5CP6D

Nucleosome core particle with adducts from the anticancer compound, [(eta6-5,8,9,10-tetrahydroanthracene)ru(ethylenediamine)cl][pf6]
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Organometallic Compound which Exhibits a DNA Topology-Dependent One-Stranded Intercalation Mode.
pubmed doi rcsb
molecule keywords DNA (145-MER)
molecule tags Structural protein/dna
source organism Xenopus laevis
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cp6D00
3KXBA 3WTPD 4Z66A 3WAAA 3R45A 1P3IB 5KDMA 3KWQA 5CPKB 3VH6W 3TU4A 4LD9C 4J8UD 5DNNA 1HQ3D 5GXQC 2HIOD 3MGQA 2YFVA 3AZFC 1P3PA 2PYOD 2NZDA 5AV6C 3UT9D 4LD9B 5GSUD 3O62C 5G49B 5GXQB 4WV4B 4DRBA 4EO5C 5BNXB 3AZFB 5AV8A 4E44A 5B2IC 3O62B 5FUGA 3W96A 5GT3D 3UTAC 3X1SC 3VH5W 5B1LC 3LELC 1P3LD 4H9PB 4YS3A 4WU9B 3C1BC 3UTAB 3AZIC 4X23A 3AYWC 3VH6A 3MGSD 5B1LB 1P3FC 3W98A 1P34D 3AZIB 3MNNC 3AFAA 5DNMD 3AYWB 5GT0D 5B40D 3WTPE 4XUJC 1U35A 3KXBC 4J8VD 1P3FB 4Z66C 3WAAC 5F99D 3AZLD 4KHAB 3KWQC 3MNNB 4CSRA 5AV5D 2HIOA 4XUJB 3KXBB 3MVDC 5DNNC 2HUEC 3WAAB 3R45B 4J8XA 3MGQC 3REKC 3VH5A 5KDMB 3X1UA 1P3PC 2NZDC 3MVDB 3REIA 2LY8A 5DNNB 2HUEB 5E5AD 3MGQB 2YFVB 3REKB 1KX3D 2CV5D 5CP6A 3X1VA 1TAFA 4H9NA 1P3MB 4HGAC 4YS3C 5FUGB 4X23C 3B0CT 3NQJB 5B31A 4HGAB 3W97A 3AZEA 3W98C 5GT0A 3AZMA 4X23B 4WU8D 2L5AA 4XZQB 3AFAC 1U35C 2NQBA 3W98B 1KU5A 1Q9CA 3AFAB 3A6NA 1F66D 2HIOC 5AVCA 3B6FD 1P3AA 1WWSA 3REHD 4J8XC 5B0YD 3MGPD 3X1UC 2F8ND 3W99D 2HIOB 4ZBJC 3C1CD 3REIC 5CPKA 2PYOB 1HTAA 4J8XB 2CV5A 3X1UB 3B0CW 1KX5D 1P3OD 5CP6C 1TZYD 3X1VC 3LJAD 5AV9D 1P3BD 4ZUXD 5GT3B 5CP6B 5CPID 5B2JA 5B1MD 5B32D 1TAFB 4KUDD 1P34C 3W97C 3AZEC 5GT0C 3AZMC 4H9OB 4J8VC 2RVQD 4WU9A 3LZ1D 1A7WA 3LZ0D 