5CP3A

Crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides in complex with sulfathiazole
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPITLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSRVPDRFTGSGAGTDFTLKISRVEAEDLGIYYCWQGTHFPQTFGGGTKLEIKRAEAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSETDQDSKDSTYSMSSTLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Class-specific Monoclonal Antibodies and Dihydropteroate Synthase in Bioassays used for the Detection of Sulfonamides: Structural Insights into Recognition Diversity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Light Chain of Antigen-Binding Fragment of Monoclonal Antibo
total genus 58
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp3A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp3A01
4ODSL 1PSKL 4PJ7F 4S11A 3UEZA 2R2BA 3U4EB 5DRNA 3CDGA 4LAQL 1WZLA 4N1CA 3H9YA 2X4QA 4RSVA 3QIWC 3IU3A 32C2B 1DDHA 2BSTA 4L3CA 5KN5A 3ME0A 1FN4B 3OGOE 3U0PA 1KCVL 1JZ3A 2VLMD 3HNTH 2E9JA 2CGRH 4KRMB 4FQHB 5C0FB 4X6CA 5T3ZH 3BPOB 1OT2A 1IGMH 2HKHL 4XVJL 3O3AA 1P4LB 5BJTA 4J8RB 2UV3A 1OPGH 2C3VB 1EA9C 2V2WA 1ES0A 1BFOB 2XTJE 4KTDL 2AJVL 1FHGA 4XP6L 2E5EA 3D9AH 2VDOL 4P3DB 3LKSB 1HNGA 4YZFE 3FB8B 2YD9A 1IM3A 3KPQB 3CIQA 2MPAH 3O2DL 4NWTL 1XT5A 4UTBH 2Z35B 2J8UF 4LSPL 3WFCH 4LKCA 4P23A 2R0LL 5AYUL 4NO0A 2ATKA 2JELL 4A6YA 5J6HA 4F2MB 2YWYA 2R0KL 4K8RD 1EPFA 3CC5B 4JVUA 5DRZA 3WLWC 32C2A 2YUXA 1RZ8B 5EDXA 4Z7WB 2P49B 4NQCE 3WS3B 1TZGL 3J7HA 3RL1B 3AS3A 4HHAA 1SBBA 1B0WA 3VXSE 2X4NB 3GJEA 5JIIA 1AP2A 2BFVL 3QISA 1A14L 2EZ0D 5BS0B 3L3KA 3BW9A 2VC2L 1MHHB 1OARH 3UPRA 4PV9A 3M1BA 1MAML 3BYTA 2VDNH 3MUGB 4J7RA 3HG1E 1H3VA 4JHZA 5FEBA 3O6FB 4X9BA 3JVGA 3JWOC 3L5XL 4JPVH 2VYRE 2YPKB 3S37H 3OJVC 3C9NA 3CK0H 2JJSC 4KFZC 4U6TA 3G6JA 4K3JH 4MAYB 5DJ0B 1J11A 3C2AH 3L1OH 1AE6L 1IM3B 4MA7H 3ROOB 4XWGL 3UPAA 1BQSA 1F4XH 4G7VL 2WWMC 3BO8A 3BVNB 4Y4HD 3M07A 5E6IA 2DQIH 3D5OF 3TBWA 3FO9A 3OKDB 1UM6H 2YC1A 4FZ8L 1T04B 4MD4A 2VDQL 3QUXC 1T03L 1KFAH 4K9EC 4NO2A 5GGRY 3P11H 3PGFH 1XZ0B 2CPCA 4UMGA 2VR5A 1YN6A 3C09B 2DBLL 4PRAB 3LIZL 1JZ6A 1MPAH 1Y6NR 4BZ2L 2DQUL 4X8JB 2H32B 4L4JA 4RGNC 5SX5H 1U8QB 4R2GB 5MHSE 3GUTA 1F11A 1CFBA 2EDYA 4ODVH 4XVSL 3FN9A 2D9CA 2FNBA 3NH7L 4RMWA 4LLUA 5CILL 1FL5A 1DBKL 4LK4A 3V5DB 4OI9A 4QTIL 1PG7W 1JUFB 4ZNCD 2XFXB 1C7SA 2EH7H 2A6DA 5T5NG 5I8CA 4KKBC 2YA1A 1OTSD 1I8IA 3I6KB 1EO8L 1F3JB 3FT2A 3S5LA 1X5JA 4Z95H 4I5BB 5IG7A 1O5DT 4X9FA 5JPNB 3DNKA 1ZLWK 4DW2H 1XCTB 4Q9QL 1UACH 2V9RA 4P57B 1JNLL 2NY1C 1N59B 2OL3B 2QSCH 3BQUB 1KB5B 2JJTC 3MV01 4WO4C 5DEFA 2E27H 4NQDB 3MBEC 3KWWB 1OPGL 4XPBH 5E9DD 3TZVC 1IM9B 3DO7A 5HI5D 3T2QA 1VFUA 2FIKB 1NGYB 1XF1A 1FL6A 4X5WB 4YDKL 1WZKA 3GSOB 3HI6L 5INDA 4RWYL 3IDMA 2RCSH 3DXAB 2Q8BH 4L9LA 1EK3A 1ZANH 4HUUA 5I9QC 3X11B 5CZVH 2PF6A 4WY7H 4TQEH 1UYWH 1RMFH 3AY4A 3RY6A 3CMGA 1GXEA 2BMKB 1MFDH 3IXTA 3D25A 4EI6A 1RFDL 2CDFB 5LWYL 5FKAB 3QQNA 4Q9BA 2LAAA 4ERSH 4CBPA 3FT2B 4JJHA 1AHWA 3CGTA 4A2LA 2AAVA 1DEEB 5K9JL 3QBTB 5TH2B 5DT1L 5F89B 1XGYL 3MC0A 3PP4L 5EU5B 5BW7C 4MDIB 3SDCB 3VGGA 3VXRE 3LEYL 4CMMA 4JPWH 4XC3L 1AKJA 1DL7L 4P5TC 3RNQA 3QWQB 4M03A 1INDH 1R3KB 1TQBC 3NIFE 4I0PB 5DSCA 3C09C 4LHQB 5SX4I 4L4VE 5D8JH 5INDB 2FB4L 1J1XL 4NQSB 2IANA 2IALB 2N1KA 4PUBL 1NCCL 3GIZL 1MLBB 1A3LH 3LZFL 3NFNB 2VDQH 4Y16D 1HH6B 4HBCL 3PHQA 5IB4B 5F6HJ 2DQEH 3O45A 2DLFH 3FQNA 4N0YH 1BQHB 1UB5A 1EGJH 3FJTA 4TSAH 4HWEL 3UAJC 4P2QD 1IGCL 3DGCR 1N3NA 3O6LL 5DMJB 4KK8C 1ZK9A 3ABZA 4XVUD 3DYPA 3QDHA 5I1AB 2ICEB 4PY8I 2PNDA 1BZ9B 1KN2H 4MQXD 3FMGH 2BNRE 2GSGA 3L3OA 3OJDB 2XN9B 3U7AA 5HHOA 2R4SL 1UXSB 4KVCL 2WM0A 4KROD 2EIZA 1N6QH 1QFWH 4Y0GA 3O6KL 2C3HA 2R23B 3A0OA 2R0LH 3RWDA 3S36H 5DEZA 3NFNA 4FQ1H 1FNSH 1EAPB 5I73B 2RFXB 4JVWA 2VLRE 1Q94A 1A4KB 2IH1A 1BLNA 1WSST 1AC6A 3D0LA 5DJDB 1CTOA 1NAKH 3KHOA 4IIQB 1H5BC 1WVZA 4ELME 4D2NA 2J7LA 3SO3C 5J0BA 1H0DB 2X4TA 3S36X 4TTDC 3BESR 4PRID 3MNWB 2DBJA 2EE9A 4HK3J 4PB9L 3U0WL 5AG8A 4PYGA 5DQDH 5A2LH 1LD9A 5JHDE 4N0CD 2RJMA 2IFGA 4X6EB 5D7IB 3BJLA 3RJQB 4KKCC 4MDJB 2BERA 3TO4D 4M6AA 1TCRA 1CVRA 3Q6FA 5GZNC 4JM2B 1SJHB 1JF5A 2XTLA 3ZE0E 1ZT7A 4JPKH 1BBDL 1YQ2A 3TT3L 3CDYA 4P5MA 1DN2A 2OJEA 4YX2L 1ED3A 1MCFA 3MV7A 3MV7D 3MFFB 2BHUA 5DK3A 4AEIH 2EDTA 5DGQA 5E9DE 1CE1H 3MNVA 1TZGH 4F33A 2N56A 4QF1A 3O0RH 1CD8A 2ATPB 1VFAB 1DUYB 3GRWH 3ROLB 2Y5TA 2NY2D 3V4PH 4G6ML 4P5TB 4PJCB 3WE6B 3O2WL 4U1SB 1A0QH 2JB5H 3D85A 3U83A 4ZG1A 2OQJA 4F7MA 3WYRA 2ZUXA 4V1DA 4PR5B 4OLWL 4R96B 4MMZC 3CDCA 5JXAH 1S9XA 5EO1A 5GXBB 5TDOB 4ZSOA 4OZGB 4GKZB 5C0BE 5TDNB 1A21A 1W72B 4DCQB 1LK3L 2FX9H 4FFYL 3MCG1 4L4VB 4OFVA 5H35B 5JQ6H 4OT1H 4WVRA 1KJMB 4HWEH 4PJGF 1M05A 5CP7B 3BUYB 4LOUC 4L8SB 5F9WC 1CLZH 2DICA 5DMGD 3BHBA 4FHBD 1KBGH 3S88L 3NCYS 3P11L 2A1WH 4QRSB 5DK2B 3M8OL 1CICD 4C83B 1NPUA 1FZKA 4E41B 1QFHA 1II4E 3EO9L 1GGTA 4ONOA 1IC5L 1LP9F 3PDOB 3QIBA 5BJTB 1I1AC 2A6JA 4XNXH 4UDUA 4ODVL 4Q9RH 2ZCHH 3N0PB 4HS8H 5BOZG 3TO2A 1JI2A 3MACH 3HNSH 1PKQB 2Q8BL 4NN5B 5CILH 3UO1L 4TQEL 1S9KC 5HYSG 5F21B 3HE6B 1T3FB 3F65A 4HS6B 2C9AA 1ZLWH 1FAIH 4Z7NE 1ZGLB 2Y5EA 3IDXH 