5CP3A

Crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides in complex with sulfathiazole
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPITLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSRVPDRFTGSGAGTDFTLKISRVEAEDLGIYYCWQGTHFPQTFGGGTKLEIKRAEAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSETDQDSKDSTYSMSSTLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light Chain of Antigen-Binding Fragment of Monoclonal Antibo
publication title Class-specific Monoclonal Antibodies and Dihydropteroate Synthase in Bioassays used for the Detection of Sulfonamides: Structural Insights into Recognition Diversity.
pubmed doi rcsb
molecule tags Immune system
total genus 58
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp3A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp3A01
2IMMA 4DTGH 2EKJA 1WBXB 5MERA 3OKMB 1QTYT 3GM8A 4C56E 1W0WB 3TCLB 1RAMA 1QEWA 4NQSB 2DM4A 3JV0A 3FZUC 1HE7A 4MJ4A 2HAZA 3ALPA 3H0TA 1UVQB 3T65A 4HEME 1KCLA 4LLMB 3KYKL 1MRCH 4A6YA 4RMQA 1NMAH 4YPGA 1NAKH 5DK0A 1QBLH 3TJEH 1OF2B 1E28A 5FV2A 3MRJA 1I8LA 1FZJA 2ZG3A 3MNZB 4POZC 2EE2A 5A3IC 1DP0A 2EYRB 3QJFB 1UA6H 3TWCH 1GC1H 3QEHA 5JHLH 2FO4B 1PKQA 3PGDB 4MJIA 1UM6H 4PY8J 4NQTA 5T3XL 3T8XA 2IAMB 5KN5A 1OAXL 1OT2A 5E03A 3G04A 5DTFB 1BX2B 2W9DH 3HG1D 1TQCB 3TESA 4JKMA 4OZFB 3GMPB 3O9WA 2VQ1A 3GI9H 4Q6YA 4Q97A 3HR5A 4QXTA 2I07B 1TTFA 4KRMB 4P2RB 4JFHD 1MHPL 5DO2C 5JXEC 1U95B 1GGCL 1OAQH 3RWEA 3ZSSA 4WNQA 4UOJA 5I6XB 4HF5H 1WBZA 4I9WD 3VWKC 4PJ8B 4PS4H 4PJCA 1AKJA 2BJMH 4ZAKB 3STLB 3KS0H 5FYJD 4EUPA 3RWDA 3REVA 5DSCA 4XHJC 3WJLA 5FIEA 3WD5L 3AROA 1YMHB 4JM2B 2CDEB 3HC0B 1IT9L 4I8DA 2AEQL 4Z7VE 4Z78B 5HHNA 4YEEA 3BIKB 3L3HA 4MXWH 4MA8L 1FNHA 1U8QB 1KPUB 5B3JF 4N1EA 5E2TH 4CGTA 4ODBD 1MRDH 1RI8A 3QT2A 4QRTB 2NCMA 1S7WA 5EUOA 3WIIL 4GO6B 1ULVA 3NFPB 4YGAB 4J3TA 2OX5A 3MV8D 4HFUL 4Y19A 4X7CC 3GRWL 4OCLC 5B38A 4RAUA 3RTQD 2NR6D 1VPOL 4KVCL 1WT5C 2HVJA 4RFOH 2VLKE 4L9DA 1P5VA 4MNQA 4LVOB 5IBTL 1G7IB 2YK1L 3O6MH 4XXDB 1E6OH 5F1OB 4P2QD 3UDWA 3KJ6H 1YPZF 2XN9E 3U9UB 3DGCR 4ZOEA 2B1HH 3VH8A 1JNNH 1IILE 4U1NA 3FOLB 1H8OA 4KJWC 1R6VA 2F54D 3WFDL 3SDXE 2X4TB 1A4KA 2KZWA 4CVWA 2LE9A 3LVEA 3QHTC 4Y7MA 3O2DL 1MCBA 2JCCA 4YHZH 4IOIB 5E8NB 1TJGH 3EIFA 4O2FA 2W0FA 5TE6L 3GMOA 2JJTC 2R0ZH 4HDIB 4QRUB 4KJPC 1F2QA 2C3GA 1I1AB 1IEAA 1BJ8A 1A3RH 3F5WA 2BOBB 1YYLL 2E7CA 5C7XL 4L4VA 4OLWL 2C4FU 3IU3B 2IGFL 3DGGA 2K7PA 1MOEA 4BK4A 2R4SL 3Q3GA 3TJHC 4NHCL 2VZVA 1EJOH 4FQLH 1SHMA 2ESVA 4XCFL 1HZHL 3C08L 2GITB 4HIEA 4KRLB 3OKDB 1E4KC 5HI4D 5DFWH 3IDGB 3K2MC 3T2OA 4QHMA 3KDMA 4PUBH 5J9PB 1KIQA 4WTWA 3L5XL 1KIRB 2VB5A 1RPQA 5FYJL 1JK8A 1QFUL 4KI5C 4PJEA 5MEPA 4M62H 5E4EC 2IF7A 2Y36L 4HIHA 1SEBA 1KG0B 5ID0A 4OD3H 5DA4A 2UZYB 1CFVL 1HKFA 3UBXB 4ORGA 2VUOA 4CW1A 4CU7A 1DQJA 3HS0A 4NIKB 2QADC 4JFZH 4RMRA 1WIOA 2R2CA 1INDH 3D3VE 4HH9A 3HN3A 3RNKA 4WUUD 1UT9A 4O2EA 1G6RH 3I6KB 4LVHB 1J0HA 3BD5A 4XMPL 3VI3E 4MA7H 2J88L 4LLUB 5FFLA 4EI6B 4G6JL 4DKDC 1XF3A 5KW9H 2I60L 2X1QA 2ICCA 4G8IB 3WFBH 4G43B 2APVA 2GY7B 4TVSa 5EIIB 1QA9B 3OKLB 4QRRA 4D9RD 2ARJB 4CDGC 3UTTA 2VAJA 4Q7DA 3MA9L 3B2UD 3N06B 2PKDA 5HYSG 4XPTL 3FQUA 3MLVH 5BQ7A 4E41A 3U36A 4L9LA 1QACA 1NKRA 1NBYB 2ZCLL 1JF1B 2VWEC 2VN7A 3ISWA 4AY0A 4NUGH 5GS0H 3RL1B 3ETBF 2XWTA 3L5JA 4Z0XB 2J8UB 1PG7L 5AZ2H 1XGUA 3TIEA 43CAA 5F1SA 3DX6B 1S78C 3KNBB 2KBGA 2WUBH 5ITFB 1UYWH 4N0UB 1JE6A 1DVFA 3FN0H 1MLBA 4GSDH 3IKCB 3RBGA 1P2CB 1S7TB 5HI3D 2MQ3A 3B3IA 5HYQB 5FGRA 4NPYA 3Q6FB 4JRXE 3CSBA 4JG1L 4ZFOA 1DLHA 3QZWG 4CN4A 5B4MD 3QWRA 1MCDA 2AJZA 5ENWA 1UCBL 4U1KA 5D2LB 5T1LB 2QSCH 1B90A 4M03A 4WW2F 3VGBA 5F9AC 4Y5VC 2C3VB 2K9UA 2JB5L 2CLZB 4ODSH 5IV2A 5F44A 2UY6A 3AU1B 1HINL 3L1OL 4ZUSA 5IT2H 5HDLA 1TVBA 3DV4B 5IHZB 3ALWA 3QXDB 1SVCP 2P7TB 3QEQA 4B41A 2GJ6E 2JIXA 4D2NA 3GJFH 1RMFH 1WEJH 2ZUQC 3TIDA 3V95A 1SJEA 4DWHA 1NDMB 5E2WH 4UNVA 5CZXD 2VLRA 3ARPA 4FQXC 3MRLB 2ZUUA 4G80A 4DK3A 3V7AE 4DZ8B 3QIBC 2V7HB 4NCDA 4IDJH 3WN5B 3DHMA 5CSBA 1QZ1A 5BVPH 4P2OC 4M48H 5KSBF 1TTGA 5H35B 1AP2B 3RVXD 2FSEA 1KV3A 3BJ91 4LLYB 5D7JA 4MZ3A 4XB7A 1NC2B 3T0AA 1FFNB 1SBSH 2E6PA 4NN6C 1OQXA 5FA3B 4O4YL 3BWUC 2QQNL 1T66D 2EDTA 5GZND 5D7LE 2W38A 4KKAD 4PD4K 1MF2L 5DJ2B 5FGCB 5EZIH 4O00A 4JPVL 2E5EA 1LHZA 1E6JH 5BXFB 4KXZH 4BA8A 5E1AB 4OZGF 1U8KA 4NQCD 1UXSB 5C8JA 1X6NA 3T2NH 1ZA6A 3V0AC 1K2DA 3QYCA 2DKMA 2VAAB 1ZEAL 1QQDA 3O45B 2NYYC 5E8PA 1QLRB 3Q2CA 3GSWA 5F21B 1ZSDB 4X98B 4JG0H 1U3HB 4WI4A 3BAEH 3NZ8B 4X7SH 5IB2B 3V6ZA 1TQCC 2YUVA 3LN4B 3TBTB 1BAFH 4WEMB 3O4LB 2CRZA 5CP3H 3KYMA 1FZMB 1BQSA 3H7LA 1U8MB 2LAAA 4P9MH 1CICA 1HSBA 3VFRA 1G7HA 5ETUA 4PBVC 1AD9A 5DJ8A 1OAKL 1AGFB 4WHTA 4H26B 1NGZB 3PL6D 2AQ2A 3HZMB 4N5UA 5D1ZB 3T0EE 3EYFA 4OUOA 4PJ5B 4OKVA 4Y8AA 1EEZB 1LEGB 4JM2C 4GKSB 3CPLA 5EU5B 1KXVC 2V2WB 3OQ3B 3OKEA 1KIPA 3TEUA 3GSNH 5B8CB 1RUKH 4WU7B 5EFIB 4KUZH 3D0LB 1CDYA 1HXYB 5HJ3B 4GKOA 1Q1JL 1Q9KA 1BJMA 1NBQA 2GFBA 1I85A 1MUJB 2EKSB 1MVUB 5I16B 1BJ1H 1PSKL 4YDIH 4HQQL 3LD8B 2RAMA 3P73A 5F97E 1TMCB 1A47A 4JO2L 2A6JA 2D7PA 2IMNA 2OI9B 5C0AA 3MREB 2ENSA 1J8HA 5CSZA 1OTTC 1G9MC 3ZKSD 3U4BL 3RX7A 