5CP3H

Crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides in complex with sulfathiazole
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
212
Chain Sequence
DVQLRESGPDLVTPSQSLSLTCTVTGYSITSGYSWHWNRQFPGNKLEWMGYIHYSGSTNYNPSLRGRISITRDTSKNQFFLQLNSVTTEDTATYYCARYGGYWGQGTSVTVASAATTPPSVYPLAPGGGATNSMVTLGCLVKGYFPEPVTVTWNSGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light Chain of Antigen-Binding Fragment of Monoclonal Antibo
publication title Class-specific Monoclonal Antibodies and Dihydropteroate Synthase in Bioassays used for the Detection of Sulfonamides: Structural Insights into Recognition Diversity.
pubmed doi rcsb
total genus 41
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp3H01
1PQZB 1KELH 5EU3B 2AK1H 4J4PA 4EN3D 5E00B 5F9OH 5J6GA 4MQXD 2VXVL 5SWQB 1G9ML 1FH5H 3NZHH 4XCEB 1ROWA 1UVQB 1MCPH 4TRPH 4LDEB 2D4DA 1OAYL 3ULVE 4Z76A 1T4KB 3KLAA 1AQDB 2ARJB 4XCCH 5FYKL 5IW1B 5HYSA 3SY0A 4HGWA 4GMSH 1J5OH 3CVIH 4HWZA 1ERNA 1FV1A 1JF1A 1Q0YL 3BEVA 5ANME 3RJQB 4L8BB 3TCLA 1G6RB 2XA8L 1HEZB 1I8LC 4Y4KB 3D2UA 5KSVA 1IGTA 5BVJB 4M02A 2DYPB 1YEEH 2EXYC 2J2ZA 3BKMH 5KTEL 4BYHA 3QPXL 3IDMB 3HB3C 1IFHL 3P77B 4L8SA 5JNYB 3GSOB 5IB5A 3T2NL 1NGPH 1DBKL 2VKWA 5LBSH 2DIAA 2NYYD 1T03H 2GIYA 1REIA 3OF6D 4IIQA 3PP4L 3VXSB 1I7RA 2GITA 1NAMB 1NMBH 3MACH 2JLLA 3QEQB 4I13B 4IMLA 3OPZL 4PB0L 4XVJH 2Q76A 4CMMA 2FCBA 4HWEH 1H3GA 3DVFA 3BXNA 3EYUL 1CQYA 1UM6L 3LKPB 5JQHC 4IRJC 5MEPA 2VLJB 1GHFH 4QRSA 5JXAH 4F7CB 4JG1L 4NKIH 3QNZA 3SGEH 2O5XL 5K9KA 4LOUC 5EA0H 3B83A 4GXUM 3Q6GH 5DZLA 3TH2T 4Z7OF 4PJGB 3VI4F 3K80A 5FOBA 1A7PH 3DI3B 3VGAB 4LLVB 1JGVL 5I1LB 5EFIB 1DQDH 5CCKL 2PYED 3QIWA 4LRIC 3SN6N 3PWPA 2FSEB 4GMTL 3SDAA 4P59L 1G9NL 1CFTB 3MV9A 3QPQC 2WBJB 2YD3A 3D39B 4Q97A 4OT1L 4PRDA 2YR3A 1T3FA 4OF6A 2Q7NA 3L9RA 3BPNC 3QNXB 1JBJA 2F58L 3NFPA 3TVMB 1X9QA 3WS6A 3ARSA 1QHOA 4AL8L 2EYSB 1NH6A 4JZJC 2ATKB 5C7XL 4HZLB 1QQDB 1H15A 4KK9C 4PRPB 5E70A 5GGVL 1N6UA 3HMXH 3QIUC 1D6VH 1HQ4B 5C9JB 2YN5A 3IGAB 3GSNH 3HNTH 1B0GA 4PV9A 1QA9B 1U8PB 3G6AA 4OM0L 1NEZB 5IMMA 1BBDL 1EEYA 2FLRT 5ESVA 2NY2C 2W9EL 3RDTA 3O4OC 4N90E 4XMLL 1ZHLA 3O2VH 2D2OA 2P49B 4Q9RL 4U6YA 1BOYA 3T8XB 1MJ8H 3L3IB 4JR9L 4JHZA 2P5EB 3B43A 4PJGF 2AEQH 2XWTB 3MBEA 4Y8AA 5HDBE 3PGFH 3C5ZB 4YXLL 1U8JA 2DLFL 1TJHH 5C92A 4HV8B 4MDJB 3V4UH 2NY0B 5HD8D 2CGRH 1QOKA 5L2JA 2H45A 3O6KH 5C0BB 1IGFL 3QXUA 1FFNA 4D0CA 1EBPA 1G7QA 5DJCA 4BQBA 4U1LB 4EXKA 3EJZC 5DJDA 3O3DA 3RI5K 3TPKA 4NNXB 5E1AA 3FO0L 2Q3AA 1IQWH 2BXYA 4CJ0A 5J11B 1YY8B 3IDGB 5KJRL 2Y1VA 5GSVA 3SDXA 4ZOAA 3NOIA 1BQHG 1YUHB 1OOAA 1FAIH 1UKSA 4ONFH 3PGDB 3H3PH 1BEYL 3PDGA 4M4PA 3ILQD 4OF8A 4UOJA 4G9FE 2OMNA 4PJXE 1F2QA 2DWDB 2IQ9L 1T1WB 3UO1L 4KKNA 5JLZA 3ES6B 2G60L 2HJLA 1JPST 5BV7L 1MFDL 2BNRE 5I66A 3MNWB 3NFNA 1JPFA 3GM8A 1T21B 1NAKL 3OKLB 5HHOD 3BZDA 4I2XB 3OWEA 2ICES 1UKTA 4ZUVA 2GK2A 5D7LD 4YDKH 4M00A 1C7TA 2FZ3B 3VXRB 2I27N 1BP3B 3BI9X 5MERB 3RWDB 4J23A 4FQ2L 4PP2B 5JIHA 5JMRA 3SQOL 1DVFA 2YPKA 4QRPE 4NRZA 2PTTB 3UZQA 1A0QH 3QUKA 3Q6FB 1Q94A 1Z0MA 1BVLA 3RWIB 3JTSB 3OV6A 2R1YA 4W4OC 4JM2C 5CGMA 1EMTL 3NIFE 4M48H 1SY6H 2EDBA 3SDDD 2FIKB 5IHUH 3ARDC 1UWEL 4ZSOE 3O4LE 3RL1B 4QOKA 4R2GB 4QNPF 4NPYA 1B88A 1K6QL 4PJAA 4UB0L 3QWOA 5D71H 5D7SL 5C0DA 3LKQA 4ORGA 2FYYA 2AKRA 2XI9A 5DRWB 2P8MA 4S1SL 1UKQA 5FK9A 4PGCA 1K8DB 3DUSA 3O9WD 4HCRL 4J3SA 5DZNA 2HLAA 5HPMA 3Q1SL 1RZJH 3WFZA 2IANB 2Y7QA 3JWDL 5HY9B 1UJTA 3LPGA 5J9PB 2ZKHL 5GHWH 2FJFB 3VGFA 1J1OL 2LTQC 3CGTA 1WBXA 3TWCL 3UCRA 1KIQB 5IEKA 4CRPA 2B5IC 1T2QL 1DUZA 1I7TB 3UJIH 2V7HA 2FECL 4WFEE 3VFOA 5CJXA 4D9LH 3MCKB 3TBWB 1NFDB 1UH2A 5DRXB 1HSBA 2Z4QA 4NO5A 5GGUA 4J3WA 5JHLH 4FQJL 5BMFL 2ZUTA 3PJSB 2AQ3A 1AD0A 3O6LH 2XNAB 3UMTA 5GXBB 5IEHA 4PGEA 3V5HA 1XF1A 3O8XD 3MRCA 1DQMH 3ZHDA 5TE4L 4PJIB 3BIKB 1YNTA 2VOTA 3G9AB 4P9ML 2DQFB 4Q9QH 1NQBA 4ETYA 4PTUB 3LEXB 4M6NH 4PLJC 4QY8A 2X6MA 4M8QA 4XXDB 5FO8A 1TVDA 3NPZB 4OCXL 4R4ND 5IM7B 4DUVA 2JK5A 5DD5L 2R4SH 3DOSA 2BSTA 2I07A 1E4KC 2DDQL 4NQEA 4C57C 1MHHB 1I85A 1SEQH 2YS4A 1H0DB 3AU1B 4PTTB 5DWUL 4X0KA 3C8KB 2VDML 5MI0B 1CD0A 2MPAH 4JQIL 1XGTA 5JHDB 1QVOB 3CMGA 4P5TB 2PW1A 1RZ7H 1U3HB 3MRGA 1ZLSH 4P9HH 4RMWA 2VIRA 5ESQA 25C8L 1JTPA 2H2SC 3JUZA 5SV4A 1A6WL 1OAKL 3RWCA 1FL5A 3QO0A 5B8CA 4JEGB 3VWJB 2SEBB 3N1MC 5I1KH 4D2NA 5TDNA 4CGTA 3WMSA 5FFLA 2V5RA 3ZE2E 2BOCB 2X44D 1XCQB 1Q9KB 5DS8A 2V5MA 2BVEA 1KENH 2UZXB 2VXSL 2FO4B 4LARL 3K3QA 4NFDA 1MJ7L 1XIWD 3BKCL 1PSKH 1S7TB 1ZEAH 4G6ML 4JFFA 2O5XH 3X3FL 4RQQB 4YHLL 4F7TB 4H8WH 5FDWA 2ADGB 3VG9C 3V52H 4EI6B 3VDCA 4IM8A 4UINH 2BJMH 3KNBB 5EWIH 1P5VA 1MCCA 4NC1C 3QI9B 3TZVB 3KPRA 4ZAKB 3MCG1 2YC1B 4XZUA 5EBMA 5FYJE 4NCC2 4UDTB 2D3VA 4RFEA 3WKNA 4UILL 1MFBL 4NZDA 3VI4E 4FABL 2I9LA 3MRIA 2X9YA 3A6CH 4OIBA 1T0NB 1T20B 3G5YA 5FKPB 2L0DA 4LLWA 2Z91A 4WEBL 3EOYG 5IQ9B 1Q8MA 3DBXB 1P84K 3BMWA 1KN2L 2R0LH 2WNGA 3U48A 1BJ8A 1MWAL 2ZPKH 2WINB 3BPOB 1YEKL 1NCCH 4NO0A 4HUKB 5JOFB 2IMMA 5MENE 1AI1L 1KLUA 4Y88A 4YIQB 1DLFL 3R0NA 3TBTB 1PEZA 4Y16D 1G7PB 4MNHA 3IRZA 4XNXL 1ZVSA 3ARED 2BSSB 5B38A 3DV4A 1NLDH 1U8LA 1BBDH 5I1HH 4EIGB 