 A;  3P8H A;  1BYM A;  3LWI A;  1QP2 A;  1VQO A;  4Q5W A;  4C8Q A;  2D6F A;  2DIQ A;  3MEA A;  1UEB A;  2PU9 B;  3OYH A;  5GAO l;  3TRE A;  5LJ5 g;  3L2R A;  4PJO A;  1G3Y A;  2FL7 A;  4C0G A;  1M5Q 1;  1P92 A;  3E19 A;  5CVI A;  3OYF A;  5AYF A;  1AHJ B;  2WAC A;  3JCM J;  2DTO A;  4JUV A;  1UGS B;  3JCM b;  4FT2 A;  4FU6 A;  3QSU A;  3CEY A;  3JB9 F;  4X9C A;  1WQ7 A;  3M4G A;  2LQ8 A;  4EMK C;  2L89 A;  2XDP A;  2DZ9 A;  3NTH A;  4CI0 C;  3CCU A;  2QDY B;  1D3B A;  3CPF A;  5FRO A;  3UDC A;  1QVF A;  1IZ6 A;  2RB6 A;  3FIF A;  3FDR A;  4C92 E;  4B9X A;  4EMK B;  1WPY A;  2Y4X A;  4J7F A;  2X4Y A;  2K57 A;  4M77 D;  2RH2 A;  3PTA A;  4LD9 K;  4XU0 A;  4OGC A;  4RMO A;  3JCM W;  3VV0 A;  2F5K A;  3JRZ A;  4FT4 A;  4Y28 E;  4MMK A;  1BIB A;  3SWN C;  3V7R A;  2RJF A;  3OYD A;  4C5G A;  1VQ6 T;  3I56 T;  2JTF A;  2RM4 A;  3CCE A;  1Q82 C;  2V8J A;  1GXI E;  2EAY A;  4HCC A;  5DY9 A;  4F7U A;  1BI1 A;  4JJN K;  3CXC A;  1VQM A;  1X6O A;  1NE8 A;  2JNG A;  3QKJ A;  1VQ8 T;  1VQ4 T;  4V2S A;  1ZBX A;  2PVD B;  4L6V 5;  4NL3 A;  3CCQ A;  1ZQ1 A;  2OTJ A;  3M4Y A;  1Y96 B;  3X28 B;  4JS5 A;  3CMA A;  2HNI A;  3EAE A;  4M75 B;  3I55 A;  4LDU A;  4RG8 A;  3BDL A;  2DK3 A;  4BE2 A;  1I8F A;  1HXD A;  2BKD N;  3AHU A;  4J5Y A;  4PJO D;  3MET A;  5GAM e;  5GAN 6;  1QVG S;  3G6E A;  1NJI C;  2DEQ A;  1YCY A;  2EYQ A;  4X34 A;  1XOV A;  2LCL A;  5C6S A;  4OB3 B;  3HL8 A;  2DKG A;  3J7A F;  3ME9 A;  1OZ3 A;  2CZ1 B;  2EQK A;  1VQ5 T;  2KDS A;  3MCA B;  2LRQ A;  2DXT A;  4M7A B;  3WVE B;  2MAM A;  2P0Q A;  4E7H A;  3QBY A;  4DQ2 A;  3CCL A;  4KUD K;  2GCX A;  1M1G A;  1VQO T;  1B34 B;  1Y71 A;  4XU1 A;  1RI0 A;  2G3R A;  3PIO A;  2KSS A;  5KE3 A;  5GAO r;  2HAX A;  3J81 E;  2JUF A;  2ZCF B;  3KUF A;  4C8Q F;  2L3R A;  2XHC A;  4C92 D;  2DPP B;  2DXB A;  5GAN 5;  1U1T A;  4MDX A;  1KQ2 A;  1BI2 A;  3HRU A;  2HQX A;  4NS5 A;  4M7A E;  3QXE B;  5HKC A;  4HA8 A;  3OYC A;  4WF2 A;  4XU3 A;  1WGS A;  2E64 A;  5DM7 R;  2PUO B;  1K9M U;  3GLX A;  4X9D A;  3RIR A;  2QXF A;  3G6E T;  2P0P A;  3GP8 A;  4P5N A;  2GFU A;  2K2V A;  2MMP A;  3LGL A;  2FHD A;  3SWN A;  4CRI A;  5HY6 A;  1YI2 A;  4M78 C;  4EMG A;  4JRI A;  4RCC A;  3DKM A;  4KBM B;  2R57 A;  2CZ6 B;  3BFM A;  2RJE A;  4BI8 B;  5J26 A;  5GAO p;  1LOJ A;  1MHN A;  3L2Z A;  3RKY A;  4FL6 A;  3SWN B;  2ZGW A;  2XDD A;  1I4K 1;  3QDR B;  2DXU A;  3CBO A;  2V8K A;  2YHT A;  4M77 G;  3RES A;  5GAN e;  5HK0 A;  3JCM d;  3CCJ A;  1VQ8 A;  4M77 F;  2HBP A;  1VQ7 A;  3PMI A;  4M7D D;  4E7I A;  1R8O B;  3CBP A;  1KQ1 A;  5A0D A;  5CQX A;  3DLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...