2AABH 1S7TA 2BY2A 3FOMA 4O51B 4CGTA 3BZFA 1UCBH 3TV3L 1HDMB 5F1IB 1S7SB 2FECI 1ZMYA 4G6JH 3IF1B 4FG6C 1OW0A 1YEEH 3K74B 5DRZB 4OGXH 4Z7WA 4LCIH 1YPZE 5IBLC 2NX5D 5T33L 3EIFA 3KPPA 2J6EL 3KDMA 4HQQL 4WIQA 3K2UL 3N1QC 4Z76A 4F8QA 2UVEA 5CCKL 1D6VL 2FATH 1CS6A 2J12B 1C12B 4G8EB 4RMVA 3C5ZB 3ILPA 1OWRM 1H3PL 1RHHA 3TCXA 3ULUE 2GT9B 1A7QL 4OFIA 2RCSL 5J13B 3TO2B 1LNUA 2PYEE 4N90D 4QHMA 5J06A 4PJDB 1QLEL 2NXZB 1KTDA 4S2SB 3WJJC 1TETH 5D2NA 2VLJE 5IT2H 4LBEB 3QEUA 1U3HB 1R0AH 1CTNA 4AEIL 1SYVB 3P30L 5GQBA 2CKBA 2CRIA 3VA2C 2IG2L 3RVWD 3WCYA 5IK3A 1IFHL 5EORH 4MD4B 5F9JA 3W11D 3GFUA 5CLTA 3ZT5A 5MI0C 3IU3B 1NEZG 2HJLA 2MFNA 4H0HB 2FZ3A 2NR6C 3L7FA 4PRPB 5ESAA 5AG9A 2KZ1B 2D9QB 4LIQH 3O8XB 3AU1A 4E0RB 4YDJA 5BZWB 1LO3H 4MYWB 2VLLA 4R0LC 1RUML 5DURD 4YDLC 3GNMH 4PLKC 1ZTXH 4FQ2L 2BOBA 4YHOL 4MGXA 5D1XD 2V7NB 3VXOA 3UTZA 4OUUA 1RZ7H 3S35L 3IFLH 1C7TA 4X83A 2ID5A 4KTEH 4MQSB 3B2UC 3G6DH 4HUWA 4TPRH 3MXVL 1FZMB 2ZKHL 3MYZA 5DLMH 1MWAH 3NFSH 4LHJB 5IFHL 4X6BA 4IRJC 1SEBB 2EZ0C 3HUJE 4M7JL 4KQ4H 4XPAH 1E4JA 4OF7A 4G43B 5HBBA 2ZSWB 5A16A 4RMUA 1AGCA 4XCYA 2OMNA 5F9JB 2WQ8A 3JV0A 3CLFH 4FQJH 4XNXL 2I07B 4HFWA 3MX0A 1P4IH 1NSNH 3TYGH 1MJ7L 2FZ3B 3DX7B 2JIXA 3L7FB 2V2TB 3OSKA 1E6JL 4WWKD 1L7TH 2XKSA 2NTFB 4YC2C 4L4VD 2WBKA 43CAB 1M7IB 1HWGB 4IM8A 1MHHA 5KSAD 1OLLA 5I18H 4P9HL 4UAOC 3STLA 2AV1A 2B1HH 1MCJA 3HC4H 2NY6B 1NAMH 1SMAA 2V5MA 4XHJD 2NY4D 3QUML 3ZLQC 4POZD 2K7PA 2LTQC 3CVHH 2UY7A 1R5VA 2UWEF 4OCWH 1WAAE 3WFZA 4JPKL 5BCAA 3T4YA 4XBPB 2J6EH 3ZYJA 2RHEA 3QHFH 1RPQA 4B41A 4OLYL 5KSVB 4JO1L 5BMFL 4GMTL 1P2CA 4PRHD 3AXLB 2C4FT 3MSPA 1K2DB 1NEUA 2Q3AA 4MWFB 5HJ3B 1WBXA 3QUYB 1HHGB 1RVFH 3O2VL 1U8HA 4NP4L 4RGNE 3RI5F 1YYMH 1CU4L 43CAA 1Z0NA 2D7PA 1OAQH 1WWBX 5D7JB 5JMOC 3LEXA 2IPTH 5T1KB 5EOCL 4F15B 1OP3K 5EOQH 2X4OB 5CJOH 1OD7A 5JHDA 4M1CC 1QRNA 4L4TD 1JPSH 3ZTNH 3OHXB 4PRIB 2Y36H 1KEMH 1N0XH 1NAMA 5DD6A 3HKFA 2GIYA 4HPOH 1WWWX 5BZDB 5DFWH 4LDLB 4XRCB 1IKNC 3FOLB 5E4EB 1S7VB 5FF6A 5KS9E 3FO0L 3RVVC 1FVCB 4LVHB 2ADFH 1HYSD 1ZTXL 1FAKT 2N7AA 3OKMB 1J8HD 1FG9C 5DI8B 2WINB 2A9NH 5DA0B 4KXZH 1ZT4A 2HKFL 3B2VL 4FXKB 4PRNA 4TULH 2VJXA 4X0KA 2DTML 4YHZL 4OQTL 1T6WA 2GI7A 1LEIA 2DJUA 4PJCE 5EBGA 3VRLE 3CSGA 2XN9D 1AGDA 5I6XC 4PIRF 3IDMB 3LEXB 5CP3A 1KCUH 5T5NF 5JDSB 1OAKH 2VXSH 4HXAL 4LP5A 3CVHA 4R8WL 5C0ND 4JGUA 4K94L 1DUZA 1YPZB 3VFSA 2NY2C 1KBGL 1BLNB 3JVGC 1MCOH 2FX8H 1A7NL 5T33H 3FOLA 2JJSA 1TVDA 2EDXA 4PPTA 3W39B 4KTDH 3ULUF 1ND0A 3BP7A 1BX2A 1IEHA 1IGIL 4NN6C 1LP9B 1HHKB 3LS5L 3QH3B 2ZCHL 1B2WH 4OQ1A 3HC4L 5GZOD 3L3IB 4EN3C 5KBNC 4NKOB 1FNEA 1Q9WB 3QP3A 4FNLL 5F6HI 3MJ7B 1RK0B 1QSFB 1AXTL 4ALAH 5EU6E 4UIKH 3BWAA 1AO7B 3GI8L 3O11A 4NN5C 1TCRB 1ZKAA 4DEPB 2BK8A 1HILB 2EYSB 2AABL 2VDLL 3RVTD 5SWQB 3V52L 1ZVSA 2QADB 5FB8B 1GCFA 5EH1A 2VL5B 3BKCH 2O5YL 5IVZA 3TBYA 2VC2H 1BQUA 1MELA 4M6MH 1CDIA 2AGJH 5EO0A 4HQQH 4KDVA 4BH8A 5IHBA 2DLTA 3SE8L 3VD4A 1B0RB 5A43C 5FYLL 4UT6H 4WO4D 3MGOB 1IGTB 3CLEH 3UBXB 4FQIH 5H8DA 2Z92A 3KLAB 3NZ8B 2Z31A 1BD2A 3SKMB 5CJOL 4LHUA 3QFJA 1I7TA 1V7NH 4KXZI 4WUUD 1N0XL 5DFTA 4APQA 3PNWB 1T03H 4I3GA 3O11B 4XC1H 1H15B 4Z5RA 1FRGL 4HIXL 1JHLL 1JIBA 3B3IA 5CP7A 4NOFA 4M5YH 1IFHH 2B0SL 3EOYG 2P4AB 2X10A 2FX7H 4X8XA 5E9DB 2EIDA 1G7PB 4CN6A 3KYNB 1DSFL 4MD5B 1RURH 3V5HB 2WUBH 2C7UA 3OQ3B 2HH0H 2Y6SD 5BRZE 5H2BA 5HVFB 4RMQA 2HVKA 4NRZA 5F96L 1MRCL 1L7TL 5I17B 4MAUL 1LO3L 4KV5E 3HA0A 3T2OA 3B9KC 2ESVB 1K4CB 2C5DC 1NCDL 5F93C 3QUKA 3CFEB 4LU5H 2W38A 1G1CA 5D2NE 3M17B 2HVJA 4XGZB 4M3JA 5D96B 4F7CA 1VADB 4JFHD 4R8WH 2YMXL 4XXDA 1WTGT 1G7HB 2G9HB 3L5WB 1CIDA 3MRMB 3GJFH 3CU1A 3GIVA 2H2PC 5DUBB 3QXUA 4JY6B 1KPVB 1PAMA 3BFOA 4U1NA 1HK6A 3MTRA 1E27B 1ZT7B 3BPCB 1J0KA 1JTPA 3HNTL 2QADD 2APWA 4GMTH 3QCTL 4U1KB 3SGEI 3X17A 4D0DB 3QXDB 3KYNA 1MJ7H 4NFBA 1JPTL 1T5WB 4A6YH 4P2QB 3MGAA 4NQXB 1BJ1J 3MREA 4GRMB 4QF1B 1FL3B 3AMLA 5TFSL 5D71H 4J1UA 3QXVA 4L3EB 1F13A 2OSLB 3MBXL 4XPGL 2A6IB 4FQXC 1YNLL 1A7OH 2Y07H 4Y4HA 3U7WH 1IZKA 1R3HB 4LSVH 1FSKB 3G6JE 2E7BA 1LO4L 5GISL 3D1MC 1MREL 3DV4B 1JPSL 2OLDA 1IEAA 3LKRB 2BZDA 3MNZB 3D0VA 5INCB 4WI7A 2Y36L 1KACB 2F53B 1BVZA 3BP6A 3SE4A 1FFNA 4UT9L 1AGFA 1RZKH 4HPYL 3RWGB 3RTQD 4OZIF 1M7DB 2A9NL 4G9FA 4AH2A 3UMTA 3QSKB 4WEBH 3UROR 4TULL 3HAEB 3KJ4C 3CFKA 5T3ZE 1FL3A 3GMOB 1T2QL 2ARJA 2VXVH 3RX5A 4FQXD 4GSDH 1IC7H 1J87A 2P5WD 4M1GL 2XA3A 5IVXF 3PHOB 1MHEB 1R3LA 1DCLA 5EOCH 3RHWF 4M5YL 3H9SE 3MNVB 1F8TH 1NGXA 2EDFA 4YHML 4HXAH 2XA8L 3QNXA 4FFVD 2DS4A 5K59E 3G5VB 4FTVB 1W0VB 3RPIB 3VDBA 3GSVB 5GGRB 1YEJL 5KZCD 4OCXL 4PJBF 2JCCB 1QYGH 4TSBH 4QXGL 2EXYC 2H1PH 4X98B 4NWUH 1Q0YH 3SDAA 1KC5L 4PRBA 4RAVA 3VXQA 2JB6A 4CN1A 4PR5A 3Q5OA 2KZWA 4YHPA 5CKAA 5AEAA 4LEXL 3M45A 3JWOL 1JGVH 1BD2E 3PWNB 1OSZA 4JO3L 3B2VH 1P6FA 3MJ6A 4UQ2B 2VIRB 1JPFA 3DTXA 4ONGL 1DVFD 2R1WB 4Z7QE 1JWUB 4JKLA 4NNPL 4ENEC 2EDWA 4F7EB 3GMPA 2OK0H 5CINH 2FGWH 5DFVD 2CIKB 4QRPB 1QBAA 4JLRA 3MLZL 4Z7UA 4IMKC 1W0WA 4WO4B 5H37H 1QLFA 4J3TA 1JNLH 4YBLC 4PJFF 4TUJB 5ERWA 2L7JA 4QXWA 3H3PH 3JWNC 1OAYL 1HSBB 3TJEH 1WIPA 5GGRA 2JCCA 4M5ZL 4H1LH 5C6WH 1OTTD 4Y16C 3QIBD 2VR9A 1KXVC 1S5IH 2OR9L 3ARFB 