5CO7A

E. coli mazf form iii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
104
Chain Sequence
VSRYVPDMGDLIWVDFDPHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 24
structure length 104
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5co7A00
5HK3A 1X75C 3NFCA 3JRZA 3G7ZA 4MDXA 1NE8A 4ME7A 5CCAA 3HPWA 4ELZC 5HK0A 5DLOA 2KMTA 5CKEA 5CKDA 2VUBA 5CK9A 5CQYA 4MZMA 1M1FA 5CKHA 5CR2A 5CO7A 3TCJA 4MZPA 5HKCA 2C06A 4MZTA 1UB4A 1VUBA 3JSCA 3VUBA 4VUBA 5CKFA 5CQXA 4HKEA 5CKBA 2MF2A 4OF1A 4ELYC
chains in the Genus database with same CATH superfamily
1SSHA 2GBQA 2X4XA 4IUPA 3G7ZA 3G71A 4M7DF 3M57A 2K2MA 3CC2A 2LNVA 3CCSA 4M75E 4X9CA 1WYXA 1CKAA 4J9DA 2RNAA 1NYGA 2FEIA 1PWTA 2LQ8A 2QTVA 2AK5A 4LD6A 2K5IA 3EG1A 3HSBA 3RKWA 3EGUA 3S3MA 1K9AA 1KD1U 2ZPHB 5I21A 1MMDA 4M7AE 1M8MA 5KYXB 1R0BG 2FPFA 1DJ7B 5HCKA 3OA6A 3I55A 2EGAA 1M30A 3DKMA 3EHRA 1ZSZC 1K73U 2I0NA 1FMKA 5LJ3e 2K6DA 1M2OA 1UE9A 1H92A 4JLGA 1KHCA 4A53A 3X20B 3HRSA 1VUBA 3OSSC 2CP5A 4J7FA 2BZ8A 3JCMb 1BCMA 1X75C 3SWNB 4PFPA 4RMOA 4JS5A 4CRIA 3EGDB 4HCCA 2DYBA 1KIKA 2RJFA 2LMJA 1TS9A 2P0PA 2SRCA 3OYKA 1VQ9T 1VIEA 2YUQA 2E64A 1M1KU 1BK2A 1RABB 1RI9A 1YJNT 4FT2A 1VQNA 2RQUA 1UFFA 1WJQA 1NJIR 4JRQA 1LNXA 1VYUA 3MKDA 4PFOA 1WHGA 2PUKB 4KRTA 3RUXA 4X34A 4RCCA 2G3RA 3VS3A 1PKTA 2RHIA 3MEVA 3LW5E 4C92F 1ZUUA 4OB0B 2OI3A 3WVEB 2KYMA 1QWEA 2CS7A 3JV3A 4FIBA 3M0RA 1NEBA 1KD1C 2H3JA 2K3XA 1OV3A 5IAYA 4BUGA 2VC8A 1OX9A 3A98A 3QPHA 1RLQC 5GJWB 3OYNA 1M3CA 1AVZC 2RK1A 4BDYA 4QQ6A 3M5AA 1S72A 1TUDA 3OMGA 4ZN1A 2M9UA 1K73C 1KSWA 1WA7A 4PL6A 3CCVT 4LDUA 4YTLA 3TU4K 1X2KA 2E3HA 5FLXE 3NFCA 3OYGA 1Q7YU 2EQJA 3SFMA 1M4ZA 2HMAA 3E9GA 5FU7C 4UC4A 2DLPA 2KEAA 4L6V5 1RADB 4F16A 2LP5A 3QZ5B 4N4GA 3VV0A 3LWHA 5KYWB 1I5OB 4O5VA 4KGXB 3CMAT 3RKYA 3PT9A 4JPBW 4HKEA 1YCSB 1VQ8Q 3D7SB 1M1KC 2MI6A 2YT6A 2DE0X 5GANg 3M58A 1YBYA 2GQIA 4BDZA 4HXJA 3CC7A 4C8QF 3CQTA 3RR6A 4PJOF 3REAB 4LUEA 2D6FA 1MGQA 2GF7A 2ROTA 2E65A 3SD4A 4E47A 1YIJA 3KUFA 1BKBA 1JXOA 1UGRB 3UDCA 5HKCA 3CCQA 4EMKB 1H3HA 3PFSA 2J6OA 4C8QB 1RLPC 3LX7A 4PJOB 2DO3A 1QCNA 4M75B 1UHFA 4C0DB 2MAMA 1NYFA 3RERA 1AT1B 3MEWA 1Q7YR 2J05A 1C6VX 3H0HA 2RH2A 2JTFA 3CCLT 3KFVA 4MZPA 5GAOm 1HXDA 1NPPA 3F70A 5ECAA 3VS1A 4BB7A 4M7AB 1IXDA 5FROA 1W1FA 5GMKm 2X3WD 3CXCP 1N9SA 1OPKA 3OQ5A 1FX7A 4EIKA 1KQSA 1QP3A 1NE8A 4FYXB 2ZGWA 1RI0A 2KMTA 2EBPA 1UJYA 5KYXA 2KXDA 2J7IA 3QG1A 1IRXA 2LNHB 3P8BB 4AG2C 4F7UF 2CP3A 1JU5C 2E1HA 1MNDA 1VQ5T 2J6KA 1S1NA 1VYTA 3SB2A 3JRZA 2VKNA 2BTTA 2M02A 1KHIA 3M55A 4JJDA 1K9MU 2R5AA 5LL6S 2XU8A 5I11A 3TCJA 4BI4A 4PJLA 5KYNA 2KY9A 2HL3A 4E7JA 1EX4A 3OS5A 2OTJQ 2M0YA 3FLGA 2X35A 3L1AA 2DL4A 3NTHA 4M78D 5KYYB 2KRNA 3MO8A 1YI2T 2ECZA 1X01A 5L23A 2YRCA 2L3SA 2CSQA 3V7CA 3FEOA 3OYHA 1Y57A 3V7SA 2F69A 1XNIA 4J83A 5A2QE 4M78G 2DMOA 5GANe 2XICA 4M78C 2RHXA 1E7OA 3M59A 4KUDK 2KBTA 4IURA 4QVDA 1X2QA 2JXBA 4JS4A 4OB3B 1VQ9A 2P0KA 1K9MR 4AG1C 3OYLA 3VRZA 4HVUA 1UB4A 2YLCA 1VQ7T 9ATCB 2DBKA 3EGXB 3PIOA 2P0QA 2KRMA 2GNCA 3RBBB 3QWYA 2EQIA 1WJSA 4LNPA 1TWBA 4PNOA 1E6GA 1N9RA 3HTRA 3CC2T 5LJ5g 4FM4B 5GAN3 1RACB 3PNWC 3CCMT 1MMGA 2MYSA 4RTXA 2FZCB 3FDRA 3M0SA 3KBGA 2JUFA 5KYWA 5KYUB 2FPDA 1LCKA 5C6SA 1ZSZA 1KFZA 2EGEA 4KH1B 4QW2A 1YFNA 1D3BB 3RDVA 1EFNA 1VQ8A 1O75A 3MP8A 2DEUA 2HBPA 4OVAA 4MZTA 1BIBA 2QAZA 3NTKA 5LJ5j 3JB9I 4Y28E 1X6OA 4EMKA 1IREB 2DILA 2VYTA 4HT9A 1QKWA 1WXTA 1VQMQ 4M77E 4M75A 4EMGA 1V1CA 4ANJA 2XHCA 4MZMA 2NYSA 2K7AA 2BE9B 1NG2A 1Z9QA 2VGNA 3NGPA 3LLRA 3QO3A 1VQ4Q 4AFSC 2GFAA 3G6EQ 4R56A 1LPLA 5KH6A 3A8LB 4OMOA 3A8OB 1UGQB 2NUPA 3FC3A 4M7AA 1FWZA 4N0AC 2DL5A 2C0TA 2CP6A 3JB9G 5IHNA 3JCMP 1I81A 4EPCA 4L59A 2QXFA 5GAMf 1BCOA 4ATOA 1JBMA 4OMQA 4J5YA 1W2BS 3TQ7P 3VUBA 3M0UA 2X4JA 2MF2A 5CAIA 3QWXX 1JJ2S 2D8JA 1YNZA 1WHHA 4XTVA 2HQXA 5AYFA 5GAMd 1OYXA 2KDSA 4BY6B 3C94A 4J9EA 2DETA 2DTHA 4FW2A 2COYA 1I8FA 1H641 2YRVA 1N6AA 2RHYA 2ED1A 3S3NA 1QP2A 2RI5A 2DA9A 3H9NA 1BI1A 2HQHA 4Z8AA 5GAMh 4AFUC 2HCKA 1W6XA 1SRMA 1GCQC 3C12A 3VKIA 2OAWA 1PRLC 1KC8R 4M7DD 1W2BP 5KYYA 5I2MA 2OTJA 2AHJB 1VQLT 3M0QA 1JJ2P 1ZBJA 1VQ5A 3OYMA 2JVVA 1Q95G 1BI2A 2XKOC 1YWPA 4M7DG 1IO6A 1PCXA 5A0DA 1LOJA 2CGHA 2K5FA 2EQMA 4M7DC 1QVGP 1ZA2B 4HCBA 2Y4XA 1ZUYA 3H0FA 3CC7T 2QI2A 2QA4T 1ZLMA 4CC3A 1GRIA 1B3QA 4X1VA 2J6FA 1WDXA 3CCQT 1KQ2A 2GTJA 5IHIA 2HNIA 1VQLQ 4V2SA 2ZZDA 3G4SQ 1X69A 4II1A 3GPLA 3L2QA 2PVDB 2AKLA 2VASA 1G3TA 2K57A 1PM3A 2DXUA 2RA2A 4BE0A 2LZ6B 1UJ0A 4E2FB 4HVWA 2FYKA 2DL3A 3I56T 1Q86C 3CXCA 5GAN5 3M4YA 3OYFA 1CKBA 1Y96B 5I2SA 2QEXQ 1IGQA 2QA4Q 4KGZB 2E3IA 1LVKA 5KYUA 4FL6A 3BDLA 3OW2P 5I22A 3PMTA 3RESA 4RUGA 2A08A 2DTIA 3RNJA 2NLUA 2ZPIB 5CQYA 2O2OA 5D7UA 1ZHIA 3JCMe 2L2PA 1NLPC 5FRMA 3EFSA 2LTOA 3HL8A 2M1HA 2QQBA 1R77A 1TUCA 3VYHB 4F14A 2MPXC 3HFOA 1SRLA 4C92D 1D1AA 4M77B 1W4SA 1QQJA 3KXTA 4DA4A 3I56Q 1NLOC 1M90R 2KK4A 3V8KA 1D1BA 2QQRA 4PLIA 3L42A 2KQWA 4GLMA 5GAN7 2RQTA 3CCMA 4C92G 1RAEB 1WGSA 1VQMA 5CVIA 1IHWA 3CMEQ 4C92C 3WXMB 3DB3A 4J8OA 1NJIU 2DYIA 1VQ6Q 3EH1A 3ULRB 3DLMA 4MMLA 1VQ4A 1YHQQ 2XDDA 1SSFA 2CH4A 3TREA 1BI3A 1YJWQ 2YRDA 2COWA 2A37A 1M1FA 2DL7A 1N8RU 1B34A 2MCNA 3CBPA 3HFNA 2QTXA 1WHJA 1SKUB 1JB0E 1I1JA 1GXIE 2XDBA 1TTHB 1YJ9Q 2AZVA 5GAOn 2HD0A 2CZ1B 5J26A 3DB4A 1A0NB 4TVRA 1AWOA 3ZL7C 4PJJA 5CIUA 3WVDB 2QYZA 4NS5A 4DBRA 4C8QD 5LJ3f 4PJOD 4M75D 2FRWA 1MV3A 1OI1A 1WLPB 3I5SA 2NUZA 3OBWA 4E7LA 2DEQA 2D0QB 2GCXA 2AIRB 2QASA 1Q81R 4C8QG 4PJOG 5LJ3d 3LH0A 1RL2A 2DM1A 2P4RA 1PRMC 1UEBA 4PJOC 5CO7A 4EMHA 2KXCA 1Q82U 5A0LA 1VQKQ 1N8RR 1UDLA 2WSEE 3CPWA 1GBRA 2A3LA 4B9WA 4JRKA 2FRYA 5LJ3h 1NJIC 1OX8A 2A28A 2EGCA 2DVJA 3HPWA 4JDSA 1KJWA 3CBMA 3CEYA 4Z88A 4K11A 1QLYA 1VQ8T 1VYVA 2BE7D 1LJOA 1IB8A 2PUOB 1G5VA 4E7KA 3LWIA 2JZ2A 2DX1A 3X24B 2LC4A 4ME7A 4RCBA 3CCUT 2JMCA 2D8HA 4Z02A 5C0MA 3OYYA 1AOJA 1HJDA 3QUIA 1VQLA 3AT1B 4LD9K 4F7UG 4N0AA 3G4SA 1AEYA 5FW9A 2L0AA 5IN1A 1ZSZB 3CD6Q 2RO0A 1Q82R 3GIBA 1Y96A 2EJFA 4RG2A 1SEMA 2CZ0B 2CSIA 4J9FA 2JM8A 3CXCS 2E12A 3NHNA 2QA4A 4M75F 2X4YA 3PGGA 3CPFA 1K8AR 5GMKe 1UECA 2CP0A 2ZPBB 3X26B 4F04B 3CCUQ 1VQPQ 1I07A 1M5Q1 4QVZA 5FU6C 3V8LA 3GLXA 2YXYA 1M3AA 2V26A 4M77A 4M7AF 5CKEA 2LX7A 2DAQA 4A4FA 3C0CA 3L2RA 1Y0MA 3CCRQ 3L2ZA 3I56A 