1P34B 2NQBC 4WNNB 3KUYD 3AZEB 5BO0A 5GT0B 4H9SA 3AZMB 4J8VB 3UTBA 4Z5TD 3REHA 5B0YA 5AVCC 1P3KD 1P3FA 3WA9D 4JJND 3AZKD 5AVCB 1KX3C 1KX5A 1P3OA 4XUJA 4G91B 2CV5C 5AY8D 1KX3B 2BYMA 2CV5B 3MVDA 5CPIA 3REKA 1EQZA 5B2JC 3AN2A 1M19D 4G92C 4WU8C 1M18D 1S32D 1P3MA 5B2JB 5B0ZD 4WU9C 3AZGD 5CPJA 4WU8B 4G92B 3NQJA 2F8NG 4H9SC 1BH8B 3UTBC 3AZJA 3B6FC 4E45A 1M1AD 3REHC 5B0YC 3RELA 4XZQA 2FJ7D 5BO0B 3W99C 3UTBB 3B6FB 3REHB 5B0YB 4YM6D 3WTPA 5B33D 1P3OC 1KX5C 4Z2MH 4QLCD 1R4VA 3W99B 1P3GD 3C1CB 2F8NK 3AZHD 5B32G 3LJAC 4J8UA 1HQ3A 1KX5B 1P3OB 4UUZA 5CPIC 3AZND 2PYOA 1TZYB 1ID3D 1F1EA 3LJAB 3UT9A 5GSUA 1EQZC 2AROD 2BYMB 3AV2D 3AN2C 5CPIB 5B32B 5B0ZA 3B0DC 3AV1D 1EQZB 1P3MC 5GT3A 3AN2B 1B67A 1P3LA 5CPJC 3B0DB 1M1AA 1ZLAD 3LZ0B 3AZJC 3MGSA 4H9OA 5CPJB 3RELC 4XZQC 4R8PD 3WA9C 1P34A 3AZKC 4WNNA 3AZJB 5DNMA 5B33A 5AVBD 5B40A 1P3KB 4J8VA 3RELB 3WTPC 4JJNB 3B6GD 1P3ID 3WA9B 4DRAA 5F99A 3AZLA 1AOID 3AZKB 5AV5A 3WTPB 4J8UC 1HQ3C 1ID3A 3MGRD 2AROA 2PYOC 3UT9C 5GSUC 4J8UB 5GXQD 1HQ3B 5E5AA 5BT1D 4UUZB 3AZFD 1KX3A 1M18C 5AV6D 5BS7A 5B0ZC 3O62D 3UT9B 5GSUB 5GT3C 3AZGC 1M18B 5B24D 1P3LC 5B0ZB 5B2ID 1M1AC 3X1SD 3AZGB 5B1LD 4M6BA 3LELD 3MGSC 1P3LB 3C1BD 5AVBA 3B0BA 1M1AB 4WU8A 3AYWD 5DNMC 5B33C 3MGSB 5B40C 1BH8A 4QLCC 3WKJD 1KX4D 5F99C 3AZLC 3MNND 4YM6B 5DNMB 5B33B 4NFTA 1F66A 5AV5C 5B40B 5C3IC 4NE5A 4QLCB 4Z66D 3KXBD 3B6FA 3X1TD 5F99B 1N1JA 3AZLB 1ID3C 3KWQD 3MGPA 5B31G 2F8NA 2AROC 3TU4D 3W99A 4G91C 5AV5B 5C3IB 5DNND 3C1CA 5E5AC 1ID3B 1P3PD 2NZDD 4NE3A 2AROB 5BS7C 3AV2B 5B24A 1TZYA 5E5AB 3LJAA 4NE6A 5AV9A 1P3BA 5AV8D 4ZUXA 3W96D 2BYKA 5B1MA 5B32A 4KUDA 4YS3D 5CHLB 2YFWA 5AVBC 4X23D 3WKJA 4AWLC 1KX4A 5BNVA 1AOIC 3LZ1A 3LZ0A 4CAYA 3W98D 5JRGD 