4Q9QH 1A7OL 2Y07L 5JW4R 4MX7A 4OM0L 3LS5H 5HPMB 1TVBA 4JZJB 2VQTA 1BM3H 3WV0A 2YD1A 3I85A 1T7ZA 5LKNA 4QT5B 3BIAX 4WFGD 3GJFA 3OXRB 2XT1B 5JMRA 4OLVH 3OJMB 5D7JA 2HJKA 2P8PA 3CZFB 4IOFC 1T4KB 3FQWA 1A6TB 5E2JA 3PE9A 3ZO0A 1RFDH 1Q72H 3F7YB 4F7EA 3TH3T 3DO3A 5E5MA 2HRPH 2VMFA 3ES6A 3GGWA 4GG6F 1YEGH 1LO5B 2EH8L 4UINH 4WEMB 4JRYE 1FYTB 5FKPA 4S10A 1NFDA 5KVDL 4V1DD 5DT1H 3GHEH 4H1LB 1J1PL 1QBLH 2IF7A 5BS0D 3D85D 2GJ6E 1J1OH 1FZJB 1BJ1H 1NCUA 1CDHA 5JW4N 1MF2L 5IBTH 3O4LA 5AZEH 1CXIA 2E8YA 2YD8A 1C5BL 3UJTL 4J2XA 5L2KD 5D2NB 1J0HA 1N5AB 3BE1L 4OIBA 1DQJA 3P4NB 3WEXA 3NBNA 4HH8A 3VXTA 1LK2B 4LPWA 4GW4B 4J6RL 3L3JA 5CJQH 1BZ7A 4Y4FD 3ZZ1A 4P23B 2EKJA 5DK0B 5I16B 3VXUD 5CEZD 2XQYG 3B5TA 4G6KH 5D70L 5C0BB 2OYPA 2CLVA 3H9HA 4RISL 4GG6E 3OX8A 4JFQA 1CE6B 3WUWA 1NCCH 5D1ZD 3HB3D 3ZDXE 3NA9H 5E5UB 4GKSA 3ULVD 1E6OH 3QQ4A 5BS0A 3LSOA 3QG7H 5GGVY 5FDYA 2EC9U 2H8PB 3AB0B 2Y25A 3RVUD 1MCNA 1P5UA 1NL0H 2Y06H 1X4XA 1A4JA 1RUPL 2QR0A 1BMGA 1DP0A 4R7NA 2IQAB 4Y8AA 3W82A 1SJXA 5IVXB 3G08B 5E8NB 1OSPH 1BBJB 3VXPB 2VXUL 4HEME 1GGCH 4HS3A 1BFSA 3BGMA 3BVNA 4M7ZC 4DKEH 1F4YL 3QEQB 1EZVX 5DVNA 3HZYB 3RWJB 1LO2H 3CDGB 4DWHA 1RIHL 1FV1B 2ZUVA 1OP9A 4PJIF 1YNTB 2I9TB 5JHDB 5EIIB 1QRNB 1UEMA 4X7CC 3T1FB 3U82B 4TUKL 1GAFL 3MCLL 4JFFA 3LD8C 2EIEA 4Y5VA 4U0RC 4X7EC 2NXYD 1FNSL 5K9QI 4Z7VA 5EZJB 4K3DL 4NO5A 3ZL4L 1FGNH 5FF6B 4BFGA 4PJ9A 2ILLA 1WEJL 5I74C 1MUJB 2X4PA 4KROC 1FVCA 1T1XA 1U3HC 4JREB 4APQD 2X2YA 3NMEA 2IBGA 4MNQE 3SE9L 1FL5B 3TBVB 4P46D 2QQKH 1S7RA 4OI7A 2VITB 4PJ7A 3ZKMC 1S7XA 3UYRH 1TNMA 1I8IB 4EDXA 3VXPA 5IG7B 2ADGB 4E41D 4LKCB 3MOQA 3MOAL 3ULUD 5MEPB 1NMCB 2CUMA 3T1FA 3N1FC 4XP5L 1U8OB 2GSIA 3HZMA 1YEDA 3V4PL 2A83A 2X40A 4OIIH 1VGEL 4JN2B 1CT8A 2HFGL 5BXFB 3I50H 4G6MH 2DYPB 3W9DB 2DQDH 2ZJSH 1T7YA 4PGEB 4OTXL 1JRHL 4KTEL 4JFDA 4RDQG 1IC4H 4ORGB 4EKXA 1K8DA 2RR3A 3QT2A 1BQLL 3T08A 4PG2A 2X1PA 3IS0X 3CX5J 1KNOB 4PGJA 1OTTC 5FYLD 1LK3H 1NGQL 3QXWA 4N0UA 5AAMA 4EEEA 5JQ6L 3GMQB 3GBMH 1F8TL 1CFQA 3C87A 4MJ2A 4OZGF 5DURB 3BO8B 4U6XA 2HP4A 4LLMB 3FTGB 1P7KA 2PW2A 3SOBH 2FX9L 5EU5A 5I1EH 3OKMA 1JZ8A 4NPYA 2A1WL 1ERNA 3KYMB 4UBDD 1SJEB 1UH2A 3C8HA 2IBZX 1A1MA 3QIWD 3O6MH 4NQCA 4PRNB 4CUCA 3NCJL 3PWLB 3EO9H 2WLZA 1J86A 4YDVB 3QXDA 1PY9A 1UXWB 1WCBA 3PWJA 5BV7B 1FG2A 2F54E 5F3BA 2I5YH 2UZIL 4YFLI 4PRDB 3PL6A 1N8ZA 1MRDH 4JQIL 4DN3H 1AGDB 1FGVH 1OTUC 3VCLB 3B83A 1U3HD 1KEGL 3E2HC 3VWJB 1CDUA 2HFEA 3V4UH 1MOEA 2D0FA 3T2NH 2HN7A 3PV6A 2X7LA 3QAZB 4CL7A 1AC0A 3MUZ1 4PREA 1MY5A 3QDJE 1J0ZA 4RGOL 4F58H 4LMQE 1KIRA 4IRSD 4M93C 2Z93A 3TZVB 1YEHL 1G6RA 3BZ4B 1QQDB 2NY3C 4RQQA 3T0DA 2B2XH 2XWJB 4UIMB 5A2IH 5EN2A 3UTTB 3IDXL 4NC0B 4M5ZH 4XNUH 1HHKA 2EE6A 4ONHA 2KL6A 3EDJA 4FQLL 5C08E 1QHOA 1KG0B 2Q76A 1QACA 5AZEL 1ZHKA 3GB7A 4JJ5B 1C5BH 5DJ8B 5ISZA 3SGJC 5I15H 3U0TB 4QRPD 3IKCA 1EO5A 1JCKA 4OZIE 4HFUL 4W68A 5HGHA 3FONA 4YHYC 3GSOA 4KI5F 3I6LD 3IS1X 1D6VH 2MQ3A 4O9HH 5KANG 1EAJA 5AYQA 2VR4A 1PGRB 4XCNB 2X1QA 5FB8A 1AQKH 4F37F 1UADC 4NZTL 3NN8B 5IVZB 1S78D 3FT4A 4NYLB 1MHCB 4AK1A 5K93A 3QNXB 4RRPA 3LKQB 5IQ7L 5HYSB 2KDGA 4IIQA 1G7HA 2DQUH 4LVEA 4Q2ZB 4UZGA 3NTCL 4HKJA 4KJPC 3HAEH 3WS6C 4HBQA 4I0PC 5E8PB 1E27A 4J3OC 4NGHL 1ITBB 4M4RA 3HG1A 2DD8L 2AXFA 3LDBB 2IAMB 1R3KA 1CR9H 1T5XB 3HLAB 3TIEA 4YJZL 1RZ7L 3PWVA 4GRMA 2BCKB 1DANT 3KPOA 4YEFA 5JOEA 4WUUA 4HAFA 1NGZB 2NXZC 3C6LC 4CJ1A 1B4JH 5DEGB 5E03A 5GRJL 1G0DA 3DURB 5CIPH 5E9DA 2VDPH 3PGDB 1J88A 5HYJA 1RJYA 3PHSA 3SGKC 5D7KE 2Z8RA 4NRZB 4KKLC 1ZV5A 1NKOA 5IW6A 4Q9CA 1YMHA 1L4IA 3NFSL 1LO0L 5E4IA 1FJ1B 4UT7L 1FFNB 3VXMB 5C7XH 4RZCB 3GSXB 4HUVB 3AS2A 1CXHA 1NL0L 2Y06L 1N0LA 4TNWF 4GW5A 2WIIB 4Z0BL 2OBGA 2VLJD 3BIKB 4PV8B 4QRUA 4O00A 3N9GH 5F9AC 3MCKA 3ARBD 4QT5A 3LKOA 5EO9A 1CZ8L 1VACA 2JK5A 4U1LA 3TO4B 3VGEA 1GGCL 3MRBA 1TJHH 4RFOH 3B9KD 3EHBD 4L3ED 2AJVH 3HRZB 4KK6D 1TJIH 3DLQR 1Z9MA 1H8NA 1IM9D 4ZTPH 4JRYB 5SWZA 3MOAH 1HYRC 2ZSVA 3KJ6L 1ZA3A 4OF3A 5TE6L 4JZOB 1UB6B 5GS3A 3MLVH 1A7RH 1ZVYA 4YNYA 5IMKA 1KCSL 4DGVH 2FSEA 1EVTC 5E8DH 2P7TB 3VFTB 3QQ3A 3VWKC 3G6AA 3VXMA 1A6VL 1LEGB 4OCRH 5IEHA 1DQJB 1NBQA 3DVNB 2Z0BA 5B39B 4G80A 4BFBD 3SCMA 2L0DA 3EGSA 1PYWB 4B7IA 1KLGB 1S7TB 3FOMB 4GAYB 4LQFH 1QNZH 3X13B 5I1DB 2HJFA 2XY2A 4MJ6B 3WJJA 1R3IH 4PJIE 1KCRH 3C2SA 4PBXA 1A5FL 2EEDA 2YPLE 1KGCE 1KJVA 2CLVB 2VZUA 4L8CB 1CDGA 2O26U 3O41B 4HPOL 3V4VH 3L1OL 3C6LB 1D5MB 4PJ7E 4XWGH 2GY5A 2BDNL 5FO9A 5EZLA 3R0MA 4P3CL 3LVEA 1N6UA 4N0FB 3FAWA 5F97E 4RBPK 1KN2L 3DV6A 2HFFA 3CFCH 1E4XI 4G6FD 5T1MB 5F1KC 4DN4H 2ITDA 2LVCA 5JHDD 1CD0A 3K3QA 5D1XC 2RB8A 2UUDK 4P3DA 4C56E 4PJEE 3V4UL 2W0LA 2D31A 2Y72A 5F7UA 4XNQB 2NY5C 4XVUC 3VG0H 4X7TB 1J18A 1SYVA 4NZJA 4OFKA 3R06A 2P43B 3Q1SH 3RWJA 1KUMA 1NCWL 5BVPL 4KMTL 4DJMA 3G04B 1AH1A 2HJKB 2P8PB 3WHE0 4FFWD 3GSNH 3WLWD 3HPLA 4ODUA 4OZHF 3HC0B 4CN4A 1BGXH 2R1XB 4Q74A 4IRJA 4Z77A 1OSZB 3KS0J 1EEZA 4H0GA 2WIMA 1KLUB 5KVGL 4MNQA 3C5JA 5DRXB 3MODL 5DS8A 4WUUE 1T89A 3ULVE 1KTRL 1U58A 3FZUC 3UPCA 3UTZB 4ZOCA 4CADA 4X6DA 5IB5A 4M93B 4UV4H 4KJWC 2PXYC 1QSFD 5E0QA 1KYOK 2XWTB 5JTWA 4ALAL 4MAYA 3K8KA 5JIKA 5GS0L 1CDCA 2HTLD 1H3GA 3FFDB 4U3HA 