3OYAA 2VVKA 3DLLA 2EYWA 2F2XA 3V8JA 2LJ1A 3ASKA 2RM4A 1GCQA 2RPNA 2DZ9A 2NUPB 4J9GA 3OS0A 1W2BA 2RMOA 1UGPB 5DLQE 3CMEA 4NOYA 3QBYA 1GCPA 2ZAEA 1JJ2A 1Q7YC 1N5ZA 3CC4Q 3OBYA 1VQ6A 2LQWA 4XU2A 2HQEA 1FXXA 3ZFJA 2YWWA 1QVFS 3CCEQ 2OTJT 2E6ZA 3EAEA 3I35A 3TSWA 1YJWA 2J06A 3INZA 5EC7A 2FG0A 5J3BA 4M78E 1HD3A 4J7IA 1QVGA 1XQHA 3S6WA 2EVRA 5A0GA 2RN8A 4CC4B 2V8IA 2D1XA 2M0OA 2X4WA 5CKDA 4D8DA 1YJ9A 2B86A 3N5BB 4C0ZA 3VS7A 2BUDA 4WF2A 2F1LA 2DXBA 1AZGB 2RHZA 2DK3A 5FU7B 2CZ6B 1R0CB 2KYBA 4RTYA 4XU3A 3E9FA 2EAYA 1PG5B 1NZ9A 4J9IA 2XD0A 1QVFP 1VIFA 3MP1A 1OQKA 1X6GA 2JS0A 3M4GA 1B7TA 5GAMg 1WXUA 1AWXA 2CT3A 1GBQA 2OTLQ 1X43A 2EYQA 2DKGA 1Y71A 1PC0A 2BZYA 3VU3C 3OW2A 3TEEA 1XTDA 2HKQB 3Q1JA 4QVCA 2EW3A 1VQKA 2KGTA 1NEGA 1D0XA 4B6MA 1PD1A 3CPWS 2RB6A 2FVUA 4WTOB 2QQSA 2LRQA 4QQGA 1FYNA 2P84A 5GAMj 2FPEA 2FO0A 5CQXA 2XIDA 2CYZB 5GANf 1WHLA 4JUVA 5L8RE 5FRNA 3TVTA 2RF0A 1TU0B 1JO8A 2DRMA 2ROLA 1H8KA 1BYMA 2KNBB 2DL8A 3MEAA 3J7AF 4XTZA 4J6XA 2XG8D 1K9MC 4RTVA 5GANd 3OYCA 1VQMT 4KGVB 1PNJA 3NPFA 4CI0C 3CPWP 2YHTA 3ME9A 3M9QA 1VQ4T 4XTYA 3G6ET 2V8KA 3JCMW 3CD6A 2JTEA 3CBOA 5GANh 4KBMB 2DXTA 3OYBA 4PJMA 3NTIA 1T3SA 2W0ZA 2RJDA 3CCUA 3JB9H 4LDVA 4LXCA 2Y4YA 3VS0A 5GMKi 1KK7A 1WFWA 2QDLA 2KR3A 2KRSA 4E7HA 5IH2A 3G71Q 4JJCA 5IHKA 1I5LA 4DBQA 3LGFA 4RG8A 4DEXA 3C95A 3QIIA 3L2WA 3CCSQ 3J81E 2CUBA 4C5HA 2JW4A 2E5QA 3PIPA 1PKSA 2ATCB 4LDYA 3CCRA 2A7YA 2L3RA 4E7IA 3IQLA 2X51A 1KC8U 3JCMX 4ELZC 3EG3A 2ENMA 4ZTFA 2HEQA 1B34B 2IG0A 1TH7A 2SEMA 4M78B 3O8VA 2LVMA 1RAGB 2ZPEB 1BU1A 3I55Q 4ZGDB 1QCOA 4BE2A 5CKFA 4LN2A 2K9GA 5KCOA 3CCEA 1WI7A 4J9HA 2HL5C 4M7DE 2EQUA 1JQQA 3RIRA 2DVEA 1MMAA 4RTUA 3TSZA 4L5GA 1B07A 3URGA 3NMZC 2EPDA 1OZ2A 1JEGA 2A36A 2JNGA 2R5MA 1QVGS 4M4ZA 2VXFA 2ZPGB 2RHUA 1ZQ1A 4P5NA 2OJ2A 4FYVB 2O4XB 1UGVA 4DEYA 1BB9A 2EYXA 4BD3A 2QQAA 1VQNQ 5LJ5e 4A4KA 1G3WA 5GAN6 4QKUA 7AT1B 2O01E 3CCJT 2DPPB 3G4ST 1YITQ 2E6NA 4HCZA 2EYYA 3UA7A 2OTLA 2BZXA 1TXQA 3GP8A 3BE3A 2JMAA 2MOXA 3MPUB 1ZBXA 1X6BA 4OGCA 1TUGB 1KC8C 1QWFA 2QEXT 2QG9B 4GLKA 3OW2S 2CREA 4CC7A 1HYOA 4MDWA 3HHTB 3OYEA 1PSEA 2OX7A 2FZGB 1G3YA 3REBB 4BACA 1M90U 2ZCFB 3QDFA 1M9SA 4RTWA 1BBZA 1S72Q 3QJ6A 3CCJQ 2MWOA 1M1GA 3PVLA 4GY5A 1PHTA 2LJ3A 4Z89A 2EKOA 2XMFA 3M0PA 3SWNC 2F5TX 4C92E 3QJYA 2V1RA 4PLLA 2E10A 3MJXA 1Y7XA 5IT9E 1GFDA 4JZ4A 2DFUA 5LJ3j 1SHGA 2QDYB 1MNEA 3VJPA 2KVQG 2KAFA 3G1JA 4M77F 2HSEB 3H6ZA 3CMET 1QKXA 5CR2A 3OY9A 1VQ6T 2LDMA 1K1ZA 1NPRA 1YHQT 2WSFE 1T3LA 2VGMA 3JCMV 1YIJQ 1YJWT 2G6FX 1ABQA 3FIFA 3JCMJ 4Y92A 5CCAA 4D8KA 3C4SA 2IPOB 1NBEB 3JCMf 4ORZA 1G8XA 1YJ9T 4HVVA 1AWWA 2NUTB 1K76A 3JAME 3OS2A 4OMMA 1I0CA 2MMPA 1QVFA 3A8GB 4XTWA 2DNUA 4FYWB 4IKFA 1Q81U 4WCIA 4KT0E 2RQVA 3GBQA 4A4EA 3JCMd 3G6EA 3UPUA 1M90C 4C8QE 4CC2A 4PJOE 3A1PA 5CK9A 4XTXA 1AZEA 1D09B 1K0XA 2VB6A 3VS6A 4BI8B 3ER0A 1UGSB 4DQ2A 1OU8A 4XK8E 1QCFA 2EJ9A 4M7DB 1ZUKA 1WJRA 4M78A 1WNLA 2CZ7B 4B9XA 3JCMh 1ACMB 3M56A 4OGEA 2K2VA 3L2UA 1J3TA 2ABLA 2HKNA 2F2WA 4LDXA 2E70A 1RAAB 4JLIA 4C0GA 1EZZB 4DOWA 1VQKT 3L2VA 1U1TA 1EIFA 1ZSGA 3LYIA 1VQOT 2LQKA 1ARKA 1QVPA 4C5IA 4RTTA 4XTUA 4DOVA 2I2LA 2QGGA 4GBQA 1CSKA 2COZA 2IVWA 5GJVB 2ESWA 1RAIB 3META 4D6WA 3SHWA 4A4HA 3S3OA 2X9HA 2GQVA 4N4IA 3O5ZA 5DLOA 3H41A 3AHUA 2O4XA 3VRYA 1ABOA 4EMKC 5KCHA 1D1CA 4FSSA 4M75G 4M7AD 1AD5A 3HRUA 4C8QC 5EG2A 4M75C 2DERA 4J9CA 4F7UE 2O88A 3LGLA 4C0DC 3MHXA 5GMKj 4XAXB 4VUBA 1WX6A 4AFZC 2EJGA 1VQOQ 4FW1A 1KD1R 2KSSA 5GAN8 2V1QA 4QT7A 4M7AG 2YDLA 2YLBA 1K8AU 1Q81C 3U23A 1YITA 2YUNA 3PTAA 4M7AC 4AT1B 2L3QA 1MMNA 3CD6T 2VWFA 2XDPA 2RD1A 8ATCB 2XK0A 3UA6A 2PVOB 1IGUA 1KQ1A 3FB9A 5GAN4 4F17A 1K73R 3VUZA 1ZA1B 2MIOA 1N8RC 4ZGJB 1OEBA 2NWMA 1RUWA 1VQ9Q 5D6YA 5GAOq 3T9NA 1MUZA 1YJNQ 4C92B 4J6WA 4R55A 1VQPT 2YUOA 1KG1A 2R58A 1D0ZA 3BDUA 1U5SA 1U8RA 3EH2A 4JJBA 1YP5A 3CCJA 1UUEA 2KE9A 2DIGA 4E7SA 1M1KR 5D6WA 3EHQA 1AWJA 2QQ9A 3CCRT 4ZN3A 1SPKA 5KE3A 2CP2A 2QEXA 3PMIA 2HAXA 4LUDA 1QW1A 2K79A 1OULA 3OYIA 2CUDA 1ZX6A 4HT8A 3QXEB 3E1SA 1SF9A 3QYGB 3CC4T 1Q82C 4DBFA 3QKJA 3CCET 3OS1A 3HRTA 4KUIA 3RMSA 3CCVQ 1NM7A 1WHMA 3QYHB 1K8AC 2W10A 1AHJB 3QHSA 4J6YA 4RTZA 4FYYB 3A8HB 3JSCA 2NUTA 1M3BA 3UWNA 2H8HA 4J9BA 1JRIA 2LJ0A 4EDUA 1T0JA 1Z9ZA 2MWPA 1MHNA 3CMAQ 5FWCA 2BKDN 1X27A 2GFUA 1UG1A 4ZGEB 1I4K1 5GANj 4BE1A 2XI9A 2O9VA 2O9SA 5CKHA 3M0TA 4FT4A 3FRNA 3V7RA 4RKUE 2F2VA 1YHQA 2PTKA 4ZNXA 2CH4W 1UHCA 5J39A 4FU6A 2GGRA 1FMVA 2ED0A 4AMCA 2C0IA 2LX9A 4M7DA 3JCMc 2RK2A 2LCCA 4Y91A 5GMKh 2DF6A 4ZTJA 1PSFA 3EFRA 3PVQA 2OTLT 5M9OA 2RI3A 3OYDA 1M8VA 3OB9A 2K4YA 4XU0A 2H3EB 3M53A 2L89A 5DY9A 1UTIA 3BY7A 6AT1B 1M2VB 1GL5A 1E6HA 1TSFA 1OOTA 4FCYA 1G3SA 2KT1A 4E7ZA 2O31A 3CCLQ 2Y90A 2GTOA 3P8HA 3SWNA 3VS5A 2JT4A 4XU1A 1IZ6A 3EFOB 4F7UB 5GAOp 5GAOl 4PK4A 2QK0A 3EGDA 1C0MA 1SG5A 3EG0A 3QZ9B 2V8JA 5HY6A 5GMKl 1VOMA 3M54A 3I9QA 4MMKA 4PKCC 2VXEA 2AZSA 4DBHA 2EIFA 4KH0B 2R57A 1TOVA 3QDRB 2FZKB 4JRPA 2DRKA 1VQ5Q 3VYGA 1U1SA 5FU6B 1OU9A 1VQOA 2A0FB 2X3XD 1QMCA 1D0YA 3UT1A 3LH5A 2JM9A 4LDWA 1BIAA 3A8MB 2ZPFB 3BW1A 2RQRA 5AT1B 1WQWA 5HK0A 2DTOA 1HK9A 2LT1A 3SEMA 2JN0A 4C92A 1G83A 4FSXA 1WPYA 3R6OA 4C5EA 1RAFB 1XJWB 2QGFB 1RAHB 2M51A 2RQWA 1OZ3A 1YJNA 4KULA 1YI2Q 4BY6C 2CKKA 2D0NA 1JXMA 2FB7A 1T0HA 1YCYA 3G71T 2E5KA 2LT4A 3E2UA 3OSVA 1WIEA 4IIMA 2L3PA 3EG9B 3CCST 2B8AA 2D9TA 3GNFB 2EWNA 2JTMA 4OP0A 1F1BB 1YN8A 4OB2B 2C0OA 2CP7A 2RJEA 3MP6A 8AT1B 2DJQA 5D6XA 3J80E 3A5ZB 3EG2A 3H0IA 3RKXA 2WSCE 1VQ7Q 1VQPA 1K0SA 2EYZA 2PVGB 4OMPA 3I55T 3QSUA 4QQDA 4E6RA 1M27C 3FJPA 2HDAA 4LE9A 3UF4A 3CCVA 3CC2Q 2CT4A 4X9DA 2E41A 2L5QA 3HP9A 2EKHA 2KROA 3CCMQ 4M78F 5HK3A 4C8QA 2LCSA 4PJOA 1WHKA 2PQWA 4C5GA 4A63B 3JB9D 4OMNA 4A4GA 5GAMe 1R8OB 3CMAA 2JS2A 2K3YA 3FJ5A 3R6NA 2F5KA 1Y07A 1O9SA 4NL2A 5IXFA 3CC4A 1VQNT 4MDXA 1W70A 4JJNK 2LQNA 3PE0A 3JCMg 4M77D 1YITT 1XOVA 2FHDA 5FWBA 2JJ9A 4IUTA 1VA7A 3VS2A 1KQSS 1G2BA 1M2VA 3UATA 1PD0A 3GF5A 1OPLA 3BFMA 2DD4A 3ZEHA 4M77G 1YWOA 2CDTA 1HSQA 2VV5A 4M77C 2E4HA 1Q86U 4F7UA 3EFOA 3CCLA 4IIOA 1BI0A 4HA8A 2IIMA 2PZ1A 3GOXA 4PFZA 2PU9B 4JRIA 1S72T 2LCLA 2RJCA 4A54A 2EQKA 3GNGA 3THKA 4R0KA 1SHFA 1TG0A 2L8DA 3MCAB 2HBWA 4IUUA 2OAUA 1KQSP 5LJ5f 2M16A 3SDZA 5LJ3g 2HZYA 2DD5A 2MK5A 3RMQA 2DXCA 2C06A 2FL7A 1C1AA 5GAN2 4Q5WA 1IHVA 2BIVA 5LJ5d 4ESRA 3H8ZA 3JB9F 2WACA 4AFQC 3P8DA 4XQ3A 1H3ZA 4PJNA 2YUPA 5GAOr 1V29B 1V76A 1YIJT 2YSQA 1Q86R 2DIQA 3X25B 5KE2A 3HKSA 5CKBA 2AT1B 5LJ5h 3OYJA 3ZBDA 2PNIA 3EGXA 3X28B 1MV0B 5DM7R 1YI2A 4IUQA 2AKKA 2HSPA 1P92A 3VS4A 3JCMQ 4OMFB 5IXBA 4HCKA 1U06A 4OMLA 3EG9A 3I5RA 2P4TA 1FMWA 4C0FA 3CC7Q 1N27A 3MEUA 2JOYA 2KI7A 4ELYC 4JZ3A 2EFIA 2K5LA 3JB9J 2K3BA 3E19A 1WXBA 2VUBA 4N4HA 3CCQQ 1D3BA 4BI3A 4O6JA 1GFCA 4NL3A 2DZCA 1VQ7A 3OMCA 1U3OA 2Z0WA 4IUVA 2RI2A 1K4US 4OB1B 1WZOA 2DBMA 2DJZA 1WQ7A 2KT8A 4OF1A