5TFSH 2DI9A 5D7IA 2QBWA 4J6RL 1CGXA 1JIBA 3WV0A 4RBPK 3HUJE 5I1HL 1HILA 1SQ2N 4DKEL 1C7SA 3WKML 2PO6A 3RWHA 4DN3L 3QAZB 2CR3A 3L3DB 3GGWA 4JJ5B 4D0BB 4X7EC 3D85A 1WSST 3AXLA 1T04A 2YXFA 3PDOB 3CCHA 4MHHG 2WBJB 4S1QL 3V7AG 5F1KC 1YPZB 1U91A 4ONGL 5HD8D 1HQ4B 1N8ZA 3L3JB 2HLFD 5GGTL 5IW1A 1T7ZA 3H3KA 3W11C 1DTUA 2AK4A 1KTDA 4YHIB 3N85L 3BP6A 3RL2B 2XOTA 4H8WH 1LQSR 5E2JA 1YN6B 5E99L 2PNDA 4XMKH 3T3PE 2DAVA 1RZKC 5LQBH 4PJBA 1MCPH 5JO5B 3TBSA 1F4YL 2ERJB 4M61B 2A2QT 3QIUB 4NC2B 2EICA 5D93B 5GGRA 1HOCA 4GAYA 3WIFA 3RKDD 2BY0A 1A7BA 1VHPA 3S8WA 2KQNA 3QXUA 3L3OB 1U8LA 1Z5LA 2AEIT 1AGBB 3HZYB 5DQDH 3V5KA 4HGKC 2KZ1B 2LTQC 2Z8VC 3C60B 4G8GB 2PXYC 2GTZB 3S34L 3OJ2C 1IVLA 3SDXF 4XNZB 1CBVH 4LSRH 5GISL 1DANU 3Q5TA 5GS2D 2NY4C 5HHQA 4S1DD 2YD8A 3QDME 3ZYOA 1QR4A 3GNMH 5DHYB 5E6IA 3PWPD 3I9GL 3U2SA 4FA8A 4X99B 1CFQA 3K0WA 2EXYC 3MO1B 4I77H 1X5AA 5CGYC 3VDAA 5EOCL 1WWWX 4HC1L 4FNLH 3IJHB 4QNPE 3OMZA 2F54A 15C8H 2WIIA 4C57C 5HGGS 2FIRT 4G6MH 4JZNB 5CBEA 2HN7A 4ODVL 4JFFA 3NN8A 4G7VH 3C5ZD 3I6LD 4HPYH 4OGZA 4O02L 1CFBA 1TVHA 5ILTH 3LEXB 4F7MA 4IMLB 1A1MB 1VENA 1YY8B 5ABDE 2B2XH 3OAUH 3NCJH 1LK2A 1XF1A 2FX9L 3B8SA 2C9AA 3KYNA 2X9WA 3NACH 4Y2DD 2EYTA 4Z8FL 4N0UE 5IVZB 2EZ0D 3BFOA 4U3CA 3SKOB 3IF1B 3MRGB 2HTKD 5BZDB 4NZRL 3FRUB 2JLLA 1Y0LB 4ZXBB 4RAVA 1N5YH 2AEWA 4JO3L 2D7NA 3H6JA 1L6ZA 2IADA 3V6BR 2NX5A 2O5XH 3KPOA 1UQSB 1S9XA 3EDDA 4EI5B 3AM8A 5IUSA 1JZ5A 1U8IA 1ZT4B 4XC1H 3L5HA 1NFIA 1AIFA 3TBWA 1AXTL 3KHQA 3VXMA 1NAMH 5MI0B 3C6SA 3B2VH 1YEHH 4HUKB 4Y1AE 4APQD 2B1AH 5TE7L 5F7EL 1Q9WA 3AGVA 1XF2B 1I7UA 4NRYB 3U1SH 1CT8A 3OKOA 4PRPA 1SEQH 4JREB 2WWMD 4QT5B 2R8SL 4KHTL 1EBAA 4HKZA 3OPZL 5C08D 1TZIA 1S9VA 3H9SE 4RQQA 1CGSH 3O4OC 4XPAL 4NSKA 2FJFA 3VXSB 4XGZB 5EUKA 4JANB 5IB1B 5IMLB 4N9OB 3TZVD 1QR1B 2DBJA 3MV7B 3C9NA 2HJLB 3EO9H 2YKLL 3WEXA 5C0BB 3O3AB 1RJZA 4X6BB 1Z9LA 1FJ1A 4NO5A 1M6OA 1H15B 3MCG1 5D8JH 2EEBA 1KTLA 2R0KL 4OM0H 2BNRD 3UBXG 4XBPB 1MCFA 1AGCA 3LHPH 4F7PA 1LO2L 3VFUA 2BNQD 4RMWA 4F15B 3VXOB 5JR1L 3CXDL 1QUNA 3F7YA 5BJTB 3RWCB 1QO3A 5JIIA 2CRIA 3QEUA 4QTHB 3DIFB 4BKLA 1DJSA 3F12A 4PJDE 1AXSB 4HXBL 1NDGB 3O4LE 2H6PB 1URLA 4OFIA 2VLJE 2HWZL 5C0CB 2OL3L 3IYLW 1FCCA 5EBGA 2R1WA 1ED3A 1BHGA 4OZGB 1CK0H 5T33H 1WIPA 4F37F 5C0FA 3RGVA 5MENB 3IVKB 3C87A 1WVZA 3CVIL 3SPVB 1LP9A 4LSSH 2YD5A 1CFSB 2KDGA 4MJ5A 2NTFA 4TQEH 3KPPB 2OR7A 4PJ5E 1YNKH 4M7KL 1QBML 4PV9B 1UJ3B 3TT3H 4UILL 3OKNA 2EIEA 4LP4A 4JDTH 1AJ7L 2X4UA 3LQAC 5I1AA 3MCKB 2OXHA 4DCQB 1E0OB 5IVXB 1OAYL 3CSGA 4YDKH 3MJGX 1JPGA 1A4JA 3A6CH 5E5MB 2VISB 5IFHH 4XP6H 2VXSL 3IAPA 5D5MA 1BD2A 1RIHH 3MLYH 4LVNC 1MCLA 4NM8L 3ZZ1A 2FB4L 4GRWF 2F19L 1L0YA 4LCYA 2ZSVB 1JBJA 3B9KD 5DDHB 4RMTA 1WICA 1Y6NR 4PP1D 3HKFA 4ODXB 3SE8L 4PRHD 1N3NB 4LEXL 1LE9B 1IFHH 2G75A 3LEYH 1D9KB 3C09B 2J4WL 1KXQE 1RD6A 4LLVA 5H2BB 2DTML 4J4PA 5LGKA 4OF8A 1TNMA 4J3WA 2CGRH 4D94A 1FGVL 1XEDA 3H9HA 4YFLF 3KLAA 3QNZB 4AZ8A 4P59H 3CDGB 3PHQB 3QXVA 5JTWA 2CDFB 1F11A 3D18B 2OI9C 3TO4D 1KCSL 1BZ7B 1Z9SA 4TUOA 5DVNA 1CD1B 1QPPA 2AQ1A 5I8OL 4HZLA 1JPST 5KAQF 2OQJA 2WINA 3KYKH 3V79C 2FLRT 4FQQB 3QDGD 4K3DL 5GXBB 5K9QG 2FR4B 4OCNC 5DQ9B 3SDYL 1E27A 3ULSB 2IALB 1MWAH 2QR0B 1OM3L 1B0WA 1S7RA 3L9RB 3QAZC 1T1YA 3VFVA 3H8NA 4Z18A 1UH3A 1KELL 4LHQB 5T3XH 4F57H 3FZUD 2WBJC 1DQQA 4P3DB 4UT7L 5INDA 4LAQL 3JWDC 3VGAB 2HFGL 1QFOA 2GSIB 1UACL 2HT3C 4LOUC 3FT3A 3MRRA 2VXTL 3LKOB 4U1SA 1BZ9B 4POZD 2GTWA 1MHPH 3V8OA 5A3ID 3CNKA 3EYOA 4MMZC 3MRKA 4X7DC 2CLVA 4C56D 4F58L 5F7YC 2ORBH 4Q9RH 4KROB 2QQKH 3HPJA 1U8HB 1PQZB 2VL5B 2BZDA 5SWQB 3QIUC 3VFNA 5JW3H 3HFML 5D93C 2YD4A 5HGAB 3D25A 2IANB 1YJDH 5F7LB 4MQSB 3QCTL 3HNSL 5C3LD 2VKWA 1K8DA 4FFWC 4LSUL 3ZMRA 5TDOB 3BXNA 5F72S 3HI6L 3C60C 3U6RB 1JGLH 5DO2D 5JXED 3FOMA 3WXWL 1MCNA 5FUCE 4XNZC 4MA8H 1HDMA 4G6FD 4IRSC 3VWKD 4GRLC 2AXHA 1TENA 4OD2B 1QLFB 1OTUC 3BOVA 4JPWH 3P9WB 4IIQA 5I76B 3MJ9H 2NY5L 4PRDB 1YYML 4XHJD 4NJ9L 5D71L 4MHHI 5BS0B 1UEYA 3SGKC 3KVQA 3IAGC 3LKRA 5JOEA 1HHIA 4HFUH 1ZHKA 2CO7B 1A14L 4MVBC 5GRUL 4R26L 1NC4B 5EBLB 4PGBB 3QO1B 4M3JA 1XIWA 4BQ6A 4M6NH 3DMMB 3QUML 4G9DA 4EBQH 2YK1H 1NGQL 3VGGA 2CKBH 4MJ6B 5F3HB 3GIZH 5CP3A 3HAEH 3TPKA 2DD8H 2EYSA 3BEVA 1J05A 4JLRA 2AXFA 5KS9F 3MUZ1 4JGUA 3R0MA 3WFDH 1QSFE 1MJJA 3WSQH 1R0AL 1BBJA 5GIRA 4Z7UE 2DLTA 3DUUA 3O2DH 5JMRA 4ZXBC 2CRYA 1X9QA 4H88H 5CWSB 1BQHG 3SDDA 1M7IB 4Y5YA 5TE6H 5GHWH 3V6FA 8FABB 1J5OL 2DLIA 4XPHL 4CVUA 3G5YA 2IH3A 4EI5C 3EUUA 1IGYB 2XFXA 1YYLH 4Y4KA 4KFZC 4KJWD 5C7XH 4OLWH 3SJVD 3MLXL 1EHLH 2IGFH 3FQRB 4PB9H 1P9MA 3QXAB 1G0DA 1W0VB 4LLDB 4X6CA 5MI0C 4U3XA 2B0SH 2UUDK 5LWYL 3C08H 4HGMA 1TPXB 2ZG1A 5HTSA 4LIQL 3L3GA 5CHNB 5I74B 5CEZE 2ITCA 5C0BE 1QVOB 3X14A 4G9FB 2OJEA 2XN9D 1S5HA 1I7ZA 1I8IB 4KJPD 3SE9H 5DXWA 4P5KA 4FMFA 4PJ9B 3L5XH 3M8OL 4AENB 3VXUE 3RUGA 4RFEA 2IEPA 3TJHD 3EOAA 5D1XB 2OTUB 2O61A 2OZ4L 5ESAB 5FGBA 1AQKL 1WAAE 4H1LH 4Y2DA 5EBWB 1I9JL 3DWTA 4Y16B 4OFVA 2W1NA 5HHMB 1OP5H 4ODHH 3MLZH 4IJ3C 3SY0B 5ADOL 3DBXA 3PDDA 5JPNA 4XNQA 2R1XA 3VWJB 4IDLA 4I5BA 4LSPH 1P4LB 2GSGA 4MCYB 4X6DE 1W72A 1UZ8B 5AWNL 5CSGA 3BW9B 2NW2A 2ADJB 2IPTL 1SYVB 5SWZB 2BFVL 