2DI8A 1PD6A 3BT2H 4ZPTB 5GS1C 2BP3A 2ZUUA 1X5GA 4YHIB 5J8OA 3L3JB 3ARVA 3NCCB 4UT9H 4POYA 3AM8A 3SDXB 4ELMB 3TBWB 4J3SA 1AGCB 1DQLH 4CNIB 1OOAA 3GRWL 1UYWL 3ZE1F 5FYKD 4DGVL 3PQYB 4XVTH 2PN5A 5C3TA 1BF8A 4PJEB 3VH8G 3DUSA 1BOGB 3W0WA 4LRNH 3UDWC 3F7RA 4B5EA 1Y0LB 5CKGA 1QUNA 1UC6A 2W65B 4U7MA 2AJXL 3SBWC 2UYLB 2NZIA 3MV9A 1EGJA 2IH3B 2NNAA 3OL2A 3V5DA 1R3IL 4JG1L 3QDAA 5FYLH 1VDGA 2H2SC 4N8VA 1INDL 2V5RA 4GLRH 1LO5A 2YD4A 4WW2A 2Z31D 3E6FA 1K3ZA 4HIXH 5HHNA 5CZKA 2XXCB 2H9GA 5DD3L 1X5XA 2IPKB 1T0PB 25C8H 2HTLC 3C8KA 4WI5A 1ZLSL 3LZFH 1FLTX 3I2CH 3JV5A 2C4XA 3BDYH 3Q6GH 3W9EB 4U49A 1A6PA 1DFBH 1YYLH 4Q9RL 1P1ZB 3KS0H 1IKNA 3KHQA 2YUZA 3EO1B 3UZQA 5EIIA 3DUSB 4PRPE 5J3HC 3LY6A 1V3KA 2BSSB 5C0AD 3VXTB 4MAUH 3SO5A 4ZUTB 1HSAA 4XCFL 1N8ZB 3MMEB 5AZ2H 4KI5E 4XP9L 3NAAL 3VCLA 5EWIL 1SVCP 4RBPH 1HQRB 1Q0XH 4TVPL 2R8SL 2F58H 3FCTA 4MAYD 2XIDA 1OB1B 3P73A 3GMNA 5FK9A 1SEQH 3PIQA 4F57L 2WLYA 3G5XA 2UUDH 1I9IH 4LCIL 2GFBA 3ALPA 4NCDA 2JJUA 4O2EA 3QIWB 1UM5H 4MA8H 5F6IB 2O5ZL 4OF8A 4WFGE 2ZUWA 2DKMA 3S36L 3H0TA 2OTWB 4P9ML 4MD0A 3ZYIA 4WNQA 2R0ZL 4DOHE 4KK5D 5J12C 5ETUB 1CFTB 4Y16A 1G1YA 4JJ5A 2AK4E 4EN3D 5D2LF 4Z7UF 1DE4B 2ADJB 2DYPA 3EYFB 2IAND 4FXLA 1FSKC 2O61A 4XMPL 4A6YL 2ORBL 2QKIA 3BSZH 1IGFH 4XMLL 2VABB 2AV1B 2AK4B 1MWAB 1YNTA 5J7CC 3QDJB 1NCBL 5ESVB 5IJKC 2NY3D 3MRNB 1KV3A 5LGJB 4EBQH 3ISWA 3V4VL 3OG4B 4FQQB 4FQXB 4UDTB 3NCFB 4JM2F 2A6KB 1U93B 5EU3A 2IGFL 5J13C 3MRDB 5ANMB 1HCFX 4LCYB 2MCPL 3HS0B 5E8DL 1QR1B 3DETC 4Q6YA 3WNMA 1T66D 1BVKB 1WFUA 1NCAH 3FRPA 2A73B 4OCRL 1F02I 5ID1A 2IAMA 1UXWA 5HYQB 1KELH 3EJYC 1QG3A 1IC7L 2XWBA 3DSFL 3TPUA 4DVBB 4PRDA 1CLYH 4JFYA 1SJVA 3EYFA 3O2WH 2YKLH 5E70A 3ULVH 1LMKA 4WEBL 1T83C 2XZQL 4IMLB 5T1KA 3KYKH 4MNGB 2W0KA 4NJ9L 5C0AE 1XF3A 2GSIB 3O4LE 4HDIA 4FRWA 1T1ZB 1PVHA 4OCXH 1X5YA 4M62L 4P2RD 4WI8A 1U8PB 3U30B 2BDNH 5MENA 2GJZA 5KW9H 4YHMH 1FFRA 3BPNB 1G6RH 5GGQL 1NJ9B 3QNZA 2BSRB 2F54A 4PJBB 4QRRD 2CDGB 3MRCA 4IS6A 2Z92B 4G5ZH 5FOBA 5HYJD 2C1OB 4F7TA 1JK8A 1CFSB 3TJHC 3BGAA 3KJ4B 4LSUL 2CQVA 4GRWF 4ZUUB 1CL7L 1LD9B 1ZEAL 1I7TB 1VEPA 2VKWA 5L8LB 5I0ZA 3D48R 3QG6B 5JR1L 3PNWA 3RGVC 1BJ8A 4U6XB 1DN0A 2BVOB 4AIXA 5BS0E 4QHLB 4HKXA 1F2QA 4KZDL 1U8KA 1I8LA 4TUKH 1JZ4A 4ODWB 2K3TA 1DANU 5MP6L 1B6UA 3RVTC 3U4BL 3ARDC 4NQCB 2VLME 3GHBL 2X09A 3GSNL 3PWLA 4Z7WE 3BZEB 2JELH 1XF3B 2D03H 4WWKA 1IAIL 2K1MA 2AKRA 4LLDB 4P48A 4J3VA 1PG7H 3MGTB 1VFAA 3L3GA 4JFXA 3MV8E 3SDXE 4U1GB 3RP1A 1HKLL 5EU6B 2HFEB 4PLOB 3QIUB 3KPRE 3IRZA 2Q7YA 3UYPA 4GW1A 2FL5A 3L5JA 1LP9A 1IILE 5GGUB 4ZXBC 4JFOA 1D5XB 1TLKA 1YMME 4PJHE 5FCUL 3OAZH 5TDOA 4ZUSA 1E4KC 3STBA 1U8JA 3OMZA 1QSVA 3SQOL 4DKAA 1DQDH 1V3LA 3ARFC 1RZIA 4EI5A 1XF4B 2HJFB 1V3MA 3ARBB 4MJ6A 4TNVK 2GYSA 4G7VH 4WUUB 4MJIE 5GSVB 1HHIB 2IGFH 4U1NB 3W11C 1P7QA 4HGMA 1H9VA 3FO0H 4ODWA 5I1GH 4PB0H 4PLNC 1M1SA 2R23A 2ZCKH 3BJ91 3KLDA 1CVSC 3LCYA 4NNXA 1A1OA 3HRPA 3C5ZC 1XEDA 1ORQA 4JRXB 4P2QA 2QHLA 2JJVA 3LIZH 1INEL 3D39E 1NEZA 4C57C 3RJDA 3EJZD 1MQ8A 2NCMA 4DZBB 4PJ8A 4R4BB 3QNYB 4ZNEE 1ZWIA 2J8HA 2F58L 5SX5K 5DRWB 3RVVD 3NN8A 5DWUL 5KVEH 3F58L 1N2RB 3S37L 4KUCF 5F9DC 1FNAA 4MNGE 3MUHL 5C8JB 1A3QA 4PJXB 1S8DA 4OFDA 4QTIH 4XZUB 3R06B 4XP1H 2MCG1 3WNLA 2VOTA 1NGWB 2ZG3A 4U1IB 4M43L 1A9BB 4O2FA 5D7IE 1EEUA 2H2PD 4EN3A 3B3IB 4TPRL 3FL7A 5L7XH 3HC0A 1GOGA 4QKXB 1ZLSH 4HIIA 2XQYK 3V6OC 4KPHL 2ZSVB 5DGRA 3UBXG 4YFEA 1KJ2B 1ZA3B 3E0GA 3TVMA 5ITBH 2R0ZH 1U41A 3DVGB 3TIDA 4BZ2H 3V7AG 4YR6A 1UVQB 2WQRA 3VMOA 4ETQA 5JA9A 5E00B 1K8IB 4D9QD 2ZCLL 1MHEA 4PS4L 1RQ5A 5AUMB 2YA2A 3WIFA 3IETB 4Y19D 4L5FH 3MLRL 4U1HA 3DVNA 2D03L 1MFDL 4KUCD 5JXED 4I18A 1I9IL 2R4RL 3KPSA 4ZYKA 1AGEA 1KLGA 2VAAA 3A6BH 2V7HA 3VFNA 5JOPE 3REVB 5GGVL 5EU6D 4X7SH 1NAML 1TNNA 5I76A 3BZDA 1G7MA 3LN5A 4FQLH 4U0RB 2PO6D 1RZGB 4LPVA 3K4DA 1ZLVH 2CXKA 3B9VA 1T7WA 4P9MH 4P4RA 5JW5A 1OGAE 1UWXH 1UZ6F 5IR1A 5IBUG 3RDTD 5HYJE 3MUJA 3WD5H 3FB5A 3KLHC 4I9WD 1VACB 2JJTA 1T5WA 3X12B 2V7NA 1L6XA 1IE5A 2P5WB 4WHYG 5EA0L 3VJ6A 3HCVB 4LPUA 2XRAL 1PQZA 4YIQA 3OR7A 1QPXA 5C0DA 4MZ2A 2UWEE 5M95B 3VW3L 3O3BA 2VDNL 5HXMA 3RTQB 1YYML 4LLVA 5KSUB 3VWJD 4Y19B 2BC4A 3FT3A 4XNQA 1A3LL 4RX4A 1CBVL 3B4NA 4GXUN 2FLRT 3FFCE 4HCRH 4PGBB 4WTWA 5INCA 5EBLA 3C8KB 5HVWA 3VDCA 5BOPA 4JHBA 4P2OC 2G60L 5DJAB 3HMXH 3WKML 4OV5A 4O02L 2QLVB 2MOVA 4KGJA 3C5SB 5C0JB 3GBNH 2HFGH 5JW5B 3RVUC 4PLKD 1TJGH 4PRHB 1I1FA 4LVHC 4ZPVB 1M6OA 5I74B 1VFOA 2FH8A 2XXMB 5GSRB 3UBXI 1A3RL 4MXQD 2F5AL 2DJSA 5GRJH 2SEBA 2I24N 5F88B 1T4KA 1YNKL 2QQNL 4WEUD 2VWEE 4R26L 1F4WH 4BQ6A 5CEXB 1OB1A 5C86A 2H2SD 3DYOA 5JORA 5BV7H 4X5LA 5GHWH 3N1GC 5D5ME 4KZDH 2NY1D 1P7HL 3V7AE 1NC4A 3AMKA 4F9PA 3LKSA 1X4ZA 3U4BH 1NGXB 1XGPB 1RUKH 3G9AB 5DTFB 5IOPB 3PWPA 4OZFH 4GQPH 2AJZB 3G5VA 2DLFL 4N0YL 3I3EA 5FO8A 2P8LB 4MNQD 4JM4H 3SJVE 4FXGB 4Y5XB 5FGCB 4M1DL 3TO4C 4OV5B 2FHBA 4GRLA 2ZCLH 4U31A 1Q1JL 4LPCA 3EDKA 3R8QA 4JQIH 3IJYA 1KB5H 4QYOA 1CL7H 2R56L 2VDKH 1NUNB 5KAQG 1T22A 3T2NL 4FN0A 3I3BA 5J1TC 5BV7C 3RI5K 4G8GA 4DUXA 2VLKE 3WNOA 3OHXA 4Z77B 1AHWC 1BWMA 3V0VA 3T3MF 1AKJD 1NC4B 3DX9A 4Y4HC 4L8BB 4QWWC 1MIEL 1W0WB 3GI8H 1L9MA 4HPYH 