chains in the Genus database with same CATH topology
1XTDA 3Q1JA 4QVCA 2QQ9A 2X4XA 3G7ZA 4IUPA 3G71A 4M7DF 3M57A 4XTVA 3CCRT 2HQXA 5AYFA 4ZN3A 5GAMd 5KE3A 1OYXA 2KDSA 4BY6B 1VQKA 3C94A 3CC2A 2LNVA 3CCSA 2DTHA 4M75E 4X9CA 1I8FA 1H641 2QEXA 3PMIA 2HAXA 2YRVA 1N6AA 2RHYA 1QW1A 3CPWS 2LQ8A 2RB6A 4LD6A 3S3NA 1QP2A 2FVUA 2K5IA 2QQSA 2RI5A 3OYIA 3HSBA 2LRQA 4QQGA 3RKWA 4HT8A 5GAMj 3QXEB 1BI1A 3S3MA 1KD1U 5CQXA 2ZPHB 3E1SA 2XIDA 2CYZB 5GAMh 5GANf 4JUVA 5I21A 3QYGB 3CC4T 5L8RE 1Q82C 5FRNA 3QKJA 3CCET 4M7AE 3OS1A 3C12A 3VKIA 3HRTA 4KUIA 1DJ7B 3RMSA 3OA6A 3I55A 4M7DD 3DKMA 1BYMA 3MEAA 3QYHB 5I2MA 1K73U 1K8AC 3J7AF 2OTJA 1AHJB 4XTZA 3QHSA 5LJ3e 2AHJB 4J6XA 1VQLT 4J6YA 2XG8D 4JLGA 1K9MC 1KHCA 1VQ5A 3A8HB 3JSCA 4A53A 5GANd 3OYMA 3OYCA 2JVVA 1VQMT 1BI2A 3UWNA 3X20B 2XKOC 3HRSA 1VUBA 3OSSC 4J7FA 1JRIA 3JCMb 1X75C 4RMOA 3SWNB 4M7DG 4EDUA 2MWPA 1MHNA 4JS5A 4CRIA 4CI0C 5A0DA 1LOJA 2BKDN 2GFUA 2YHTA 2CGHA 3ME9A 2K5FA 2EQMA 3M9QA 4ZGEB 1VQ4T 4M7DC 4XTYA 4HCCA 1I4K1 3G6ET 5GANj 2RJFA 4HCBA 2V8KA 2Y4XA 3JCMW 3CD6A 4BE1A 2P0PA 2XI9A 3CC7T 2QI2A 5CKHA 3CBOA 5GANh 4FT4A 2QA4T 3FRNA 3V7RA 4RKUE 4KBMB 3OYKA 1YHQA 1VQ9T 1VIEA 2E64A 1M1KU 5J39A 2DXTA 3OYBA 4FU6A 1YJNT 4FT2A 1VQNA 3TEEA 2LX9A 4M7DA 3NTIA 3JCMc 3CCQT 1KQ2A 2RK2A 2RJDA 2LCCA 1WJQA 2HNIA 4Y91A 5GMKh 4JRQA 4ZTJA 1PSFA 4V2SA 3EFRA 2ZZDA 2OTLT 5M9OA 3CCUA 1LNXA 4LDVA 3JB9H 2RI3A 2Y4YA 3OYDA 1M8VA 3OB9A 4II1A 5GMKi 2PUKB 3GPLA 2K4YA 3RUXA 3L2QA 4X34A 2PVDB 4XU0A 1G3TA 2K57A 3M53A 2L89A 5DY9A 4RCCA 2DXUA 2RA2A 4BE0A 2G3RA 2RHIA 4E7HA 3BY7A 3MEVA 3LW5E 2FYKA 4C92F 3I56T 4OB0B 1I5LA 3WVEB 1Q86C 3CXCA 5GAN5 3LGFA 3M4YA 4RG8A 2CS7A 3C95A 3QIIA 3L2WA 1G3SA 3OYFA 4FIBA 3J81E 1Y96B 5I2SA 4C5HA 2E5QA 3PIPA 4LDYA 3CCRA 2A7YA 2L3RA 2Y90A 4E7IA 1KD1C 4FL6A 3BDLA 1KC8U 3P8HA 2H3JA 2K3XA 3SWNA 3PMTA 3RESA 4XU1A 4BUGA 5IAYA 4ELZC 1IZ6A 4F7UB 3JCMX 5GAOp 5GAOl 2DTIA 2VC8A 2NLUA 2ZPIB 3QPHA 5CQYA 3QZ9B 3OYNA 1ZHIA 3JCMe 4ZTFA 2V8JA 5HY6A 1B34B 2RK1A 5FRMA 3EFSA 5GMKl 4BDYA 2IG0A 2LTOA 3HL8A 1TH7A 2M1HA 2QQBA 3M54A 4MMKA 3M5AA 4M78B 4PKCC 2VXEA 3O8VA 1S72A 2LVMA 3OMGA 3VYHB 4ZN1A 2M9UA 1K73C 2ZPEB 3HFOA 2EIFA 4PL6A 4C92D 4ZGDB 4M77B 4BE2A 1W4SA 3CCVT 4LDUA 5CKFA 4YTLA 3TU4K 2R57A 4QQ6A 5FLXE 5KCOA 3NFCA 3QDRB 3KXTA 3CCEA 4DA4A 3OYGA 1Q7YU 2EQJA 4M7DE 3SFMA 1M4ZA 2EQUA 3RIRA 2KK4A 4JRPA 3V8KA 2DVEA 3E9GA 5FU7C 4UC4A 2QQRA 4L5GA 4L6V5 4PLIA 3L42A 3VYGA 1U1SA 5FU6B 1VQOA 2KQWA 3URGA 5GAN7 3CCMA 1OZ2A 4C92G 1WGSA 3QZ5B 4N4GA 3VV0A 1VQMA 3LWHA 2JNGA 2R5MA 5CVIA 1QVGS 4O5VA 4C92C 3CMAT 2VXFA 3RKYA 3WXMB 3PT9A 2ZPGB 3DB3A 4J8OA 2RHUA 1NJIU 3UT1A 4HKEA 1ZQ1A 1M1KC 4LDWA 2MI6A 4P5NA 5GANg 1BIAA 3DLMA 3A8MB 3M58A 2O4XB 4MMLA 2ZPFB 3BW1A 1YBYA 1VQ4A 2XDDA 1SSFA 4BD3A 1WQWA 5HK0A 3TREA 2DTOA 4BDZA 1HK9A 3CC7A 2LT1A 1BI3A 4C8QF 2QQAA 4PJOF 2D6FA 2JN0A 1MGQA 1M1FA 4C92A 2GF7A 3SD4A 2E65A 4E47A 4FSXA 5LJ5e 4A4KA 1G3WA 1WPYA 3R6OA 4C5EA 3KUFA 5GAN6 1BKBA 1N8RU 1B34A 1OZ3A 1UGRB 2O01E 3CBPA 4KULA 1YJNA 3UDCA 5HKCA 3HFNA 2QTXA 4BY6C 3CCJT 3CCQA 2DPPB 1JB0E 4EMKB 3G4ST 1GXIE 2CKKA 3PFSA 2E6NA 2XDBA 4HCZA 2FB7A 2OTLA 4C8QB 5GAOn 3LX7A 2HD0A 3GP8A 2DO3A 4PJOB 4M75B 2CZ1B 4C0DB 1YCYA 1ZBXA 5J26A 3DB4A 3G71T 2MAMA 3RERA 4TVRA 2LT4A 3MEWA 3OSVA 4OGCA 5CIUA 3WVDB 1KC8C 4NS5A 3CCST 2B8AA 2D9TA 3GNFB 2RH2A 4C8QD 2EWNA 2JTMA 2JTFA 4OP0A 5LJ3f 4GLKA 4M75D 2QEXT 4OB2B 3CCLT 3OW2S 4MZPA 1OI1A 5GAOm 4MDWA 3HHTB 1HXDA 1NPPA 3F70A 2RJEA 3OYEA 3MP6A 1PSEA 5D6XA 4BB7A 3A5ZB 4M7AB 3J80E 3OBWA 5FROA 4E7LA 5GMKm 2DEQA 1G3YA 4BACA 2D0QB 1M90U 1N9SA 2GCXA 2ZCFB 3OQ5A 1FX7A 1M9SA 1KQSA 1QP3A 3RKXA 3QJ6A 1NE8A 2ZGWA 5CAIA 1RI0A 2WSCE 1VQPA 4C8QG 2MWOA 1M1GA 2KMTA 4PJOG 4GY5A 5LJ3d 3LH0A 4PJOD 1RL2A 2PVGB 3I55T 1UEBA 2EKOA 3QG1A 3QSUA 4PJOC 4QQDA 5CO7A 3SWNC 2F5TX 4C92E 3QJYA 3FJPA 3P8BB 4F7UF 4EMHA 4PLLA 2E10A 3CCVA 1Q82U 2E1HA 1Y7XA 5A0LA 5IT9E 4X9DA 2WSEE 2E41A 1VQ5T 2L5QA 3HP9A 3CPWA 5LJ3j 2A3LA 4B9WA 4JRKA 2QDYB 4M78F 5HK3A 3SB2A 3VJPA 2KVQG 3JRZA 4C8QA 5LJ3h 1NJIC 4PJOA 2KAFA 3HPWA 4JDSA 4M77F 3H6ZA 2PQWA 3CBMA 1KHIA 3M55A 3CMET 4C5GA 3CEYA 3JB9D 2R5AA 5LL6S 4A4GA 1K9MU 5GAMe 2XU8A 5CR2A 1R8OB 1VQ8T 3OY9A 3TCJA 3CMAA 1VQ6T 1LJOA 4BI4A 2LDMA 2K3YA 2KY9A 1NPRA 2F5KA 1YHQT 1Y07A 2PUOB 1G5VA 4E7KA 1O9SA 2WSFE 2VGMA 4NL2A 3JCMV 4E7JA 3LWIA 1YJWT 3CC4A 1VQNT 2JZ2A 3FIFA 3OS5A 3JCMJ 3FLGA 4MDXA 2X35A 3L1AA 3NTHA 3X24B 2LC4A 4ME7A 4M78D 5CCAA 4RCBA 3CCUT 4Z02A 4JJNK 3C4SA 5C0MA 3OYYA 3MO8A 1YI2T 1X01A 1YIJA 3JCMf 3JCMg 3QUIA 4M77D 1YITT 1VQLA 1XOVA 4LD9K 2FHDA 4F7UG 1YJ9T 3V7CA 3FEOA 4IUTA 3OYHA 4N0AA 3JAME 3OS2A 3G4SA 1KQSS 3V7SA 2F69A 1XNIA 2MMPA 4J83A 5IN1A 3GF5A 5A2QE 3BFMA 3A8GB 1QVFA 4M78G 2RO0A 4XTWA 5GANe 4IKFA 2XICA 1Q81U 3GIBA 1Y96A 2DD4A 2EJFA 4KT0E 4RG2A 3ZEHA 4M78C 2CZ0B 2RHXA 4M77G 4A4EA 3JCMd 3G6EA 3M59A 3UPUA 1M90C 4C8QE 2VV5A 4KUDK 4PJOE 5CK9A 4M77C 4XTXA 4IURA 4QVDA 3CXCS 2E12A 4F7UA 1Q86U 2QA4A 1BI0A 2X4YA 3PGGA 3CPFA 4HA8A 4M75F 3CCLA 4JS4A 5GMKe 3X26B 2ZPBB 3ER0A 4OB3B 4BI8B 1VQ9A 2P0KA 3OYLA 3GOXA 1UGSB 4DQ2A 4XK8E 2EJ9A 1UB4A 1S72T 2PU9B 4JRIA 4M7DB 1WJRA 4M78A 1WNLA 1M5Q1 2YLCA 1VQ7T 2LCLA 2CZ7B 4QVZA 5FU6C 3V8LA 3GLXA 2RJCA 4B9XA 2P0QA 3JCMh 4A54A 3PIOA 3M56A 2EQKA 3GNGA 4M77A 4OGEA 2K2VA 3L2UA 2L8DA 3MCAB 4IUUA 1WJSA 4LDXA 4M7AF 2E70A 2OAUA 5CKEA 4JLIA 2DAQA 4A4FA 4PNOA 4C0GA 1N9RA 4DOWA 1VQKT 5LJ5f 3L2VA 5LJ5g 1U1TA 1EIFA 3CC2T 2M16A 4FM4B 3SDZA 5GAN3 3L2RA 3LYIA 1VQOT 2LQKA 3PNWC 3L2ZA 1QVPA 3OYAA 3I56A 4C5IA 5LJ3g 3CCMT 4XTUA 3DLLA 2DD5A 3RMQA 2I2LA 4DOVA 2DXCA 2C06A 3V8JA 3FDRA 3ASKA 2RM4A 2FL7A 3KBGA 2JUFA 2DZ9A 2IVWA 3META 4D6WA 