4OKVB 1S8DB 1OAUH 3FONB 3SJVB 1XR8B 5I18H 3L5WB 3W9DA 1FG2A 3VXSE 1VFOA 2RBLA 4O2FA 4WWID 4EDWL 1ADQL 2GTWA 3QEQE 4E41D 5IBLC 4GO6B 2W91A 1G7MA 3OG4B 5I8KL 4NO3A 4ZXBD 1QBML 1UA6L 2BVOB 4YHKH 1X5IA 5IROC 4HXAL 1T6VN 2VLJE 5DJAB 5ILTH 4LNRB 3HAEA 1DQJA 5KSAD 2ICWA 3B5GA 5DJ0B 3ETBF 3CH1A 3RKPA 1JHKL 2Y07L 2CIKB 3CU7A 4JO2H 3I02B 4NKMA 4YDIL 5DMKB 3FRPA 4O2EA 3BZ4B 2PO6A 1TVBA 1F6AA 4LVOC 2AABL 4WJ5A 1J0HA 3GSRA 4LSVL 5FO7A 3GGWA 3MLSL 4PB9H 3D39E 1AJ7L 1WBYA 1FRGH 5FM4A 3FOLB 4EI5C 3QUZB 4C56D 1K8IA 3E2HB 2ATPA 2GQHA 4PGDA 1N3NA 5A2IH 4CJ1A 4KV5F 4XBGA 3V6ZB 4KK5D 1JPGB 2VL4A 4MA7L 1C5BL 5T5FL 1DTUA 5K59F 2D7TL 2IMNA 4RAUB 5T1MA 1AGBA 3K8LA 4UOW0 4G7YH 1JTOA 5EO0B 4HMDA 1URLA 2FEEL 4WGWB 3CLFH 4PRPE 3UO1H 1OTSC 2VLRD 4JFQA 2I5YL 4NQVB 3QNYB 4WI4A 5I1JH 5IFHH 5IB3A 3JXAA 5CSBA 4Z0XA 4KXZI 5JR1L 4U1KA 4PRHB 2BZDA 5JDSA 1BF8A 4P3CH 4MSWB 3RJDA 4MJ4A 3QDJB 1G0XA 5JA8B 2CKBA 3LKSA 1MREL 2P5EE 2H9GB 1KBGH 1AY1H 1JWUA 3TBSA 4PRIA 3VFGL 3EO0B 3CFJA 3KS0J 5JW3L 2IAMA 4YFEA 2RJMA 4ODWA 2AXJA 2E9IA 5CILH 4OI7A 5GS1A 1U41A 4P46A 3UTZB 4IRZL 1ND0B 4MYWB 1JYVA 1IL1B 5E8EB 3DUHA 4M93C 2YXMA 1E27A 2OK0L 3FFCA 5F7DB 4E0RB 4HGMA 2FBJL 3FB7B 4QTIH 5JUEL 5JA9A 4G6AC 3HS0B 3S98A 3WN5B 4GRWH 4RIRA 4QCIA 3F58H 5I1AA 2GHWB 1DBBL 1JK8A 2IPUG 4HS6B 1PZUB 1MFAL 1EUTA 4X7CC 4LU5L 1LEIB 3TWCH 1CYGA 5ELIA 4HUNB 5E6YA 1YMMD 1MCDA 2V5TA 4OZGF 1FORL 1KEGH 3ZKNC 4L9DA 1O7VA 2CH8A 3DYOA 5DRZA 5BMFH 4KJYB 3D87B 3O6ML 3T3PF 1F13A 2I24N 4E42A 3JWOC 1JRHH 2A38A 1GC1C 4HFWB 4I2XE 3TO4C 4U3HA 1RK1B 3BSZH 2AJ3B 3DSFL 4NIKB 3VXRE 4M7ZC 2D9CA 1CGYA 5F7UA 1QR1A 3FO2A 4PJXA 2DDQH 5E6IB 1KTRL 2YEZA 3GMRA 2VABA 5KZCB 4Z95L 2CIIB 1GGBL 1YJDC 1AO7E 3IDIA 2BNRA 3BMVA 4NWTL 5CEZE 4TNVK 2W65B 1NGQH 2VAJA 4FXGA 1HYRC 5CJQL 1FFOB 5LGHH 1R5VB 2BY3A 4OQTH 1U8HB 4ONHB 4Y4FB 2P5WB 4J3XA 3DROB 2HRPH 1R3JB 2FLBT 4QRPA 2XKUA 1CDYA 4IOIA 1QSEE 4L8DB 2EDQA 4DGIL 4KI5E 1JYXA 3VXUB 1NCNA 2VXSH 2CDGA 1CL7H 4ZFOL 1PJ9A 2VZTA 2IANE 1DBML 1RULL 1OL0A 3SE9H 5GGQH 2AK4D 4QRUA 4KGLA 3ULUC 3X3FH 1NC2A 3WFBL 1A14H 3O4LA 4FG6C 2XZAH 5E1HB 2NY3B 1ZA3B 2IWGA 3CVHA 1JYNA 1HXYB 1KIUA 1NFDE 3F7RA 3RWEA 3PWLB 4JPVL 3QDGB 4HDIA 2R2HA 1AFVL 3G6JA 3CK0L 3LB6D 3TGXA 4K71B 3P4OA 2NXYC 4PJIE 1UZ6F 3IJHA 2R8SH 4PJ5A 5GS0C 4WO4B 3SDYL 2ZCHL 4I5BB 5I1EL 3IDJB 1DN0A 4GS7B 4C59B 4HS3A 4RGOH 4ZFZB 4MAYC 5ICZB 3CFBA 3KXFB 3HLAA 1YEKH 4GRLA 4NFBA 3RAJL 2VZSA 1UB5B 4DFIA 4PRAA 3AAZB 1AI1H 4GAGH 5ICYB 1VB9A 1DLFH 5IVXB 5SWSD 3WLBB 4NWUH 1QZ1A 1K3ZA 3MNZB 4ZOCA 1I9JL 3QQ4A 1BGXL 4HUWB 5JHDE 1WZ1L 3TIDA 4LLMA 2J88H 2PXYB 3LDBB 2X4PA 1T7VA 5DD1L 1YMHA 4P2QD 3QUYD 1P4BL 2X4RB 5I30L 3FB6A 4QYOA 4FFWD 1HCFX 1KACB 3MR9A 3DXAE 5I1GL 3PWJA 4DK3A 3KPOB 3KPNA 2EKSB 5IK3A 3DUUA 5FM5O 3WD5L 2EC8A 1PGRB 1UA6H 1J8HB 2Z93A 1YN7A 3MFFB 4ORZC 5DURB 5F9JB 2FL5A 5I9QB 1JHLH 2JJTA 4OFIA 3UAJC 2QSVA 2OI9C 3T0WA 2IADA 1MFNA 4LSDA 5KSUA 5DJZA 2OTUB 3JWNC 3QUXA 4DW2L 2DRUA 4GUPB 1JHKH 4F3FA 4OI8A 4LKXA 4DN3L 4WFHE 4LCUA 4JHAH 1XF2B 2GYSA 5DC9B 2R29L 1KPVA 2QADB 2PNDA 5BZWB 2ZNXA 1XAUA 4X99A 2MCPL 2L7JA 1OSZB 1MHPL 5AG9A 3FQTB 2ZOKB 5LQBH 3HUJB 3VWKD 5HI3C 1JNJA 3MV7A 1IEAA 2Z31C 1LP9F 4LCIL 4QHLA 5IMLB 4XBPA 1DBAH 1L7IL 4MA7H 4DGYH 2HWZH 1T7ZA 1TQCC 3TO2B 5CZXD 5L2KD 3MLXH 1BVKA 1FIGH 1WWWX 1JP5A 4AENB 1JWSB 2FWOA 1UADC 2XRAL 5HHVH 3S35X 3MLVL 3GIZH 5ITFB 1PQZA 4POYA 2H3NB 5DEFB 5EU3A 5E00A 4XP9L 1L0QA 4I9WD 5FB8A 5SWQA 1WC7A 4XCEA 3EFFB 1NC4B 3MREB 4HKBB 4LVNC 4WI9A 5DMIL 3RU8H 1UVQA 5EUOE 3Q0HA 1E4WL 1AC6A 2IPTL 2X10A 4M5ZL 5F7EH 1UWGL 1AQDA 2ARJA 3I50H 5IW1A 1HHGB 1UXSB 2B1AH 4OD1H 3MO1B 3SJVE 1J0KA 1PX4A 2HT2D 4KMTL 3M1BB 43C9B 4KRPD 4L8BA 4APQD 1G6RA 1HEZA 1IGCL 4ZQKB 4Y4KA 5C6PB 4I0PC 1G7LB 3BQUC 3MUGB 1UQSB 1QLEL 4O2CA 4F9PC 2CK0L 4K2UL 3VA2C 2YPVH 3QDAA 4ISVB 2DYPA 4S2SA 4NSKB 4O02H 4N0UB 3IDMA 3I3DA 1NCUA 2L7UA 4OUUB 5GRUL 3P77A 5JNYA 4OB5H 3GSOA 3U2SA 3B9DA 4YJZL 2BNQB 1CD1B 4P2OD 4GBXD 4TYUA 4IRZH 4XC1L 1Y6NR 3HUJF 5DUBB 3K8MA 2FB4H 4GG6B 1I9IH 2D31B 2R23B 4K7PL 3WV0A 2OK0H 3QCUL 1MELA 3VXSA 4U1IA 3DLQR 1IKNA 1QYGL 2IPUK 3QEQA 4PJCE 1D5ZB 4R0LB 3QAZB 4MAUL 4CDHA 2C26A 2E8YA 2RFXA 3LKPA 4U7SA 3DMMD 1DANT 1EH9A 1MCBA 3SGKC 15C8H 2APBA 4FQQA 2Y5EA 5ISZD 3MPCA 1MFAH 5FYKU 2F54E 5MHSD 3ZMRA 2C7UA 4PYGA 3MMEB 5F3HA 3SDDA 3X17A 3LKOB 4PJGA 4FQXB 2X5PA 1CR9L 3WFCL 5JIKA 3GB7B 4LLVA 5EFIA 3MYZA 4ZFGL 3MA9H 2FSEA 1IT9H 3CC5A 5HGDB 1EO7A 2LU3A 5LAXB 2WBJA 4LLAA 3CXDL 3D39A 5GZNC 7FABH 5C86A 3SDAC 1QPXA 2QHLA 4PRHE 2BHUA 3ZDYE 1YPZE 3EOAB 5B4MC 1I8KB 4M9PA 2RB8A 4JM4H 2DD8H 2EO1A 3G5VB 1WWBX 3TVMA 3ECBB 5EO1A 3TYFB 1B2WH 3DSFH 3ARFD 3QDJE 4YC2B 2EYSA 4WI7A 4YDLC 4YH6A 2ATKA 4HZLA 2ORBH 4HUXA 5FUOL 4X4XA 1GZQB 1HQ4A 5C9JA 3IGAA 4PJ9D 3MLYH 4IOSD 1LK2A 3CFEB 1QA9A 3BGMB 1ZV5A 3T4YB 3C8HA 4W70A 1U8PA 1EAPA 4KI1A 4MJ6A 1NEZA 3O8XA 5CJQH 4U4BA 5CGYC 4TOYL 4C55A 5LCVH 5C09B 1KB5L 2X4SB 3KPSD 5E2UH 2DF3A 5I73C 2VDKH 3O2DL 1SJVA 3P0YH 2DAVA 3L3IA 4I3RH 4H26B 2P5EA 2P8LB 2X70B 2XWTA 1RK0B 2R2EB 2XN9B 1ZLWH 2A0LD 5H35B 4V1DE 1ADQA 1DBMH 3QEHB 4MDJA 4WRLA 3WFBH 5C0BA 2IPKB 1FL6B 