4W81A 3S98A 2IFFH 1A1NA 2DIBA 3QAZC 5FO8B 4ZO6A 2FYYA 4JRWA 4K94C 3QEGH 4Y88A 2VZSA 2APXA 2BY3A 1PW3A 2OL3L 3GI9H 5LJYH 4CKVX 4OLWH 3VW3H 4X8JA 2NTFA 1RZJC 2CKBL 2OTPA 4P9HC 1MAJA 4XX1E 1AQKL 4LEOA 1HQRA 1ULVA 2NY5L 1QYGL 5JOFB 4RMRA 3B8SA 3FQUA 4PJEA 3B2UD 4G8GB 1FFOA 1RZFL 2HLAA 5I1GL 1YDPA 1O7VA 5ITFA 4KRPB 2IC2A 4HHAB 3TT3H 4X9HA 2A38A 5IW3A 2PXYA 1AD9B 3NTCH 3I6KA 5KANI 4KJQD 3ZT7A 3T65A 5EZJA 4OLEA 4KPHH 5AD0B 3ECBB 5GRVL 3SKJH 4IS6B 2BNRB 5T1LA 1DR9A 5CD3A 5IMLA 5B3NA 4HJ0D 1RULL 4P2RB 3L3IA 5HJ3A 2VITA 1IM9A 4PJ7B 1INQA 5EIQA 1R5WA 2X89D 4WWID 5FHAL 3ROOA 4P23D 1BEYL 3TWCL 1PZ5A 5TE4H 4BK4A 1HIML 4LHUG 4CMHB 3QFDB 3ARXA 1HILA 2EYSA 3QCUL 4JRXE 3IDIB 4G8FB 5E24E 3EYVA 2OZ4H 4ENED 4XH2A 4C56D 2PXYD 3V0WH 4L3CB 2P48B 5SV3A 3MA7B 4JHAL 1IC1A 4K71B 5FGRA 4G6JL 1OF2A 1DVFC 1ONQB 3TBYB 2A83B 2PXYB 3RWFB 4WCYL 1TFHA 4N0CC 3WFBH 3CPLB 4NT6B 4KHXL 3LMJL 1GC1H 2C3VA 3ARRA 1HXMA 1F90H 2BNRA 5F7FA 3WHE1 3QUMA 4JFZH 4HIEA 1KNOA 2WINA 2NXYC 2D7NA 4WTZA 4P2RA 2K7QA 2Q7NA 1A7QH 3GMMB 4HZLA 3S5LG 4JDVB 3IAQA 1UH4A 2WP3O 1NGPH 5E6YA 4GXVL 1OM3H 1A47A 1CGTA 3H6JA 1A02N 1U8MB 4NZRH 2VUYA 1CF8L 4HJJL 5FM5O 1BFVL 5DUMH 3MRKA 1MCWM 3H7BB 5DUPL 4DGYL 3A6BL 3DMMA 4JGJA 1IAOA 4X5XB 5BVJB 2YXMA 5L8JB 4LCWE 3DX6A 4Y5YA 4HGKC 1QRNE 5ALBL 1F5WA 4D94A 5E8OB 1KCSH 2P8MA 3BH8B 1YPZA 3VFSB 1IJ9A 1I1AD 4UOW1 1CGUA 1N64L 1T6VN 1LP9E 4JFED 1FL6B 4G8GD 2VAJA 3VI3E 3HNVH 1FO0A 2ADIA 2WBJB 4GH7B 4WV1C 4Z7VB 3KPRA 1XGUB 3QCVL 5F1SA 1HI6B 4JFDE 4JG1H 5D7JD 2ZUTA 2Z4QB 1D5IH 3QJFA 4K8RH 3ZT6A 3IDNA 5MERB 1KJ3L 3AAZB 2PTTA 5CMAB 1JGDB 4UUJB 3D25B 3C9NB 4N8CH 2OXGA 1WLHA 3QUYD 1U3JA 4MXVF 4RFNC 2NY7L 3L3OB 3OJDA 1JTOA 2XWJA 3BDYL 4KI5D 4WW2C 5I30H 4WHDA 3TESA 1RIVL 4QTHA 1T04A 5BQ7A 4U1KA 4F7PA 4D0DA 2ENYA 2Q76B 3DGGB 4NKDA 2A73A 1AKJB 1NC4D 4K2UL 4OD3L 4XNYH 3NAAH 2WBWB 4I0PA 2H32A 4TVPH 2FBJL 4NFDA 1QHPA 5KSAB 2XICA 5H94B 2AJYH 2Z4QA 4NQSA 3BP4A 3MRGA 5K9QG 5L0QC 5J11B 1JGVL 4HUNB 5CJXC 4P9HH 1WCQA 1QBBA 4YQXL 3S35H 4HS8L 1AQDA 1XGQB 1T7XA 2A6DB 2HLFC 2AEWA 3G6DL 4XTRD 4KY1L 4XPHH 5ANME 5CD5C 3L9RB 5DJYA 4S1RL 4LLMA 2ZUSA 2JCCE 5GSVA 3CSPA 4D9RE 3FRUB 1I1CA 2CGRL 2VSCA 5D2LB 4BKLA 7FABH 2NY6C 5DJ2A 2ZG2A 2H26B 3CFKB 4HF5L 2WUCL 1HNFA 3CJJA 4FQCL 5E99H 5IKCB 1F4AA 2G5RA 5I17A 4JPIB 5I1IH 5JPMA 1DBML 5ILTH 3OJ2C 1ZLUK 1QO3B 1K4DA 5D7LE 4ZFZA 4AZ8A 4LHUD 5JW3L 2KQNA 4ZTOL 3PUCA 4K3JL 1CXFA 3X11A 2UWEB 1YUHB 3IJSA 5D5MA 3I6GA 2I26N 1GYAA 3QUMH 5CSZB 4NQEE 4BA8A 2MMXA 1A7PL 3ZTNL 4UTAL 4E9LA 4W4OA 1AHWB 4FZEL 1RK1A 4XVTL 2G2RA 3CVIL 5DD1L 1F2XK 1RY7B 4AG4L 1QLRB 5F7MC 3SDXF 2BHZA 4F9PC 4DUWA 2XQBL 3MJ9L 2W60B 4WFHE 3S34H 3GSXA 4HUVA 5JQHC 3BD5A 5EU4A 1TZIA 1CLYL 5J1AA 1KJ2A 3TVMB 3W0WD 4H26A 4MB4A 5DJ2B 4E41A 5IP4A 3ZE2F 2HRLA 1FNFA 3R8BB 4EI5B 5T3XH 1FLRH 3OKOB 4LIQL 2W07A 3S96B 5TE4L 5E00A 2DKUA 5IHUH 1BD2D 1G0XA 4JRYA 5SWZB 4F8TA 4FFVC 2R15A 3CFDB 5EULV 2DQJL 2UWEA 3IJSB 3MFFA 3U36A 4GFTB 4MJ5A 3FT4B 4NYLA 4LLAA 1AGBA 1OAKL 2VXSL 3RNKA 3PHQB 5IB4A 5IOPA 3O45B 4HWBL 4PJ9D 1MSPA 3QXTA 5HHMD 1AGEB 2VAAB 2W0PA 4O51A 1DFBL 1YYLL 2XOTA 2P7TA 4PJ8B 4I3RH 3CH1A 1I8KA 3LRSA 3O4OB 2EYTB 3H9SD 5F7YC 4MS8D 3SN6N 4U0QB 5CS7A 2RIKA 5C8JA 3R4DA 5AWNH 5LGHH 1Q0XL 3CFJA 3KLSA 4KJYB 3HZVA 1JWSA 1W72L 5HHXL 5IEKA 1Y18B 3L3DB 2PW1B 4WY7L 3G9VA 5GGTH 2DB8A 2HA1A 5F6IC 3GBLA 4H8WL 5DVLA 3DX9B 3N85L 4RWHA 4HKZA 1HKLH 1QP1A 3P9LB 1UCTA 5IW6B 4PJIB 4YR6B 4QOKA 2E27L 3UTTD 2Z91A 3D39B 5FA3A 7CGTA 4MA8L 2FYYB 1LDPL 2GK0A 2UY6A 5EZOL 4DAGH 1JV5B 4YHPB 4IIQC 1EMTL 3B9AA 3WIFB 1EEYB 1KXTB 4AY0A 1JNHA 2EYTA 2X5PA 2Y6SC 3SO3B 2YSSB 3PWNA 2ICCA 2NY1B 3HI6H 4QRUB 5D7LB 1RVFL 4FNLH 2QHRL 3K1DA 4YXKL 1BZ7B 5E2VH 2H3NA 3JV4B 1UM4H 5DK0A 3PWUA 4PGCB 1MCEA 5C07E 12E8L 1P9MA 1KIPA 4QRTA 2QQKL 2HMIC 3IU4L 5GS1A 3R1GH 3V52H 1ED3B 4QEGA 4D9RD 4DKFH 1INEH 3MV7B 5GRZA 1UZ6E 3DVFA 3CX2A 1UB6A 3X12A 2B20A 4FQHA 3EO0A 4KKAC 2W9DL 4HLZH 2YD6A 3BKYH 3P0YL 1LEKB 1AJ7L 2GK0B 5F96H 1T0MB 5GS2H 1D5ZB 4JPWL 4XC3H 5HDQH 5DO2C 3OR6A 3CLEL 2AV7B 2C1PB 3K2MC 2VH5H 1NCDH 5FGSA 4Z0XB 5KSUA 3I50L 5TGBB 1DBAL 1MCPH 1U8LA 4MXQC 2ESVE 4PGDA 5IHZA 3G5YB 1OAUH 1Y6MR 3NCMA 5ADOL 1M7IA 1BF2A 3RU8L 1KELL 3OXRA 2NY4C 4NO0B 5DJAA 3QI9B 4G8FA 5D9SA 1KJMA 4KKNA 3EJZC 3UTSE 3MRPA 3GSRB 3L95A 3BUYA 4KZEH 4JG0H 5ITBL 4JHWH 1RIVH 4YWGH 5C0IB 3CUPA 1S3KL 3BPNC 4IEFB 3LQAC 1UJTA 1MFCL 4I1NB 3QUZD 2X4NA 3LV3A 1DLHB 4G7YH 3QB7C 1XGRA 3WS6A 3O8XA 1IGCH 3MZTA 1FYTA 5FKPB 4E0RA 3C60B 1A8JH 1T1YB 1MUJA 1MCBA 4KK9D 3MRIB 3MV9B 3EYUH 5CEXA 1I8MA 3AXLA 4Z7QF 5FYJH 3O4LB 2AJYL 5A3IC 1WQVT 5EUOF 1WTLA 1YNLH 3U7WL 1S7XB 1KT2A 1YJDC 3Q5TA 4PP1D 4EDXB 4YQXH 2FJGB 3BGFC 1S5HB 4U6HA 4X7SL 1X5FA 3QUXD 3RUGA 3DVIA 4WI4A 2R2BB 1X6LA 5IM7B 4BZYA 2ED9A 2DDQL 2N4IA 4FQ1L 2JIXD 3NPSC 2X4OA 6CGTA 3DX7A 3T4AB 4F9LA 5C0IA 3VFWB 3F5WA 1EEZB 1G9EA 1EHLL 3B43A 3TP4A 1CXEA 3ZKSD 5DYOA 3D2UB 3ARDD 5A2JH 5AD0A 4LQFL 4IRZH 2E6PA 2V2XA 3QEQD 4RGNB 3TN0A 3VXRA 2VLRB 4NC2B 4M6OH 4U6YB 2DWEA 1JZ7A 1NC2D 3KXFA 5C0NC 2J5LB 4FQPA 1S9YB 4L8BA 4U33A 4ZNEA 2FR4B 4XBPA 4BSVA 1L0XA 3EYSH 1WUNT 4JQVC 3S3JA 4NM8H 3VWKB 