5C6SA 3OS0A 5GAN2 4QW2A 4Q5WA 1UGPB 5DLQE 1W2BA 4A4HA 3CMEA 3S3OA 2BIVA 2GQVA 4N4IA 5LJ5d 4NOYA 3QBYA 3H8ZA 1D3BB 5DLOA 3AHUA 2O4XA 3JB9F 2WACA 4EMKC 3P8DA 4XQ3A 5KCHA 4M75G 1Q7YC 1JJ2A 1VQ8A 1H3ZA 1O75A 3OBYA 4M7AD 1VQ6A 4XU2A 2HQEA 3HRUA 4C8QC 1FXXA 3ZFJA 3MP8A 5EG2A 1V29B 5GAOr 4M75C 1YIJT 1QVFS 4F7UE 2HBPA 4OVAA 3LGLA 4C0DC 2OTJT 2DIQA 2E6ZA 3MHXA 4MZTA 3X25B 1BIBA 3EAEA 3NTKA 5KE2A 5GMKj 5LJ5j 3JB9I 4XAXB 3HKSA 3INZA 1YJWA 4VUBA 4Y28E 2EJGA 5CKBA 5J3BA 1X6OA 4M78E 4EMKA 5LJ5h 3ZBDA 3OYJA 1IREB 4J7IA 3X28B 2VYTA 1XQHA 3S6WA 1QVGA 5A0GA 4HT9A 2KSSA 5DM7R 5GAN8 1YI2A 4M7AG 4M77E 4M75A 2V8IA 2M0OA 2X4WA 4IUQA 2YLBA 1K8AU 1P92A 4EMGA 5CKDA 1YITA 1Q81C 3PTAA 4M7AC 2XHCA 4MZMA 3JCMQ 1YJ9A 4OMFB 3N5BB 4C0ZA 2BUDA 2VGNA 3LLRA 3CD6T 4WF2A 2XDPA 3QO3A 2RD1A 2XK0A 2GFAA 2PVOB 5GAN4 1KQ1A 3FB9A 2DXBA 2P4TA 2RHZA 3VUZA 2DK3A 4R56A 5FU7B 5KH6A 3A8LB 4C0FA 2CZ6B 3A8OB 1UGQB 1N27A 1N8RC 4ZGJB 3MEUA 2JOYA 4ELYC 3FC3A 4M7AA 1FWZA 4XU3A 4N0AC 3E9FA 5D6YA 2EAYA 5GAOq 1NZ9A 2EFIA 3T9NA 2K5LA 3JB9J 2XD0A 1VIFA 3JCMP 3JB9G 1I81A 3MP1A 4EPCA 4C92B 3E19A 4J6WA 4R55A 2VUBA 3M4GA 4L59A 4N4HA 1VQPT 1D3BA 2QXFA 5GAMf 5GAMg 4BI3A 4ATOA 2R58A 4O6JA 1KG1A 3BDUA 2EYQA 1JBMA 2DKGA 1U8RA 4NL3A 2DZCA 4J5YA 3OMCA 3CCJA 1Y71A 1VQ7A 1W2BS 4IUVA 2RI2A 4OB1B 3VUBA 2DIGA 2DJZA 3VU3C 3OW2A 1WQ7A 2X4JA 2MF2A 1JJ2S 4OF1A 5D6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HK3 A;  1X75 C;  3NFC A;  3JRZ A;  3G7Z A;  4MDX A;  1NE8 A;  4ME7 A;  5CCA A;  3HPW A;  4ELZ C;  5HK0 A;  5DLO A;  2KMT A;  5CKE A;  5CKD A;  2VUB A;  5CK9 A;  5CQY A;  4MZM A;  1M1F A;  5CKH A;  5CR2 A;  5CO7 A;  3TCJ A;  4MZP A;  5HKC A;  2C06 A;  4MZT A;  1UB4 A;  1VUB A;  3JSC A;  3VUB A;  4VUB A;  5CKF A;  5CQX A;  4HKE A;  5CKB A;  2MF2 A;  4OF1 A;  4ELY C; 
#chains in the Genus database with same CATH topology
 1SSH A;  2GBQ A;  2X4X A;  4IUP A;  3G7Z A;  3G71 A;  4M7D F;  3M57 A;  2K2M A;  3CC2 A;  2LNV A;  3CCS A;  4M75 E;  4X9C A;  1WYX A;  1CKA A;  4J9D A;  2RNA A;  1NYG A;  2FEI A;  1PWT A;  2LQ8 A;  2QTV A;  2AK5 A;  4LD6 A;  2K5I A;  3EG1 A;  3HSB A;  3RKW A;  3EGU A;  3S3M A;  1K9A A;  1KD1 U;  2ZPH B;  5I21 A;  1MMD A;  4M7A E;  1M8M A;  5KYX B;  1R0B G;  2FPF A;  1DJ7 B;  5HCK A;  3OA6 A;  3I55 A;  2EGA A;  1M30 A;  3DKM A;  3EHR A;  1ZSZ C;  1K73 U;  2I0N A;  1FMK A;  5LJ3 e;  2K6D A;  1M2O A;  1UE9 A;  1H92 A;  4JLG A;  1KHC A;  4A53 A;  3X20 B;  3HRS A;  1VUB A;  3OSS C;  2CP5 A;  4J7F A;  2BZ8 A;  3JCM b;  1BCM A;  1X75 C;  3SWN B;  4PFP A;  4RMO A;  4JS5 A;  4CRI A;  3EGD B;  4HCC A;  2DYB A;  1KIK A;  2RJF A;  2LMJ A;  1TS9 A;  2P0P A;  2SRC A;  3OYK A;  1VQ9 T;  1VIE A;  2YUQ A;  2E64 A;  1M1K U;  1BK2 A;  1RAB B;  1RI9 A;  1YJN T;  4FT2 A;  1VQN A;  2RQU A;  1UFF A;  1WJQ A;  1NJI R;  4JRQ A;  1LNX A;  1VYU A;  3MKD A;  4PFO A;  1WHG A;  2PUK B;  4KRT A;  3RUX A;  4X34 A;  4RCC A;  2G3R A;  3VS3 A;  1PKT A;  2RHI A;  3MEV A;  3LW5 E;  4C92 F;  1ZUU A;  4OB0 B;  2OI3 A;  3WVE B;  2KYM A;  1QWE A;  2CS7 A;  3JV3 A;  4FIB A;  3M0R A;  1NEB A;  1KD1 C;  2H3J A;  2K3X A;  1OV3 A;  5IAY A;  4BUG A;  2VC8 A;  1OX9 A;  3A98 A;  3QPH A;  1RLQ C;  5GJW B;  3OYN A;  1M3C A;  1AVZ C;  2RK1 A;  4BDY A;  4QQ6 A;  3M5A A;  1S72 A;  1TUD A;  3OMG A;  4ZN1 A;  2M9U A;  1K73 C;  1KSW A;  1WA7 A;  4PL6 A;  3CCV T;  4LDU A;  4YTL A;  3TU4 K;  1X2K A;  2E3H A;  5FLX E;  3NFC A;  3OYG A;  1Q7Y U;  2EQJ A;  3SFM A;  1M4Z A;  2HMA A;  3E9G A;  5FU7 C;  4UC4 A;  2DLP A;  2KEA A;  4L6V 5;  1RAD B;  4F16 A;  2LP5 A;  3QZ5 B;  4N4G A;  3VV0 A;  3LWH A;  5KYW B;  1I5O B;  4O5V A;  4KGX B;  3CMA T;  3RKY A;  3PT9 A;  4JPB W;  4HKE A;  1YCS B;  1VQ8 Q;  3D7S B;  1M1K C;  2MI6 A;  2YT6 A;  2DE0 X;  5GAN g;  3M58 A;  1YBY A;  2GQI A;  4BDZ A;  4HXJ A;  3CC7 A;  4C8Q F;  3CQT A;  3RR6 A;  4PJO F;  3REA B;  4LUE A;  2D6F A;  1MGQ A;  2GF7 A;  2ROT A;  2E65 A;  3SD4 A;  4E47 A;  1YIJ A;  3KUF A;  1BKB A;  1JXO A;  1UGR B;  3UDC A;  5HKC A;  3CCQ A;  4EMK B;  1H3H A;  3PFS A;  2J6O A;  4C8Q B;  1RLP C;  3LX7 A;  4PJO B;  2DO3 A;  1QCN A;  4M75 B;  1UHF A;  4C0D B;  2MAM A;  1NYF A;  3RER A;  1AT1 B;  3MEW A;  1Q7Y R;  2J05 A;  1C6V X;  3H0H A;  2RH2 A;  2JTF A;  3CCL T;  3KFV A;  4MZP A;  5GAO m;  1HXD A;  1NPP A;  3F70 A;  5ECA A;  3VS1 A;  4BB7 A;  4M7A B;  1IXD A;  5FRO A;  1W1F A;  5GMK m;  2X3W D;  3CXC P;  1N9S A;  1OPK A;  3OQ5 A;  1FX7 A;  4EIK A;  1KQS A;  1QP3 A;  1NE8 A;  4FYX B;  2ZGW A;  1RI0 A;  2KMT A;  2EBP A;  1UJY A;  5KYX A;  2KXD A;  2J7I A;  3QG1 A;  1IRX A;  2LNH B;  3P8B B;  4AG2 C;  4F7U F;  2CP3 A;  1JU5 C;  2E1H A;  1MND A;  1VQ5 T;  2J6K A;  1S1N A;  1VYT A;  3SB2 A;  3JRZ A;  2VKN A;  2BTT A;  2M02 A;  1KHI A;  3M55 A;  4JJD A;  1K9M U;  2R5A A;  5LL6 S;  2XU8 A;  5I11 A;  3TCJ A;  4BI4 A;  4PJL A;  5KYN A;  2KY9 A;  2HL3 A;  4E7J A;  1EX4 A;  3OS5 A;  2OTJ Q;  2M0Y A;  3FLG A;  2X35 A;  3L1A A;  2DL4 A;  3NTH A;  4M78 D;  5KYY B;  2KRN A;  3MO8 A;  1YI2 T;  2ECZ A;  1X01 A;  5L23 A;  2YRC A;  2L3S A;  2CSQ A;  3V7C A;  3FEO A;  3OYH A;  1Y57 A;  3V7S A;  2F69 A;  1XNI A;  4J83 A;  5A2Q E;  4M78 G;  2DMO A;  5GAN e;  2XIC A;  4M78 C;  2RHX A;  1E7O A;  3M59 A;  4KUD K;  2KBT A;  4IUR A;  4QVD A;  1X2Q A;  2JXB A;  4JS4 A;  4OB3 B;  1VQ9 A;  2P0K A;  1K9M R;  4AG1 C;  3OYL A;  3VRZ A;  4HVU A;  1UB4 A;  2YLC A;  1VQ7 T;  9ATC B;  2DBK A;  3EGX B;  3PIO A;  2P0Q A;  2KRM A;  2GNC A;  3RBB B;  3QWY A;  2EQI A;  1WJS A;  4LNP A;  1TWB A;  4PNO A;  1E6G A;  1N9R A;  3HTR A;  3CC2 T;  5LJ5 g;  4FM4 B;  5GAN 3;  1RAC B;  3PNW C;  3CCM T;  1MMG A;  2MYS A;  4RTX A;  2FZC B;  3FDR A;  3M0S A;  3KBG A;  2JUF A;  5KYW A;  5KYU B;  2FPD A;  1LCK A;  5C6S A;  1ZSZ A;  1KFZ A;  2EGE A;  4KH1 B;  4QW2 A;  1YFN A;  1D3B B;  3RDV A;  1EFN A;  1VQ8 A;  1O75 A;  3MP8 A;  2DEU A;  2HBP A;  4OVA A;  4MZT A;  1BIB A;  2QAZ A;  3NTK A;  5LJ5 j;  3JB9 I;  4Y28 E;  1X6O A;  4EMK A;  1IRE B;  2DIL A;  2VYT A;  4HT9 A;  1QKW A;  1WXT A;  1VQM Q;  4M77 E;  4M75 A;  4EMG A;  1V1C A;  4ANJ A;  2XHC A;  4MZM A;  2NYS A;  2K7A A;  2BE9 