4DQOL 5C0FA 3WNLA 1DP0A 4NP4H 3TJHD 3HE7C 1OAXL 4UU9B 5FV2A 1R3LB 2VAAB 5HI4C 1MRCH 4YO0A 4CN4A 4U1LA 1RFDH 1QSFD 3LRHA 3N1PC 3MODH 4O9HL 4J3UA 3T77A 1TNNA 3W11D 4DFHA 2BSED 2CLZB 3CK0H 5D7KD 2BXZA 3NN8A 1YY8A 3IDGA 4OCWH 1NPUA 3PP3K 2V2TA 4RMVA 5F1KC 1X5KA 4X83A 1YUHA 1EEQA 1UM4H 4KUZL 2J5LC 3PGDA 3GNMH 1D5IH 5IFJB 3RVUC 4HH9A 3FQWB 3HZYB 1JCKA 1MCQA 4OUOA 2DWDA 1T1WA 4J6RL 3FAXA 2ADFL 1VKXB 4GRWB 4PP1C 3ES6A 3VFSB 2A9ML 3NTCH 2NNAB 4XPBL 1EFXD 1I1YB 3RQ3A 4RGMB 2ZJSL 3MNWA 4WEUD 3V8CA 1T21A 4HF5L 3OKLA 4K94L 5CD5C 4WUUD 1CLOL 2WUCL 4P23A 1GXEA 1A6TB 3WS3B 2PR4L 4QXTB 2DM2A 3WSQL 4ODHL 4FQCL 3P30L 2FZ3A 1ORQB 4GW4B 2P5WE 3RWDA 5MERA 5I1GH 1YEDB 5F9WB 1UZ8B 5F88B 4PP2A 1TFHA 3OR7B 2Z92B 3WHE1 5TFSL 5INDA 12E8L 1AXTL 3JTSA 4KMLB 1ZT1A 3SDCD 3HE6D 4FZEL 1S7XB 5CBEB 2A77H 2W9DH 1NCBL 2FIKA 3HI6L 1N6QL 3NCYS 3OGCB 3ZT6A 1BLNA 3QDGE 5I8EB 2XQYG 1W0YT 4URTB 1MHPH 5HHOB 3WLWC 2XKNB 1K8DA 4XWOC 4KK8C 4PJHB 1EAJA 5GJTH 3QXTA 2OZ4H 4I4WA 4G8FA 3VDBA 5D5ME 3ARBD 3MLRH 2DQHL 5C2BL 5HY9A 1ES0B 1OSPH 3ZKXC 4NZRL 2EO9A 3PL6B 4EIZC 1R5IB 2FJFA 1ZAGA 2XA3A 4WI2A 3BPNB 4OCRH 1FVEA 3C5SB 1I7TA 2YMXL 4JFEE 4M6OH 5KOVC 3S5LA 1QG3A 1JPSH 3MCKA 4XNUL 3TBWA 4KVCH 4XRCB 3VD4A 2VITA 3OJVC 2YPLD 4WEMB 5HYIA 3QISA 3TNMA 5IVXE 5ECJE 5DYOB 4B7IA 4JDTL 3UC0L 2XNAA 1HQRA 2COQA 3FFDB 3QIUB 4WDIB 3RVXD 3CSPA 4LPUA 1OF2B 4GRMB 2DQTL 2LAGB 1JMZA 4PJIA 2C3HA 4PJ8D 1H8SA 3ARGB 3PHOB 3G5ZB 3LEXA 3T3ME 1OQOA 4XXDA 5BOPA 4PREB 1VADB 3RNKB 5GRYA 2PUQT 3DIFB 4OV5B 3AU1A 1J8HE 1F4AA 1F97A 2VLRA 1ZANH 2WP3O 2H8PB 1ED3B 3IFNH 4Z7WF 4M43L 4LVHB 4PS4L 5JHDA 1QVOA 2GJ6A 1C16A 1MCLA 3DETD 4P5TA 1U3HA 4XC1H 3HC4L 5T1LA 3VI3E 1GJIA 4JN1H 3L7FA 3B9KD 2JKXA 5KAQG 3ARPA 4TVPD 3NCEB 2R56H 1BPVA 1XF5B 1A6VH 2SEBA 4WU5A 3WKML 4Z7VB 3EDFA 1KLGB 3GDBA 2BOCA 3S96A 5B8CC 5MEOA 1Q9KA 5H37G 2OTWA 3HUJE 4R7DB 4G6KH 4G8EB 1OB1B 2X41A 4HIIB 1S7TA 4RQQA 1G9EA 2M1KA 4F7TA 2OJZL 4JDVB 1YDPB 2ADGA 3MYJB 3TJEL 4EI6A 4ZFOA 5BQ7B 4D8PA 1ZS8B 2CUIA 3WDHA 4YHYC 3QI9A 3TZVA 4NBZB 2X1XR 4ZAKA 3MJ9L 2E5EA 4UDTA 5EZIH 2QR0B 5IB1B 2ICEB 3GJFK 4N8VG 2EXYD 2AW2A 5CEYB 5CZVL 2BC4B 1MI5A 1Q1JL 2P44B 3HB3D 1SVCP 1RURL 1CFNB 4ACPA 3E3QC 1T20A 5F71A 2QL1A 1MIEL 3I75B 3O41A 2FGWL 5FKPA 4XWGL 3ZKMC 3LV3B 4WFGE 4ELMF 5IQ9A 5SX5K 3DBXA 2R9HC 4QTHB 2XYCA 1MQKL 5BW7A 2WV3A 2GCYB 2WINA 1KCVL 1NKRA 4CU6A 3OB0K 1GH7A 4LKCB 5JOFA 2VXUL 5C71A 4H20H 2IBBA 1MCIA 4YIQA 4GT7A 2GEEA 1OLLA 2X4NB 3L3DA 4OAWB 4IRJD 1CD9B 4NRYB 4TQEH 3ZHLA 4XP4L 2BSSA 2QHRL 4Z7VF 1YEIH 2BNQE 4KRNA 1FE8L 1J18A 3GKWL 3VD7A 2YK1H 4XPAL 4WHYH 5E5MA 3ULVC 5H94B 4LOUD 1X4XA 4AH2B 1S8DA 3SGJA 2BNUA 1FYHB 1LGVA 3FONA 3SJVA 4GG6E 3L5WA 2JIXB 3U82B 4ODXA 4ODTL 3GZKA 3MRDA 4DEPC 1DE4B 2DM3A 2GT9B 2WQ8A 3IRPX 3U30C 3ZTJG 3QPQD 2BVOA 4I0CC 1CGSL 3VGDA 5HHXL 2I26N 4MA8L 4LNRA 4A6YL 3MJ7B 3PWNB 1KTLB 5F8RC 2F5BL 4DQOH 5DJ0A 4PJBB 1QHPA 4TVPL 4LIQL 4HJGB 2OS7A 3L95B 2CR6A 3HG1B 3KYKL 4LEOB 1CTNA 1ZLVK 5F1OB 2EXWC 1QFWH 2QQKL 3I02A 5DMKA 1OCWL 1FPTL 5IHLB 3Q3GB 4PBXA 3BZ4A 5J4MA 3P0VL 4O4YL 3KPTA 5ID0B 5CP3H 5TQ0L 3ABZA 3B6SB 1CDJA 2GY5A 1CVSC 1ITBB 2NX5D 3FOLA 3QUZA 3EYSL 4JREB 1IAIM 4D9QD 2IBZX 3T0EB 1DL7H 4RFOL 1JPGA 4KUZH 4BFEA 4GKSA 2NY2D 1U8NB 2F8OA 4RAUA 1MCSA 4J12A 1C7SA 4ZXBB 3OJDA 3W5NA 2Y4SA 5EO0A 5HYJD 3UTPD 2Q3ZA 3BWAB 2CQVA 4J6RH 2XTJB 4LSRL 1X4YA 4NQVA 5EU6D 4EUPA 1QFUH 1MJUL 2DLIA 4I48A 4PRHA 3FCTA 4LHUA 4NDMB 2PYEE 3G9VA 1V7NH 2YZ1A 1SJEB 4OZGA 1BX2B 4FQCH 4MSWA 1RHHB 5C09E 1CU4L 1D9KB 3BP5B 1JFQL 4G7VH 2HTKC 3G6DH 3EJZD 4DKFH 4NFCA 2AXHA 1UACL 4FA8A 3UJTL 1JGEA 1CDIA 2X9XA 4DZBB 12E8H 4TUJB 3CX2A 3RIAK 2IGFL 1IJ9A 1RAMA 4MS8D 1UENA 3HI6H 1OGAD 3AVEA 2Y36L 2IAMC 3ILPB 4X6DF 4ZS7H 1FFPA 2QEJA 3UTZA 5ALBL 4YWGL 4JJ5B 1RY7B 1IL1A 4EOWH 4KKCC 2K1MA 5F7DA 4E0RA 5C70A 2NY6B 3FB7A 3TESA 4AZ8A 4H88L 5EU7E 1X3DA 5D1ZC 1RIUL 4L5FH 4BSJA 3HS0A 3SCMC 1FVCB 3WN5A 2KZ1B 3ZDXF 3WE6B 3O2WL 4S1DC 1AKJB 1WAAE 4HS6A 4K23H 3TV3H 2NZIA 4GFTB 5CIPA 3S3PA 1NCTA 1FN4B 3RZCA 3EO1B 3LIZL 1IKFL 2BVQB 2YMXH 4CNIB 3PQYD 3UTSD 4QGYA 4WNQB 3PHQB 4MB5A 4JDTH 3U9PH 1IGYA 4GRWE 3O3AB 4HGKC 4U1GB 1C5CL 5M7QA 4JM2D 4WUKH 1KULA 1XGPB 4FP8H 3HI1B 3I9GL 4OLVL 2IH3B 3NA9L 1RK1A 1SHMA 1ZE3C 2AJ3A 1MRFH 3OKNB 4ZTPH 4IRSC 1IBGL 2XOTA 5DD0H 2V17L 1WUNT 4ZG1A 3RGVD 4U6HB 4FNLL 2IALB 3T2OA 1A2YA 1OAZL 1S3KL 5FO9B 2CIIA 2VLME 4HEME 1ORSB 3JUYA 4PS4H 3WFEL 3NACH 3DARA 4LCCC 5ENWB 4NN6B 3TM6A 1U8MB 3ZL4L 1R5VA 2BHZA 1U8HA 4Y4FA 5CAYB 2OL3L 4XMPH 1KCUL 1H9VA 4ERSL 4QHKJ 1QLFA 1QBBA 1N0XL 3DROA 3PABB 1R3IL 3NIGE 1M71B 3PDOB 3WKMH 3QJFB 5HHOE 1V5JA 2V7NB 2EC9U 4PJHE 3VXUA 2QSQA 1KB5A 3F5WB 3DV6B 4FFYH 1EGJL 2H1PL 3RX5A 4RBPK 5DD6B 3NZ8A 3O0RH 2WIIB 3MOBL 4ZPTA 3D1MC 5DJ2B 4K3JL 3OAUH 5BZDA 4OSUL 4ONGL 1IC7L 1TZGL 3MUJA 3VXQA 2CR3A 3PWLA 4TNWK 2ESVB 3QDGA 3V6FA 2ARWA 3ZO0A 3WBDA 4GKNA 3OG6B 1HIML 3N85H 1I4FB 1TQBB 4XTRC 3RHWF 4BKLB 1Q1JH 1WSST 3BP6B 1SY6A 4OGXL 3DMMA 4WO4A 1JGUL 3WNPA 4NQDB 3IDJA 1UCTA 2B20A 1MQKH 3KYNB 1LO3L 4ZFZA 2H2SD 5ICZA 3KXFA 4P4KB 2A2QT 3KG5A 4P2RB 3MQIA 1UB5A 2AK4B 4AG4L 1FVDB 1NMAL 3OHXB 5L8LB 4G6JH 