2XZCL 5T5NF 4W6YB 1OB1B 1KGCD 2OBGA 2J88H 3KPRB 3BD3A 2ZG2A 4KI5D 4KQ4L 4OCYL 4P0DA 4G6JH 3FB6A 4MB4A 2DOCA 1I1YB 4F15C 5CIPH 1KFAH 3TM6A 3INUL 1X5KA 5CEXB 1B0GA 2FZ3B 4DW2H 4OZIF 4XP4L 1YEKL 2QADD 4OD1H 4PREA 3SOBH 4BZ2L 1JNHA 3GSQA 5CMAB 2AEPL 1WBYA 3GK8L 4JN2A 1JCKA 1WISA 3O6FA 2Z4QA 3S9DB 1VEMA 2ZUVA 3QA3B 4L8DB 5IKCA 3C6LA 2WLZA 1RHFA 4QRSB 5FYKE 3W9EB 1RULL 5C08A 1C12B 4LLQA 4PJXB 1D3CA 1FO0B 5JA8B 2CJUH 2IQ9H 2E7BA 1IQDA 4YHPB 1FAIL 5F7WC 4JAMA 2IPUG 3I85A 2R2EA 4KH2A 5FO8B 1EO8L 3TZVA 4XBEL 5C2BH 2DF3A 4FTVB 4U0QB 1CXEA 1MPAL 1OHQA 1MFCL 1UJ3C 3RU8H 1F3RB 3AS1A 3STZB 1R24B 4WO4B 4DQOL 3MNVB 3DUHA 2J1KA 3MRIB 3HMXA 2MJWA 3UBXI 1CI5A 2XRAL 2BNRA 4OSUH 2VH5H 1MCRA 1S78D 3T0DA 4R4BA 1N0XH 5DK0B 4WGWB 5IHUL 2BNQA 3MRJB 4K2UL 1FZJB 1YN7B 1U58B 3HC4L 4WRLA 3IGAB 2F53A 1LDPL 4OF6A 1G7PB 5E8EB 1ZS8A 4FQ1L 1HSAA 3BKJL 5J12B 2N7BA 3ARXA 1T7VA 2ZPKL 1ODAA 1A6TB 4F37K 1MFNA 5KVEL 1K4DA 3FO9A 1A9EA 3OHXA 5EOCJ 2B39A 4FXLA 3O6KL 4G42A 5L2JB 5F89B 4ZS7H 1PY9A 1G84A 4QXTB 4WFGE 1KB5B 4M1GH 2E7LA 1YNLL 4JRXD 1D6EB 1KTRL 3BD4A 1KN2H 4O4YH 2YEZB 3UPCA 1WBZB 4AM0A 3RNQA 4L3EB 4HS6B 1EGJL 3RAJH 3KXFA 4JPVH 4FQXD 5I1DB 1R3IL 1IKFH 1B0RB 5I1KH 2BY1A 2XWJB 3AB0C 1KCRH 4U6XA 3QIBD 1LVEA 4OZHA 1JPFB 1ZHLB 2MHAA 3T4AA 3BP7B 3ILPB 3UC0L 2DM3A 4P2OD 3HR6A 2FGZA 1FCGA 1ZEAH 4PY7B 4MA1C 1UWEH 5E6ZA 2AJSL 3GHEH 4MAUH 3DROA 5IM7A 1QSEB 2D3VA 1ZLSH 3V0WH 1MFDL 1MHCA 2IANE 1I9IL 4X7FC 3VGAC 5LXGH 4LCWB 5HYIA 5C0RL 1CXHA 1ETZA 1T89A 1PY4A 3B9KA 3GHBL 3BKCL 4QCIB 4V1DE 4WI9A 4DEPC 2XV6B 2EDQA 5IBUG 2DIAA 1XGPA 1LO5A 3QUMA 3PP4L 2H32A 3L7FB 3LEVL 5DRXA 1WZLA 1U6AL 2G2RA 2EC8A 5IJVB 3REWA 4KROC 2NYYD 1V7ML 3JWNC 2NPLX 2H2PC 4TSBL 1F3DH 5EPMB 5T1KB 1OAKH 1GHFL 3OR7A 2OJZL 4RAUB 2BVPB 1I1FB 5F9JB 4M7LL 2NMSA 5DI8B 3ARDA 3HCVB 3X3GL 5ITBL 3WO4C 1GGTA 3MLSL 4AQOA 5BS0E 2DM7A 4MNQB 1KT2B 2YD9A 4P2RD 2PF6A 4JY5L 4NKIL 4R3SA 3QDGA 1JZ2A 2MCPL 1EXUB 4O58H 1HWGB 1PBYA 3CZFA 4KK6C 2CRMA 4YHNA 2DM2A 1S7VA 2FIKB 1FL5A 4GBXC 3FONA 4LSTH 3VFGL 1MCHA 5CJXA 1ZA3A 2BSTA 1ZLWH 3H7BA 1L6XA 4QOKA 3V4PL 3U82B 4HQQH 2ZZUT 5JUEL 5DZNA 4JM2D 3QB7C 5DD5L 1FRGL 2A6IB 2O26U 3MGOA 1KCUL 1OT1A 3X12B 2VZSA 1Y18B 1IZJA 1EK3A 1EFXA 1MJUH 3F5WB 1WC7B 3DMMC 4FXGB 1DSFH 3VXNA 4L4VB 4NO0D 1MHEA 2WANA 4MD0A 4PRNA 1P7QB 5I1HH 2X89D 9CGTA 2FNBA 2YHGA 3WKMH 5HGHA 4DN3H 4M5ZL 5F88B 5FKPA 1XCQA 2JE8A 2XPGA 2G5BA 3BMWA 4HIEB 5IB4A 3U46B 2AW2A 4JFOB 5IB5B 4X83A 4ONGH 4K7FB 5I19L 1IAOA 3L5WB 1OTTD 3CFEA 5GGTH 1PYWB 1FYTB 3DVIA 3OWEA 2YN5A 5T1DL 3L7EA 5KS9B 5LAXA 1OAUL 1VEOA 3N85H 4W81A 5TGBB 3RWJB 2GUOA 1HHKA 5E99H 2NY3B 1JF5A 3MSPA 2YWZA 4XCEA 3BH8A 1YQ2A 4WWID 3D39B 2MPAH 3ZYIA 2DWEA 2XTJE 1T22A 1S9WB 1NQBA 2HJFB 3ZLQC 3ROOA 3UJJL 4ORGB 4OJFL 1XGRA 5I9QC 3HS0B 5FUOL 5I1LA 4I18B 3U0WL 3BPOC 5JIPA 3ZTNH 3W11D 1OLZA 3CFKB 3EOTL 4O2CB 1TPXC 4HHAB 3S34H 1A5FL 4O2EB 5IEKB 5I74C 3ZE0E 3AY4C 5I1EH 3U7AA 1LO4H 3C2AH 4OBSA 2W92A 2QLVB 4PJHA 3QG7H 3PJSA 5TQ0L 3KGRA 3MXVH 4PJ9C 4L8CA 1YMMB 3QISA 5F8QC 4QRRB 2VABB 2Z35B 1CQKA 5IQ9A 3RBSA 4GG6A 3EFDL 1VFAA 3I9GH 1R5WB 4HGWB 3FQUB 4NP4H 5GGSB 2F8OA 4L9LB 3GMRB 1OSPL 7CGTA 3KYAA 5KSUB 4WHCA 5BO1L 2PXYD 4HC1H 1B2WL 5E0QA 3TFKC 1EUTA 5HHOE 1WT5A 4J23A 1K3IA 1BMGA 2XWTB 4YFDB 5ICXB 3VWJC 4PBXA 1EERB 1CDHA 2NY4D 4YDVB 4OI8A 1FZOA 4O02H 3A6BL 4FP8L 4ODTL 2VDOL 4R7DB 1A64A 5IQ7L 4LLAA 3EYUL 5EOTA 2F5AL 1AY1H 1DVFB 3AREB 2L7UA 5B39A 4MDIB 1JRHI 3CXHK 4PJXE 5HYSA 5F9OL 4OIIH 1Y6MR 2EXYD 2E6QA 5CGYD 3SJVA 2DRUA 4PJAE 4U1KB 4WWKA 1C8PA 1RJCA 3BPCA 5CAYB 2AXGA 3VFTA 3NIFF 2PYEB 5DEGA 3CFJB 4PGCA 4NNPH 3TO2A 3QDMD 5GS1C 4S1RH 2UZIL 4GQ9L 4IRZL 4KZEH 2XY2A 1IBGH 4OZIB 3N0PB 5L7XH 2IPKB 5EU6A 1KB9J 3CMOH 4YDLC 4ZUSB 4PRIA 4UINL 1MHHA 5JW5A 3KAAA 2R2BB 2UYLA 5J6HB 1RZFL 4IRJC 1J0JA 1MSPA 2JIXB 5D2NB 1D5XA 4RZCB 2DQTL 4NWUH 1DE4A 5EA0L 1AXTH 1WV7T 3BKYL 1UC6A 4NHUA 4IMKC 2R23A 1G9ML 2GK0B 1INQB 2OLDA 2P8MA 3PIQA 2VDRH 4YC2B 2Z92B 3BE1L 4WJ5B 2I9TA 5TH2A 2H1PH 1FSKB 1PKQE 1H3GA 4MJIE 3OSKA 5DK2A 4EQ3A 4DVBB 2VLLA 3RX8A 1QHOA 4YHOH 1IL1A 5D7JB 5HVGB 3CLEH 1E4XL 3HE6B 3WFZA 5C6WH 1EEQA 1FQ9C 1NFDB 4R2GB 1B3JA 1I9RL 4S1SL 1E4JA 2R56L 3IDMA 1UENA 3FQXB 4K9EH 3U0PB 3DO7B 3OL2A 4KDTC 2O5YH 2RFXA 1P6AB 4XPBH 5DGRA 1ZA6B 5SX5H 1OPGH 2VMFA 4U1LA 2CKBA 4P3WA 4J1UA 3ULVE 2KH2B 1SM3H 3F8UB 4FQIH 5J12C 5T1LD 4Z7WF 4PJCE 2DQDH 4OM1L 1WGOA 3OKYA 3SQBA 5DJAB 1NCAH 3BWAA 1RZKL 4XPGL 1J1PH 3ULUL 2M8XA 4N9GA 3PV7A 4GMSL 2R0KH 2Y5TB 3ZKQD 3V6ZB 5EOQH 3S3SA 2ICEA 1LO2H 1BQUA 4BFEA 4OCWH 4P23A 1F97A 4Z77A 4C54A 3U9PH 5DGQA 2NNAB 5JR1H 3CXDH 5TDNA 2MSPA 3NFSH 3ULVC 5FGSA 1BWWA 4HS3A 2AJ3A 1AQDA 4HXBH 3BN3B 3DX9A 1BF2A 1I75A 2VQUA 3RWFA 4YJZL 3EAKA 5EUOE 4EJ1C 1I3VA 2OL3H 2D31A 3VRLE 2BVQA 3MMEB 4UU9B 5EU3A 3ARFB 5ID1B 3EYFB 5FUZL 4M1CC 5KVDL 4OKVB 5F7HA 4Y19E 4XNMB 1SMOA 1DBML 1CFTB 2OSLB 3CVIH 1RUAL 1KIPB 4HCRH 3D1MC 4HD9A 3RWGA 5JLZB 2PW1A 4X9GA 4UOW0 4EVNA 4MNQE 1QSZA 5FK9B 4R7NB 2EO9A 1KCVH 1LILA 4G8FA 3ZO0A 4P4KB 4ONHB 1D5BB 1K9TA 3KPQA 1CIUA 5MHSD 2EE3A 2RIKA 1P4BL 4LDLB 4Z7OE 2CK0H 4X7TB 4HXAL 4ZPTA 1JPSH 4JO1L 1JTTA 1OD9A 3P73B 