B;  1NG2 A;  1Z9Q A;  2VGN A;  3NGP A;  3LLR A;  3QO3 A;  1VQ4 Q;  4AFS C;  2GFA A;  3G6E Q;  4R56 A;  1LPL A;  5KH6 A;  3A8L B;  4OMO A;  3A8O B;  1UGQ B;  2NUP A;  3FC3 A;  4M7A A;  1FWZ A;  4N0A C;  2DL5 A;  2C0T A;  2CP6 A;  3JB9 G;  5IHN A;  3JCM P;  1I81 A;  4EPC A;  4L59 A;  2QXF A;  5GAM f;  1BCO A;  4ATO A;  1JBM A;  4OMQ A;  4J5Y A;  1W2B S;  3TQ7 P;  3VUB A;  3M0U A;  2X4J A;  2MF2 A;  5CAI A;  3QWX X;  1JJ2 S;  2D8J A;  1YNZ A;  1WHH A;  4XTV A;  2HQX A;  5AYF A;  5GAM d;  1OYX A;  2KDS A;  4BY6 B;  3C94 A;  4J9E A;  2DET A;  2DTH A;  4FW2 A;  2COY A;  1I8F A;  1H64 1;  2YRV A;  1N6A A;  2RHY A;  2ED1 A;  3S3N A;  1QP2 A;  2RI5 A;  2DA9 A;  3H9N A;  1BI1 A;  2HQH A;  4Z8A A;  5GAM h;  4AFU C;  2HCK A;  1W6X A;  1SRM A;  1GCQ C;  3C12 A;  3VKI A;  2OAW A;  1PRL C;  1KC8 R;  4M7D D;  1W2B P;  5KYY A;  5I2M A;  2OTJ A;  2AHJ B;  1VQL T;  3M0Q A;  1JJ2 P;  1ZBJ A;  1VQ5 A;  3OYM A;  2JVV A;  1Q95 G;  1BI2 A;  2XKO C;  1YWP A;  4M7D G;  1IO6 A;  1PCX A;  5A0D A;  1LOJ A;  2CGH A;  2K5F A;  2EQM A;  4M7D C;  1QVG P;  1ZA2 B;  4HCB A;  2Y4X A;  1ZUY A;  3H0F A;  3CC7 T;  2QI2 A;  2QA4 T;  1ZLM A;  4CC3 A;  1GRI A;  1B3Q A;  4X1V A;  2J6F A;  1WDX A;  3CCQ T;  1KQ2 A;  2GTJ A;  5IHI A;  2HNI A;  1VQL Q;  4V2S A;  2ZZD A;  3G4S Q;  1X69 A;  4II1 A;  3GPL A;  3L2Q A;  2PVD B;  2AKL A;  2VAS A;  1G3T A;  2K57 A;  1PM3 A;  2DXU A;  2RA2 A;  4BE0 A;  2LZ6 B;  1UJ0 A;  4E2F B;  4HVW A;  2FYK A;  2DL3 A;  3I56 T;  1Q86 C;  3CXC A;  5GAN 5;  3M4Y A;  3OYF A;  1CKB A;  1Y96 B;  5I2S A;  2QEX Q;  1IGQ A;  2QA4 Q;  4KGZ B;  2E3I A;  1LVK A;  5KYU A;  4FL6 A;  3BDL A;  3OW2 P;  5I22 A;  3PMT A;  3RES A;  4RUG A;  2A08 A;  2DTI A;  3RNJ A;  2NLU A;  2ZPI B;  5CQY A;  2O2O A;  5D7U A;  1ZHI A;  3JCM e;  2L2P A;  1NLP C;  5FRM A;  3EFS A;  2LTO A;  3HL8 A;  2M1H A;  2QQB A;  1R77 A;  1TUC A;  3VYH B;  4F14 A;  2MPX C;  3HFO A;  1SRL A;  4C92 D;  1D1A A;  4M77 B;  1W4S A;  1QQJ A;  3KXT A;  4DA4 A;  3I56 Q;  1NLO C;  1M90 R;  2KK4 A;  3V8K A;  1D1B A;  2QQR A;  4PLI A;  3L42 A;  2KQW A;  4GLM A;  5GAN 7;  2RQT A;  3CCM A;  4C92 G;  1RAE B;  1WGS A;  1VQM A;  5CVI A;  1IHW A;  3CME Q;  4C92 C;  3WXM B;  3DB3 A;  4J8O A;  1NJI U;  2DYI A;  1VQ6 Q;  3EH1 A;  3ULR B;  3DLM A;  4MML A;  1VQ4 A;  1YHQ Q;  2XDD A;  1SSF A;  2CH4 A;  3TRE A;  1BI3 A;  1YJW Q;  2YRD A;  2COW A;  2A37 A;  1M1F A;  2DL7 A;  1N8R U;  1B34 A;  2MCN A;  3CBP A;  3HFN A;  2QTX A;  1WHJ A;  1SKU B;  1JB0 E;  1I1J A;  1GXI E;  2XDB A;  1TTH B;  1YJ9 Q;  2AZV A;  5GAO n;  2HD0 A;  2CZ1 B;  5J26 A;  3DB4 A;  1A0N B;  4TVR A;  1AWO A;  3ZL7 C;  4PJJ A;  5CIU A;  3WVD B;  2QYZ A;  4NS5 A;  4DBR A;  4C8Q D;  5LJ3 f;  4PJO D;  4M75 D;  2FRW A;  1MV3 A;  1OI1 A;  1WLP B;  3I5S A;  2NUZ A;  3OBW A;  4E7L A;  2DEQ A;  2D0Q B;  2GCX A;  2AIR B;  2QAS A;  1Q81 R;  4C8Q G;  4PJO G;  5LJ3 d;  3LH0 A;  1RL2 A;  2DM1 A;  2P4R A;  1PRM C;  1UEB A;  4PJO C;  5CO7 A;  4EMH A;  2KXC A;  1Q82 U;  5A0L A;  1VQK Q;  1N8R R;  1UDL A;  2WSE E;  3CPW A;  1GBR A;  2A3L A;  4B9W A;  4JRK A;  2FRY A;  5LJ3 h;  1NJI C;  1OX8 A;  2A28 A;  2EGC A;  2DVJ A;  3HPW A;  4JDS A;  1KJW A;  3CBM A;  3CEY A;  4Z88 A;  4K11 A;  1QLY A;  1VQ8 T;  1VYV A;  2BE7 D;  1LJO A;  1IB8 A;  2PUO B;  1G5V A;  4E7K A;  3LWI A;  2JZ2 A;  2DX1 A;  3X24 B;  2LC4 A;  4ME7 A;  4RCB A;  3CCU T;  2JMC A;  2D8H A;  4Z02 A;  5C0M A;  3OYY A;  1AOJ A;  1HJD A;  3QUI A;  1VQL A;  3AT1 B;  4LD9 K;  4F7U G;  4N0A A;  3G4S A;  1AEY A;  5FW9 A;  2L0A A;  5IN1 A;  1ZSZ B;  3CD6 Q;  2RO0 A;  1Q82 R;  3GIB A;  1Y96 A;  2EJF A;  4RG2 A;  1SEM A;  2CZ0 B;  2CSI A;  4J9F A;  2JM8 A;  3CXC S;  2E12 A;  3NHN A;  2QA4 A;  4M75 F;  2X4Y A;  3PGG A;  3CPF A;  1K8A R;  5GMK e;  1UEC A;  2CP0 A;  2ZPB B;  3X26 B;  4F04 B;  3CCU Q;  1VQP Q;  1I07 A;  1M5Q 1;  4QVZ A;  5FU6 C;  3V8L A;  3GLX A;  2YXY A;  1M3A A;  2V26 A;  4M77 A;  4M7A F;  5CKE A;  2LX7 A;  2DAQ A;  4A4F A;  3C0C A;  3L2R A;  1Y0M A;  3CCR Q;  3L2Z A;  3I56 A;  3OYA A;  2VVK A;  3DLL A;  2EYW A;  2F2X A;  3V8J A;  2LJ1 A;  3ASK A;  2RM4 A;  1GCQ A;  2RPN A;  2DZ9 A;  2NUP B;  4J9G A;  3OS0 A;  1W2B A;  2RMO A;  1UGP B;  5DLQ E;  3CME A;  4NOY A;  3QBY A;  1GCP A;  2ZAE A;  1JJ2 A;  1Q7Y C;  1N5Z A;  3CC4 Q;  3OBY A;  1VQ6 A;  2LQW A;  4XU2 A;  2HQE A;  1FXX A;  3ZFJ A;  2YWW A;  1QVF S;  3CCE Q;  2OTJ T;  2E6Z A;  3EAE A;  3I35 A;  3TSW A;  1YJW A;  2J06 A;  3INZ A;  5EC7 A;  2FG0 A;  5J3B A;  4M78 E;  1HD3 A;  4J7I A;  1QVG A;  1XQH A;  3S6W A;  2EVR A;  5A0G A;  2RN8 A;  4CC4 B;  2V8I A;  2D1X A;  2M0O A;  2X4W A;  5CKD A;  4D8D A;  1YJ9 A;  2B86 A;  3N5B B;  4C0Z A;  3VS7 A;  2BUD A;  4WF2 A;  2F1L A;  2DXB A;  1AZG B;  2RHZ A;  2DK3 A;  5FU7 B;  2CZ6 B;  1R0C B;  2KYB A;  4RTY A;  4XU3 A;  3E9F A;  2EAY A;  1PG5 B;  1NZ9 A;  4J9I A;  2XD0 A;  1QVF P;  1VIF A;  3MP1 A;  1OQK A;  1X6G A;  2JS0 A;  3M4G A;  1B7T A;  5GAM g;  1WXU A;  1AWX A;  2CT3 A;  1GBQ A;  2OTL Q;  1X43 A;  2EYQ A;  2DKG A;  1Y71 A;  1PC0 A;  2BZY A;  3VU3 C;  3OW2 A;  3TEE A;  1XTD A;  2HKQ B;  3Q1J A;  4QVC A;  2EW3 A;  1VQK A;  2KGT A;  1NEG A;  1D0X A;  4B6M A;  1PD1 A;  3CPW S;  2RB6 A;  2FVU A;  4WTO B;  2QQS A;  2LRQ A;  4QQG A;  1FYN A;  2P84 A;  5GAM j;  2FPE A;  2FO0 A;  5CQX A;  2XID A;  2CYZ B;  5GAN f;  1WHL A;  4JUV A;  5L8R E;  5FRN A;  3TVT A;  2RF0 A;  1TU0 B;  1JO8 A;  2DRM A;  2ROL A;  1H8K A;  1BYM A;  2KNB B;  2DL8 A;  3MEA A;  3J7A F;  4XTZ A;  4J6X A;  2XG8 D;  1K9M C;  4RTV A;  5GAN d;  3OYC A;  1VQM T;  4KGV B;  1PNJ A;  3NPF A;  4CI0 C;  3CPW P;  2YHT A;  3ME9 A;  3M9Q A;  1VQ4 T;  4XTY A;  3G6E T;  2V8K A;  3JCM W;  3CD6 A;  2JTE A;  3CBO A;  5GAN h;  4KBM B;  2DXT A;  3OYB A;  4PJM A;  3NTI A;  1T3S A;  2W0Z A;  2RJD A;  3CCU A;  3JB9 H;  4LDV A;  4LXC A;  2Y4Y A;  3VS0 A;  5GMK i;  1KK7 A;  1WFW A;  2QDL A;  2KR3 A;  2KRS A;  4E7H A;  5IH2 A;  3G71 Q;  4JJC A;  5IHK A;  1I5L A;  4DBQ A;  3LGF A;  4RG8 A;  4DEX A;  3C95 A;  3QII A;  3L2W A;  3CCS Q;  3J81 E;  2CUB A;  4C5H A;  2JW4 A;  2E5Q A;  3PIP A;  1PKS A;  2ATC