4GRLC 3WLBA 1VSCA 2NY5C 2O61B 3MNZA 4IOFC 1K2DB 2QHRH 5GRXG 4L4JA 4N8PA 4B0MM 5CEXB 4HUWA 4GKZB 3H9SD 2FDBP 3IXAB 3LVEA 2VE6B 3C5JB 1CGUA 3QZWG 2X4RA 43CAB 2MTPA 4CW1B 3QRFM 1FCCA 5DK2B 3BP7B 5DVOA 3ARFA 3U83A 1RIHL 3JBG7 3KPOA 2EZ0C 2BERA 2EKSA 3O3BB 4GAFB 4P4RA 4Z7VE 4XVSL 2GAZA 1U91A 1NSNL 1UH4A 5F9JA 4WTWA 4PJ9A 2IG2H 5HHXH 4MXQD 2G5BA 3IDYB 2OTUA 4PJEB 4OFDA 4QXGL 4HJ0C 4LPCA 3IU3B 3SPVA 4LFHG 4KDWA 1V8HA 1AQKL 3QUXC 4MD5B 2CRMA 4F33B 1N8ZB 2JJSA 3N06B 4JQVA 4XCFL 3GUTB 1DEDA 4A2MA 1ZHKB 3ZE0F 5CBAA 5ADPH 4R90L 2VDOH 5T3XD 5BS0D 2AXGB 3BH9B 2JELH 3JV4B 3FQTA 1T0PB 2ZOKA 3TN0D 4OJFL 1U36A 3H9HB 2DQDL 5C0CD 3HUJA 5L8JB 3RWJB 1DSFH 4FFZH 4Z7UB 1S7RB 5MP6L 4RFOH 2C4FU 1ZWIB 2X9WA 3TO2A 1LO5B 4R8WL 3BDYL 4H25A 3WUWB 5GPRA 4AENA 1JWSA 1J7VR 5L0QC 4GKOA 5GS2H 5ITFA 1F3DH 1UWXK 1B90A 2H3NA 5DEFA 3DX9B 5K93A 5IBLD 4HBQA 4U1NB 3EFFA 1NC4A 2ZZUT 3LKNB 1BVZA 3MREA 4HKBA 4QRTB 2DTML 3DX8B 2C5DC 3HZVA 1F3JB 3H42L 1I9RH 4LSUH 2DQUL 1U8QA 1HHGA 3N0PB 4W81A 5ESAB 1UXSA 5J1AB 3MO1A 3MLTB 5JXED 4UAOB 1IRAY 3NH7L 1CT8B 3WHXB 4BUHA 5IHBA 1J10A 1JFQH 5CP7B 3HPJB 4I3SL 3M1BA 43C9A 4OFPA 3EGSA 4PJEF 4Z77B 3QWQB 3QO1B 2Q7YB 1OP3K 3BIAX 4XP6H 4MHHG 4ZQKA 2UUDK 3BEWB 1L6XA 1UQSA 3R1GH 3S36L 1J12A 4AIZB 1FO0L 1U2CA 4NSKA 3VXPB 4N0UA 3QYCA 2IGFH 4NZTL 4OUUA 1FYTD 4M1DH 2GTZA 2ITDB 4OF0A 4OI9A 2UZYB 3DX7B 1CD1A 4OLYL 4PJBE 4O58H 4YWGH 3HG1E 4WUUA 3FN9A 3FMGL 3LEVH 1F8TL 4TULL 5A43C 5DUBA 4ODVH 5F1NB 2MCG1 3CFCH 4YQXL 3QXVA 5GJSL 4HHAA 4NQSB 3B3IB 3L6FB 1FGNL 5F7YC 3PWVB 1Y0LB 2F5AH 4XNQB 3MLWL 1CLZL 4PG2A 1OVZA 3VFVB 2EYTB 1BD2D 1HSAB 2I25N 4LPVA 3GMLB 2Y23A 5LJYH 5FAAA 3RIFK 3FT4A 3O2WH 5TE7H 3NCFB 2A83B 3T0EE 3HE6A 4WCYH 2NTSP 5IVNA 4E41E 5EULV 1IC1A 2YXFA 1S7VB 3LKOA 4FQXA 4QWWC 1O0VA 2VL5A 3GB7A 4U49A 5T3XL 4BQ9A 5KS9F 5C0AB 4LQFL 1IAIL 4NRXB 2XTJE 4IMKC 1FNHA 4P2OB 5HGDA 4YHML 1X5GA 3VGAC 5LAXA 1I1AB 4LSPL 4U1SB 5M94B 3NMEA 5C0EA 2ZSVB 1INEL 1S78C 4F15B 5F93C 3TA3C 5KSBB 1RJYB 1J0IA 4J3TA 4RWYH 1I8KA 2WBJC 3ARBA 2XY2A 4X9IA 2XZCL 1QUNA 1FZKB 3G5VA 3CPLA 3TYFA 1HH9A 1RSFA 1IBGH 3I2CL 3BD5A 1NMCB 3CD4A 1JGLH 1IC5L 1AXSA 4N0YL 3CCHB 3ULUF 4WI5A 1GZQA 2F53B 1S3KH 1RJZB 5HVGB 5IR1A 4G6AD 4HH8A 3BGMA 2J6EL 3T4YA 3INUH 5T33L 3OXSB 3WEXB 4Y4HD 1NGXB 3ARXA 3OL2A 4Y5YB 4OLUL 3D3VB 5C6WH 1SM3L 2IQAA 5C09A 2X4SA 4F58L 3BD4A 4Z78A 4KVNL 3OKMB 1NDMB 2P8LA 2X70A 1RK0A 3BOVA 5IQ7L 2XN9A 3WIHH 2ED8A 5H35A 1U93A 4OGYH 1KV3A 4HPYH 3QEHA 4NJ9L 5IMKA 3C5ZC 1IGJB 4KHXH 2IPKA 1E4XL 2VDQL 5I2IB 1YZZA 4XVTH 1G6VK 1TQCB 1Q9WB 3CSYB 4OSUH 4UU9A 1R3LA 4Y2OA 3TYGH 1PYWB 4A6YA 3U4EB 3OKDA 3TH4T 1AGCB 2R0WL 4I77L 4JFOA 4P48A 4POUB 1MOEA 5HHPB 5FGCE 5I8OL 3LPFA 3RUGB 1PX3A 2CLZA 4LSQH 1LE5A 1WK0A 2FGZA 1JNNH 5DMYA 4HKJA 1V05A 3VFPA 1F6FB 1I3RB 3KPSB 4Y0GA 4HIJA 5J11C 4MWFB 2XXMB 4PGBA 4CVXB 3LRSB 5IFJA 4WWKB 1F11B 5L9DH 4XNMB 2DQJL 5FCUH 2NLJB 3RWGA 3HZYA 4BSVB 2HKHH 4JHBA 5FUCE 4JE4B 1I8LA 4JY5L 3LHPH 3RVVC 3VFSA 4N1HB 2NNAA 1YEHL 4UUJB 1Z5LB 1HNGA 4JB9H 4L3CB 4AEEA 4ZNEA 1P1ZA 3ULUD 3VD9A 1X5HA 3P4MB 2Q86B 3WS3A 3D0VA 1T5WB 2AJZB 4FG6D 5HDQH 1H3VA 3L7EB 1RZ8B 4Z0BL 3K2UH 3MRKB 1CF8L 5FA4B 1RIHH 1YEDA 4M7LH 3U36B 4KGJA 1UZ8A 1MF2H 4F7EB 1NBVL 1U6AL 2Z92A 1BBJB 5DD3L 2ZSWB 1FSKB 4MMZC 1A6ZB 1T80A 3GMPA 1MPAL 3FQUB 3DJ9A 1IAKB 3IYLW 1VPOL 2NXYD 3GKZA 4QHUA 5CBEA 5GS0D 1R3HB 4JQXA 3OQ3B 2P47B 3KLHD 3QEUB 4AT6B 4OZ4B 4WFFE 4UNUA 4MAYD 4JO1L 1V3LA 4Z7WA 5I8EA 1CGXA 3DPBA 4R2GC 3JWOL 1QTYT 2A6JB 1I7ZB 4R90H 2AGJL 5GRZA 1N26A 2E7BA 5EG6C 5DUML 1EZVX 1GC1L 3I6KB 1OD9A 4ZO7A 1RZKL 1YQVH 1ZA6B 1ES0A 5IBTL 3OAYK 1MEXL 1N0LA 3QQNA 1SMAA 4KI5C 2MKWA 3OKOB 4NQDE 3BDYH 4YBHA 4OQTA 5EORH 4UQ3B 2O93L 4OFYA 2VDRL 4XI5C 3ZT7A 3FHQA 3FZUD 1OWRM 4P2RE 4NM4H 4XRCA 1DQQB 1CLCA 2AK4E 4JZJA 1D5MB 3MRJA 1PVHA 3HKFA 5B39G 3P73B 3JTTB 1YJDL 2YRZA 3F7YB 2B0SH 5DYOA 4K7PY 3FFDA 3QIUA 4WDIA 4AJ0A 1I3GH 4GRMA 2Z35B 2X2YA 4BSWA 3DRQB 4BK5A 2IFFL 5GGSA 4Y1AB 4U2YA 4WI3A 1F45A 3PE9A 3ARGA 3EO9H 3WYRA 3PHOA 5EIIB 4L4VD 4FTVB 3G5ZA 1FGVH 1NCDH 1FBIH 2F74B 2QSCH 2VDPL 3PF2A 4JCLA 4XAWL 4AY0A 4MXVE 4JO4H 3MXVH 1OHQA 3QG7H 4H1LH 4PREA 1VADA 4U05A 3CDCA 1Z3GH 3DIFA 4OV5A 4JPWH 3HI5L 1FO0H 5EZOL 5IVZA 1GIGL 4UI2A 3ULUL 3B2UC 5E8PB 4ELMA 3QB7C 5C07D 4P57B 1ED3A 2GJJA 1OTTC 3IS1X 3UPAA 4YBQC 5TPWL 4YXHH 4HC1H 2EIEA 4JJHA 3DO3A 1J9CT 3GMOB 4YXKH 5MI0C 4TULH 2C9AA 1F8TH 5SWSE 5HGHB 5GJSH 2FX8L 2AV1B 3MGOA 3BPLB 1TIUA 4P5TC 3MV8D 1U3HC 1WIPA 1XF5A 4J7RA 4M9OA 4YR6B 4PJ8B 4Z7VA 1YECH 1JMXA 1M7IB 5GS0L 1BWWA 1ZHBB 3OKKA 2OL3A 4P2QE 3VWJC 5IUSA 4XHJC 4NNPH 5EH1A 3BH8B 4R7DA 4RGND 4Z7UE 1XF3B 4G8EA 1OB1A 4HIIA 4AMKL 3FQNB 2XIDA 2HFEB 5C8JB 1MIML 1NEZG 1YDPA 1OGAA 2D7NA 4Z9KB 3LRGA 3I85A 3MYJA 1YEJL 3GIVA 5BQ7A 1HHHB 1EGJA 2NY1D 1ZS8A 1MVFA 4I0PD 4WIQA 4Y2DC 3EBAA 1A9EB 4M03A 2EECA 4OTXH 1INEH 4YHOH 4D9RD 5CEYA 1TETH 2BC4A 3QI9C 3LQAC 1X7QB 3TZVC 1RU9H 3D2UD 3AS2A 1CFNA 4WI6A 5F21B 3ZSTA 3N50A 1JF6A 3I75A 5IW6B 4MNQB 3LV3A 5GGTL 1W72B 5FGBA 1UM5L 5DT1H 4DCQB 3V0WH 1QBLL 2GCYA 1IC5H 4K8RC 5DQ9B 3HNVL 2VH5H 5E2VH 1B4RA 1N59B 3UTSA 3P9MB 5BW7C 2XV6B 