3RZCD 2PYFA 4JB9H 2DI7A 1C08B 1X7QB 4ZO9A 4D8PB 2CIIA 3BXNA 1EFQA 4HUKB 2W91A 2OTWA 2COQA 1HINH 5L6YL 4LRIA 5IB3B 4ZMAT 2QEJA 3UTPD 1FRGH 2C26A 1MEXH 1KB9K 2VZ1A 3IXAA 1RZ8A 4OZ4B 5DMIL 2FDBP 4WHTA 1WWAX 2R2HA 3V6FB 1BIIA 3L7EB 1FG2B 3AREB 3OKEA 1A6WL 3LRHA 1FFQA 3ILQD 3RWFA 1J5OL 1V7MH 3D6GA 1CG9A 4WFEE 2I27N 3I9GL 5EUKA 3KGRA 5JLZA 1P84J 5KSAA 5GHWL 1P53A 1MFAH 3MRGB 5KVFH 1QFWI 4ONGH 4C4KT 1F3RB 1LWRA 3IDUA 4MQ7B 4QXTB 5F7EH 5I8OL 3DWTA 3LN4A 3QH3A 4TYUA 2VXTL 3AFLA 4ZDHB 4JHWL 5L2KB 2DQJH 1GGBL 1N26A 2E6JA 4OI8A 5C2BH 4R7DA 4OSUL 4PJGB 5HI3C 4FS0A 5IFJB 3BXNB 1YEJH 3GMLA 1IGML 2IPUG 5T1LB 4MDIA 3SDCA 2EDEA 4D0BA 3O3EA 1F3DH 2EDNA 4YLQT 4FFWC 4XI5D 5C0CE 2X9XA 2VZ3A 4CDGC 3VD7A 4DVBA 4ZUTA 1FZOB 2X6MA 2B4CL 2APFA 3N50A 3KNBA 2F53E 3HG1D 4NC1C 1D9KC 3QJFB 4LOUD 4XCNA 4M61A 1IGTA 3LS4H 1UM4L 5KSBF 3IFOA 4MQ7A 3HR5B 3LN4B 5HPOA 3KAAA 3GMNB 5I19L 4Y89A 4JREC 3MLXH 4H8WH 4UAOB 1ZLVK 3ZKMD 3RIFF 1I8LC 3MLYH 1GZQA 2IG2H 4DKFL 3RBSA 4R7DB 4APQB 3GO1L 1YEEL 1OP5K 4P57A 1P2CB 5GJSH 3NA4A 3MJ8B 2Y1VA 4HUXB 1GPOH 2JJWA 3BPOC 2ICES 4GBXA 2OR9H 1G7PA 4G8IA 4YDVA 1RZJL 4JDVA 1A7RL 3HI1B 5D1QD 1QSFA 3KPNA 3GNML 3VMPA 1T21A 2J8UA 2MQCA 5CWSB 1WGOA 5EA0H 1NGYA 2NR6D 1XIWB 3O6FD 2NY5H 3WD5L 5T5FH 4ZXBA 4QHLA 5FA4A 1HN1A 1A2YA 4OLVL 1PDKA 2ARJQ 3RU8H 1MWAA 4NBZB 4EUPA 1OCWH 3GM0A 3VRIB 1N5YH 2XKNA 4QHUA 3W2DL 1O0VA 2I60H 4EI5C 1DQQB 2B7DT 4XPAL 4NQVB 4EZMA 4HMDA 3I75B 4P46A 2ADIB 4BQCA 4H0IA 4G3YL 3EZJB 1RUAL 3S7GA 3NPZB 4M6NH 2VN7A 3RKDD 2F74A 2VUOA 1CICB 3GHEL 4HAGA 5KZCB 2G5BA 3MLSL 1BPVA 2VQ1B 4R90L 4FTVD 1D5XA 4ONHB 1R24A 3UTOA 1G9MH 1T0NA 3OKKA 3QUZB 2YK1L 3HZVB 1KTLB 2P1YA 3P4MA 4DZ8B 1QSZA 2EO9A 3MRBB 4U3XA 4IDJH 3V6OE 4JY4B 3RWHA 5IKCA 4MJID 3NGBB 4QHKI 3VFMA 2F19H 3S4SA 4XXCC 2IANB 4XPFH 5DHYB 2VZOA 5GJTH 2NTSP 5ID0A 3HR6A 3HE7D 2XKNB 1D9KB 1WAAA 5CIPB 4JZOA 4Z7NF 3WBDA 2WWMD 2ED7A 3EDEA 3OTTA 4F33B 4YHLL 5BVPH 4GG6B 4V1DE 1MFEL 4XCCH 3FQNB 5SV4A 4QGTA 5MENB 1HKFA 4U05A 1RK1B 1RUKL 1VESA 4IDLA 3N1MC 4XMPH 4B53A 4V1DB 1TZHB 1CI5A 1FBIL 1IQDB 4KVNL 5CEYB 4XB7A 4PG9A 3TCLB 5L9DH 3HAEA 3RWIA 3TIEB 5DD5H 5LQBL 4U1IA 4Y2DB 2VDKL 2AJ3A 2FO4A 3HUJA 5TJWK 1MAKA 4Y4FA 1KJVB 3F7VB 3FN0H 3E3QC 3ARPA 4Y1AE 1D5MA 1KN4L 1J8HA 5HGDA 4ODHL 2A74A 3QHFL 3GSWA 2RAMA 4LLDA 3QCVH 2F8OA 4RMSA 5EBMA 4N9GB 4Y5YC 5F70A 4NQXA 1MI5A 2HRPL 3MCLH 3BDXA 2P5ED 4K8RL 1YC7A 2BFVH 3GSVA 1A6WH 3OKYA 4YBQD 3EDFA 4IHOA 4OD2A 5T5FL 1JL8A 1FJ1A 1MNUH 4LCWD 2Q7YB 1MCRA 4OJFH 4R4FH 3T0EC 1N7MH 2IEPA 3ARZA 3RWEB 4X7TA 1QR4A 4I18B 4LKXB 1IBGL 1NQBA 3NVQA 3RUGE 1F4XL 1WICA 1ZHNA 2RGSA 3OKLA 4KUZL 3F7PC 3QI9A 4C4KO 1G9NC 3LKPA 1RZGA 3HPLB 4ODUB 3B9EA 4AQOA 5TF0A 1JYXA 1DLHA 1A7NH 1IAKB 1MEXL 4MD5A 4RISH 3RPKA 5DS8B 3NCJH 3QJHA 5JUEL 5CSGA 4G8EA 4X6CB 3QO1A 2YK1H 1IGYA 2G75B 3NA9L 1HSBA 4Z8FL 1QVOB 5HHOD 2UZIH 5IVOA 2EIBA 1C1EH 4HX1B 4O5LH 3T0XA 1K4CA 5JO5B 4R4BA 5JZ7D 2GTZB 1YECH 1ZS8A 2FJHB 4KVCH 5LVEA 5TF1H 1XAUA 3NH7H 5I71B 5IJVA 4GS7B 5IEHB 4Y19A 1I7ZB 2V5SA 1BFTA 4M7KL 5HYFA 4OFPA 3DROA 4UI2A 3ZE2E 1QSEB 2YPLB 5DHVA 1DBBH 4M9PA 3LH2H 4GAJH 5LXGL 2G9HA 4NFCA 4WI6A 2BY1A 3I02B 1I7UA 3LQAH 1NAKL 3MLYL 4CNIA 4YE4H 2ATKB 4DW2L 1A6TA 4K94H 5EPMA 4UILH 5DDHA 5IF0A 4L8SA 4Y2DC 4BFIA 3VFWA 1J8HE 4NZUH 3O6ML 2O5ZH 2CLZB 4X6FA 1GAFH 1F6AB 3CFBA 4PP1C 3I6LE 4PJAF 5I1CH 3HE6C 3STZB 1CFVH 2A6JB 4K3DH 2A6IA 4NKMB 1T0MA 1Q9OB 1V05A 2ZPKL 2CR6A 5JHLH 1KEGH 4OAWA 5E2UH 4C56A 5IIEA 4LSRL 2ZNWA 2GAZA 3GSQB 2HTKC 1F90L 4WGWB 2D31B 5ICXA 1QLFB 4NJAH 3GMRB 3S34L 1MHPH 3DRQB 3MV8B 4ERSL 1E4WL 3G04A 4P4KB 4UB0L 4QWWD 1H3UA 4XCYB 1S7SA 4TN9A 2NQCA 2XTJC 3ARFA 5CBEA 1MJ8L 5C08B 1OAZL 1RURL 4JN1L 4NQDD 4BFIB 4X9GA 4OJFL 4R4FL 3RX8A 1U8IB 4GKOA 5DJCA 4JY5H 3U46B 1X3DA 4EVNA 3UTQA 3C5ZA 2V6HA 1G7QB 2ARJB 2M8XA 2GITB 1N64H 4XMKL 4XP1L 3WUZA 3V6OA 4FFYH 2BXZA 2X9WA 1ES0B 3TN0D 3VXRD 1JGLH 5GIRA 1JRHH 1V7NL 5HGBB 4P59L 5ACMA 4PJDA 4JM2C 1BQLH 2BSED 4K3GA 3BAEL 4ZO7A 3IDYC 3WFEL 3QIWA 4BSWA 3S88H 1F3JA 4PJBE 3S5LB 3ARDA 2Q3ZA 4I5BA 3TJHD 3OKNB 1A1NB 2FLBT 5EBLB 1EJOL 4DVRH 2LFGA 1I3RB 4V2CB 4UV7H 1FDLL 4PRBB 1ACZA 3TZVD 3HI5L 3VFVA 4R90H 3BD4A 5FGCE 3HNSL 2Y23A 1MRCH 3GJEB 4L4TB 4UQ2A 1JPFB 4LCUA 2O61B 1OQOA 1G7QA 3DXAA 3JZ7A 4J3UA 4WW1A 1EHXA 5JOFA 2IH3A 5FYKL 3H9HB 4KJWD 5C70A 4J4PA 1N6QL 1GGUA 4UILL 3PJSB 3NGBC 1SMOA 2CDFA 5FKAA 2QSQA 4WTZG 4ZTPL 3VGFA 4FQQA 1AD9A 2KH2B 4U2YA 1NMAH 1WK0A 4KWUA 4XPHL 4RA0C 4OCSL 1LE5B 3HFML 2EXWC 5F89A 2I9LB 3HS0A 1H3PH 3VFGH 4S1RH 4WRLA 5IMLB 4L3AA 1B9ZA 3CH8A 4FG6D 1I1AB 1UT9A 2MNUA 4N5UA 4U1JB 1QLEH 3L7EA 3RL2B 4KVNH 3DXAE 4K3EL 3D18B 4LP4A 5DQ9A 5D93B 3RIAK 1R0AL 1T22B 3DOSA 5M94B 4WFED 1A9EB 4HGWA 5JNYA 5CAYB 1WAAF 3F7YA 4KUZH 2IAMD 5D1QA 1A7PH 4O4YH 1OF2B 4JN1H 1YA5A 4KDWA 5K59F 1CIUA 1WWCA 4W6XB 4R4NC 1TJGL 3VGHA 1NFDB 4S0TD 4P3CH 4UBDC 3FTGA 3KYOA 1BZQK 3MLVL 2BSRA 4PJBA 2EYRA 4YHOH 1D9KD 2OX5A 3HE7B 3T0BA 2HT4D 3KWWA 5KSBE 1K2DA 4D0CB 2XQBH 2CDEB 5BV7L 3RWCB 1JGLL 3ZHLA 5IW1B 1KF9B 3MRRB 4JZNB 3BEVB 3BKJL 1TIUA 4Y4KA 3UTSA 3VWKA 1DE4A 3ARSA 2UZXB 3CXDH 5IHUL 5DQJB 5GRUH 4DFIA 1YJDL 4M7JH 4OT1L 