B;  4LDY A;  3CCR A;  2A7Y A;  2L3R A;  4E7I A;  3IQL A;  2X51 A;  1KC8 U;  3JCM X;  4ELZ C;  3EG3 A;  2ENM A;  4ZTF A;  2HEQ A;  1B34 B;  2IG0 A;  1TH7 A;  2SEM A;  4M78 B;  3O8V A;  2LVM A;  1RAG B;  2ZPE B;  1BU1 A;  3I55 Q;  4ZGD B;  1QCO A;  4BE2 A;  5CKF A;  4LN2 A;  2K9G A;  5KCO A;  3CCE A;  1WI7 A;  4J9H A;  2HL5 C;  4M7D E;  2EQU A;  1JQQ A;  3RIR A;  2DVE A;  1MMA A;  4RTU A;  3TSZ A;  4L5G A;  1B07 A;  3URG A;  3NMZ C;  2EPD A;  1OZ2 A;  1JEG A;  2A36 A;  2JNG A;  2R5M A;  1QVG S;  4M4Z A;  2VXF A;  2ZPG B;  2RHU A;  1ZQ1 A;  4P5N A;  2OJ2 A;  4FYV B;  2O4X B;  1UGV A;  4DEY A;  1BB9 A;  2EYX A;  4BD3 A;  2QQA A;  1VQN Q;  5LJ5 e;  4A4K A;  1G3W A;  5GAN 6;  4QKU A;  7AT1 B;  2O01 E;  3CCJ T;  2DPP B;  3G4S T;  1YIT Q;  2E6N A;  4HCZ A;  2EYY A;  3UA7 A;  2OTL A;  2BZX A;  1TXQ A;  3GP8 A;  3BE3 A;  2JMA A;  2MOX A;  3MPU B;  1ZBX A;  1X6B A;  4OGC A;  1TUG B;  1KC8 C;  1QWF A;  2QEX T;  2QG9 B;  4GLK A;  3OW2 S;  2CRE A;  4CC7 A;  1HYO A;  4MDW A;  3HHT B;  3OYE A;  1PSE A;  2OX7 A;  2FZG B;  1G3Y A;  3REB B;  4BAC A;  1M90 U;  2ZCF B;  3QDF A;  1M9S A;  4RTW A;  1BBZ A;  1S72 Q;  3QJ6 A;  3CCJ Q;  2MWO A;  1M1G A;  3PVL A;  4GY5 A;  1PHT A;  2LJ3 A;  4Z89 A;  2EKO A;  2XMF A;  3M0P A;  3SWN C;  2F5T X;  4C92 E;  3QJY A;  2V1R A;  4PLL A;  2E10 A;  3MJX A;  1Y7X A;  5IT9 E;  1GFD A;  4JZ4 A;  2DFU A;  5LJ3 j;  1SHG A;  2QDY B;  1MNE A;  3VJP A;  2KVQ G;  2KAF A;  3G1J A;  4M77 F;  2HSE B;  3H6Z A;  3CME T;  1QKX A;  5CR2 A;  3OY9 A;  1VQ6 T;  2LDM A;  1K1Z A;  1NPR A;  1YHQ T;  2WSF E;  1T3L A;  2VGM A;  3JCM V;  1YIJ Q;  1YJW T;  2G6F X;  1ABQ A;  3FIF A;  3JCM J;  4Y92 A;  5CCA A;  4D8K A;  3C4S A;  2IPO B;  1NBE B;  3JCM f;  4ORZ A;  1G8X A;  1YJ9 T;  4HVV A;  1AWW A;  2NUT B;  1K76 A;  3JAM E;  3OS2 A;  4OMM A;  1I0C A;  2MMP A;  1QVF A;  3A8G B;  4XTW A;  2DNU A;  4FYW B;  4IKF A;  1Q81 U;  4WCI A;  4KT0 E;  2RQV A;  3GBQ A;  4A4E A;  3JCM d;  3G6E A;  3UPU A;  1M90 C;  4C8Q E;  4CC2 A;  4PJO E;  3A1P A;  5CK9 A;  4XTX A;  1AZE A;  1D09 B;  1K0X A;  2VB6 A;  3VS6 A;  4BI8 B;  3ER0 A;  1UGS B;  4DQ2 A;  1OU8 A;  4XK8 E;  1QCF A;  2EJ9 A;  4M7D B;  1ZUK A;  1WJR A;  4M78 A;  1WNL A;  2CZ7 B;  4B9X A;  3JCM h;  1ACM B;  3M56 A;  4OGE A;  2K2V A;  3L2U A;  1J3T A;  2ABL A;  2HKN A;  2F2W A;  4LDX A;  2E70 A;  1RAA B;  4JLI A;  4C0G A;  1EZZ B;  4DOW A;  1VQK T;  3L2V A;  1U1T A;  1EIF A;  1ZSG A;  3LYI A;  1VQO T;  2LQK A;  1ARK A;  1QVP A;  4C5I A;  4RTT A;  4XTU A;  4DOV A;  2I2L A;  2QGG A;  4GBQ A;  1CSK A;  2COZ A;  2IVW A;  5GJV B;  2ESW A;  1RAI B;  3MET A;  4D6W A;  3SHW A;  4A4H A;  3S3O A;  2X9H A;  2GQV A;  4N4I A;  3O5Z A;  5DLO A;  3H41 A;  3AHU A;  2O4X A;  3VRY A;  1ABO A;  4EMK C;  5KCH A;  1D1C A;  4FSS A;  4M75 G;  4M7A D;  1AD5 A;  3HRU A;  4C8Q C;  5EG2 A;  4M75 C;  2DER A;  4J9C A;  4F7U E;  2O88 A;  3LGL A;  4C0D C;  3MHX A;  5GMK j;  4XAX B;  4VUB A;  1WX6 A;  4AFZ C;  2EJG A;  1VQO Q;  4FW1 A;  1KD1 R;  2KSS A;  5GAN 8;  2V1Q A;  4QT7 A;  4M7A G;  2YDL A;  2YLB A;  1K8A U;  1Q81 C;  3U23 A;  1YIT A;  2YUN A;  3PTA A;  4M7A C;  4AT1 B;  2L3Q A;  1MMN A;  3CD6 T;  2VWF A;  2XDP A;  2RD1 A;  8ATC B;  2XK0 A;  3UA6 A;  2PVO B;  1IGU A;  1KQ1 A;  3FB9 A;  5GAN 4;  4F17 A;  1K73 R;  3VUZ A;  1ZA1 B;  2MIO A;  1N8R C;  4ZGJ B;  1OEB A;  2NWM A;  1RUW A;  1VQ9 Q;  5D6Y A;  5GAO q;  3T9N A;  1MUZ A;  1YJN Q;  4C92 B;  4J6W A;  4R55 A;  1VQP T;  2YUO A;  1KG1 A;  2R58 A;  1D0Z A;  3BDU A;  1U5S A;  1U8R A;  3EH2 A;  4JJB A;  1YP5 A;  3CCJ A;  1UUE A;  2KE9 A;  2DIG A;  4E7S A;  1M1K R;  5D6W A;  3EHQ A;  1AWJ A;  2QQ9 A;  3CCR T;  4ZN3 A;  1SPK A;  5KE3 A;  2CP2 A;  2QEX A;  3PMI A;  2HAX A;  4LUD A;  1QW1 A;  2K79 A;  1OUL A;  3OYI A;  2CUD A;  1ZX6 A;  4HT8 A;  3QXE B;  3E1S A;  1SF9 A;  3QYG B;  3CC4 T;  1Q82 C;  4DBF A;  3QKJ A;  3CCE T;  3OS1 A;  3HRT A;  4KUI A;  3RMS A;  3CCV Q;  1NM7 A;  1WHM A;  3QYH B;  1K8A C;  2W10 A;  1AHJ B;  3QHS A;  4J6Y A;  4RTZ A;  4FYY B;  3A8H B;  3JSC A;  2NUT A;  1M3B A;  3UWN A;  2H8H A;  4J9B A;  1JRI A;  2LJ0 A;  4EDU A;  1T0J A;  1Z9Z A;  2MWP A;  1MHN A;  3CMA Q;  5FWC A;  2BKD N;  1X27 A;  2GFU A;  1UG1 A;  4ZGE B;  1I4K 1;  5GAN j;  4BE1 A;  2XI9 A;  2O9V A;  2O9S A;  5CKH A;  3M0T A;  4FT4 A;  3FRN A;  3V7R A;  4RKU E;  2F2V A;  1YHQ A;  2PTK A;  4ZNX A;  2CH4 W;  1UHC A;  5J39 A;  4FU6 A;  2GGR A;  1FMV A;  2ED0 A;  4AMC A;  2C0I A;  2LX9 A;  4M7D A;  3JCM c;  2RK2 A;  2LCC A;  4Y91 A;  5GMK h;  2DF6 A;  4ZTJ A;  1PSF A;  3EFR A;  3PVQ A;  2OTL T;  5M9O A;  2RI3 A;  3OYD A;  1M8V A;  3OB9 A;  2K4Y A;  4XU0 A;  2H3E B;  3M53 A;  2L89 A;  5DY9 A;  1UTI A;  3BY7 A;  6AT1 B;  1M2V B;  1GL5 A;  1E6H A;  1TSF A;  1OOT A;  4FCY A;  1G3S A;  2KT1 A;  4E7Z A;  2O31 A;  3CCL Q;  2Y90 A;  2GTO A;  3P8H A;  3SWN A;  3VS5 A;  2JT4 A;  4XU1 A;  1IZ6 A;  3EFO B;  4F7U B;  5GAO p;  5GAO l;  4PK4 A;  2QK0 A;  3EGD A;  1C0M A;  1SG5 A;  3EG0 A;  3QZ9 B;  2V8J A;  5HY6 A;  5GMK l;  1VOM A;  3M54 A;  3I9Q A;  4MMK A;  4PKC C;  2VXE A;  2AZS A;  4DBH A;  2EIF A;  4KH0 B;  2R57 A;  1TOV A;  3QDR B;  2FZK B;  4JRP A;  2DRK A;  1VQ5 Q;  3VYG A;  1U1S A;  5FU6 B;  1OU9 A;  1VQO A;  2A0F B;  2X3X D;  1QMC A;  1D0Y A;  3UT1 A;  3LH5 A;  2JM9 A;  4LDW A;  1BIA A;  3A8M B;  2ZPF B;  3BW1 A;  2RQR A;  5AT1 B;  1WQW A;  5HK0 A;  2DTO A;  1HK9 A;  2LT1 A;  3SEM A;  2JN0 A;  4C92 A;  1G83 A;  4FSX A;  1WPY A;  3R6O A;  4C5E A;  1RAF B;  1XJW B;  2QGF B;  1RAH B;  2M51 A;  2RQW A;  1OZ3 A;  1YJN A;  4KUL A;  1YI2 Q;  4BY6 C;  2CKK A;  2D0N A;  1JXM A;  2FB7 A;  1T0H A;  1YCY A;  3G71 T;  2E5K A;  2LT4 A;  3E2U A;  3OSV A;  1WIE A;  4IIM A;  2L3P A;  3EG9 B;  3CCS T;  2B8A A;  2D9T A;  3GNF B;  2EWN A;  2JTM A;  4OP0 A;  1F1B B;  1YN8 A;  4OB2 B;  2C0O A;  2CP7 A;  2RJE A;  3MP6 A;  8AT1 B;  2DJQ A;  5D6X A;  3J80 E;  3A5Z B;  3EG2 A;  3H0I A;  3RKX A;  2WSC E;  1VQ7 Q;  1VQP A;  1K0S A;  2EYZ A;  2PVG B;  4OMP A;  3I55 T;  3QSU A;  4QQD A;  4E6R A;  1M27 C;  3FJP A;  2HDA A;  4LE9 A;  3UF4 A;  3CCV A;  3CC2 Q;  