3KUYA 5AVBB 3AFAD 4AWLB 3B6GB 1U35D 3X1TA 1AOIB 1F66C 4Z5TA 3MGRC 2IO5C 3KSYA 1P3KA 3MGPC 4JJNA 3WA9A 4H9RB 1F66B 5BT1C 3AZKA 3MGRB 2IO5B 3C1CC 4J8XD 1N1JB 3X1UD 3MGPB 2F8NB 3REID 5AY8A 1ULYA 5B24C 1TZYC 5AV6B 5AV9C 1P3BC 4ZUXC 5CP6D 4EO5B 3X1VD 5B24B 5B1MC 5B32C 5JA4B 5B2IB 5AV9B 1P3BB 4KUDC 4ZUXB 1M19A 1H3OA 3X1SB 4J8WD 1JFIB 1M18A 1S32A 3LELB 2BYKB 5B1MB 3WKJC 2RVQC 5JRGA 1KX4C 5B31D 3C1BB 4KUDB 3LZ1C 3LZ0C 3AZGA 3W97D 3AZED 3KUYC 3AZMD 2YFWB 4KGCD 3WKJB 1KX4B 3REJD 5BNVB 3X1TC 3LZ1B 2NQBD 1BH9A 4Z5TC 4CAYB 2FJ7A 3KUYB 3TU4C 1P3KC 4JJNC 3A6ND 4Z66B 3X1TB 5AVCD 4Z5TB 3KWQB 1P3AD 4YM6A 3NQUA 3TU4B 4Z2MG 4QLCA 1P3GA 3AZHA 5CPKD 1P3PB 5AY8C 5AV8C 4WZSB 2NZDB 3W96C 3AZNA 5AV8B 5AY8B 4LD9D 3AV2A 4J8WA 3W96B 1M19C 3AV1A 5B2JD 1S32C 4YS3B 4H9QA 5JRGC 3V9RA 1M19B 4KGCA 1H3OB 1B6WA 3REJA 1S32B 1ZLAA 4WU9D 1WWIA 5JRGB 3UTAD 4R8PA 2FJ7C 1U35B 3UTBD 3AZID 1BH9B 4YM6C 2FJ7B 3B6GA 4CSRB 1P3IA 1AOIA 1P3FD 1P3GC 3AZHC 4H9RA 2JSSA 3NQUB 4XUJD 3MGRA 4ZBJB 1P3GB 3REIB 3WAAD 3AZNC 3AZHB 4LD9A 5G49A 5GXQA 3AV2C 3MVDD 4J8WC 5BNXA 3AZFA 2CWEA 5AV6A 3AZNB 3X1VB 3MGQD 3O62A 3REKD 1EQZD 3AV1C 4H9NB 5B31C 1BFMA 4J8WB 3AN2D 3VH6T 4H9PA 5JA4A 4KGCC 5B2IA 3AV1B 1P3MD 3REJC 5B31B 3UTAA 3X1SA 1ZLAC 3W97B 4H9QB 1JFIA 3V9RB 5B1LA 3LELA 5CPJD 4KGCB 4R8PC 3A6NC 2F8NH 3C1BA 3REJB 3AZIA 2NQBB 3AZJD 1ZLAB 3AYWA 1P3AC 3RELD 4XZQD 4R8PB 3A6NB 3B6GC 1P3IC 4KHAA 3MNNA 5CPKC 3VH5T 1P3AB
chains in the Genus database with same CATH superfamily