3WMSA 5C0AB 2AS5M 4D9QE 4LCIL 5ALBH 1U93A 4JDVB 1F3JB 1T0MA 1HH6B 4WUKL 1F5WA 5KSAB 3OZ9L 1F58L 2EEAA 2X05A 4NNYA 3I75A 1N5AA 2ADGA 4ONFL 3SEPA 5SWSA 3T3ME 1L4IA 1M7DB 1S3KL 1TETL 1YNTB 3O4LD 5C07B 4JY4A 2JCCE 2F19H 4XP1L 4GW1A 2VLJD 1LD9A 1T2QL 3RWHB 3GGWB 4OCXH 4TPRH 3D85B 3SE8H 3STBA 1H5BA 4LEXH 4OGAC 2MCG1 3S3JA 4Z95L 4N8VB 3OJDA 3GMNA 5BVJA 1BVLB 4L4VE 4PPTA 3MBEB 5HXMA 1MAKA 2YRZA 1WBXA 3GMLB 2HKHL 1ZLVH 4QF1B 3OKMA 1N8ZB 1FGVH 1W0WA 3OJMB 4NQSA 2ESVE 5C0DB 1Q0XL 1QRKA 4WI3A 4PJ5D 2YD7A 1KCSH 3BP5B 1UVQA 4LLMA 5I8OH 4NO3B 5IJKA 3WNNA 1A7OL 1QLEL 4UTAL 1OF2A 3FTGB 4DGIH 1RHHB 4ELMA 2FH6A 3EGSB 4JCMA 5CINL 2EYRA 3FKUS 2OMBA 2DLGA 4XNYL 3A0OA 2FO4A 4PJEE 1G7JB 2FJHB 1L0XA 3IDXL 3PGDA 4OFYD 1S7QB 2IAMA 4WI8A 1U36A 2Z31B 1PGRB 4QXUL 2RB8A 5DTFA 1BX2A 3DTXB 2IWGA 1FNEB 4OZFA 3GMPA 1N59B 43C9B 4LDOB 2I07A 2FGWL 2VXTH 1MCIA 4P2RA 3GB7A 2Q7NA 4J3UA 1U95A 5IW3A 3N1GC 2ICES 5IGXL 4MB3A 5LCVL 3I2CL 3T0VA 4YDJA 1XFPA 2NY3C 4PJ8A 1ZTXH 4U6HB 4F58H 4MCZA 4ZAKA 3STLA 2AXJA 4FZEL 4YXLH 1CVRA 1MIEL 2WBJD 4C83A 3KYOB 4QRRE 1U0QA 4L4TB 3EJYC 1IAIM 3P30L 2VDLL 5CBEB 1F6AB 3UTTE 2HN7B 2X42A 4LARL 5F1NB 4JFFB 2HT3D 4I18C 4LOUD 4XVUC 4Z0BL 5EU7E 3RKPA 1GSMA 1NSNL 4LSUH 1IRAY 1YMHA 4JM2A 3HC0A 3DX8B 4E41E 5I0DA 3HI6H 5B38G 1WZ1L 5DWUL 1FG9C 3OB8A 5BCAA 1JV5B 3BIKA 1U8QA 1KPUA 3U7WL 5HHXL 1XH3B 4V2CB 3F62A 2XA3A 1CF8H 2HP4A 3MLTB 4N0YL 2XKSA 3QIUD 4EN3B 3LCYA 3C8HA 3NFPA 3VH8G 3LAFA 4U1HB 2W65B 4FFWD 4X80L 3SDAB 1GPOH 3FL7A 2BRRL 5E1HB 3C60D 4G8GD 4L9LC 3CAFA 5GRUH 3ESUF 1PLGH 4PY8I 5CKAA 4XX1E 4IM8A 5D6DA 3FAWA 3BPNB 4IBLT 3LQAL 4XPFH 4IRSD 4GRLD 2O93L 4LASH 1OTUD 4Z7QE 1G7IA 2CQVA 1K8IB 4XXDA 2C3HA 1IGJB 1NFIB 1P5UA 4ZOCA 3BKML 2GW5A 1A6PA 3C6SB 3AREC 4KC3B 1DVFC 3CFCH 3U9UA 4FQ2L 4OQTA 3FOLA 1JZ7A 2RQ8A 3VU2A 3QEQE 4EXKA 1C5BH 4I3SL 4NFBA 3UTOA 4MVBD 3BVNB 4GRMB 4KTDH 1CXKA 1UM5H 2R0LL 1U2CA 2X4TA 5GRXG 1G0XA 1R0AH 2VLRE 2I5YL 2J2ZA 2X40A 1OL0A 4Y4HB 3WBDA 1F4AA 1FVDB 4D0CB 2FJFB 3G6DH 5E8NA 5TF1H 1UM4H 2WK2A 3ESVF 3MZTA 3ARTA 5GJSL 2H8PB 4HDIA 4QRUA 1D5MB 1I1AA 3RJQB 1MEXH 1I8KB 4JDZB 4AEIH 3FQNB 4JZOB 5D2NC 4UNTA 1NFDE 3WEXB 3ZDZE 5K9KA 3S36L 4RSVA 1T4KB 4B50A 4HJJL 3Q1SL 1L7IH 2GITA 3OKDA 3QRFM 4YC2C 4ZXBD 4LIQH 1RU9H 3IDGA 4OCSH 3RPIB 1NLDL 2XZQL 5J9PA 2XWBB 2ED9A 1FSKC 4PJGB 4IHOB 1RY7B 2JB6B 5D7JC 1GGYA 4EI5D 3HE6C 2V5YA 2X1XR 5MP6L 5M95B 5IFAH 4R2GC 1QO3B 5FM4A 1FNLA 2X10A 4TVPD 4MAYB 4WI2A 1TZGL 4ZD3L 3QH3A 1MRFL 1QSFD 4GMTL 4U2ZA 3JWDL 4KRNA 3V0VB 3EYVB 2CIIB 2OZ4H 2VYRE 1KG0A 1EUUA 2VDQL 3O3EB 1AQKH 1I9JH 2AERT 3T77B 1FZKB 3BZ4A 3UBXA 4Q6IB 5C2UB 3RGVB 1XAUA 4WFEE 5EDXA 1LP9B 2X7LB 5AWNH 3S5LB 3I6KA 3A6OA 1F13A 1EEYA 4PJFF 1HYRC 4YX2L 2XZCH 2CH8A 4JPKH 2ZOLB 4OCYH 25C8H 4G8IA 4RDQF 4G43A 2WUCL 5EIIA 4C58B 3MV7D 1QA9A 3OKLA 4DFIA 5CEZD 5C0BD 1H3XA 4KVNL 3HNTL 4BZ2H 2W9LA 2AEPH 4XVSH 1NBYA 1QKZL 1JF1A 3U7YL 5JQ6L 3VXUD 5LBSH 3EO0B 2HFTA 2YA1A 4XX1G 5F8RC 3ARFC 4PJCF 1JYWA 3RL1A 3BHBA 4Z0XA 1RULH 2J8UA 4BQCA 1A6VH 5C0AE 4G7YL 2XA8L 2NY2C 3BRGC 1G6RB 2VITB 4M1DH 2FBJL 3DX6A 5ITFA 4JFDB 4QTIH 1J8HE 2IFFL 3LIZL 1VSCA 1A6UH 1P2CA 1S7TA 1TCRA 3C5SB 2I27N 4NQVB 5D7IE 5HYQA 1FIGL 3TPUB 3VD5A 3MROB 3Q6FA 2DQEL 1MPAH 5C0CD 5FF6A 4P4KC 2Y5EA 5D2LA 4I9WE 1JF6A 2CMRH 4TUJA 5T1LA 3WIHL 4LMQE 3U4AA 4DQOH 4MZ2A 4FOMA 5EG6C 4N90D 2CXGA 2OMNA 5MEND 5D72H 3QO0B 5EUOF 4XXCA 2C3VA 2CLZA 2EH8L 4HPOH 2XRAH 3VRLF 3QBTB 4HZLB 1FC1A 4ZTOH 3AU1A 3JTSA 2CXKA 4KTEH 3DHJA 3QG6B 3DV4A 3QXDA 2P7TA 2AK4E 2P49B 3HRZB 4XTRC 1E27B 3CX5K 3TVMA 2I9LA 1LDSA 4TRPL 2PO6C 4AL8H 2VDKL 1NDMA 3NZHL 1IC1A 3BKJH 4PJBE 1DQLL 3MRLA 4LF3B 3UTSB 2ZPKH 2OK0H 3H42L 1CLYH 1RK0B 3ZDXF 3MBEC 1BIIB 5HSFA 1UKQA 4IEFB 3WN5A 4RGNE 1NJ9B 4RWYL 5H35A 3QDJB 5BRZB 3O6KH 1AP2A 2ADFL 5EIQA 1A02N 4TVPL 3DXAA 4LLYA 2ED7A 4RX4D 4DKAA 1NC2A 1FFNA 5EORL 4TULL 3SGEI 5I8KH 3LKQB 4U0RC 4TYUA 5DLML 4ZPVB 4UBDC 3WJJA 2CLVB 1RIUL 5C92A 5DJ2A 1RVFL 2BX5A 3WCYA 3ARQA 5BXFA 3HPJB 3OAYH 3QWQB 4R90L 5E1AA 1EGJH 4B53A 3GJFB 1UXSA 3VFNB 3P9LB 2FRGP 2B5IB 2BDNL 1R3IH 3D25B 3EDFA 5DMKA 4RGNC 2QSVA 1DBBH 5J6GB 2VAAA 3O45A 5FDYA 3ET9F 3WS6C 3S98A 1QLRA 3S7GA 2FECI 4HULB 4OLYH 2Z31C 4X98A 1UWGH 2GHWB 2UUDH 3CVHL 1U3HA 2F54E 4L4TE 2PR4L 3NZ8A 1KNOB 1MFDH 4MX7B 5DD1H 4AIZB 5IB2A 1BWMA 1U42A 2YD3A 3LN4A 5J11B 3O8XB 3TBTA 4JFFE 4MLSA 3UPRB 3L3IB 5C0RH 5CEZL 1CU4L 1FZMA 5I75C 4FABL 2DDQH 1U8MA 1IM9B 2XNAB 3O2WH 5E6IC 2DQJH 1WLHA 3PP4H 4RFNB 1DBJH 1UZ6E 3RZWA 4HMDA 3LEVH 4HJ0C 2ITDA 1AGFA 4WFGD 4H26A 3R06B 2X4RA 4I3GA 1NGZA 1VFMA 2Y72A 1GC1C 3KR3H 4G3YL 3LQMA 1XIWB 3X3GH 2V9TA 5D1ZA 4L3AA 3MLSH 4PJ5A 1EEZA 1LEGA 1T1XB 4HKXB 3Q6GH 2V2WA 1J87A 1BP3B 2UWEF 2NX5E 5B8CA 4WU7A 3M1BB 5EFIA 4NNXB 4ISVB 3D0LA 1TNNA 2DQGH 4KROD 4NN7B 1HXYA 4HAGA 1FP5A 2H2PD 4P57B 5HJ3A 4JLRB 3BRDA 4EN3C 1EAPA 3VXME 5TQ2H 2IAND 1MUJA 1FGNL 1MVUA 5I16A 3RGHA 1ADQH 5BV7H 3S36X 3WNKA 3SDAC 2WZPD 3DUUB 3VJ6B 1N4XH 1X5GA 4HT1H 4LCUB 4PRPE 3MREA 2X4QA 3T0XA 4V1DD 1FH5L 4HUWB 1QRNA 4Y5YB 4DGYL 4X5XA 3BPNC 1P69B 3ZT7A 1LK3L 1P4IL 3AM8C 4Y4KB 4QYOB 4KK6D 1FDLL 1KEML 1BEYL 5K93A 2DIBA 4XC3L 4GBXD 1CZ8L 