2CT4 A;  4X9D A;  2E41 A;  2L5Q A;  3HP9 A;  2EKH A;  2KRO A;  3CCM Q;  4M78 F;  5HK3 A;  4C8Q A;  2LCS A;  4PJO A;  1WHK A;  2PQW A;  4C5G A;  4A63 B;  3JB9 D;  4OMN A;  4A4G A;  5GAM e;  1R8O B;  3CMA A;  2JS2 A;  2K3Y A;  3FJ5 A;  3R6N A;  2F5K A;  1Y07 A;  1O9S A;  4NL2 A;  5IXF A;  3CC4 A;  1VQN T;  4MDX A;  1W70 A;  4JJN K;  2LQN A;  3PE0 A;  3JCM g;  4M77 D;  1YIT T;  1XOV A;  2FHD A;  5FWB A;  2JJ9 A;  4IUT A;  1VA7 A;  3VS2 A;  1KQS S;  1G2B A;  1M2V A;  3UAT A;  1PD0 A;  3GF5 A;  1OPL A;  3BFM A;  2DD4 A;  3ZEH A;  4M77 G;  1YWO A;  2CDT A;  1HSQ A;  2VV5 A;  4M77 C;  2E4H A;  1Q86 U;  4F7U A;  3EFO A;  3CCL A;  4IIO A;  1BI0 A;  4HA8 A;  2IIM A;  2PZ1 A;  3GOX A;  4PFZ A;  2PU9 B;  4JRI A;  1S72 T;  2LCL A;  2RJC A;  4A54 A;  2EQK A;  3GNG A;  3THK A;  4R0K A;  1SHF A;  1TG0 A;  2L8D A;  3MCA B;  2HBW A;  4IUU A;  2OAU A;  1KQS P;  5LJ5 f;  2M16 A;  3SDZ A;  5LJ3 g;  2HZY A;  2DD5 A;  2MK5 A;  3RMQ A;  2DXC A;  2C06 A;  2FL7 A;  1C1A A;  5GAN 2;  4Q5W A;  1IHV A;  2BIV A;  5LJ5 d;  4ESR A;  3H8Z A;  3JB9 F;  2WAC A;  4AFQ C;  3P8D A;  4XQ3 A;  1H3Z A;  4PJN A;  2YUP A;  5GAO r;  1V29 B;  1V76 A;  1YIJ T;  2YSQ A;  1Q86 R;  2DIQ A;  3X25 B;  5KE2 A;  3HKS A;  5CKB A;  2AT1 B;  5LJ5 h;  3OYJ A;  3ZBD A;  2PNI A;  3EGX A;  3X28 B;  1MV0 B;  5DM7 R;  1YI2 A;  4IUQ A;  2AKK A;  2HSP A;  1P92 A;  3VS4 A;  3JCM Q;  4OMF B;  5IXB A;  4HCK A;  1U06 A;  4OML A;  3EG9 A;  3I5R A;  2P4T A;  1FMW A;  4C0F A;  3CC7 Q;  1N27 A;  3MEU A;  2JOY A;  2KI7 A;  4ELY C;  4JZ3 A;  2EFI A;  2K5L A;  3JB9 J;  2K3B A;  3E19 A;  1WXB A;  2VUB A;  4N4H A;  3CCQ Q;  1D3B A;  4BI3 A;  4O6J A;  1GFC A;  4NL3 A;  2DZC A;  1VQ7 A;  3OMC A;  1U3O A;  2Z0W A;  4IUV A;  2RI2 A;  1K4U S;  4OB1 B;  1WZO A;  2DBM A;  2DJZ A;  1WQ7 A;  2KT8 A;  4OF1 A; 
#chains in the Genus database with same CATH homology
 1XTD A;  3Q1J A;  4QVC A;  2QQ9 A;  2X4X A;  3G7Z A;  4IUP A;  3G71 A;  4M7D F;  3M57 A;  4XTV A;  3CCR T;  2HQX A;  5AYF A;  4ZN3 A;  5GAM d;  5KE3 A;  1OYX A;  2KDS A;  4BY6 B;  1VQK A;  3C94 A;  3CC2 A;  2LNV A;  3CCS A;  2DTH A;  4M75 E;  4X9C A;  1I8F A;  1H64 1;  2QEX A;  3PMI A;  2HAX A;  2YRV A;  1N6A A;  2RHY A;  1QW1 A;  3CPW S;  2LQ8 A;  2RB6 A;  4LD6 A;  3S3N A;  1QP2 A;  2FVU A;  2K5I A;  2QQS A;  2RI5 A;  3OYI A;  3HSB A;  2LRQ A;  4QQG A;  3RKW A;  4HT8 A;  5GAM j;  3QXE B;  1BI1 A;  3S3M A;  1KD1 U;  5CQX A;  2ZPH B;  3E1S A;  2XID A;  2CYZ B;  5GAM h;  5GAN f;  4JUV A;  5I21 A;  3QYG B;  3CC4 T;  5L8R E;  1Q82 C;  5FRN A;  3QKJ A;  3CCE T;  4M7A E;  3OS1 A;  3C12 A;  3VKI A;  3HRT A;  4KUI A;  1DJ7 B;  3RMS A;  3OA6 A;  3I55 A;  4M7D D;  3DKM A;  1BYM A;  3MEA A;  3QYH B;  5I2M A;  1K73 U;  1K8A C;  3J7A F;  2OTJ A;  1AHJ B;  4XTZ A;  3QHS A;  5LJ3 e;  2AHJ B;  4J6X A;  1VQL T;  4J6Y A;  2XG8 D;  4JLG A;  1K9M C;  1KHC A;  1VQ5 A;  3A8H B;  3JSC A;  4A53 A;  5GAN d;  3OYM A;  3OYC A;  2JVV A;  1VQM T;  1BI2 A;  3UWN A;  3X20 B;  2XKO C;  3HRS A;  1VUB A;  3OSS C;  4J7F A;  1JRI A;  3JCM b;  1X75 C;  4RMO A;  3SWN B;  4M7D G;  4EDU A;  2MWP A;  1MHN A;  4JS5 A;  4CRI A;  4CI0 C;  5A0D A;  1LOJ A;  2BKD N;  2GFU A;  2YHT A;  2CGH A;  3ME9 A;  2K5F A;  2EQM A;  3M9Q A;  4ZGE B;  1VQ4 T;  4M7D C;  4XTY A;  4HCC A;  1I4K 1;  3G6E T;  5GAN j;  2RJF A;  4HCB A;  2V8K A;  2Y4X A;  3JCM W;  3CD6 A;  4BE1 A;  2P0P A;  2XI9 A;  3CC7 T;  2QI2 A;  5CKH A;  3CBO A;  5GAN h;  4FT4 A;  2QA4 T;  3FRN A;  3V7R A;  4RKU E;  4KBM B;  3OYK A;  1YHQ A;  1VQ9 T;  1VIE A;  2E64 A;  1M1K U;  5J39 A;  2DXT A;  3OYB A;  4FU6 A;  1YJN T;  4FT2 A;  1VQN A;  3TEE A;  2LX9 A;  4M7D A;  3NTI A;  3JCM c;  3CCQ T;  1KQ2 A;  2RK2 A;  2RJD A;  2LCC A;  1WJQ A;  2HNI A;  4Y91 A;  5GMK h;  4JRQ A;  4ZTJ A;  1PSF A;  4V2S A;  3EFR A;  2ZZD A;  2OTL T;  5M9O A;  3CCU A;  1LNX A;  4LDV A;  3JB9 H;  2RI3 A;  2Y4Y A;  3OYD A;  1M8V A;  3OB9 A;  4II1 A;  5GMK i;  2PUK B;  3GPL A;  2K4Y A;  3RUX A;  3L2Q A;  4X34 A;  2PVD B;  4XU0 A;  1G3T A;  2K57 A;  3M53 A;  2L89 A;  5DY9 A;  4RCC A;  2DXU A;  2RA2 A;  4BE0 A;  2G3R A;  2RHI A;  4E7H A;  3BY7 A;  3MEV A;  3LW5 E;  2FYK A;  4C92 F;  3I56 T;  4OB0 B;  1I5L A;  3WVE B;  1Q86 C;  3CXC A;  5GAN 5;  3LGF A;  3M4Y A;  4RG8 A;  2CS7 A;  3C95 A;  3QII A;  3L2W A;  1G3S A;  3OYF A;  4FIB A;  3J81 E;  1Y96 B;  5I2S A;  4C5H A;  2E5Q A;  3PIP A;  4LDY A;  3CCR A;  2A7Y A;  2L3R A;  2Y90 A;  4E7I A;  1KD1 C;  4FL6 A;  3BDL A;  1KC8 U;  3P8H A;  2H3J A;  2K3X A;  3SWN A;  3PMT A;  3RES A;  4XU1 A;  4BUG A;  5IAY A;  4ELZ C;  1IZ6 A;  4F7U B;  3JCM X;  5GAO p;  5GAO l;  2DTI A;  2VC8 A;  2NLU A;  2ZPI B;  3QPH A;  5CQY A;  3QZ9 B;  3OYN A;  1ZHI A;  3JCM e;  4ZTF A;  2V8J A;  5HY6 A;  1B34 B;  2RK1 A;  5FRM A;  3EFS A;  5GMK l;  4BDY A;  2IG0 A;  2LTO A;  3HL8 A;  1TH7 A;  2M1H A;  2QQB A;  3M54 A;  4MMK A;  3M5A A;  4M78 B;  4PKC C;  2VXE A;  3O8V A;  1S72 A;  2LVM A;  3OMG A;  3VYH B;  4ZN1 A;  2M9U A;  1K73 C;  2ZPE B;  3HFO A;  2EIF A;  4PL6 A;  4C92 D;  4ZGD B;  4M77 B;  4BE2 A;  1W4S A;  3CCV T;  4LDU A;  5CKF A;  4YTL A;  3TU4 K;  2R57 A;  4QQ6 A;  5FLX E;  5KCO A;  3NFC A;  3QDR B;  3KXT A;  3CCE A;  4DA4 A;  3OYG A;  1Q7Y U;  2EQJ A;  4M7D E;  3SFM A;  1M4Z A;  2EQU A;  3RIR A;  2KK4 A;  4JRP A;  3V8K A;  2DVE A;  3E9G A;  5FU7 C;  4UC4 A;  2QQR A;  4L5G A;  4L6V 5;  4PLI A;  3L42 A;  3VYG A;  1U1S A;  5FU6 B;  1VQO A;  2KQW A;  3URG A;  5GAN 7;  3CCM A;  1OZ2 A;  4C92 G;  1WGS A;  3QZ5 B;  4N4G A;  3VV0 A;  1VQM A;  3LWH A;  2JNG A;  2R5M A;  5CVI A;  1QVG S;  4O5V A;  4C92 C;  3CMA T;  2VXF A;  3RKY A;  3WXM B;  3PT9 A;  2ZPG B;  3DB3 A;  4J8O A;  2RHU A;  1NJI U;  3UT1 A;  4HKE A;  1ZQ1 A;  1M1K C;  4LDW A;  2MI6 A;  4P5N A;  5GAN g;  1BIA A;  3DLM A;  3A8M B;  3M58 A;  2O4X B;  4MML A;  2ZPF B;  3BW1 A;  1YBY A;  1VQ4 A;  2XDD A;  1SSF A;  4BD3 A;  1WQW A;  5HK0 A;  3TRE A;  2DTO A;  4BDZ A;  1HK9 A;  3CC7 A;  2LT1 A;  1BI3 A;  4C8Q F;  2QQA A;  4PJO F;  2D6F A;  2JN0 A;  1MGQ A;  1M1F A;  4C92 A;  2GF7 A;  3SD4 A;  2E65 A;  4E47 A;  4FSX A;  5LJ5 e;  4A4K A;  