3KXBA 2Y2PA 3WTPD 4Z66A 3WAAA 2Y2JA 1W2EA 3R45A 1P3IB 5KDMA 3KWQA 5CPKB 3VH6W 3TU4A 4LD9C 4J8UD 5DNNA 1HQ3D 5GXQC 2HIOD 3MGQA 2YFVA 3AZFC 1P3PA 2PYOD 2NZDA 5AV6C 3UT9D 4LD9B 5GSUD 3O62C 5G49B 5GXQB 4WV4B 4DRBA 4EO5C 5BNXB 3AZFB 5AV8A 4E44A 5B2IC 3O62B 5FUGA 3W96A 5GT3D 3UTAC 3X1SC 3VH5W 5B1LC 3LELC 1P3LD 4H9PB 4YS3A 4WU9B 3C1BC 3UTAB 3AZIC 4X23A 2ZY4A 3AYWC 3VH6A 3MGSD 5B1LB 1P3FC 3W98A 1P34D 3AZIB 3MNNC 3AFAA 5DNMD 3AYWB 5GT0D 5B40D 3WTPE 4XUJC 1U35A 3KXBC 4J8VD 1P3FB 4Z66C 3WAAC 5F99D 3AZLD 2DQNC 4KHAB 3KWQC 3MNNB 4CSRA 5AV5D 2HIOA 4XUJB 3KXBB 3MVDC 5DNNC 2HUEC 3WAAB 3R45B 4J8XA 3MGQC 3REKC 3VH5A 5KDMB 3X1UA 1P3PC 2NZDC 2Y2NA 3MVDB 3REIA 2LY8A 5DNNB 2HUEB 5E5AD 3MGQB 2YFVB 3REKB 1KX3D 2CV5D 5CP6A 3X1VA 1TAFA 2J8PA 4H9NA 1P3MB 4HGAC 4YS3C 5FUGB 4X23C 3B0CT 3NQJB 5B31A 4HGAB 3W97A 3AZEA 3W98C 5GT0A 3AZMA 4X23B 4WU8D 2W8SA 2L5AA 4XZQB 3AFAC 1U35C 2NQBA 3W98B 1KU5A 1Q9CA 2XD5A 3AFAB 3A6NA 1F66D 2HIOC 5AVCA 3B6FD 1P3AA 1WWSA 3REHD 4J8XC 5B0YD 3MGPD 3X1UC 2F8ND 3W99D 2HIOB 4ZBJC 3C1CD 3REIC 5CPKA 2PYOB 1HTAA 4J8XB 2CV5A 3X1UB 3B0CW 1KX5D 1P3OD 5CP6C 3FDDA 1TZYD 3X1VC 2Y2OA 3LJAD 2BG1A 5AV9D 1P3BD 4ZUXD 5GT3B 2G5IC 5CP6B 5CPID 5B2JA 5B1MD 5B32D 1TAFB 4KUDD 2Y2QA 1P34C 3W97C 2JE5A 3AZEC 5GT0C 3AZMC 4H9OB 4J8VC 2RVQD 4WU9A 3LZ1D 1A7WA 3LZ0D 1P34B 2NQBC 3H0LC 4WNNB 3KUYD 3AZEB 5BO0A 5GT0B 4H9SA 3AZMB 3F6TA 4J8VB 3UTBA 4Z5TD 3REHA 5B0YA 5AVCC 1P3KD 1P3FA 3WA9D 4JJND 3AZKD 5AVCB 1KX3C 1KX5A 1P3OA 4XUJA 4G91B 2CV5C 5AY8D 1KX3B 2BYMA 2ZY3A 2XD1A 2CV5B 3MVDA 5CPIA 3REKA 1EQZA 2Y2GA 5B2JC 1Z2CB 3KFUG 3AN2A 1M19D 4G92C 4WU8C 1M18D 1S32D 1P3MA 5B2JB 5B0ZD 4WU9C 3AZGD 5CPJA 4WU8B 4G92B 3NQJA 2F8NG 4H9SC 1BH8B 3UTBC 3AZJA 3B6FC 4E45A 1M1AD 3REHC 5B0YC 3RELA 4XZQA 2FJ7D 5BO0B 3W99C 3UTBB 3B6FB 3REHB 5B0YB 4YM6D 3WTPA 5B33D 1P3OC 3P5JB 1KX5C 4Z2MH 4QLCD 1R4VA 3W99B 1P3GD 3C1CB 2F8NK 3AZHD 5B32G 3LJAC 4J8UA 1HQ3A 3EG5B 2Y2HA 