3GSNB 4NC0B 4JJ5A 3L3DA 1MQKH 1NCWL 3DV6B 3QUKA 4M5ZH 2E27L 3CLFH 5CILL 3QPXL 4Q9QL 3PDOA 5BS0D 2WBJA 4GW4A 1RIVL 1YPZA 4UQ2B 3A67H 4D9RE 1HQ4A 1OWWA 5I19H 1NC4D 3S6CA 4OCMC 1CE1L 2OJEB 5E00B 1S5HB 1WWCA 3DSFL 5E9DB 2NY1B 2YPVH 4MQXC 4JZJB 1IAKB 2CUIA 2HTLC 3DMMD 3T04D 4YHIA 5EZLB 5AEAA 4ZFFB 4Y4HC 3CK0L 1OAUH 3RL2A 4FQJH 3RUGB 3KG5A 1YN6A 1MCJA 3NFNB 2VR9A 4YBLB 1V3MA 1X4XA 5JO5A 4QHKI 4M61A 3QIUA 1WQVT 4E42B 1LWRA 3QIWB 1DBKH 1BFVL 5F6HI 1KJ2L 1ZE3C 5FYLE 4TSAH 4F7CB 5DHVH 1KENH 4K23H 3L3OA 2R1XB 1A0QL 2FATH 3HZYA 4LSQH 3U0WH 4I5BB 3C60A 4G8GA 4RISL 2QQLH 4KI1A 2GTZA 4PTTB 2B4CC 2C3XA 5D1QB 4P46B 2EC9T 2AK1L 1IQWL 1LP9E 4XB8A 2RHEA 1XZ0B 1CDGA 1B0GB 1J0YA 3G6AB 4MB5A 4N1HB 3IETB 4X99A 3KPNB 5I1IL 2VSCA 3GSQB 2AKRB 3W2DL 4QGTA 2CO6B 3SE4A 4HS8L 3IJHA 3O6FB 5BO1H 4BFGA 1B2WH 3BSZH 3C6LB 1QBAA 3KLDA 4JZNA 4RNRB 4Q6IC 5EO1B 2JJSC 3RGVC 4G9FD 2PW2B 2GIYA 4NZTL 3LEXA 3WIHA 4PJ9D 3MV01 4FP8H 1JFQH 5D5ME 1BD2E 2R2EB 5FHAL 1AXIB 2F5AH 3P4OB 4GRWH 1YY8A 5L9DL 1VFBB 4RMVA 3KPMA 5DJZB 3VFMB 1L9NA 3G9AB 1ACYL 2H26A 3TFKD 3ZE1E 1WUNT 3OBAA 4UTBL 4PD4J 3N9GH 5ADPH 1ZANL 3SKOA 3IF1A 3EDJA 1BM3L 3MRGA 3VWJD 5BZDA 3FRUA 5KZCD 1Y0LA 2J6EL 1NUDA 4IRZH 3R8BB 4JQVA 2Q76A 1F4WL 4UINH 1CD8A 1UQSA 4XVJL 2C5DC 3P2TA 3KPRD 4EI5A 1JWMB 3JSSA 4L8SB 4PFEA 1ZT4A 4Z7NF 4OLEA 1CR9L 3UCRA 4GKNA 4OLUH 5J89A 3BUYB 1C5DB 3GMQB 5EA0H 4OV5B 3GSVA 1K6QH 4NM4H 2YBRB 1XF2A 4NRYA 5F71A 5JMOC 4J4PC 1XF4B 4YHYB 4CVXB 5DURB 2OYPA 3BE1H 4QT5A 2AJVL 3B4NA 2YMXL 2C7UB 4LPUA 1IGIL 4IRJD 5M7QA 3IJYB 4PBWD 1E4XH 5HDOA 5BMFH 5TE4L 4DGVL 3P11L 3IS1X 1S7SB 4WW2A 1KLFA 3VXSA 4XGZA 1NCUA 3RNQB 1VFOA 1I9RH 3PXHA 3BIBX 4JANA 4YZFE 3KXFB 5IMLA 1LE5A 1QR1A 3SO3B 5IEHB 3MV7A 1IGCH 1UXWB 2AJUH 1AE6L 3VFWB 1NAMB 3MODL 2ED8A 3KPSB 1QG3A 3O3AA 5FCUH 3HE7A 3RA7L 1XR9B 4X6BA 2DYPB 5D7IF 4C59B 2GEEA 1H15A 2ATPA 1JGUH 4NWTL 5HYJB 3SDCB 3VDBA 2R39A 5CCKH 1JP5A 2ZSWB 4XBPA 1YECH 3V5DB 3MRHB 1CGTA 1OD7A 2FEEL 1BVKB 3S4SB 1H3WM 3VXOA 1NEUA 4YQXL 5BJTA 3ARYA 3RWCA 5LJYH 3PWUB 1VEPA 4HWBL 3MCLL 4QTHA 3DIFA 3REWB 4OF0A 4FZ8L 4KKLC 1NDGA 2H6PA 5EH1A 5C0CA 4P4RA 2B5IC 4FFZL 5DK3A 4AT6B 4KY1L 3DI3B 3T1FB 4OZGA 1B88A 2PN5A 5ALCH 2D03H 5FUZH 5KVDH 5MENA 2YZ1A 1X4ZA 4MDJA 2PETA 2DICA 5IOPB 1DBMH 3GBNL 2NY6B 4U4BA 1KPRB 4ESKA 4NBZB 1CFSA 3EBAA 2VDNH 4R3SB 4AMKH 3ULVD 5DJ6A 5TPWL 5GRJH 3O8XC 3KPPA 3BT2H 1DR9A 4L3ED 2EDOA 1AKJD 4PV9A 4J3XA 1UJ3A 4EZMA 1O5DT 3F7QA 3MCKA 3S35L 4DCQA 1MCWM 5IVXA 3VI4E 5JQHC 2A77H 3FFDB 4HXAH 3LY6A 4RFNC 4M9OA 4M1CD 4KJQC 4JO1H 2DBLH 1EZVY 1LO3L 1YY9C 4F33B 3MA7A 4ALAL 2VISA 4KPHL 2N1KA 3MGOB 4YGVB 5HHPB 1F58H 1XIWC 4HUUB 1EFXB 3LS5L 1BPVA 2ZSVA 1S3KH 1TETH 1V8HA 1GZQB 3V4UL 1MHEB 4MD0B 4PRNB 4P49A 4ODXA 1HCVA 3PHSA 4OLZL 5TDPB 1N3NA 3B8YA 2DQUH 5DC0A 1LE9A 1XCQB 2XPGB 2G5BB 3E8UL 2OR9H 1RZIA 1D9KA 3V52L 1FORL 5H2BA 3FMGH 3MRQB 5SX4I 3RZCB 4X6CE 1UZ6F 2XQBL 3IFPB 3QNZA 4HBCL 5DRZB 1JPTH 3CDGA 3PHQA 2CDFA 3D18A 1DDHA 2R29H 1IEBB 4MNQD 3VFPB 4J3SA 1BZ7A 4HUXB 1CD1A 5EO0A 4NN5B 2F8XC 1Z9OA 3MV9B 1YEFL 3SDDC 4FQQA 4Y5YC 1A7OH 1A22B 2FECL 4OGAD 3JUYA 2FR4A 4UTAH 5ICYA 3NA9L 5DQ9A 2DWEB 4Y4KC 3ULSA 2IALA 3MLUL 2W0KA 5E8DH 3RUGE 2YRPA 3L9RA 1JGDB 5AYUL 2OM5A 1FLTX 3IDXH 3QWOB 1U8JB 2EDYA 1KSRA 5EN2B 5JZ7C 1RURL 4P3DA 1CL7I 4K3JL 1V5JA 4DKFH 4UDUB 2GSIA 1NGXB 4HK0B 1CDCA 3C2SA 3O2VL 3LKOA 2NY1C 3E2HB 4PJHB 5I18L 4JZJC 2BVYA 3BYTA 1BZ9A 4OTXH 4HWEL 4L4VD 5IQ9B 1X5YA 4MXVE 4UIMA 1P7QD 5E2UL 5IGXH 4PJ7F 3I2CH 4JFXB 1HWHB 3PWVA 1U8HA 1PQZA 2VL5A 4R96A 5SWQA 1T03H 5FGBC 1D5IL 1ORQB 1MWAB 4FZEH 3QIWC 4JKPH 4QRPB 5HGAA 1MIEH 2IANA 3DRTB 3P0GB 1DLFH 3DX7A 5J1AB 2V17H 5IESH 2VDLH 4NCC1 4LARH 4OGYL 4Z0BH 3MRPA 1FYTD 1XGYL 2DWDA 2EDRA 4Q2ZB 1FZOB 5GGRY 3UTQB 3U6RA 1I4FB 4YE4L 5D1QC 2ICWB 1WZ1H 4MA3B 2DQCH 4PRBB 2J6EA 4BQBA 4P46C 5C08E 4JR9L 1J8KA 2VIRB 3U7WH 2F5BL 2NY3D 4JN1H 4OD2A 1MCWW 1J0IA 3F7PC 1QLFA 4L1DA 4NKQB 4N0YH 1AHWB 4QGYA 3T4YA 5I76A 1HIML 1X5FA 4KAQL 4PRDA 1I3GL 3EJYD 1PFCA 3BPCB 4YK4B 2RCSH 5DEGB 4DUWA 4GAGH 4XVUD 3IJSB 4PGCB 2BSSB 4X80H 1QFWH 2YPLB 4LLWB 5DQJB 5EC2B 5D7SL 3O6FC 5EU6B 1G7LB 4PGBA 3LPWA 3C6LC 4PRIB 3QO1A 4JRYB 3DMMA 1DN0B 2D0GA 1KJ3L 3AVEA 3FB5B 2EDBA 1D5XB 5E8OB 4JQXA 1JHKL 2BNRE 3F7VA 4QRRD 2PCPB 4MJ6A 5F3BB 4I3RL 4NHUB 4HSQA 3PQYB 3ZKXB 2BNQE 3NMEA 1II4E 1GOGA 4I3SH 2F53E 2R15A 4WEUD 5F7FA 4WW1B 1A8JH 2P5EB 4ZOAA 4L5FL 3QULB 1WK0A 3TV3L 2D4FA 1JUFA 3LMJL 3AS3A 4WU5A 1GGBL 1GGIH 3AFLA 5CWSA 1M7IA 3ARED 1DVFD 8FABA 2JJUA 2RFXB 1WJ3A 3TA3B 1IGYA 4L8SC 5D5MF 3FQRA 3MLRL 2CKBB 3QWRD 3QXAA 4QHUB 4J1UB 3SGDH 1W0VA 4NT6B 5JW4R 3HAEB 2XT1B 1SY6H 1Z3GL 3S36H 1L7TL 1JMXA 3KXFE 1JHLH 4XRCB 5EZOH 3IT8D 5K59E 1EEUA 3V9FA 5CJOH 1VDGA 3ZE1F 3O6LH 5CHNA 1C1EL 4OZHE 4YHYC 4X5LA 3AY4A 5DMIH 4R0LB 1X5JA 1QVOA 2DLHA 3HI1B 3O41B 4HIIB 1O7VA 4G9FA 5BW7A 3SO5A 3GM0A 1NLDH 1I8IA 3WS3B 4JKWA 3MUGB 4PJ9A 2HG5B 3QEQD 4M93B 2JIXD 4I48B 4AENA 2EH7L 3QHFL 3QUZA 5FO9B 4P9HH 4O9HL 4H0HB 5D1XA 1C16B 2OTUA 1GAFH 5ESAA 4NZUL 5MEOB 2F9BT 1JNLH 3SO3C 3JWDH 3EYSL 5EBWA 4Y16A 2BVQB 4XMLL 3W82A 3SY0A 3BZEB 1CGWA 3FRPA 3HG1B 3G6JB 2DN7A 