1F02I 3HRPA 5J6HB 1TVHB 1LHZA 3BPOC 3STLB 1YN6B 5C3TA 2VXQH 4OAWA 1M7DA 2J6EH 4NRYA 1TJGL 1X6NA 3KLSA 5H8DA 1Q72H 1I3VA 2H6PA 1IM3B 4W4OA 4X6CB 5H94A 4HQQL 4I9WE 3PP3H 3ARDA 1F90L 1KGCE 4OZFA 2JIXA 3EHBC 2CXGA 2LVCA 3BYYA 4XH2B 4YHNA 2XZQL 3WO4B 1OT1A 3GI8H 1CLYL 3CFDB 4YHZL 5K9QI 2OXHA 3PV6B 4XXCC 2H32B 4TUOB 5AZ2L 1DE4A 5IQ7H 2GT9A 1RIVH 3ZDZF 3DI2B 4OZIE 1GGCL 2ZG1A 4TSCH 4HZAA 1D5BB 4NKDA 5GIRA 3QIWD 3UTTB 4LRNH 2DQGH 4HWBH 3SDAD 3LN5B 4WHTB 3BN3B 3AB0B 5B4MD 2NY4C 5EOQH 1A3LL 4PJBA 4WTZA 4NQCB 2EDLA 4HJGA 3BGFC 3C6LC 3L95A 1MAML 2PYFB 3HG1A 4LEOA 1NLBL 4OLWH 3VGHA 5HI5C 4AIXA 1CK0L 4XMKL 3Q3GA 1CFVL 1FFRA 2W0KA 1P7HL 2MQCA 3OZ9H 5C0AE 5ID0A 1S9YA 1HDMB 4GAJL 1S7SB 3IFLL 32C2B 1N64L 3B6SA 4Q9BA 3U7AA 4X6DA 2O5YL 3QXDB 1TJIH 5KSBE 3U7YL 5F7WC 1SYSB 3CSBA 5DJ6A 3OKEB 4ODBD 4MHHI 5FKAB 1U8NA 4UBDC 2A6IB 4L8CB 1BIIB 4NHCL 3E2HC 4R26H 1JV5B 4DZ8B 4JFZH 2LABA 3C2AH 1DBJL 4X6CF 5ISZE 1MY5A 1S7WB 2F53E 5AUMB 3RDTD 5MHSE 4M5YL 4ZUTA 2CRZA 2OMBA 4GQ9H 4X8JA 1KJ2H 1SYVB 3IB4A 2O5ZL 4RZCA 3MBED 4W4NA 3RPIB 2X1PA 4HIEB 1SJEA 3F12B 2BOBB 2DQEL 3D3VE 3HE7D 3QXAB 1D9KA 5HI4D 1BM3H 1FCGA 4D3CL 3PXJA 2DKUA 4M3KB 3S5LG 2F19H 5K9JH 2X40A 5DD3H 1OARH 5L7XL 4OLZL 4I3GA 5E7BA 3EDJA 1MPAH 4DZBA 4KROB 4CU8A 5J56B 4QHMB 5TF1L 1YEFL 5L88H 5C08B 1P7QA 5E2WH 5F7LB 3CZFB 5CUSH 3I6LE 3VXTB 4NM8H 1KYOJ 2H2PD 4HUUB 4JJ5A 3S37L 3MNVB 1MFCL 5LGJB 3WNNA 3RVUD 5F70A 3V9FA 5BJTB 3GHBH 1RZFL 5FYLH 1HHIB 3VXMB 3RUGE 3MRFA 3X13B 4X6BB 4PP1D 2DI7A 3HPLA 4WI8A 5TH2B 1IQDB 1RZKH 3KPSE 1YY9D 1NUFA 4N1EA 1X5FA 4NHUB 3WN5C 4JGUA 2D03L 3P4NB 1FN4A 1YC8A 2EICA 3EO1A 2BVQA 4RCAA 1A3RL 4NQTA 4YLQT 2PKDA 2YWYA 5DJYA 4WNQA 3PHQA 5B3JE 5I1CL 1OTUD 1JZ5A 3O3AA 4Y19D 4RISH 5DF0A 1HKLH 4QXUL 1XGPA 4U31A 3GSUB 3HI1A 2IH3A 4OV6F 4MXWL 4XPFL 1HOCB 3QDMA 3OKNA 4ZYKB 5D8JL 1HHJB 1RUKL 1V3JA 5AAMA 4U6HA 5F6HJ 2IALA 1F4WL 2EH8L 4QOKD 2P48B 4YDVB 1LO4H 2XWJB 5FO9A 3IVKB 1ZVHA 4KK8D 4KY1L 5FA3B 1ORSA 5E6IC 5ANMB 3D48R 4AM0B 5IROA 3W0WB 3U4BL 5EPMB 2NXZC 4LPTA 3GJFH 3PQYB 4YUEH 5ENWA 4U6VL 4DWHA 1WT5A 5GS3A 5DQJA 1OGTA 3BP4B 3C60C 4PIRF 2FX8H 1NGWB 4JY6B 4XPHH 3UTOA 1D5XA 4LMQE 4EBQL 1H3PL 4GLRH 5E94B 3PABA 1O7SA 3ALXA 1K3IA 1M71A 2XQBL 3QCTL 3ULSA 3QJFA 2VLKB 2X7LB 2X4UA 5J8OA 3F5WA 4LLUB 1LO2L 1Z9LA 3OB0H 3B9AA 5D1QC 1QLRB 3BGAA 4DTGH 1PG7X 3K4DA 5T1DL 4EI5A 5DD6A 5KVFH 1MCWM 4PD4K 1MIMH 1SJHB 4KTEH 2WIIA 5KVGH 3V7MA 4RNRB 4OCNC 2Y6SD 2HVJB 5DJ2A 5A3IC 5BRZB 8FABB 3UPRB 4X4YB 3LS5L 5IJKA 3E8UH 4LPWA 4FQ1H 4G42B 2ESVA 2AJUH 3QWRA 2BRQA 3IDXH 1YNLL 2NY3C 3WIIH 4JFDA 3ULVF 1G7JB 1XT5A 2B8OT 5T5NF 4M6ML 4HMEA 4BKLA 4WV1B 3BP6A 3EDEA 4M62H 4NQED 4Y1AE 2NPLX 1IGIL 3L3HB 4K71C 5JORA 4LASH 4NQDA 1C1EL 3U7WL 3UEZA 1UM5H 1A7NL 3KYNA 2YA1A 5E9DB 4WO4C 3GHEL 5INCB 3H0TB 4P2RA 5FHAH 2DOCA 4P5KB 4GS7C 3MCLL 4OCYH 1ZLVH 3D0LB 3LS4H 5HVWA 1FVDA 4F57L 4FS0A 3OHXA 5C0NC 4R96B 1XCTB 2OZ4A 2MFNA 3MBXH 3HCVB 3VFMB 2J1KA 2XFXB 5CEXA 5ACZB 1J0ZA 2UY7A 3T0DA 2E9BA 2WQRA 4GKZA 1YYML 3U0WH 1RZJC 2YPLE 4JKKA 3C5JA 4UZGA 5LWYH 3KPMB 1XH3B 2IBGA 4JANB 5DK2A 1F58L 2JB5L 2PXYC 2XZQH 3LDBC 4JFFD 3FT3B 2BSRB 5FIEA 1RUML 4YDJA 4OLXL 1HH6B 2Q8BH 1KEML 1P4IL 4RAVA 4LEXL 3EJYD 2EDNA 2WWMD 3KPRD 3SCMB 4EUPG 4JPKL 2FEDC 4PJEA 3BO8B 4HX1A 2QQNL 4LHUG 3IU3A 3WFDH 3LN4B 3D9AH 3RRQA 2OP4L 4OM1H 4XMKH 4MD5A 2P42B 4F33A 1N8ZA 3MLZL 2ZCLL 3PV7A 2P8PA 3GUTA 3VW3H 3ZYJA 1WZMA 3DRTB 5I75B 2DKSA 1ZHKA 3BKJL 1AR1D 1CI5A 3SE8H 3BH9A 4P5MA 3JV4A 2O5YH 4ENED 2QADC 3H9HA 4NO0D 3U7YH 3RWJA 3VFUB 3QHZH 1S7RA 2KPNA 1ZWIA 1LO5A 3T65A 4CVZB 4M7KL 2GJZB 4JO3H 5BVPH 1JNLL 2P45B 4X8XA 3B8SA 3TO4A 4JCMA 1T1XB 1BJ1J 5K9OB 4P9HC 2HKFH 4PLKC 3A0OA 4DVBA 4IRSB 1WGOA 3ME0A 2RCSL 2APTA 2VLLA 5CEZH 4N9GB 4MNGE 4U1NA 1R6VA 4QRTA 3DX6B 3PIQB 5HYQB 3HC0A 3B2VL 1MH5A 4IJ3B 4JKPL 3BKYH 3EDKA 5KVDL 2D7QA 1TMCB 4G9FB 1UCBH 5ADOL 5F3BA 1Y18A 5HHQB 5KBNC 3HR5B 2KH2B 1QKZL 5ESAA 5J1AA 3NABH 2DQEH 3MLTA 3N9GL 4IDLA 3I3EA 3VCLB 3WHXA 4N8CH 5BS0B 4X80H 5CP7A 4L3AA 3HPJA 2EXWD 4XPGH 3ZZ1A 7CGTA 4H8WC 4Z77A 3QO1A 2Q7YA 3TNNB 5F9AC 5J7CC 3S4SG 3BEWA 5HDBF 5KN5B 1KJMB 5E2TH 3C9NB 3WXWL 4XCNB 3TT1L 1T1YB 4QRRA 2EH7H 3ZHKA 1ACYL 1T7XA 4M7JH 5TF1H 2PO6D 3UTTE 3VXPA 2VC2L 5GGSY 2V2XB 2ITDA 2FO1A 3DX7A 1GGIH 5SWZA 1K4CA 3QQ9C 4NQCE 2W9LA 1DN2A 3S37H 2K9UA 4UNTA 2XPGB 4GW5A 1LDSA 4J8RA 2CRYA 4NQSA 5EOCJ 1I7UB 2VR9A 3L6FA 1E6JL 1Y0LA 3HZKA 4XNQA 3ZKSD 5CD3B 1KN4L 4KHTH 3VFVA 2EYTA 4PJDB 4EZMA 2VTFA 4JKMA 1TZIB 3GMLA 1JZ6A 3QRGL 5E08L 1VEMA 1L7TH 4PG2C 1IM9B 1TLKA 4HUVB 2A83A 4R0LC 3QAZC 4Q7DA 2D03H 2HFGH 2HN7B 3SKMB 1Q9OA 1S7VA 1U8KB 1BECA 1SQ2N 4NJAL 5L6YH 4JLRB 4BK4A 4PJXF 5E8NA 3L1OH 1R24B 3G5XA 3O6FB 2HTKD 3STZA 4FQXC 5C0AA 5I19L 4OGZA 4NRXA 3ZT5A 1LO0H 5H37H 2X4TA 2ZSVA 1HILA 4LAQL 1LEGB 1RJYA 5CJBA 4QXUH 1AIFB 2YHGA 5GZOC 3WUZA 4PRID 1B4JL 5ACMA 3ZTNL 1FZKA 2IAMD 4L3EA 3N1QC 4GSDH 4KKAD 5I1DB 4HPOL 1KIRA 4KKCD 4YEEA 4RBPH 1A1OA 4HFUL 4LSTL 1EV2E 4UV7H 1Z2KA 1DCLA 5CP3A 2ZOLA 3LD8B 3CCHA 5J0BA 2L4OA 1MVUA 1RJZA 4YC2C 4YX2H 2Y06L 5D1ZD 1VGEH 1JF5A 3FFCD 5D70L 3UJJL 1OAQL 3NIFF 1JN6B 5C08E 4EQ3A 