1P3OB 1KX5B 4UUZA 5CPIC 3AZND 2PYOA 1TZYB 1ID3D 1F1EA 3LJAB 3UT9A 5GSUA 1EQZC 2AROD 2BYMB 3IP4C 3AV2D 3AN2C 5CPIB 2Y2IA 3MNNA 5B32B 5B0ZA 3B0DC 4DQYB 3AV1D 1EQZB 1P3MC 5GT3A 3AN2B 1B67A 1P3LA 5CPJC 3B0DB 1M1AA 1ZLAD 3LZ0B 3AZJC 3MGSA 4H9OA 5CPJB 3RELC 4XZQC 4R8PD 3WA9C 1P34A 3AZKC 4WNNA 3AZJB 5DNMA 5B33A 5AVBD 5B40A 1P3KB 4J8VA 3RELB 3WTPC 4JJNB 3B6GD 1P3ID 3WA9B 4DRAA 5F99A 3AZLA 1AOID 3AZKB 2VQRA 5AV5A 3WTPB 4J8UC 1HQ3C 1ID3A 3MGRD 2AROA 2PYOC 3UT9C 5GSUC 4J8UB 5GXQD 1HQ3B 5E5AA 5BT1D 4UUZB 3AZFD 1T3UA 1KX3A 1M18C 5AV6D 5BS7A 5B0ZC 3EPHA 3O62D 3UT9B 5GSUB 5GT3C 3AZGC 1PZRA 1M18B 5B24D 1P3LC 5B0ZB 5B2ID 1M1AC 3X1SD 3AZGB 5B1LD 4M6BA 3LELD 3MGSC 1P3LB 3C1BD 5AVBA 3B0BA 1M1AB 4WU8A 3AYWD 5DNMC 5B33C 3MGSB 5B40C 1BH8A 4QLCC 3WKJD 1KX4D 5F99C 3AZLC 3MNND 4YM6B 2JCHA 5DNMB 5B33B 4NFTA 1F66A 5AV5C 5B40B 5C3IC 4NE5A 4QLCB 4Z66D 3KXBD 2Y2LA 3B6FA 3X1TD 5F99B 1N1JA 3AZLB 1ID3C 3KWQD 3MGPA 5B31G 2F8NA 2AROC 3TU4D 3W99A 4G91C 5AV5B 5C3IB 5DNND 3C1CA 5E5AC 1ID3B 1P3PD 2NZDD 4NE3A 2AROB 5BS7C 3AV2B 5B24A 1TZYA 5E5AB 3LJAA 3AL0C 4NE6A 5AV9A 1P3BA 5AV8D 4ZUXA 3W96D 2ZY2A 2BYKA 5B1MA 5B32A 4KUDA 4YS3D 5CHLB 2YFWA 5AVBC 4X23D 3WKJA 3EPJA 4AWLC 1KX4A 5BNVA 1AOIC 3LZ1A 3LZ0A 4CAYA 3W98D 5JRGD 3KUYA 5AVBB 3AFAD 4AWLB 3B6GB 1U35D 3X1TA 1AOIB 1F66C 4Z5TA 3MGRC 2IO5C 3KSYA 1P3KA 3MGPC 4JJNA 3WA9A 4H9RB 1F66B 5BT1C 3AZKA 3MGRB 2IO5B 3C1CC 4J8XD 1N1JB 3X1UD 3MGPB 3H0RC 2F8NB 3REID 5AY8A 1ULYA 5B24C 1TZYC 5AV6B 5AV9C 1P3BC 4ZUXC 2Y2MA 4UPKA 5CP6D 3A1KA 4EO5B 3X1VD 5B24B 5B1MC 5B32C 5JA4B 5B2IB 5AV9B 1P3BB 4KUDC 2F2AC 4ZUXB 1M19A 1H3OA 3X1SB 4J8WD 2RIQA 1JFIB 1M18A 1S32A 3LELB 2BYKB 5B1MB 3EPKA 3WKJC 2RVQC 5JRGA 1KX4C 5B31D 3C1BB 