1G3W A;  1WPY A;  3R6O A;  4C5E A;  3KUF A;  5GAN 6;  1BKB A;  1N8R U;  1B34 A;  1OZ3 A;  1UGR B;  2O01 E;  3CBP A;  4KUL A;  1YJN A;  3UDC A;  5HKC A;  3HFN A;  2QTX A;  4BY6 C;  3CCJ T;  3CCQ A;  2DPP B;  1JB0 E;  4EMK B;  3G4S T;  1GXI E;  2CKK A;  3PFS A;  2E6N A;  2XDB A;  4HCZ A;  2FB7 A;  2OTL A;  4C8Q B;  5GAO n;  3LX7 A;  2HD0 A;  3GP8 A;  2DO3 A;  4PJO B;  4M75 B;  2CZ1 B;  4C0D B;  1YCY A;  1ZBX A;  5J26 A;  3DB4 A;  3G71 T;  2MAM A;  3RER A;  4TVR A;  2LT4 A;  3MEW A;  3OSV A;  4OGC A;  5CIU A;  3WVD B;  1KC8 C;  4NS5 A;  3CCS T;  2B8A A;  2D9T A;  3GNF B;  2RH2 A;  4C8Q D;  2EWN A;  2JTM A;  2JTF A;  4OP0 A;  5LJ3 f;  4GLK A;  4M75 D;  2QEX T;  4OB2 B;  3CCL T;  3OW2 S;  4MZP A;  1OI1 A;  5GAO m;  4MDW A;  3HHT B;  1HXD A;  1NPP A;  3F70 A;  2RJE A;  3OYE A;  3MP6 A;  1PSE A;  5D6X A;  4BB7 A;  3A5Z B;  4M7A B;  3J80 E;  3OBW A;  5FRO A;  4E7L A;  5GMK m;  2DEQ A;  1G3Y A;  4BAC A;  2D0Q B;  1M90 U;  1N9S A;  2GCX A;  2ZCF B;  3OQ5 A;  1FX7 A;  1M9S A;  1KQS A;  1QP3 A;  3RKX A;  3QJ6 A;  1NE8 A;  2ZGW A;  5CAI A;  1RI0 A;  2WSC E;  1VQP A;  4C8Q G;  2MWO A;  1M1G A;  2KMT A;  4PJO G;  4GY5 A;  5LJ3 d;  3LH0 A;  4PJO D;  1RL2 A;  2PVG B;  3I55 T;  1UEB A;  2EKO A;  3QG1 A;  3QSU A;  4PJO C;  4QQD A;  5CO7 A;  3SWN C;  2F5T X;  4C92 E;  3QJY A;  3FJP A;  3P8B B;  4F7U F;  4EMH A;  4PLL A;  2E10 A;  3CCV A;  1Q82 U;  2E1H A;  1Y7X A;  5A0L A;  5IT9 E;  4X9D A;  2WSE E;  2E41 A;  1VQ5 T;  2L5Q A;  3HP9 A;  3CPW A;  5LJ3 j;  2A3L A;  4B9W A;  4JRK A;  2QDY B;  4M78 F;  5HK3 A;  3SB2 A;  3VJP A;  2KVQ G;  3JRZ A;  4C8Q A;  5LJ3 h;  1NJI C;  4PJO A;  2KAF A;  3HPW A;  4JDS A;  4M77 F;  3H6Z A;  2PQW A;  3CBM A;  1KHI A;  3M55 A;  3CME T;  4C5G A;  3CEY A;  3JB9 D;  2R5A A;  5LL6 S;  4A4G A;  1K9M U;  5GAM e;  2XU8 A;  5CR2 A;  1R8O B;  1VQ8 T;  3OY9 A;  3TCJ A;  3CMA A;  1VQ6 T;  1LJO A;  4BI4 A;  2LDM A;  2K3Y A;  2KY9 A;  1NPR A;  2F5K A;  1YHQ T;  1Y07 A;  2PUO B;  1G5V A;  4E7K A;  1O9S A;  2WSF E;  2VGM A;  4NL2 A;  3JCM V;  4E7J A;  3LWI A;  1YJW T;  3CC4 A;  1VQN T;  2JZ2 A;  3FIF A;  3OS5 A;  3JCM J;  3FLG A;  4MDX A;  2X35 A;  3L1A A;  3NTH A;  3X24 B;  2LC4 A;  4ME7 A;  4M78 D;  5CCA A;  4RCB A;  3CCU T;  4Z02 A;  4JJN K;  3C4S A;  5C0M A;  3OYY A;  3MO8 A;  1YI2 T;  1X01 A;  1YIJ A;  3JCM f;  3JCM g;  3QUI A;  4M77 D;  1YIT T;  1VQL A;  1XOV A;  4LD9 K;  2FHD A;  4F7U G;  1YJ9 T;  3V7C A;  3FEO A;  4IUT A;  3OYH A;  4N0A A;  3JAM E;  3OS2 A;  3G4S A;  1KQS S;  3V7S A;  2F69 A;  1XNI A;  2MMP A;  4J83 A;  5IN1 A;  3GF5 A;  5A2Q E;  3BFM A;  3A8G B;  1QVF A;  4M78 G;  2RO0 A;  4XTW A;  5GAN e;  4IKF A;  2XIC A;  1Q81 U;  3GIB A;  1Y96 A;  2DD4 A;  2EJF A;  4KT0 E;  4RG2 A;  3ZEH A;  4M78 C;  2CZ0 B;  2RHX A;  4M77 G;  4A4E A;  3JCM d;  3G6E A;  3M59 A;  3UPU A;  1M90 C;  4C8Q E;  2VV5 A;  4KUD K;  4PJO E;  5CK9 A;  4M77 C;  4XTX A;  4IUR A;  4QVD A;  3CXC S;  2E12 A;  4F7U A;  1Q86 U;  2QA4 A;  1BI0 A;  2X4Y A;  3PGG A;  3CPF A;  4HA8 A;  4M75 F;  3CCL A;  4JS4 A;  5GMK e;  3X26 B;  2ZPB B;  3ER0 A;  4OB3 B;  4BI8 B;  1VQ9 A;  2P0K A;  3OYL A;  3GOX A;  1UGS B;  4DQ2 A;  4XK8 E;  2EJ9 A;  1UB4 A;  1S72 T;  2PU9 B;  4JRI A;  4M7D B;  1WJR A;  4M78 A;  1WNL A;  1M5Q 1;  2YLC A;  1VQ7 T;  2LCL A;  2CZ7 B;  4QVZ A;  5FU6 C;  3V8L A;  3GLX A;  2RJC A;  4B9X A;  2P0Q A;  3JCM h;  4A54 A;  3PIO A;  3M56 A;  2EQK A;  3GNG A;  4M77 A;  4OGE A;  2K2V A;  3L2U A;  2L8D A;  3MCA B;  4IUU A;  1WJS A;  4LDX A;  4M7A F;  2E70 A;  2OAU A;  5CKE A;  4JLI A;  2DAQ A;  4A4F A;  4PNO A;  4C0G A;  1N9R A;  4DOW A;  1VQK T;  5LJ5 f;  3L2V A;  5LJ5 g;  1U1T A;  1EIF A;  3CC2 T;  2M16 A;  4FM4 B;  3SDZ A;  5GAN 3;  3L2R A;  3LYI A;  1VQO T;  2LQK A;  3PNW C;  3L2Z A;  1QVP A;  3OYA A;  3I56 A;  4C5I A;  5LJ3 g;  3CCM T;  4XTU A;  3DLL A;  2DD5 A;  3RMQ A;  2I2L A;  4DOV A;  2DXC A;  2C06 A;  3V8J A;  3FDR A;  3ASK A;  2RM4 A;  2FL7 A;  3KBG A;  2JUF A;  2DZ9 A;  2IVW A;  3MET A;  4D6W A;  5C6S A;  3OS0 A;  5GAN 2;  4QW2 A;  4Q5W A;  1UGP B;  5DLQ E;  1W2B A;  4A4H A;  3CME A;  3S3O A;  2BIV A;  2GQV A;  4N4I A;  5LJ5 d;  4NOY A;  3QBY A;  3H8Z A;  1D3B B;  5DLO A;  3AHU A;  2O4X A;  3JB9 F;  2WAC A;  4EMK C;  3P8D A;  4XQ3 A;  5KCH A;  4M75 G;  1Q7Y C;  1JJ2 A;  1VQ8 A;  1H3Z A;  1O75 A;  3OBY A;  4M7A D;  1VQ6 A;  4XU2 A;  2HQE A;  3HRU A;  4C8Q C;  1FXX A;  3ZFJ A;  3MP8 A;  5EG2 A;  1V29 B;  5GAO r;  4M75 C;  1YIJ T;  1QVF S;  4F7U E;  2HBP A;  4OVA A;  3LGL A;  4C0D C;  2OTJ T;  2DIQ A;  2E6Z A;  3MHX A;  4MZT A;  3X25 B;  1BIB A;  3EAE A;  3NTK A;  5KE2 A;  5GMK j;  5LJ5 j;  3JB9 I;  4XAX B;  3HKS A;  3INZ A;  1YJW A;  4VUB A;  4Y28 E;  2EJG A;  5CKB A;  5J3B A;  1X6O A;  4M78 E;  4EMK A;  5LJ5 h;  3ZBD A;  3OYJ A;  1IRE B;  4J7I A;  3X28 B;  2VYT A;  1XQH A;  3S6W A;  1QVG A;  5A0G A;  4HT9 A;  2KSS A;  5DM7 R;  5GAN 8;  1YI2 A;  4M7A G;  4M77 E;  4M75 A;  2V8I A;  2M0O A;  2X4W A;  4IUQ A;  2YLB A;  1K8A U;  1P92 A;  4EMG A;  5CKD A;  1YIT A;  1Q81 C;  3PTA A;  4M7A C;  2XHC A;  4MZM A;  3JCM Q;  1YJ9 A;  4OMF B;  3N5B B;  4C0Z A;  2BUD A;  2VGN A;  3LLR A;  3CD6 T;  4WF2 A;  2XDP A;  3QO3 A;  2RD1 A;  2XK0 A;  2GFA A;  2PVO B;  5GAN 4;  1KQ1 A;  3FB9 A;  2DXB A;  2P4T A;  2RHZ A;  3VUZ A;  2DK3 A;  4R56 A;  5FU7 B;  5KH6 A;  3A8L B;  4C0F A;  2CZ6 B;  3A8O B;  1UGQ B;  1N27 A;  1N8R C;  4ZGJ B;  3MEU A;  2JOY A;  4ELY C;  3FC3 A;  4M7A A;  1FWZ A;  4XU3 A;  4N0A C;  3E9F A;  5D6Y A;  2EAY A;  5GAO q;  1NZ9 A;  2EFI A;  3T9N A;  2K5L A;  3JB9 J;  2XD0 A;  1VIF A;  3JCM P;  3JB9 G;  1I81 A;  3MP1 A;  4EPC A;  4C92 B;  3E19 A;  4J6W A;  4R55 A;  2VUB A;  3M4G A;  4L59 A;  4N4H A;  1VQP T;  1D3B A;  2QXF A;  5GAM f;  5GAM g;  4BI3 A;  4ATO A;  2R58 A;  4O6J A;  1KG1 A;  3BDU A;  2EYQ A;  1JBM A;  2DKG A;  1U8R A;  4NL3 A;  2DZC A;  4J5Y A;  3OMC A;  3CCJ A;  1Y71 A;  1VQ7 A;  1W2B S;  4IUV A;  2RI2 A;  4OB1 B;  3VUB A;  2DIG A;  2DJZ A;  3VU3 C;  3OW2 A;  1WQ7 A;  2X4J A;  2MF2 A;  1JJ2 S;  4OF1 A;  5D6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...