5C0EB 4XCEB 3IXAB 4OZ4A 4GRWE 4GXUM 4HWBH 4LCWA 5D1QB 4N5ED 1BIIB 3AREA 3OKEB 3TLRA 3H3PL 5C6PB 4M43H 5D4QA 2Z93B 3TZVA 3ZHKA 2B8OT 4OF0A 4GJTB 2RQ8A 2V5YA 2IQ9H 5F1NA 3D9AL 3UBXA 3U79A 4ZS6C 1QFUH 1TZHA 1I3GL 4TSCL 4JO2L 1NBVH 5SX4H 2VLKA 2EDKA 2FD6H 3O2DH 4NWTH 4D0CA 4BQ8A 4ZUSB 3KXFD 5I8EA 5JHLL 4LRIC 3VU2A 4JZNA 5A40E 2XWBB 4Y5XC 1MIEH 1XCTA 5GGTL 1Q9KA 2CO6B 5T1KD 3S37X 3IAPA 3LB6C 3DJ9A 2OL3A 1P7QB 1NCWH 2WSKA 3C5ZD 5D7SH 3IYLW 3QO0B 2V17L 3ARWA 3BEWA 3LB6D 4MNGA 1EVUA 1PKOA 3GSWB 3LQZB 3BQUC 2VL4A 4YK4B 2BNQE 1Q9LA 1GGYA 1VFBA 4NQVA 5KVGH 2DQFB 2EDOA 3K8LA 1G7JB 3W39A 1NANH 4P0DA 3QFJD 3O4OC 2J5LC 3SKNB 1QSFE 1YY8B 2W0FB 4NQED 3FHAA 5DRWA 4F7TB 4M7LT 1CFSA 4D3CH 3DHMA 5C09E 1OTUD 2XTJB 1JYWA 4HZLB 1OW0C 4QCIB 4A2MA 1Z5LB 1KEML 1C16A 2ITCB 2V9QA 4DZ8A 1NGWA 1ACYL 2BCKA 3WFEH 1A9BA 1Q72L 3RWHB 5B39G 4JY6A 5CLWA 1CGYA 4HKXB 3QDGA 1VCAA 2DYPD 2J4WL 3MA9L 4ZFGL 3ET9F 1OP3H 3QQ9D 3GK8H 4NUGH 4O2CB 1QEWB 4LAJH 1UQSA 1DQML 5F1OB 5DJDA 4OQTH 1I9RL 2G75A 2F8VA 3WKMH 2O5XL 5FGBC 1B0RA 1HIMH 2VH5L 3GBNL 2F15A 1WFOA 3JWDC 5EUOE 4G9FE 2ZG1A 4NQEB 2W0FA 1AJ7H 5CMAA 4XBEL 2JF1A 1V5JA 4I2XE 3E8UL 5SWSA 5DJ6B 2CO7B 1T1WA 1BQHA 4JHAH 1MJJB 3VGAC 1C16B 3RWIB 1UKSA 2F53A 1RZIB 2G2RB 1H15A 2OXHA 5F72S 3D2UD 1YEFL 4OD1H 4LNRB 4MJ4A 4R0LA 1AIFB 1YEKH 2BNUB 5FYJU 3O8XD 3DI3B 3WSQH 4G8GE 3FKUS 2E8ZA 4NNXB 3QWRD 3KDMB 4JFPA 1FC1A 2MTPA 4AH2B 2Z8WC 3V5HA 3Q0HA 1IAIM 2CLZA 3P4MB 4TUOA 5IWLA 2E7HA 1WEJH 1RUPH 4G7YL 1IL1B 2P45B 3SE9H 2AQ1A 1RHHB 1L0QA 1AR1D 3VFMB 2EE2A 3QQ3B 4IOSD 2GTWA 3QNYA 1UENA 3OGCB 2XZAH 1E0OB 2VLRD 4DGYH 5I8KL 1FO0L 4R96A 3S3PA 2X7LB 4YDIH 1REIA 3WMSA 4LLVB 1P69B 1Q94B 3FT3B 2A2QT 4PREB 3QEUB 4M8QA 4XPTL 4I0CC 5DJ6A 4GUPB 1NCBH 1T1WB 3EFDL 1S8DB 4G80B 2DI9A 4I9WE 1RIHH 1HQ4B 4QXUH 4EBQL 4L29A 1Y6KR 4BUHA 4P4KA 3A67L 3TA3C 5EN2B 2DWDA 3UDWA 1BECA 3UTTA 4ZFFA 3V9FA 4LNRA 4LSPH 4JO1H 1ADQH 5IGXL 5K9OA 2NMSA 4OFYA 3U4AA 1Z3GL 4Y1AB 3BHBB 4OZHA 2X4UB 2AXGB 2GKIA 5D1ZB 4BKLB 5DK2A 3MCKB 1U8IA 5DJ8A 5ISZB 1JF1B 1TPXC 5E6ID 3P9MA 3NPSB 3SPVA 4MDJA 2CJUH 1WIUA 1IC4L 3QUXB 3RZCA 3QO1B 1IGYB 5J12B 1OTSC 3PF2A 1GRWA 1OCWL 2NW3A 2AJ3B 4POZC 2LTQB 4ETQB 1K4DB 4M00A 4M6OL 4Y4FB 4HEPG 3IB4A 1Z9LA 1NC2A 1AD0A 1U95B 1UJ3A 4ZODA 2OP4L 4NM8L 3REWB 5EBMB 4NJ9H 4KJQC 4O4YL 1DUYA 3C2AL 2Y5TB 2ZOLB 4Q2ZA 3EYSL 5IJKA 3PP3H 3IDJA 4H5SA 4FXGA 1WIOA 5I76B 1CXLA 2GW5A 2DWDB 3L5HA 1I4FA 3BKML 4HH9A 5IMOB 2W92A 3VMNA 1H3WM 4OCYL 1QFUL 3MQIA 1WBYB 3KR3L 2HKFH 3IJYB 1KLUA 4NO0D 2AXFB 1U8NB 3L5IA 3TBSB 4RFEB 2MWCA 5DMIH 3E8UH 2CSPA 1XCQB 3PWUB 4PGCA 4XPFL 1OWWA 3KVQA 3GMOA 3EOTH 2AK1L 1M05B 1CFNB 4I8DA 2VXTH 4N0UE 5B4MD 4AQ1B 3F6IA 3SGDH 4E41E 2VDMH 3OR7B 4OD1L 3GBML 1R5VB 1KTDB 3O9WD 2V17H 4HT1H 2YZ8A 5CP3H 3B5HA 5IMMB 4N0FA 3RUGF 3VDAA 7FABL 5I1LB 1LVEA 1GZPA 3QIBB 2EDJA 4PJGE 3DRQA 3MV8A 5KSVA 3SGJA 3ZDZE 2GTZA 5FM4A 3RGVB 3V0WL 1PFCA 2JB6B 4P2CG 1YC8A 5ESQA 2YBRA 5ACZA 3TA3B 3TH4T 4DKDC 4JO2H 2JLLA 1S7UA 4MS8C 1I1FB 4LSUH 1AP2B 3LMJH 4RFEA 1ZEAH 5BZWA 3QQ9C 1IARB 1MREH 5IEKB 5D7LD 2ESVD 4Z6AT 3IDGA 2GITA 4FZEH 1QA9B 1SYSB 3MRPB 3MR9A 1GGIL 5IF0B 3O6FA 3U30C 1CE1L 2R1XA 2LE9A 1TQBB 3HMWH 2YA0A 5FUOL 1ZANL 1S7QB 2B2XL 1L9NA 1RMFL 1JPGA 2PYEA 2ZCKL 4OZFG 3D39D 3E6FB 4GMSL 1J12A 2YRZA 4M6ML 2JB5L 3DECA 3WIIH 2YHGA 1EO7A 1VFMA 4QNPE 3C8DA 4HMCA 2QBWA 2ZSWA 5IBLD 4IOIB 4JFFE 5JXAL 5E56A 1K6QH 2DLEA 3G6AB 4X7DC 4X4ME 5I15L 2ERJC 1GOHA 4WV1B 4XNMA 4OB5L 2NZ9D 5F7NC 4PRAA 2JKXA 2DM7A 4XBGA 2VLKD 4ZPTA 4HC1A 5D7LA 4HWNA 2XA8H 1G9NL 2CRZA 2FJFB 2Y7QA 4WJ5A 3P3YA 1QA9A 3PQYA 2H1PL 2NX5A 1EJ6A 1KIPB 1KJ2H 4QRTB 3TYFA 1MVFA 4LLUB 4MCZA 5C08D 3O41A 2YN5A 4LFHD 3W0WB 2XZQH 1PX3A 4P2OB 2CD0A 4X80L 3TBTB 3KYKL 5FO7B 2DL2A 1JPGB 3MV8D 1C1EL 2FEDC 4JO3H 5DJCB 2WUBL 3OAYK 4ESKA 2HH0L 5HHPB 1YECL 1EBAA 4OUUB 3ZE1E 2GJ6D 1JMZA 5HSFA 2XN9E 1EX0A 5DD0L 5EOTB 3SY0A 3VGAB 2I9LA 5DC9B 1ZVHA 4TOYH 4K2UH 4OD3H 4MWFA 3WNPA 3K80A 1H5BB 4WUKL 1G84A 2WMPA 1L0YA 4Z0XA 3O6LH 1F42A 5KSAC 5L0QB 5IB2A 5IQ9A 3ZDYE 5BO1H 4L5FL 2DM3A 5DJZA 4X5WA 3U9PL 2Z8SA 2R0WL 4HZAA 4PJXF 2XPGB 2YD2A 3QO0A 5B3JE 2BVYA 4NZUL 3W9EA 3OF6A 1KIQA 3H9SA 4I0PD 4GRLD 3THMH 4UNTA 5E1AA 3MPCA 2VL5A 4XNZC 2DLIA 1CLCA 4DUVA 1ADQL 5LGJA 5CZXD 5DD6B 4L4TA 1JNNL 4JN2A 4ODTL 5FO7A 5JXEC 5C71A 4L8SC 3WL9A 2Q8AH 3C60A 4K7PY 1BQHG 2ZUYA 3PWPD 1NMCC 3F12A 1OD9A 5DMGC 3SKNA 1MFEH 3KYOB 4XCCL 3STLB 3B6SB 5TFSH 3O3AB 2BVPB 2CJUL 2CMRL 4EOWL 4ZFOL 4HKBB 3N9GL 1JUFA 2X9YA 1NDGB 4PJCF 3WN5A 1FORL 4YBHA 3FB8A 1PLGL 2J88L 1E4WH 3FB6B 3FFCD 4UB0H 5IQ9B 5GISH 1KCLA 3RUGB 5F9WB 2AK4D 2HT2C 5C07D 3S97C 2PW2B 4ZUWA 1QOKA 2BOCB 4C58B 1FYHB 4XH2B 3DGGA 4NKDB 4DTGH 3QDGD 1GIGL 5IGXH 5IUSA 3BKMH 4JY5L 5FAAA 1ONQA 3F5WB 4ELKB 2ADJA 3OB8A 1I3VA 3L3KB 3DUHA 4U7KA 35C8L 2ESVA 3VE0B 3VWJA 3WLBB 2E9WA 5JNYB 4CU7A 4HUUB 3V7MA 3O3UN 4NQEA 5C09A 3QDJA 3EOTL 2BMKA 3KPTA 3CD4A 4R26H 1U0QA 1IGJA 4YHNA 4F7CB 5J1SC 4YWGL 3S8WA 1MIMH 1BZ9A 1GZQB 3FB6A 1G6RB 1IKFH 3F58H 3VXSD 2PYFB 1FDLH 4KMQA 3PP3K 5AAWA 3RTQC 2P5WE 3PXHA 3SCMD 1WZ1H 4J12A 3FQRA 2NY0D 3OKDA 4PJ5D 5T3ZD 3JBG7 5KJRL 5HGAB 2VDRL 