4KUDB 3LZ1C 3LZ0C 3AZGA 3W97D 3AZED 3KUYC 3AZMD 2YFWB 4KGCD 3WKJB 1KX4B 3REJD 5BNVB 3X1TC 3LZ1B 2NQBD 1BH9A 4Z5TC 2ZM5A 4CAYB 2FJ7A 3KUYB 3TU4C 1P3KC 4JJNC 3A6ND 4Z66B 3X1TB 5AVCD 4Z5TB 3KWQB 1P3AD 4YM6A 4WJ3C 3NQUA 3TU4B 4Z2MG 4QLCA 1P3GA 3AZHA 5CPKD 1P3PB 5AY8C 5AV8C 4WZSB 2NZDB 2UWXA 3W96C 3AZNA 5AV8B 5AY8B 4LD9D 3AV2A 4J8WA 3W96B 1M19C 3AV1A 5B2JD 1S32C 2FFFB 4YS3B 4H9QA 5JRGC 3V9RA 3H0MC 1M19B 4KGCA 1H3OB 1B6WA 3REJA 1S32B 1ZLAA 4WU9D 1WWIA 5JRGB 3UTAD 4R8PA 2FJ7C 1U35B 3UTBD 3AZID 1BH9B 4YM6C 2FJ7B 3B6GA 4CSRB 1P3IA 1AOIA 1P3FD 2ZY5A 1P3GC 3AZHC 4H9RA 2JSSA 3NQUB 4XUJD 3MGRA 4ZBJB 1P3GB 3REIB 3WAAD 3AZNC 3AZHB 4LD9A 5G49A 5GXQA 3A1IA 3AV2C 3MVDD 4J8WC 5BNXA 3AZFA 2CWEA 5AV6A 3AZNB 3X1VB 3MGQD 3O62A 3REKD 1EQZD 3AV1C 4H9NB 5B31C 1BFMA 2DF4C 4J8WB 3AN2D 3VH6T 4H9PA 5JA4A 4KGCC 5B2IA 3AV1B 1P3MD 3REJC 5B31B 3UTAA 3X1SA 1ZLAC 3W97B 4H9QB 1JFIA 3V9RB 5B1LA 3LELA 5CPJD 4KGCB 4R8PC 3A6NC 2F8NH 3C1BA 3REJB 3AZIA 2NQBB 3AZJD 1ZLAB 3AYWA 1P3AC 3RELD 4XZQD 4R8PB 3A6NB 3EPLA 1P3IC 3B6GC 2Y2KA 4KHAA 2G5HC 5CPKC 3VH5T 1P3AB
chains in the Genus database with same CATH topology
3KXBA 2Y2PA 3WTPD 4Z66A 3WAAA 2Y2JA 1W2EA 3R45A 1P3IB 5KDMA 3KWQA 5CPKB 3VH6W 3TU4A 4LD9C 4J8UD 5DNNA 1HQ3D 5GXQC 2HIOD 3MGQA 2YFVA 3AZFC 1P3PA 2PYOD 2NZDA 5AV6C 3UT9D 4LD9B 5GSUD 3O62C 5G49B 5GXQB 4WV4B 4DRBA 4EO5C 5BNXB 3AZFB 5AV8A 4E44A 5B2IC 3O62B 5FUGA 3W96A 5GT3D 3UTAC 3X1SC 3VH5W 5B1LC 3LELC 1P3LD 4H9PB 4YS3A 4WU9B 3C1BC 3UTAB 3AZIC 4X23A 2ZY4A 3AYWC 3VH6A 3MGSD 5B1LB 1P3FC 3W98A 1P34D 3AZIB 3MNNC 3AFAA 5DNMD 3AYWB 5GT0D 5B40D 3WTPE 4XUJC 1U35A 3KXBC 4J8VD 1P3FB 4Z66C 3WAAC 5F99D 3AZLD 2DQNC 4KHAB 3KWQC 3MNNB 4CSRA 5AV5D 2HIOA 4XUJB 3KXBB 