2EE9A 3ECBB 3S35X 1P4LA 4KQ3L 1J1XL 1UZ8A 5D7JD 5KJRH 3K7UA 3BW9A 3SDCC 1OGAA 3HE6D 1MCQA 3D6GA 2ADJA 4POYA 1SYVA 4R2GD 3TNNB 5SWZA 1OB1A 4TN9A 3TNMB 4OI9A 1NCBL 3BX7C 3KPRA 3P3YA 4EVNB 1GIGL 5A2LH 1T89C 4P2YA 1I1YA 1FNSL 2H9GA 3KPQB 2YR3A 5DJCB 5CEXA 1S9YB 1TJIL 2FZ3A 4ZPTB 1RK1A 3QDGE 3MXWL 3WFEH 1BBDL 1DQTA 2XQYK 5CMAA 4H1LB 3G9VA 1U93B 5JXAH 1T0MB 1NLBL 5DHVA 1GRWA 1QKZH 3QA3A 3ARDC 4U7MA 4BZ1H 5JQ6H 2A9NL 3I75B 4QRSA 2HKFH 4Z5RB 4QOKE 1C12A 1FO0A 4X4XA 1YEEL 5DD3L 4U6YB 1AR2A 4YHPA 4GW1B 2E3VA 2IFGA 2BERA 4G7YH 1LD9B 1LO0L 2NY6C 2K7QA 35C8L 2FBJH 1DL7L 1ZWIA 2GJJA 4ZSOB 5ESQB 3LIZH 5FO8A 1VA9A 1VGEL 2P5WA 2AABH 4FTVA 5CIPB 4WFED 2HH0L 1QNZH 1FIGH 3MV8B 1DN2A 3MTRA 2DQEH 4BH7A 5CJXC 3UX9B 3STZA 4PYGA 1YEIL 4OB5L 1PKOA 1IAIL 1R24A 4WO4A 3RTQB 3VA2C 3ARFD 3MNVA 4BYHA 3MRIA 4ACPA 3GI8H 4TUKH 1XCTB 1BVZA 2NY2D 4YAQB 2EH8H 4XP5L 4W70A 4ZFOL 2B20A 1YQVH 4KDTA 4P2QB 4XCNB 3QQNA 5L8KB 2EIZB 4ELMB 2CKNA 1OP5K 1YN7A 1U58A 3BN9C 2WP3O 1M1SA 3IGAA 2V6HA 5E8EA 1G7PA 4P4KD 1RUPL 5EWIL 4TRPH 1AH1A 2J5LC 1CXFA 1CLZL 3IRZA 2OTWB 1A6TA 5I66B 1TJHH 1A6AA 4MNGB 5C0AD 4JHBA 1VKXB 5A2IH 3VI4F 1S8DB 3RZCC 5K33A 1J8HD 2CSPA 3G5VB 4RWYH 5L2JA 5D9SB 4BELD 5F89A 1KB5A 1J1OL 3P0VL 4XTRD 3GB7B 5IG7B 1PJ9A 1Q0YL 1D6EA 2NY0B 5EORH 4X4YB 1Y6KR 3LN5B 5GSRB 2YEZA 2PO6D 5F96H 2Y23A 5GGVL 4IS6B 4YDJB 2XZZA 3D85D 4L3EA 1RVFH 3CU7A 4HS6A 4MCZB 4PJHE 3CH1B 4R90H 5I1DA 5BOPA 1B0RA 1LEKB 2XWJA 4M8QB 4C83B 2APBA 4FQHB 3MBED 2G60L 1JPFA 1ZHLA 5HDBE 5LGJA 3BP7A 1BGXH 3ILPA 4GG6E 5ESVB 5E56A 3NAAL 1MELA 2VERN 5I30L 4PY7A 4XP9L 4R4FL 2Q86B 2C1PA 2AK4D 8CGTA 4Y2OA 1H0DB 5JIHA 1QSEA 4PLJC 1Z9MA 2D4DA 5DHXB 3CVHH 5IWLA 3WXVL 5F7UA 4UBDD 3HA0A 2VR5A 4LCWA 2AGJH 2BVUA 2P8LA 5CEZH 2MNUA 3FN3A 3MYZA 1FPTL 2E7MA 4QCIA 1N6VA 1S9KC 5KVGH 1JI2A 4RGND 3J8F7 3L7FA 3HB3C 1QP1A 4LRNH 3RDTB 5IJVA 1C5CL 5DVKA 5EPMA 5T1KA 3SJVE 5KTEH 2Z31D 2BVPA 5I8EA 1I1FA 4PJ7B 5F9JA 1EBPA 3ZL4H 5DI8A 3HCVA 4N0RA 4MQ7A 1MFAL 1PAMA 4WUUB 4LKXB 5GZOC 5HVFB 1KT2A 1MFBH 3FFCB 2ILLA 3NIDE 5EU6E 1YEDA 5E6ID 5HHVH 4GJTB 4PRIE 4L3CB 4HBQA 2Q20A 2C26A 3CDFA 1CG9A 1EXUA 5HVHB 4I0KA 4JM4H 4JPIA 2BSRB 4HJ0D 4BQ9A 2FIKA 1XT5A 1AHWC 1LGVA 4MXVF 3LRGA 2BVEA 5DS8B 4WWKC 1HCFX 5CKGA 4L4TD 5JIKA 1FGNH 1AFVL 5CZVH 4ZG1A 1MY5A 4JFFD 3F65A 3E6FA 5TJWK 3GO1H 1T20B 2BNUB 1YJDC 4YUEL 4NGHL 1RUQL 2A6IA 1Q9OA 4LQFH 4JFEB 3P77B 3DURB 4ERSL 3X12A 5DF0A 1Y18A 3OXSB 2A9ML 1NUFA 4XNUH 1RZ7L 1WC7A 2A6DB 4FXGA 1P4IH 3PABB 5GGUB 2ZCKL 3MC0A 5FYKH 1CL7L 1KBGH 1NL0H 4B5EA 4EN3D 5CUSL 1P7QA 5K9KB 2XKNB 1IC5L 1KGCE 2QV2A 2DQHH 2WWKO 4FG6C 4K3GA 4KI5E 4A2MA 5F88A 5KVFH 2E27H 5J7CC 5JW4N 3QPXH 4O51A 4Q9QH 5ICZB 4M7JL 4OQ1A 5FOBB 1T3FA 3MBXH 3VG0L 5GGQL 3SDAD 4NYLB 3U46A 1JTOA 4KXZI 1RIVH 1IC4L 1UJTA 4JFOA 5IB5A 4K7FA 2JTDA 3L5WA 2V7NB 4UT9H 4WCYL 1PYWA 1FYTA 3HZVB 1CE1H 2NX5D 3DSFH 5KS9A 5AZEL 1MIML 4XCCL 1FLRL 5TGBA 3RWJA 4LNVA 3MPCA 2R0WH 4PG9B 4OIAA 3VXMD 2JK5A 3QH3B 2E9JA 3I6GA 4HUNB 1EIBA 4HIJB 5DT1H 4KKCC 5HPMB 3TA3C 3D39A 1BFVH 4M6OL 1S9WA 1KJ2H 4PRPD 3LS4H 2HJFA 4JFYA 3BZ4B 3MRDB 2R4RL 4I18A 3SKMB 1GL4B 4HWZB 4Z76B 5EB9A 3LDBB 4MQXD 4X8XA 2HTLD 3CFKA 3WLWC 1ROWA 4LHUB 4O2CA 4Y4HD 1A7NH 2VWEE 1ZGLB 1HYSC 4HHAA 4KK9C 5IEKA 1DUZB 1EEYB 4R0LC 6CGTA 3WDIA 1WITA 3NABH 3FO0L 2VC2L 4P23C 1MJ7L 1YMMA 3FN9A 1ZLWK 2VABA 4NQCB 1SYSB 2Z35A 1U3YA 3TC9A 4DTGL 5B39G 5KBNC 1RFDH 1YZZA 1R5WA 2X4OB 5SV4A 4HGWA 3WKNA 1F6LL 4HG4K 5GGSA 3GMRA 5KSUA 4BK5A 4PJIF 5CGTA 3BHBB 1D6VL 5ICXA 5K59F 5A2JH 3NIGE 5C9JB 5DD6B 1DBAH 4YDVA 1DEEB 4RGMB 1TIUA 4R7DA 1A1OB 2IC2A 2Y7QB 3CZJA 4K71C 4QRQB 2YPKA 2DQFB 3AREA 5FYLD 1R3LB 4MDIA 3W39A 4DVRL 1TCRB 1GC1L 4NCC2 5SWSE 1A1NA 5L9DH 4S0SD 2BVOA 4WY7H 5FF6B 2P4AB 3H9ZA 3LZFL 1ACYH 4TUJB 4KGLA 1PX4A 2FYYB 4GS7B 3GJEB 2PYEA 3CFJA 4JO4L 3RGVD 3NTCH 5FM8A 2AV1B 1BM3H 1OY3B 4KHXL 1CDBA 4E0RA 4OZIA 3BEWB 2IPKA 3JTSB 1AGDB 4L29B 4MD4A 1EV2E 2R2BA 1WZKA 5J6HA 4ZNEA 3FHAA 5D2NA 4RAHA 1R3KB 3MGTB 4PS4L 3TVMB 2I9LB 4RZCA 3U30C 2MTPA 2D7OA 2LU7A 3KLSA 1CR9H 3QQ9C 2VQTA 4OF3A 3B6SA 4JB9L 4GXUM 1H5BC 3GKWL 2B7DT 2MKWA 2GK0A 1INQA 4ELME 4HLZG 3EOBB 4TNVF 4ZTPL 2Z92A 4QO1A 1L0QA 3WNOA 2YZ8A 4WJ5A 1BD2D 4DVBA 4S10A 3DXAB 4N5EC 4GKZA 3HE6A 4LDEB 1NFDA 5TE4H 4K8RC 2AVGA 1MRDL 3AUVA 5IJKC 5DRWB 3FQXA 3UPAA 3U0PA 3DO7A 3VMNA 4XI5C 4P2RE 3ILQC 4ZFGL 3M07A 5DMKB 4J4PD 2X5PA 4Q9CA 1F8TL 1GH7A 2VJXA 3RA7H 1X4YA 2IAMC 5DJAA 1KC5L 1FAKT 3SE3C 4AEHL 1NUGA 4MXQC 5I15H 3PP3K 5I17B 4M6MH 1ZXQA 2HA1A 2XI9A 1IARB 1CLOH 2Y5TA 4QWWC 3O6ML 3JXAA 2GJZA 1HHHB 5DJXB 3KJ6L 3VG9B 1EZVX 1QSVA 1JNNL 5FYJU 2NNAA 4ZUVB 2NY0C 4BH8B 5IF0B 3EFFB 5I6XC 1PDKA 5J13B 4HWBH 2B4CL 2DQIH 4PJ8C 5CZKA 1Q72H 2ITDB 4FZ8H 4ZAKC 2X4RB 3X11B 5D6CB 2ZUTA 2EDNA 3MUJA 4YHZL 4EIZC 2I26N 3MMEA 4UU9A 5ID1A 3ARFA 4U05A 1J0ZA 3ZTJG 4WV1A 1TJGL 1U3ZA 5BRZD 5FYLL 1MCEA 4XNMA 3W0WA 2R0ZL 1CFTA 1OLLA 3HMWH 2OSLA 2EDJA 4QHKJ 1A3RL 3GBNH 2AV7B 4HK3J 5F6HJ 4YHLH 1J88A 1WFUA 4ZNCD 5JLZA 2YRLA 3LQZB 1EJOL 4KKLD 5FK9A 5FKAB 2VKXA 4R7NA 4FQLL 1JNJA 1YEGH 3IDYB 1EAPB 4P4KA 4ONHA 1D5BA 5JA9A 4X7TA 5ANMB 3S35H 5EU4B 3RDTC 3V4VH 4PUBL 