4PGJA 2DL2A 3VE0B 2R4RL 3BD3A 2D0GA 3HMWL 3UTPE 1NGXA 5EZJB 1RMFL 4OZHE 1NL0L 1B0RB 3UTQB 5JW4N 3G08B 1QACA 1HINH 4IHOB 4WW2B 5EU6E 5FCSH 4PUBH 4FRWA 1OY3B 2ZUVA 1OP9A 5D96B 3OKMA 4OLEA 3VXME 5HPOA 4F2MA 1IGMH 1MHEB 2R1XA 5A2FA 6FABL 3DVGB 5ERWA 1KJ2B 5IKCB 1RUQL 2GUOB 3VG0H 3CXHJ 2M8XA 1BJMA 3C6SB 1E28B 1DEEB 2Z31A 3CMOH 5I2IA 2X1WL 3CSYA 1Q9WA 5TGBB 2P24B 5C0GB 1PYWA 3U4EA 1AGCA 2CLRA 5AYQA 2D4FA 2HRLA 1KTDA 4G5ZL 4RWHA 5HHPA 3ZTJH 4R7NB 5L0QB 2EDTA 3ARQA 3MV8A 3OSKA 3MV01 1UEMA 1XR9A 2HT3D 5FDYA 3VXNB 3A6BH 4N5EC 1KJ3L 4S1RH 2VKXA 3MRPB 1IGIH 3NCJL 5DA4A 5EU7C 5IGXL 1I3RA 3DYPA 3BAEH 1PLGL 4MWFA 4UIKL 2AJYL 5T1KD 1MLBA 4NOBA 5E56A 2BNRD 4Q6IB 4XNMA 3UBXB 1KT2B 4GXVH 1P7KB 5CWSB 4G3YH 4BSVA 2CKBL 4YZFE 2EC9T 1V7ML 4I0PA 3BQUA 4F9PA 2RR3A 4JZOB 4UUJA 1Z5LA 5F89B 5DQDH 5C3LD 4XNZB 2BCKB 2YUVA 2RAMA 1A4JA 4FXKA 4QRPD 3W0WE 4U33A 1N4XH 3PQYE 5IW3A 2HH0L 5MENB 2GFBB 3P4MA 3F7QA 1WLHA 2VDLH 1XGRA 4RGMC 1T5WA 2AJZA 5ID1A 1RZ8A 2JB5H 4JVUA 3MRKA 1NC2D 5FA4A 4L4TB 2YRPA 3U36A 3GJEB 2CMRH 3O4LD 2E6QA 2VO5A 3KPPB 3ZE2F 1W0VB 2VLKE 4OD2B 3RA7H 1BBJA 1U8OB 2ZSWA 3LZFL 2GSIB 4LEXH 1A6ZA 2R0ZL 4XTRD 5DJ8B 3DNKA 5F9WC 1IAKA 3BW9B 1UWXH 2EE9A 2ZUSA 2QQNH 1JWMB 3GO1H 3SGKA 1AHWB 4UOW1 2DTSA 3EYOB 1CXFA 3WFHA 4GW1A 3QEUA 4AT6A 4OZ4A 5BRZE 3QIBB 1EBAA 4GQPH 5DR5H 4ZTOL 1A7OL 5IFAL 4PJ5D 4AEIH 3KLDA 3F6LA 4JQXC 1Z6JT 2W0FA 1S5IH 1JIBA 1I7ZA 5FHBL 3QEGH 4OCSL 1T04B 4WFED 1S9XA 1A6AB 1GGUA 2OQJA 4GRLD 4UQ2B 1OP3H 2BFVL 3QJHB 1FDLL 1WBZB 2BY0A 2UUDH 2X05A 5IESH 3C08L 3RL2B 1ZA6A 3VGGA 5ALCL 3GJFB 3WIFA 4U1JB 3TA3B 3RY6C 4M7KH 5JZ7C 2W92A 3TPUB 4UQ3A 4F7MB 4F7PA 5EBWB 3QHFH 5E9DE 1XGUB 3PL6C 4ZD3L 1DUYB 1DQQA 4X7SL 2EZ0D 4PG9B 1D5MA 4NC0B 3H6JA 3P73A 2EE6A 4KPHL 1OW0C 3F7YA 1FNGA 2F8VA 3DRQA 3UZVB 4ALAH 5JQ6L 4X4ZA 4D0BB 2QKIB 4TPRL 1F4HA 4FTVA 5H2BB 3ET9F 1F4XH 2R69H 3SKOA 2XY1A 3ARGC 3QUXD 5EBGA 1GCFA 3BYTA 2DQCH 3GM0A 4LLQB 2EYRB 5D72H 5I8CB 1I8IB 2NMSA 3LPWA 1IAOB 3OB8A 2DLTA 3TT1H 3O9WC 1J1PL 1MFEH 4YNYA 5C0JB 5C2UB 2FD6H 3BT2L 2VC2H 4N0FB 4I18B 4P57A 3ESVF 2C4FT 2DM4A 1VFAA 4PRNA 1HYSD 4XNYH 1IEBB 3BVNB 4NO2B 3MV7D 4LVHC 5HGHA 1VGKB 3CVHL 2ADIB 2NY7L 3HE7A 3FO1A 4GAYB 4F80A 1MNUH 3H9SE 3TFKD 3LQZA 1M7IA 3REWB 4L4VB 4XHQA 3F65A 1ZHBA 5ETUA 5E08H 1EJOL 2M2DA 1BQLL 3TBVB 1XF3A 5FYJD 3FQNA 4KH2A 1BZ7A 2HFEA 5DK0B 4XP5H 3RWHA 3MA7A 4NJAH 4R4NC 5CJOL 1MRDL 1HHHA 2H26B 1U8IA 4KC3B 4HS8H 3ZSSA 3VRLF 2NY5L 1MLCA 3C2SA 4PY7B 1XF4B 5D7JB 2P7TA 1C08A 4AEHL 2P1YA 1X7QA 4Y4KD 5LGKA 3QCVH 2DYPD 4OIAA 5IW6A 4MNQA 1W72A 1BQSA 3P0GB 2CO7B 1A7RH 1QRNB 3RPKA 3MRHB 1HHKA 3WL9A 5BS0E 4DCQA 5AD0A 3CU1A 1LK3H 5HVHB 4TSAH 4IDJH 5C0CE 3T0XA 5DQ9A 5FGBC 5CFHA 5DFTA 3GMMB 5J6HA 1TVHA 3VXSD 3SGEI 3SBWC 3STLA 1KCKA 1YN6A 1BOGA 4KJPC 4Z76B 3IFOB 4U3XA 4ZUSB 3GBNH 3QEQD 4OIIL 4N0RA 1XIWC 2EE3A 4Y19A 2R4RH 3WCYA 2NY1B 1IM3A 4X6CA 2XACC 4K9EL 2JJWA 1FV1B 2C3XA 2HJFB 2VN4A 3KAAA 3FN0H 2KUTA 1ZTXH 3TCLB 4XH2A 1A8JH 1AO7B 1H8OA 4JHWH 1YNKL 2I60H 2ZWLT 4OCMC 3PV6A 2H32A 4TUOA 1CGTA 4JFPA 4PJDE 3U46B 4JVPA 1D5BA 2ARJQ 3PG2A 1L4IA 1S78D 3KYMB 4CAGA 4WHTA 2DJUA 3QUML 4QO1A 2WBJD 1A1MB 3D39D 3THMH 3T1WA 1QSEB 3AS3A 1CE1L 4IIQB 1E6OL 1NGZA 1OT2A 1I7RB 4YGVB 4G5ZH 3CX5J 4IMLB 3IU4L 3TVMD 2Q76B 1FIEA 1HDMA 5GGRY 1S7SA 32C2A 1PKQB 4Y16C 3KJ4B 3BXNB 5FYJL 3MXWL 2RIKA 1N7ML 1S9VA 2CJUH 3EOTL 4F8QA 4R97B 3ESUF 3QXDA 4G6FB 5TE6L 3X3GH 4PGZA 1FNFA 3QNZB 4OFVA 2VXVH 1G9MH 3L5JA 5DLML 2AJYH 1FC2D 1BIIA 3H9YA 3LEYL 1OAYH 1SVZA 4JREC 5CINL 3SKUD 4ZDHB 1VFBB 4P99A 3T0EC 4DZ8A 5D2NB 3QIWB 2P46B 4B53A 3PWPB 2X4QA 4R4BB 5FYKH 1G6RL 2N7AA 1EHLL 1B6DA 1S7WA 5AUMA 4ZXBC 1BZQK 3MV9B 2J8UB 2XG4A 3V7AG 1PKOA 1Q0YH 2AJSL 4NNYA 4PRDB 3W82A 1SYVA 1T3FB 2HP4A 2P5ED 2XA8H 4MD4B 1KCSL 1RUPL 2XTJC 4HIXL 1UFUA 3RPIA 2HH0H 3FL7A 4LNVA 1KFAL 1K5NB 3F12A 1GPOL 2BOBA 3GK8L 4MLIA 2I9TA 1MCOL 5KTEH 4POZC 2NY0D 1F00I 5E7FA 3QPXH 1IFHH 4EDXA 1HE7A 3OAYH 1A7BA 5C0BD 3T2NH 1DBKH 5HJ3A 1H15B 2QTEA 2DI9A 2JF1A 1NAML 1KIPA 4YPGA 4KI5F 2AQ1A 3HNSL 1D9KC 1NCWL 4PPTA 5E4IA 5E8DL 1CFSA 4PV9B 3T09A 1QO3B 5DHYB 3PP4H 4QHMA 2B1HL 3AM8C 2H41A 5C08A 4AQOA 3G6AB 3DXAB 3CZFA 2Y5TB 3OPZH 4PB0H 1C12B 4NUGL 1RV6X 1IVLA 3HC3L 3VXTA 3EYUH 4HUUA 3TT3L 1UM6H 5LGJA 2BDNL 2LAAA 1A7OH 4QLRA 1NFDF 1LDPL 4Z7QE 1RVFL 5BJTA 1KOAA 4JAMB 3TIEA 4JG1H 4N8VB 1F6LL 1H3XA 3MBEB 3RTQB 3X13A 4X6BA 2PCPA 4Y2DB 1NCAL 4Q0XL 3RVVD 1JGVH 1FDLH 2NY6C 4PJIF 4K3EL 4YHIB 5TH2A 5CCKH 4GMTH 4X6EA 3CDFA 2J8UF 4P59H 1G9NH 5I74C 4NHUA 1FFNB 3WDIA 1BAFL 4D0CB 2BMKB 3F8UB 1G7QB 4CVUA 3IAGC 1PDKA 4OT1H 5DJCB 2UYLB 3TF7C 4KZEL 1F42A 4UTBL 5FYLE 3P9WB 3EW3B 4P23D 4GOSA 4X7SH 35C8L 4KDTA 3O3DB 2E3VA 2F58H 1FNSL 5DDHA 4AL8H 4XC3L 2MJWA 4DVRL 1J0JA 3D85B 5I17B 2VRAA 5C7XH 2OLDA 3GRWL 5GGVH 2FRGP 5JOPD 2AI0L 3GSUA 4U3CA 4U1GC 3QDHA 4LCWB 5IT2L 1CN4A 5EUOB 3KVQA 2YN3A 1AE6L 1WJ3A 4F9LC 1WZLA 4L4TE 3EOBB 2IFGA 1HHJA 1QNZL 4OM0H 4TUKL 1A6UL 4WENB 2WWKO 4AIOA 3A67L 4DAGL 4YDVA 2W9EH 3E6FB 2FNBA 1U95B 4DKDC 3IVKA 4XMLH 5FA3A 1FLRL 3BT2H 2HJLB 2DBJA 4OD3L 5ANMA 4Q9RH 1JPFB 5FUCC 3MLUL 4JR9H 4PV8B 5F96L 2IJ0C 