3BPCA 5KTEL 1BVKA 1KENH 5C0AB 4J23A 3VXME 5L7XL 3ILQC 5C0RH 4PJAA 4Z8FH 2X70A 2H26A 4X6CF 4X9IA 2NY6D 1VFBB 1OLZA 3KPSD 4LVOC 4XVJH 2YUVA 1FC2D 4G9DB 3CU7A 1HI6A 1T66C 1A6ZA 4ORGA 5L2JA 2GTWB 4JKWA 4XP6H 1CD1A 5JDSA 4UQ3A 1R3HA 1I1YB 4I18C 2X89A 3I6GB 2PKDA 5AWNL 5LGHL 3C6SA 4MB3A 3QULA 3QRFM 4E5XB 4N0UB 3EUUA 3J8F7 4PJEF 1R5IB 4XP4H 3EZ8A 3VFUB 3WFCL 1WITA 3L3HB 4L29B 1CFQB 3IT8D 5LCVL 1KPRA 4JFEB 3TN0C 3ARBA 1QLRA 2AVGA 3ZL4H 1ZXQA 2VN4A 3Q6FB 3FQRB 3HHRB 4LLQA 4FTVE 1OT1A 2R39A 4KKLD 3O8XC 1MI5E 3LQAL 5ALCL 4JM4L 3KYMA 1A1MB 3MODH 2J1KA 4OZHB 3E6HA 4NKOA 4HIHB 4DK3A 4JR9L 5J1AB 5LAXB 2BVEA 2BVQB 2FIKA 5C07B 4XI5C 4HD9A 1EERB 3GI9L 3KPOB 1MAMH 4LPTA 4GRLC 3FFCB 4OZIA 5CCKH 5E2UL 5HD8D 4DAGL 5LBSH 4M7ZB 4R97C 4L9LB 3QA3A 4APQC 4ZAKD 3M17A 2HVJB 4I2XB 1DZBA 2K9UA 1MHPL 4TVPD 5HVGB 2Q1EA 1YEGL 3SGEH 4X80H 1RSFA 2AJSL 3JTTB 1KPRB 1NFDF 3G5ZB 4JFEA 4KU1A 1KPVA 3IAGC 4Z7WF 4HH9B 2DTMH 4YHZH 2DBLH 3KLAA 3NZ8A 2OI9C 5DD0H 3E6HB 1I9JL 3CXDL 3WO4C 2AXJA 4TOYL 4K7PH 3HI1A 3LOWA 4OB5H 3ARTA 4QCIA 1RULH 4MA3A 4OM1L 3U0TA 1YJDH 4JQXA 5I66A 3RZWA 3MBEA 2AW2A 1MIML 2WNGA 5J3HD 1EBPA 5HGHB 5HHVL 43C9A 1F6FB 5FFLA 5E1HB 3BDBA 2FO4B 3HUJB 4KHTL 3RKPA 4ZFZB 3GMPB 1XR9A 3RBGA 4OGYH 1ZOXA 1CXKA 1UA6L 4L1DA 1HE7A 2BNRD 4PTTA 4EQ2A 3IFLL 1X9QA 4HKZB 3WIHA 1MI5B 3DIFA 4LAQH 4WI3A 3JUZA 4JDZB 4K23L 3KPSB 4ZYKB 3KYAA 4OKDA 3AREC 3V6ZA 3MO1A 5JZ7C 1MRDL 1B2WL 5TDPA 2F74B 3SDDA 5D2NC 4JG0L 4X4YA 3QUKB 4W4NA 3P4OB 4DVRL 2AJUL 4I3SH 5K9OB 4HLZG 4KQ3H 5F8QC 4XCFH 4JZJA 3DMMD 4M1DH 4YUEH 1JHKL 4M4PA 3SDCC 4Q97A 5T3ZL 3QG6A 3P9MB 1RHFA 1IAII 3GIVB 4IBLT 1MCLA 1V8HA 5B38B 5BO1L 4U2ZA 4GBXC 1SEQL 2YD5A 4NKIL 1FPTL 4NHCH 4L8CA 5DEGA 3RWDB 4PTUA 5LWYH 4F3FA 3KXFE 5DMYA 1NBZB 3HC3H 5T1LD 4WWKB 5EG6C 5F3HB 4UTBL 1AGBB 1U3HA 1IVLA 4KRNA 3DIFB 2OTUB 3L6FA 3U9UA 4ODTH 5L88L 4NZDA 3T3PE 4NQUA 4Q6IA 1FCGA 2OSLA 3T1WA 1NMAL 4HFUH 3BH9A 3SDDB 2R29L 3Q5YA 2FJHA 3VH8B 3S35X 1YY9C 3LEYH 5HY9A 4OCSH 1ZT1B 1B4RA 3MRLB 1IQDA 3S9DB 3BIKA 4XBGB 4PV8A 4PJ5A 1NLBH 1T3FA 1MLCB 2YKLL 3DRTA 1IGFL 3VG9B 5D8JL 4Z9KB 1JHLH 2FB4H 3SE3A 5FUCE 3OV6A 2XKUA 4PUBH 2J4WH 1B0GA 4P5TD 3JWDL 3LN5B 2ZWLT 1S7WB 2NY2B 4NUGL 1AGFB 3MLPA 1U42A 3JTSB 3PXJA 4HBCH 4PTUB 4Z78B 1HYSC 2GUOA 1I9RH 1HHJA 4MNQB 1M7XA 5D72L 2VXQH 4NGHH 1KENL 3TF7C 2LAGB 4FMFA 3TFKD 2ZUQC 5EC1A 5CEZL 3STZA 4HCRA 3DYMA 1KFAL 1RZKC 4YBQC 3BH9B 1DBJH 5E08H 3O9WB 3VRJA 4Y5VC 4CVXA 4KHTH 1LEGA 3D69A 3QPQC 3UJIL 4LSTL 1H5BA 3WIHL 2NLJA 5JW4Q 1S9XB 1HZHL 2P47B 2FJGA 3ULVL 3T3ME 4ZSOB 5JIPA 3CXHJ 4RAUB 4YHLH 2MJWA 1QFWL 4M48H 4BELD 4HULB 1DBKH 5I8OH 3O3DB 5HI5C 2EDHA 1XF2B 3JSSA 1VEOA 2EH7L 3OPZH 3NCYP 5IMOA 4FP8H 3RL1A 3WXWH 1FBIH 3X14A 2APTA 4AT6A 3FAXA 1JNJA 5GGQH 3MBXH 2Q87A 1UACL 5DYOB 2PO6B 5KG9B 1W8NA 4EVNB 1FIEA 1I3UA 1P4BH 4TSCH 4OUOA 1FO0H 1CFNA 2MKWA 1RAMA 2H32H 1FGVL 3MLUL 2Q86B 5JORB 4HKBA 4CW1A 1BREA 3DSNA 4WU7B 4NKIH 1QFOA 3BWUC 5AUMA 2QJDA 4LPYA 4XNMB 3GM8A 4ZTOH 1A6UH 5TGBA 4BSWB 4OLXH 1VEMA 5GRYA 1ZLUH 1LGVA 5HHNB 1RUQH 3G5YA 4RGOH 3PG2A 5EZIH 3VD3A 2X1WL 3T0EA 3HB3C 1D5BB 1AXTH 4LEOB 4AENA 4HG4K 1HDMA 5L88H 2KPNA 3D3VB 3KPRD 1RJCA 4YBLB 1XF2A 5I19H 5D6DA 3GSRA 5DUPH 5ACZB 1EEQA 5FYJE 3EHBC 1UWGL 4MXWH 1XF5B 4EDWH 1TVHA 1FN4A 3FB5B 3TM6A 2EEAA 2YR3A 3E2HB 5HYIA 5J57B 5K9JH 2FGZA 1S7VA 3X3GH 1IBGH 2H8PA 3VE0A 3ZDZF 2J8UE 3NACL 5JA8B 2BX5A 4J8RA 3T77A 1WBZB 3LHPL 5I1HH 4LNVA 1MVUA 4YIQB 5A2FA 5C0CA 1LNUB 1ZT4B 4FXKA 3QZWG 2XZCL 2DF3A 4EUPH 1U36A 3T09A 3EFFB 4U1MB 1UJ3C 2P5EA 4H1LA 1PZ5B 2D0GA 4YXHL 4KK8D 1KSRA 1P7KB 4ZFGH 3GIZH 4EJ1C 5IM7A 4K23H 2M26A 2E9IA 1ACYH 2RBLA 4K8RC 2X1XR 2HJLB 1N5AA 3QI9C 1XIWC 3RGVD 1XF5A 1WCBB 3PWJB 1TVHB 3ALXA 5E8EB 2VISB 3DBXA 1SY6H 2WAHA 3QIUC 1I9JH 4F80A 4M6NL 2HWZH 2QQLH 1CQYA 4KC3B 4G9DA 4RX4D 1U92B 3LH2L 3DXAD 4GAJL 2W65A 4ZQKA 5HHQA 3SKOA 3VFOB 5LXGH 1QRKA 4M7LH 5ISZE 3B6SA 1W72H 4U3CA 5HHXH 4M48L 3LPFA 1MVUB 2DOCA 3PV6B 5C0CB 3IXTB 5FUZL 1S9VA 2PR4L 4PRIA 4LU5L 3QULB 4Z7UE 3UTPE 1LHZA 1IMHC 3D87B 2N7BA 4FABL 1U93A 5EU3B 4RQQB 1UFUA 4KY1H 1KOAA 4D8PA 2KKQA 2QSTA 2XYCA 4JRXD 5EBWB 5GJTL 3RDTA 2YC1B 4JVPA 4NOBA 4QHNA 5DI8A 4PLJC 4PGZA 2A77H 2DQGH 5FXCH 5GZND 1R3JA 4G8IB 2AJUH 4I3SL 4WHTB 1A64A 3D3VD 5ID1B 4JO4L 2M1KA 3HZMB 4H88H 1ZHLB 3NIGF 1CT8B 3QEQA 5BXFA 3NFPA 2P24A 3KG5A 2XZAL 6FABL 1XGUA 5FA4B 3P2TA 1J05B 4AJ0A 2BRQA 1FCCA 2UVFA 3KPLB 3P73B 5DQDL 4NHCL 2XG4A 2XFXA 1JVKA 1DUZB 2C3WA 4HJGB 4B0MM 4PJ8D 3WIIL 3QFJB 3IU4H 1U8PA 5F7LB 3I75A 4P46B 3N85H 4RAHA 3INUH 2FRGP 5CFHA 3HMXL 3JTTA 2VXQL 1BX2B 2X4PB 3EFDH 4NIKB 2LVEA 2CKNA 4ZS6D 3LD8B 3X3GL 4QOKE 3P9WB 1KB5A 3K81A 4LCCA 5E8PA 3RA7L 2W9DH 4U6VL 2BNQA 2BRRL 4XMKH 5ECJE 5CGYD 1UZ8B 4TRPL 1KTKE 3MJ7A 3B8YA 1NMBL 4MA3B 3AROA 1BJMA 2X70B 4MQXC 1OGTB 4EI5D 2XRAH 4TTGA 2HVKB 1Q9KB 1MQKL 3WJLC 4ZUWB 2VABA 5JOPD 3FO1B 1DEDA 2AK4A 1ZVSB 2AEQL 3NIDE 4LGRB 4P5KB 5FM8A 5HYJB 2HLAB 4YO0A 1AQDB 1XGQA 4X7FC 2IH1B 4ELKA 4FQXA 3GSNB 4UDTA 4JDZA 5D72H 3WFDH 4ZFOB 1KCVH 4PGEA 3BX7C 3MO1B 1DEEA 2D4DA 2HFTA 5KOMC 2MQ0A 4RZCA 2HKHH 2FEEL 1Q1JH 3AAZA 1X5IA 2IMMA 4OFYD 3SKMA 2J3SA 4DN4L </