1A7RL 5JHDB 4JDVA 1LO3H 1F3JA 3P4NB 2OL3B 5CEYB 4EIGB 2X4QB 1HH6A 4GG6F 5KSAA 1F90H 4LVEA 2FDBP 3VGEA 1QRNB 1BOYA 5SX5K 5D6DC 4X5XB 3IXTB 3O8XD 5L6YH 5C07A 1M7DA 1T1WB 1YNTA 1GOFA 3LS5H 1N2RB 4H5SB 4LVOC 4Z7VF 1AO7B 1NGYB 4M62L 1O7SA 4M8VA 5IP4A 3U4EB 1I7TA 4U6TA 5DA0B 3QUKB 4OD3L 4OLZH 4LCCB 3ULUE 1LNUB 4GQPH 3SBWC 5HVHC 4N8VA 5A2FA 4KJQD 5H94B 4GW4B 1BVLA 3WE6B 3V52H 3MBEA 1YY9D 4JFZL 1FORH 4XWGL 2NY7L 3GMLA 4QF1A 1VGKB 1U2HA 1TQBB 2XQBH 1G6RL 1XIWD 5C0DA 4HBCH 4MA7L 3FHQA 4GXVH 7FABL 2V2TB 5J1SC 3MGAA 3BISA 1T21A 5KW9L 1RZJC 3IXAB 3BP5A 2DTSA 2XXCB 4OZFG 4NO3A 1T5XB 3ULUC 4P2CG 3FTGA 1I1AC 1HQRB 1RHHA 4LQ1A 3DVFA 3EGSA 4Q0XL 4K3EH 3NIDF 5DUMH 3MLVL 5L2KB 3MLUH 2J3SA 4QLRA 3FO1B 1ZGLM 3VXRB 3WS6A 5AYUH 1G7JA 2FJHA 3G08A 5L0QB 4NUGL 1S7QA 2Z31A 4A6YH 2GKIA 5AZ2L 1NMBH 3DTXA 1FNEA 6FABH 1MI5B 1N59A 2H45A 1D7FA 1UYWL 2WBWB 3SDDD 43C9A 2FX7H 4X9BA 1PG7X 3AAZA 4GW5B 3TCXA 4Y4KD 4XZUB 4NQUA 5I1JH 4IOFC 5DR5H 3MUY1 4U6HA 4U7KA 3D87B 2QSCL 4PRAB 2AJXH 2ZP0T 2IBZY 3KYOA 1MAML 2SEBB 3GMMB 3H2WA 3CFDA 4L4TA 5JZ7D 3DUSB 4KI5F 4YXHL 5C86A 2XYCA 3WUWB 1F6AA 5F1NA 4ODSL 3HNVL 1Q94B 1VADB 4UV7L 5IT2L 5E9DD 2NY1D 3LDBC 3DX8A 1XGYH 3ULVH 5JOFB 4YE4H 4ONOA 3M45A 1JV5A 4LVHC 1RMFL 1WEJL 2Y06H 4OZ4B 2VRAA 3QQ4A 4EUPH 1XH3A 2J8UE 3KPMB 1ZLVK 2F5BH 3MLTA 5IMMB 1UH4A 2I24N 4EN3A 3QIWD 1Q9LB 5T3ZE 2H26B 5GRVL 3RIAF 1A7PL 1SJXA 4U1HA 2W65A 5FO7B 4M48L 1CCZA 3SDAA 2W9EH 1CWVA 3N50A 3WFCL 4Z6AT 5D2LE 1UB5B 1DEDA 1JGVL 5D1QD 3SGJC 1E4WL 1SBSL 4HIXL 3ZHDA 1H3PH 1G9NH 4U1GB 2Q76B 5I1CH 4P46D 2IBGA 3GSOB 4FMKA 2E6JA 2H41A 1ZHNB 4KMLB 3NCYS 2UY7A 3CGTA 4RGMC 1K8IA 3VI3F 1IGJA 4GKNB 3BMVA 3T2NL 4P5MB 2CR6A 3GSVB 3P0YL 2KQMA 4RIRB 5KSVB 4I3RH 3QEGL 4NQEB 1F4XH 2BC4A 2COQA 3QFJA 3BVNA 1CE6B 4GRMA 5SV3A 3O6FD 4JG0L 1TFHA 3LOWA 3BAEL 5E7FA 3C6LD 4GS7C 3HI5L 1G1CA 1NCDH 2Y25A 2HFFB 3FO2B 4Y4HA 1SVZA 3TV3H 4MNHB 1FVDA 1HI6B 4NRZB 5D70H 4XXCC 3LMJH 4D0CA 5L88H 2A73B 4OAWB 4WW2B 4NQDB 4P9ML 4R8WH 1OCWH 3JZ7A 2H8PA 1LE5B 1D5MA 1FVEB 1I8KA 3DXAE 2ICWI 2MOVA 4JDZA 1H3UA 5AG9A 3FQNA 4JZOA 3TVMC 3HZKB 3HE7B 3DNKA 5FGCE 1T4KA 2ATPB 1A6ZB 5MHSE 1ND0B 1YEJL 3K4AA 3WN5C 1C1EH 2RGSA 5J57B 2CUHA 3RPIA 4F7TB 2WAHA 2XWBA 4WHDA 4PJGA 4IHOA 3T09A 2JB6A 3GSNL 1RUKL 4KUZL 5KSBB 4URTB 5FB8A 2BOCB 5E24E 1NGPH 2F53D 2Y6SC 3WJJC 3I3BA 1R3JB 4MAYA 3HC3H 3MLWH 1A3LL 4O9HH 2APWA 1K4CB 2X09A 4YDIL 3V0VA 3EYVA 2CIIA 4GOSA 4P4RB 4LPTA 3O3EA 4LK4A 3EYSH 1JZ3A 3T77A 1FZKA 4FRWA 4XMLH 4Q6IA 4MSWB 2JJSA 4YXKH 4V2BA 1MJ8H 4MDJB 1Q8MA 1JYXA 2PUQT 1TDQA 4D9LL 1J1XH 2X7LA 1U3HC 1FV1B 3S5LA 4UB0H 4Z7WA 2FL5B 3O0RH 5DJ6B 3JWOH 3MRFB 4U6VH 2ZOLA 2Q1EA 3I50L 3KXFD 3VFOB 1KYOK 1K3ZA 1W72L 4K9EC 3KPSD 4OBRA 2X44D 5I8CB 4ZYKB 4CNIB 2DYPD 1HH9B 3IFNH 3MXWH 3FQTB 2NXZB 4PLKC 3MA7B 1FNGB 5B3JE 3SDCD 4HUVB 4KMTH 3EO0A 3QNYB 1IGMH 2J7LA 5D1ZC 3TYFB 2W60B 5F6IB 4XMKL 1T1ZB 1MCPL 3VWKB 5B22A 5JHDE 1G6RA 2VITA 4G5ZH 5DVOA 4JFDA 3L95B 4NUJA 3RFZC 1DL7H 1QRNE 4G6AC 5B8CC 4JM2F 3C5SA 5EIVA 4NQVA 1RZIB 3TPUA 3MROA 2HH0H 3IDYC 1KN4L 4UV4L 3ARDD 1YEIH 4FHBD 1IAIH 3LD8C 5LKNA 1CBVL 2VXUL 4LSRL 5C0JB 1DDHB 3QO0A 3WLBB 1YPZE 2NY6D 2X2YA 1U8OB 5EO0B 4LFHG 3E3QC 3GNML 4XP5H 2ADIB 3QG6A 2VZ3A 4HFWB 2Y9RT 5KG9B 5ICYB 3HRZA 1FG2A 3HMXL 4FNLL 1RUPH 4AEFA 3DOSA 4Z7VB 1ZMYA 4G6ML 4QOKD 4LF3A 3UTSA 2HVKB 4WEBL 4G7VL 2XIDA 1RK0A 1ZT7B 1OAXH 2E8ZA 3D2UB 4YHKL 4HPYL 1BIIA 3NOIA 1A21A 5ILTL 1NJ9A 4M4RA 4K7PY 1OGTB 3QDJA 1TQBC 5BRZA 3QQ3B 3R4DA 4H20L 1EVUA 1EFXD 4G8GE 3OF6D 2B2XL 3BN9D 3OAUL 3LKQA 4QHNB 1IEHA 3N1FC 4ZPVA 1GGCH 4UIMB 3IDIA 3NACL 3PWVB 1I1RA 2ERJC 4R96B 3GJFA 3HUJF 2LQRA 3P9LA 4WTZA 2KL6A 3BGFB 2VLKB 3LRHA 3JV4B 3FCTB 3DX7B 4N0FB 5J6GA 1N5YL 3RZCD 3VD3A 4TNWF 3MRPB 3WD5H 2DWDB 1I8MA 2Q8AL 2XN9B 4LHJB 3CD4A 1IT9H 1CTNA 1IGFL 3F58L 2AEQH 4WFFE 4CU6A 1KNOA 4MX7A 3GEWB 4AIZA 4CADB 4XC1L 3QZWB 1ZKAA 3O8XA 3UPRA 4DUXA 1NAML 3L3IA 4M9PA 3SDXB 1YEHL 3DRQB 2B1AL 2EDFA 5DUPL 1MNUL 1FPTH 3T4YB 1IM9A 2XNAA 4L8BB 2WNGA 3T3PF 1CS6A 3H3PL 3U1SL 3RJDA 3WIIH 3TBVB 1SEQL 2FWOB 2IQAB 2Z9TA 3KS0J 1OQOA 4H0IA 3IS0X 1C5CH 3R06A 2W91A 3GRWH 1NANH 3SE4C 3O11B 4PLJD 3RVWC 2PYFB 1VPOH 4KUCD 4WI6A 1YUHB 1VERA 4KVCH 1MFAH 2JJVA 2Q6WB 4JHZA 4UT6L 1T1XA 4HKXA 3W9DB 5IBTH 3F7VB 5E4EB 1N0LA 1I7RA 1ZVSB 5INCB 3EO9L 3HB3D 1Q38A 3M1BA 3PNWA 4NNXA 4ISVA 2X6MA 3AS0A 3BP4B 3RWIB 4P57A 3EKCA 3ES6B 5EULV 4TVPE 5D8JL 2VE6B 1UB6B 1NBZA 5DZOA 5GZOD 3VJ6A 5DMJB 4QNPF 4ZFZB 1JUFB 2J8HA 3FAXA 4LPCA 4WU5B 4LCUA 4YUEH 4NGHH 4ODWB 4POUB 3X3FL 3OAYK 4HUWA 1ZT1B 3GSUB 4D8PB 4JQVC 4LSVL 1AD0B 3W81A 2A9MH 2Q8BL 3MFFB 4QYOA 4JQIL 4DUVA 1CVSC 2ZCKH 3D3VB 3VXSE 2R4SH 3GSNA 4WWKD 2YA0A 3DV6A 4NHCH 1IC5H 1OSZB 4HKBB 3QI9A 3MYJB 1CK0L 4XCFH 3M17B 1HZHH 3MV7E 4OT1L 1SBBA 3VG0H 4UQ2A 2YPLD 4JREC 4HZAA 4LSSL 5EU6D 3X17A 4N8CL 5BV7B 5E00A 4PRID 5E9DA 4JRYD 4JZJA 1IAKA 4TQEL 3MJ8B 3WNMA 5EZLA 3GFUA 1S5IL 4ZFFA 1MIMH 1YNKL 1FN4B 1FLRH 1KLGB 3HPLB 3QUZB 2DMKA 4WW2C 3NFNA 5FYJH 2BVTA 3CJJA 4FG6D 4GLRH 1QFUH 3IFLL 3RIAK 1J11A 3PQYD 3RX5A 4NBXB 2Y36H 4E42A 2ZUXA 3QIWA 4YDKL 1U8PB 3I3DA 5IMKA 3SQOL 3BUTA 2HJKB 3A6CL 4F7CA 