4YXLH 2DLFH 1F4YL 3BP4A 2NY4B 1YYLL 3CVHH 3BGFB 3C6LB 3MRQB 4NN6C 2DLHA 3SO5A 1WT5C 4KRMB 1IGFH 1DVFB 3N1GC 4MB3A 3BX7C 4YE4L 4YAQB 3QUKB 2CRIA 4CADA 1Q94B 1OD7A 1LD9A 1EJOH 4JRXB 4LLUA 3V4PL 4JRYB 2CK2A 1QLRA 2G75B 1HZHL 4LLDB 1SJHA 3DGGB 3FO0H 4JFHE 4QOKB 4PJCB 3KJ6L 4RNRA 1DFBL 2HVJA 5KJRH 5BRZA 8FABA 4PJAB 1MRDH 4X4YA 3LKQB 1KPRB 4K07A 4ORGB 2AKRB 1I9EA 4OZFG 4G42A 2F54B 2P8MB 4PJ7E 5EUOF 3DUSB 4NZUL 1BEYH 1G7JA 3V5KA 4ZPVB 4UT6L 2Q8AL 2A1WL 2HLAB 1T89C 5D1XB 4CL7A 5IJKC 2WBKA 2R1WA 1A7QL 5DC4B 4G8GB 1CGWA 2PW2B 3L3HA 3E6HA 1Z9OA 1TQBC 2IQ9H 3VRLE 1WBXB 4HKZB 2R15A 5KW9L 2G60H 3IS0X 2V7HB 3VFOB 3V79C 5BV7H 5JHDD 1MFDH 2C1PB 2GJ6D 5INCA 3H0TA 4P5TD 1NAKH 1U3HD 1YPZB 4P5KA 1JI2A 5GGUB 5T1LD 3D0LA 5EU4B 5I71B 2EDWA 1HI6B 4P4KC 3VH8B 5IB2A 4R96A 1XCTA 1YQ2A 3WXVL 3P9LA 3VWJD 3V5HB 2D7OA 3MRCB 3VFMA 4XHJD 2XFXA 4FHBD 5I76A 4FQ2H 3SQOH 1CTOA 1EEZA 4K9EH 1XH3A 4HKXA 4JANA 4O5LL 5AWNL 1EMTH 3FT3A 4DKAA 2BSRA 4ODSL 2BSTB 1YNKH 2I07B 4KJQD 4NQEB 5ITBL 4PJCF 1TTUA 4MJIB 1UWEH 2BRRL 1HH6A 4L4VE 4WFHD 3CIQA 2F9BT 2G9HB 4XPTL 1CBVL 1K6QH 4UB0H 5D7SH 5D1ZA 3L3KA 1AP2B 3QI9D 3TZVD 4ZAKD 1XGTB 3SCMA 3BN9D 4MDIB 1N5AB 3HFML 4S1SH 5EO9B 3GSNB 4HCRH 1FZOB 1MI5D 2VIRB 3LN4A 5ESQB 3Q1SH 4V1DB 3IDYC 5DVMA 2IBZY 4UTAL 3RWCB 1FL5B 3JWDH 3X11B 1EFQA 1J1XL 2AEIT 4K8RD 2ZKHH 5EIQA 1UXWA 4KJWC 3DRTA 1J1OH 4S10A 1JPTL 5E8OA 5DS8B 3T1FB 4JGMA 1T2QH 3M07A 4X9BA 3ZDYF 1YPZF 3MJ8B 3VFUA 5D2LB 3MRBA 4H1LG 5F1IA 5I1IL 5FDWB 2VZUA 4FQJH 4CVZA 3QUYC 2GJZA 1QRNE 2DQIL 2BHYA 4KDVA 3QR2A 1A9BA 3V6OE 1QR4A 1T1XA 5TE4H 3UXFA 4RGNE 4IRSA 1A5FL 5EBMB 3ZLQC 4N9GA 4P9MH 3SJVD 1H3TA 4OQ1A 2YBRA 3H7BA 4RFEB 2E27L 4Y5XC 1R0AL 3DX6A 3PIQA 3QA3B 1CD8A 5HYQA 2I9LB 3MRIB 4OCXH 1J05B 4G9FA 5DD5H 3LMJL 5FV1L 3HR5A 3REVB 5DWUH 4LCCA 2NXZB 4Z18A 3VCLA 2VDMH 1MCNA 3S3SA 4ELKB 2IH1B 4JQIH 4D9RE 1JTTA 3NFSL 5T1KA 3C60B 5IHZB 5HYFA 3TNNA 3U1SL 4NO0B 3FAWA 1C8PA 5KN5A 4UAOC 1YC7A 3C9NA 4XCNA 1T1YA 1GRWA 2OR9L 2CLVB 25C8H 1KB9K 2FJGA 1ZVSB 3VWKC 1A6WH 1OAKH 4KZDL 3FOMB 2V2XA 1HKFA 3DV4B 4UIMB 3S88L 3G04A 5D1QB 2K7PA 3FB5B 1IC4L 4G8IA 3QUZD 4BZ2L 2XPGA 1LDPH 4O2FB 1RVFH 1WF5A 4LARH 3PGCA 1I7UA 1MJ7H 3BKCH 5SX4H 2OXGA 4G6MH 4YHLH 2VZVA 5C0RL 3LAFA 5CD3A 4MQTB 3LQAL 5C1MB 1PKQE 4PJDA 4ZSOA 5AG8A 5I15L 1TZIA 1NCAH 5BO1L 3CLEL 1K4DA 1DQJB 1IM9A 2ID5A 2ICWB 4MQ7B 4HUVA 2VR4A 2FR4B 2FJHA 3UZEA 2VERN 4HJJL 1INDL 2HN7A 3SKMA 1CGVA 4K8RL 1KC5L 1U8KA 2HT2C 4UILH 1MFBH 4FABH 3QFJB 4PRHD 4K3HA 4LHUD 5D2NE 4O2EB 2B39A 4APQC 1R24A 4FQIL 1ZOXA 3PWPE 3O6FA 4MA1B 5D5MB 5JW4R 35C8H 3LH2L 4WJ5B 5D7IB 2GSGB 2HJKA 3GSRB 5JO5B 4WEBH 3MV9E 1JL8A 2D7MA 2J8UE 4CN1A 3DVNA 3DO7A 4RDQG 1WBYB 3VXOA 4XC3H 1KN2H 2R39A 4HWBA 4PLNC 1MWAH 3RBGA 2ATPB 4JFEB 3OMZA 4P2OC 3QZWB 1I1AC 2NW3A 3SE3A 4F15C 4LBEB 5I1DA 3BJ91 2XWBB 4XNXH 4LSSL 3MLPA 2DWEB 2GK0A 1KELL 1ZSDB 2AK1L 1CG9B 2YZ8A 4ZOEA 4JFQB 5DEZA 1FH5L 3NZHL 2AAVA 1DLHB 1MCPL 2HFTA 3IKKA 1NMCC 4TRPL 2C1OB 5HTSA 4EDWH 1JN6A 1ADQH 5JIIA 1OM3L 3KGRA 2XZZA 1I3UA 5DHXB 2NCMA 5I8KH 1RI8A 5EZJA 2R2BB 4GMSL 1J0YA 1QBMH 1F4YH 1AGEA 4K3GA 1J5OL 3CVIL 5HVFB 1IE5A 4G43B 1B0RA 4HXAH 2YUZA 4HSQA 1PW3A 4MGXA 3MRMA 1ITCA 3LKSB 2C3VB 4Y5YC 3RVWC 3RZCD 1MHEA 1RD6A 4PRIB 2EIBA 2VQTA 1HCVA 3RKDD 1YEEL 1JRHI 2Y07H 3DVGA 4U0RB 5IKCA 1KJ2A 5HGBB 2C3GA 5D5MF 3ZE1E 2EIZB 4ODWB 4YDIH 2GUOA 1BFVL 1NGPL 2AABH 5GS1B 1A6PA 1DEEA 4LSVH 4ONOA 5LBSL 4P46B 3IETB 4IBLT 3MLSH 2B4CL 4Q6YA 1T03L 4C83A 5CJ5A 4N0CC 1AJ7H 5JDJA 1NJ9A 4FFVC 5C0GA 3AMLA 5HXMA 1N2RB 1U92B 4QEGA 2Q87A 4W6XB 1WVZA 4YBLB 3QUMA 2QJDA 5IVXF 5T5FH 4XVJL 1C5BH 3O3EB 2D7TH 4CDGC 4QHNB 5HHMB 3SDXE 1MCFA 4QCIB 5J57B 1GHFL 5E6ID 1DR9A 4JDZA 5JXAL 1SBSL 3MRPA 5KZCD 1BIHA 2WM0A 2B7DT 5EA0L 3Q6GL 1XZ0B 4LCWE 3T3MF 2I5YH 5HYEA 1A7PL 5F1SA 4Q6IA 2VZ3A 3UBXA 1KT2A 4FMKA 5JR1H 1X5YA 1DQDL 1T4KA 5CWSA 2N4IA 5EC1B 1CL7I 1EIBA 4WWKC 2A0LC 5CLTA 3J7HA 4Y4FD 1CICB 3GSWB 3GBLA 4N1CA 3OKYA 4JZOA 3VD5A 2BCKA 5CMAB 4C58B 1MREH 1KB9J 3VI3F 3VXUD 5MENA 2GFBA 4GXUN 3VFGH 3TJHC 2Y25A 5BVJA 3L3GB 3U0PB 4E5XB 2HMIC 5JW3H 3I3BA 2V2WB 3ARTA 3GJEA 3ARWA 2YEZB 4M61B 3HMXL 3KPPA 1W0VA 4OD2A 4EN3B 2NY3D 2GSIA 1FLTX 3HNTL 4LGRB 4OFKA 4XPTH 4JRXE 3GMNB 5DJ8A 3BW9A 4JRYE 3QDGD 1U3YA 1NGYB 1NAMA 2FBJH 1NUDA 1FSKC 4WU7B 1JWMA 4FXGB 3FO9B 5DI8B 3GMQB 3EYOA 5JUEH 2NZ9D 4QOKE 4HG4J 3ARVA 3NVQA 3P11L 4J2XA 3K8KA 4PJAE 1FFQA 2VLJA 4WO4D 4LDLB 1DBBH 4F7CA 1MJ8L 2FBOJ 8CGTA 2AEQL 4LU5H 1MY7A 3JV6B 1O5DT 3PGFL 1TJHL 4N5UA 3KXFD 4U1HB 2CDGB 4UQ2A 4IMKA 4Q58C 2RQ8A 1RZIB 3V4UL 2HA1A 1J11A 4G8GE 5I1LA 2CGRL 3T0AA 4QRUB 3RL2A 2UY6A 3FT2B 3GJFA 4OBRA 3VFWB 3VA6A 1FORH 3O6KL 4U1JA 3KHOA 3TA3A 5I1IH 3TPUA 1CFTA 3O6MH 1HXMB 4F7MA 5EBWA 1ACZA 1XGUA 5ABDE 5F97E 1WCBB 2PXYD 3NCCB 3T4AB 4HDIB 1DUYA 1A5FH 3QNXA 3G6JB 1IQWL 4Z8FL 4XVUC 3SDCC 3ORJA 1VENA 3LMJH 3WJLA 1QQDA 4D0BA 1FAIL 4PRPA 2FEDD 2QKIA 1J8HD 4RRPG 5DURD 4Z95H 4ONFL 5LXGL 1DN0B 4GG6F 1RHFA 3H3PL 3F6IA 1IEHA 4HS3B 1GGBH 2CPCA 3NFSH 5GRWA 2EDXA 3IJYB 4NWTH 3GRWA 4PRAB 4NQEE 2EYRA 3SO3C 5I8CA 1I8IA 5I16B 4MJIE 2PYEB 2FHBA 1IAOA 1I1RA 5CLWA 2OR9H 3MZGB 1CIUA 4EXPX 5C0JA 4F8TA 1MCHA 2QADD 4I18A 4BA8A 3TIDB 3T8XA 3RHWK 3HTLX 4XCYB 5IBUG 3MROB 4DGIH 3C5ZA 1IEBA 3BVNA 2Q6WB 4YDKL 4HV8A 5BV7B 3FB6B 1RULH 1CXLA 4FXLA 3PWJB 4GAYA 5C0RH 4PLKD 5IK3B 3H7LA 1A0QL 1YN7B 2FL5B 3BPLC 3VMOA 5BO1H 1OWWA 1XEDA 3CLEH 2IADB 3I6GB 4PJ8C 3TBVA 5D2LE 4JPVH 4M48L 1SY6L 4JFFE 3T08A 1NC4D 4NOFA 4S11A 1AFVH 5IHUL 4F3FB 4NNXA 2E9JA 5DK0A 1PG7W 3UP1A 4L29B 4I0KA 4OKDA 4LCUB 4C4KO 3KPRE 1L0XA 4WFGD 3SDYH 2ZCHH 5I1EH 4PY7A 1XF4A 1HN1A 2JE8A 1YEGL 2AERT 1FJ1B 3EYVB 4LGPB 2Z8WC 1RZJL 3MV7B 3RAJH 3R0MA 2V9QA 3O81A 4XBPB 3FQRB 5GRJL 1P69B 1DDHB 5GHWL 1AXIB 4HK3N 3RNQB 4JRWA 2CSPA 1JI1A 3QQ9D 2XTLA 1P6AB 3MRHA 4R3SB 2FWOB 1TNMA 1M6OB 3LN9A 2BNQD 3UJIL 2ILLA 1I9JH 3GSXB 4D9LL 1BGXH 1WZ1H 3F7PC 4KWUA 3ALWA 5FB8B 1WC7B 5DD1H 1WEJL 4I2XA 5JHLL 3GMMA 3DECA 3W39B 3O6LL 1P4BH 5I30H 3IFOA 1Q38A 4ZUSA 1BFOB 3VXRA 3IFPB 5EBLB 1OM3H 1DQML 4RX4D 1W8NA 3WD5H 5FXCH 2PTTA 4Q9QL 3Q6FA 2HJFA 4M6NL 3S34L 3RWIA 1EHXA 5IIEB 1G1CA 4K7PX 1ZHNB 1AO7A 5F72S 2R4SL 3MGAA 5A2KH 4DW2H 2QSTA 4O2CB 1SEQL 4FQXD 3U46A 5HYSG 4S2SB 2CDEB 3RL1A 4DN3H 3WO4C 3L3JB 3KYMA 2MPAL 1WAAF 5KG9B 1ETZB 1BFVH 2R29H 3U2SB 1QP1A 5GZOD 1QFOA 2MCPH 2B4CH 1A1MA 5DRWA 4EKXA 1RZ7L 5SV3A 1QSEA 1ZLSL 4P9HL 3AB0C 3QFJE 5D7LB 4X5XB 4U1IB 2IANA 1GGTA 5B39B 4YGVA 4LCIH 5D7IE 1L7IH 5J9PA 1GGYA 5I1KL 2X1QA 4GRWF 4WHDA 1PKQA 2GKIA 4E9LA 1KIQA 2RFXB 4BH7B 3OX8B 2HT4C 1KENL 2XRAH 4FQQB 4EUPH 3MLVH 1TTFA 1SBSH 3UYOD 3CJJA 1NFDA 1PSKL 3W81A 5DRXA 1NANI 1ZEAL 4XP9H 2C7UB 4ZS6C 4H8WL 5F3HB 3SDDB 3EYQC 1PD6A 5DMIH 1IMHC 3PJSA 1DQTA 4YFDB 4ZDHA 1E4WH 3V52L 2IPTH 1VFBA 4M5ZH 5D2NA 2YD8A 1UWGH 4UINL 2BJML 1JJUA 5EWIL 4R4BA 3BIKA 4HK3J 3CC5B 4X9FA 1S9WB 4X7FC 2J8UA 2DQFA 4JY4B 5C09D 4PTUA 1IAII 3O9WB 4KMTH 3Q5OA 3A6CL 3RVTC 5IM7A 3MGTB 4MD4A 1IGCH 1QLEH 2XN9D 2CK0H 4K2UH 1S9KC 1MHHA 1K5NA 5EO1B 1H0DA 2HTLC 4PTTA 3C8KA 1RPQA 2R0LL 5GRUH 5FYKE 4OGAC 3NIGF 2ZPKL 1NCCL 5F9DC 4HUXB 1MHCB 4X4XB 2YUXA 4PRIE 2EDFA 4PJHF 1JNHB 1PY4A 5FYJU 1LK2B 1QO3A 1MWAB 5DHYA 4K7PH 3QCUH 4N5ED 4XX1G 3SHSA 5B3NA 1EAPB 1MUJB 1QYGH 3VWJA 4MJ6B 1ONQB 3O8XB 3DXAA 1NLDL 2Y5TA 1C12A 3NGBB 4EQ2A 5I1HL 4Q74A 4FOMA 4KROC 5CIPH 1EZVY 3P11H 4MAUH 2PTVA 1OAUL 1WQVT 1XCQA 3RX7A 2VJXA 5I18L 4W68A 3FFCE 5BOZG 1I75A 2FO4A 1TITA 4JAMA 4LPXA 4N8VA 2W38A 2XXCB 4RMQA 3RTQA 3ROOB 1P5UA 2VXTL 5HHME 1CR9H 4NYLB 4YHKL 3WFCH 5A16B 5HGGS 4Y2DA 5ILTL 3M8OL 4YHIA 1U58B 4ZFGH 4PY8I 3KNBA 3KYAA 4ETQB 5C0FB 2YC1A 4PY8J 2BMKA 3C8DA 2ED7A 3CXDH 5M95B 4RMSA 1E4XI 3ZYZA 4JO2L 4YO0B 2UYLA 4BH8B 3R8QA 2Z8RA 3T77B 1T0NA 5EZLB 1JZ3A 4LF3B 3TLRA 4JKLA 4Z8FH 4PB9L 4Y5VB 3NN8B 1FRGL 3K0WA 4KDTC 3D85A 5I17A 2V2TB 1FC1A 4MS8C 5DGRA 2WUBL 5FUOH 4MQSB 2BX5A 2YUWA 3B4NA 1XIWB 5LXGH 1XFPA 2VLMD 3TBTA 3UDWC 1Z0NA 1G7PA 4LCWA 5EUOA 4G7YL 4HH9B 4KQ4L 3EOBA 3EJJX 3CLFL 4NQUA 3VGEA 4TSBL 3E6FA 2E7HA 1U95A 4OKVA 3BPCB 4TOYH 4XXCA 2YD4A 1EX0A 5I1JL 1XR8A 5IFHL 1KB5H 3V95A 1GYAA 3O2DH 3OJ2C 4PV8A 4P23B 3U6RB 2CUHA 5JZ7D 3MJGX 3S97C 4P3CL 1EO8L 4BUGA 4JFXB 5A40E 5DJAA 3C6LA 3MRQA 1X5ZA 3PL6D 3MRRB 5E03A 4AK1A 1KBGL 1AY1L 4OFYD 1EHNA 1MSPA 4YAQA 1OAXH 5INDB 1SJXA 1BF2A 2CIKA 1ZT1B 4JRXA 3KDMB 3TCXA 4HWNA 4Y16B 1F3RB 4JRYA 3BRGC 3FRUB 4O9HH 5CILL 5I6XB 2G75A 1ULVA 3AREB 3R4DA 4KK9D 4LLDA 1A1NB 2OX5A 3DGGA 3QIUD 4NQXB 3SGDI 1UJ3C 2ZUQB 4PJCA 1UB6B 4XP1L 3BHBB 3RGVC 3ARGD 1KPRA 1BLNB 3BE1L 4QF1B 2F54A 3V6ZA 4QTIL 3G6JE 1YEGH 4E41B 4ZPVA 5JW5B 3Q5YA 5D1XA 3WDJA 4I4WB 4G8FB 1X4ZA 3F58L 4G8GA 5AZEL 4PJ5E 5GRJH 2PW2A 5KSAB 3ELAT 1UC6A 4WV1C 4QRQB 2ADFH 4HKZA 4BZYA 1FVEB 4WHCA 2A9MH 1W2KT 3QNYA 4XPBH 5BCAA 3S5LB 2C1PA 2ZJSH 1NDGB 2WW8A 3GBML 2W1NA 2VITB 4HF5H 2A73B 1YPZA 1A64A 4K94H 4NCDA 1CLOH 2WUCH 4WY7L 1KEGL 1WEJH 3TNMB 2PR4H 2Z8SA 2FATL 2ERJB 5EU4A 3WSQH 5IMOB 1HQRB 4ODHH 1HI6A 4RFNB 3VH8A 3LQMA 3P30H 5D6DA 3QDJA 1CXEA 3JV0A 4X5WB 4PJBF 4C56B 1JRHL 4QXWA 2H9GA 1BHGA 4HLZG 1T66C 3MJ6A 3EO0A 5TFSH 3S34H 3BSZL 2X89D 2EDEA 1AXTH 4FZEH 1WITA 2ADJB 1NCBH 2A6KB 4MJIA 1JVKA 2ZUWA 3DSNA 1ND0A 1N6QH 2VLRB 5E8EA 2G9HA 3UX9B 3AROA 1AGFB 4KK6C 1AP2A 3H8NA 3CAFA 2GJ6B 2MQ0A 1EO5A 1C16B 4JZNB 3HMXA 1NGQL 4M1CC 1N5AA 4MDIA 4F37F 3PDDA 5EO9A 3GSNA 5LGHL 4L9LB 5T1LB 1FZOA 4YGAB 4OQTL 3L7FB 5I74B 3NIDF 4V1DA 3TBYB 3P40A 3X11A 2DQHH 5C2BH 2ZUXA 2HRPL 4NZRH 4WU5B 3BDBA 2KL6A 1LEIA 1KLFA 3S96B 2NW2B 4KXZH 5MEOB 3T1FA 2OTWB 3MRLB 3GSQB 4KJPD 1CL7L 3MZTA 3MV7E 4XNUH 5I75C 3SE9L 3QSKB 5GGQL 3MJ8A 5D2LA 1MAKA 5J1SC 1NBZB 5FGCB 1A14L 4KJYA 3UC0H 1LEKB 4ZFOB 2XZAL 4LK4A 2DQTH 3IXTB 4D8PB 3KS0H 5DA0B 2KZWA 2XKSA 3PUCA 4HFWA 3ARDD 2G2RB 2JIXD 3QA3A 4Z7OE 1MI5B 1EERB 3TC9A 1JZ2A 1J05A 4NN5B 4MXQC 2BY2A 2R8SL 3O41B 3LY6A 1QFWI 5E6IA 2JCCB 1ZLUK 3SKNB 3REVA 4IJ3C 3U0TB 5C0IB 3EZ8A 1KCLA 4RGOL 4ELKA 2EEDA 2IH1A 1H5BB 2YOCA 4BM7A 2KQMA 3C60A 4M43H 5IHZA 3HG1D 2W65A 1YMMB 4GAGL 1VEOA 1FFOA 2APXA 3HC4H 3TN0C 4QHKI 2CLVA 3AFLA 2KBGA 3L3DB 4ONHA 4NWUL 3VFTB 4NT6B 5I0ZA 2P5WA 3FOMA 1S7QB 2OTPA 4UIMA 2DMBA 1R3JA 5E5MB 2J88L 5CS7A 5D1QA 3NBNA 3HN3A 3FB5A 2BNUB 2NR6C 2AV7B 4L8DA 3KWWB 4U0QB 1LVEA 5ACLA 5D7LE 1LE9B 5CKGA 3T0ED 4ODXB