3IFOA 4Y5VB 1CFVH 4NOBA 3HE7C 4XP6L 5HI5C 3SKNA 2R4RH 5C0CE 1EA9C 4HEPG 1KLUB 1OGAB 4PTTA 5D1QA 1UADC 2FHBA 4JRXB 4OZGE 4XMPH 4P46A 1HEZB 4N90E 5MENE 4QEGA 4MGXA 3ZT6A 2I60H 4KKCD 2APFA 2H9GB 3TT1L 1IFHL 5EZJA 4HV8A 3TA3D 1TZHA 4FQXB 3FT2B 1R5VB 2FD6L 1XZ0A 3MACL 3G6AA 3SKJL 1RK1B 2CGRL 3IETA 2PTUA 1NKOA 3KPNA 3MA9H 4P2OB 4XPTH 2AKRA 3T0BA 4P59L 3WLWD 3P9MB 1N6UA 3CX5J 5DHVB 1HYSD 2ZCLH 4KK9D 2GJ6B 4NN6B 4RNRA 5IVXE 5BOZG 5EO1A 5DUBB 4ETQB 4JY6B 2PW2A 4X4XB 1D6VH 1PG7H 2KUTA 2X1OA 4P23D 4FQPA 12E8L 4ENEC 4P99A 2EIBA 1T2XA 2VZTA 1KJVB 4K55A 1X7QB 1ZWIB 3OXRA 5FECB 3OR6B 3NCFB 4X4MA 5GSVB 4U3HA 1MWAL 3P4OA 1VCAA 1VFBA 2P5WB 4DVRH 5DJZA 2G5RA 3VFMA 5KOMC 4JVUA 4JG1H 4PJFA 4BH7B 4F57L 4ZUTB 1UCBH 5DEFB 2P24B 3LZFH 4B0MM 4PJDF 3VE0B 1V3KA 5D7LB 2C4FT 4QHLA 4JO4H 1N6QL 2NXZC 1DQDL 3K8KA 2CDGB 4KHXH 4KK5C 5DVLA 3TN0B 2JB5H 5ACZB 1HINH 3L1OH 1K5NB 5FHBL 3BQUB 1FL6B 5F6IC 1MCSA 1RZGB 1JWMA 2ORBL 4Q9RL 4WGVB 4PGDB 2FJGA 2QQKL 4L8SA 4KWUA 5A40E 2DMBA 3ARWA 2ZKHL 5JW3L 1N64L 3ZYZA 3BUYA 1C5DA 4GRWB 3GMQA 3V8CA 4OV5A 1YJDL 3KJ4B 4XAWL 4JB9H 2YBRA 3GKWH 1A6AB 1IM3B 1D9KC 3C09C 1KEGL 1XF4A 4ZTPH 1NCNA 4CVXA 4TTDC 4CAGA 1JGLL 3DYOA 4WI7A 1FBIL 2C7UA 4XAKD 5F70A 5A43C 5SWSD 4WHYG 3IJYA 2EDDA 3X13A 2QQNH 4NO0B 4JPWL 1S7SA 2WW8A 2HYMA 4JJHA 4KKNA 3QQ9D 3MJ9L 1MF2H 4CMHB 1HXMB 4KMQA 3QUYB 1MCKA 4YBHA 4XVTL 4AH2B 5IEHA 3QUXA 1UXWA 3T0EB 4UMGA 3VFWA 5GRZA 1NAMA 4ZFGH 3KPSA 3RVVC 2YXMA 5LGJB 1VESA 1F8TH 3UYRL 1XR9A 2DYPA 4XCYB 2C1PB 4M6NL 3UMTA 3QXWA 5HYJA 4U33A 1EPFA 1KC5H 4N5ED 3SDCA 4AEHH 2X1PA 1P1ZB 4EBQL 2ZSWA 4K8RD 3S3PA 2LAGB 3V5DA 3MRHA 3GUTB 2FH8A 4NKDB 2CKBL 2P8LB 1BVKA 4XI5D 3GIZL 3U0TB 3S4SA 3EZ8A 5T1MA 2A6KA 2DD8L 4JFPA 4JGMA 1HKLL 3ILQD 3RQ3A 1WTGT 3LB6C 3PWUA 4CN6A 3CSPA 2B4CH 3WSQL 4S2SB 2IAMD 5JOPE 3BGFC 4MXQD 5I8EB 4AT6A 2XG5A 4MQ7B 3T1FA 3HUJB 1CN4A 4QWWD 4H88L 4R4NC 1T7YA 1NUNB 5ELIA 5FYLH 5GHWL 5IOPA 1KPRA 4HX1B 3IRPX 2KKQA 2NY0D 1YEDB 5K9OB 2VZ1A 4PB9L 1EHLL 4CJ1A 3QNXB 1CG9B 4PJ8D 4JPIB 4OFKA 1CXIA 4ZAKD 1NCTA 2B0SL 3CDYA 1Q1JH 4XBGA 2LTQB 3PWJB 5IFJB 2YUWA 2AJYL 3LKNB 3CC5B 2PXYB 3C8KB 3L6FA 1PSKH 3FFDA 3E6FB 4F33A 1A7RH 4JO2H 2A74B 3SE9L 2NY4B 1Q9OB 1ZLUH 4YGVA 5HHPA 3U4BH 4YR6B 4R9HA 4HUUA 2BXZA 2Z8SA 5C0IB 3OF6A 1ZGLP 1JGEB 2L0DA 2V9RA 5KOVC 4J6RH 1GZQA 4JQXC 3EZJB 4M7LT 5IMOB 4DKEH 1OP3H 4HKJB 5TDPA 3MRMB 4ODHL 3MLZL 4O51B 3RDTD 5I2IA 1BREA 1T3FB 4BFBD 1BQLL 3IU4L 4S1QH 5CD5C 4TNWK 4LSPL 2UWEA 4XWGH 1BJ1J 3MRQA 2NY7H 3DVNB 3E6HB 3QDMB 2ATKB 4PV8A 3RZCA 3IFPA 5DRZA 1AGEB 4I4WB 3AS2A 5C0NC 2IBZX 1IEBA 4K7PL 7FABH 3VFPA 1HN1A 2CIKB 4HUXA 4PGEB 2J12B 3FFCD 4X9HA 3MV9A 2JK5B 3WNPA 4G9FE 3I6GB 1KFAL 4KV5E 1F4YH 2DKSA 4DW2L 3IDNB 2R9HC 2EXWC 1X5IA 4OD1L 4Q0XH 3SOBL 2YSSB 5DD0L 4JFYB 4PR5B 1JGDA 4X0KA 3CU1A 4LEOB 2YS4A 1N26A 4K8RL 2P43B 3QWOA 1U8JA 2CJUL 2IQ9L 5EN2A 1KPVB 5HHME 5ISZA 4Z7UF 4UDUA 4JFED 1NGXA 4FXKB 1TLKA 5BW7C 4EDWL 4HK0A 5BV7C 5GISH 1BFSA 1JZ6A 3QHZL 4EXPX 2HT2C 4I2XA 3ULUD 1I1AD 1FFOB 5C2BL 3GKZA 1BOGA 5CS7A 4AG4L 5FA4A 1OGAE 1IZKA 4J8RB 3N1QC 3QUZC 4N0CC 5SWZE 4UDTA 3RU8L 4JFXA 3KPRE 5D1XC 3QPQC 1ORQA 1MWAA 5EOCH 4QRPA 5KANG 3DRTA 2BK8A 1VB9A 2VXVL 4Y16C 1MAMH 5J1AA 1OVZA 3O4OB 4YXHH 3HTLX 3TH3T 4OSUL 4OLVL 2VH5L 3E0GA 4ODVH 5A2KH 1QD0A 3HNVH 1N0XL 3WO3B 4YO0B 4Q2ZA 1ES0B 2A83B 4UV7H 3ZHLA 3UTQA 1I4FA 4BJLA 2QL1A 4Y1AB 3EJZC 2ICWA 4MA3A 4ZS6C 2YPKB 3PP3H 4IOFD 4PRBA 4BZYA 1CYGA 5DJYB 3W39B 2VIRA 1A1NB 3ELAT 2BVOB 3PE9A 4K94C 2FX9H 1AHWA 1YDPB 1MLCB 3H9SB 4KJYB 2VL4A 4YEFA 4Z8FH 3BH9B 1A7PH 5C71A 2R69L 4FTVE 2P5WE 2MKLC 3IJSA 1X5HA 4QY8B 3BDYL 1WAAF 2BSSA 4G8EB 4ZS7L 4NZRH 1JWUB 2VZUA 4E0RB 2YPLA 4LLWA 5DQJA 4LHUD 5EC2A 4F8TA 4M1GL 3WFCH 1G7LA 3BGMB 3S37L 4JO3H 1JGVH 4ZO7A 1E4WH 4HIXH 1ORSB 1YC7A 4MD4B 1KN2L 4JRYA 3WHE1 4X6DF 4D0DB 1DN0A 3FB5A 2DLFL 3TP4A 4BSWB 5I0ZA 5E8OA 3RAJL 3UO1L 4TOYL 2VDML 1SJHA 5I1KL 1IKFL 2PCPA 1KCRL 5F3BA 3B6SB 4F7EB 3P0YH 3PQYA 5GJTL 2BSED 4LSDA 5TE7H 5F7EH 3QEGH 1PW3A 1UWEL 3MJ9A 4ORZC 3GHEL 4MAUL 5F1IA 4U31A 2HFEB 4WW1A 4GRWE 1ZLSL 2LV4A 2P5EA 4WDIB 3V0WL 4WO4C 2DMCA 2R8SH 4KHTH 3HI5H 3QULA 3OPZH 5LXGL 3GRWA 3WHXB 5AAMA 2M2DA 4GKZB 3QJHB 1R5IB 4PJDB 2BHUA 4OQTL 4XPAH 3FT4B 3TN0C 5IVXF 2VLJB 3ZKNC 5T3ZD 1OAZL 3FQWB 5FEBA 1S7XB 1SMAA 4AK1A 1X5XA 3BQUC 3TA3A 3ARVA 4LAJH 3WL9B 2YKLH 4QHUA 1DANT 1KTKE 4ZDHB 4NT6A 2FHCA 4OCRL 3HAEA 1RZJL 4L3EE 3KJ4C 4UQ3B 3SCMB 2DS4A 4XRCA 4LVNB 3V6OA 5GS2H 1CD9B 2OTPA 1YEJH 5HGBB 4LBEB 4R0LA 3O41A 3HI1A 1UKSA 2GJZB 4HIIA 3FRPG 3EDKA 4EQ2A 3WS3A 3O2DA 3JV5A 1XR8B 5FM5M 3MUGA 2HG5A 3SN6N 1QSEE 2EIDA 1PZ5B 2RJMA 4I48A 4O58L 3TVMD 3F7RA 5FO9A 4LSTL 1TCMA 3UTZB 1P84J 4LCWE 4PTUB 1C16A 1QFPA 5ACLA 4CMHC 1A3LH 1FL3B 3CMGA 3LKPB 3QUYC 5E94A 5MEOA 3HRPA 5IIEB 1EVTC 3TBYB 2HWZH 3T0EC 3LSOB 1HHGA 1KOAA 3ARGB 2GI7A 1OWRM 2EECA 4LFHD 2GCYB 3BZEA 4QXGL 3MLPA 5ECJE 5HYEA 4WV1B 2EDHA 3HG1A 3G6JA 3ECBA 3W0WB 2VZOA 1PZUB 3DXAD 1MJUL 1NC2D 1X44A 1DSFL 2DLEA 4D9LH 5I73B 4JCLA 5C70A 5IWLC 1GGUA 2Y6SD 3TNNA 2MFNA 4F2MB 1T6VN 3TNMA 4GXUN 2QTEA 3OKKB 1JHTB 1EJ6A 3I50H 4M7KH 1QBMH 1FVCB 4UILH 1I1CA 5JW4Q 1RJYA 1AJ7