3MVDC 5DNNC 2HUEC 3WAAB 3R45B 4J8XA 3MGQC 3REKC 3VH5A 5KDMB 3X1UA 1P3PC 2NZDC 2Y2NA 3MVDB 3REIA 2LY8A 5DNNB 2HUEB 5E5AD 3MGQB 2YFVB 3REKB 1KX3D 2CV5D 5CP6A 3X1VA 1TAFA 2J8PA 4H9NA 1P3MB 4HGAC 4YS3C 5FUGB 4X23C 3B0CT 3NQJB 5B31A 4HGAB 3W97A 3AZEA 3W98C 5GT0A 3AZMA 4X23B 4WU8D 2W8SA 2L5AA 4XZQB 3AFAC 1U35C 2NQBA 3W98B 1KU5A 1Q9CA 2XD5A 3AFAB 3A6NA 1F66D 2HIOC 5AVCA 3B6FD 1P3AA 1WWSA 3REHD 4J8XC 5B0YD 3MGPD 3X1UC 2F8ND 3W99D 2HIOB 4ZBJC 3C1CD 3REIC 5CPKA 2PYOB 1HTAA 4J8XB 2CV5A 3X1UB 3B0CW 1KX5D 1P3OD 5CP6C 3FDDA 1TZYD 3X1VC 2Y2OA 3LJAD 2BG1A 5AV9D 1P3BD 4ZUXD 5GT3B 2G5IC 5CP6B 5CPID 5B2JA 5B1MD 5B32D 1TAFB 4KUDD 2Y2QA 1P34C 3W97C 2JE5A 3AZEC 5GT0C 3AZMC 4H9OB 4J8VC 2RVQD 4WU9A 3LZ1D 1A7WA 3LZ0D 1P34B 2NQBC 3H0LC 4WNNB 3KUYD 3AZEB 5BO0A 5GT0B 4H9SA 3AZMB 3F6TA 4J8VB 3UTBA 4Z5TD 3REHA 5B0YA 5AVCC 1P3KD 1P3FA 3WA9D 4JJND 3AZKD 5AVCB 1KX3C 1KX5A 1P3OA 4XUJA 4G91B 2CV5C 5AY8D 1KX3B 2BYMA 2ZY3A 2XD1A 2CV5B 3MVDA 5CPIA 3REKA 1EQZA 2Y2GA 5B2JC 1Z2CB 3KFUG 3AN2A 1M19D 4G92C 4WU8C 1M18D 1S32D 1P3MA 5B2JB 5B0ZD 4WU9C 3AZGD 5CPJA 4WU8B 4G92B 3NQJA 2F8NG 4H9SC 1BH8B 3UTBC 3AZJA 3B6FC 4E45A 1M1AD 3REHC 5B0YC 3RELA 4XZQA 2FJ7D 5BO0B 3W99C 3UTBB 3B6FB 3REHB 5B0YB 4YM6D 3WTPA 5B33D 1P3OC 3P5JB 1KX5C 4Z2MH 4QLCD 1R4VA 3W99B 1P3GD 3C1CB 2F8NK 3AZHD 5B32G 3LJAC 4J8UA 1HQ3A 3EG5B 2Y2HA 1P3OB 1KX5B 4UUZA 5CPIC 3AZND 2PYOA 1TZYB 1ID3D 1F1EA 3LJAB 3UT9A 5GSUA 1EQZC 2AROD 2BYMB 3IP4C 3AV2D 3AN2C 5CPIB 2Y2IA 3MNNA 5B32B 5B0ZA 3B0DC 4DQYB 3AV1D 1EQZB 1P3MC 5GT3A 3AN2B 1B67A 1P3LA 5CPJC 3B0DB 1M1AA 1ZLAD 3LZ0B 3AZJC 3MGSA 4H9OA 5CPJB 3RELC 4XZQC 4R8PD 3WA9C 1P34A 3AZKC 4WNNA 3AZJB 5DNMA 5B33A 5AVBD 5B40A 1P3KB 4J8VA 3RELB 3WTPC 4JJNB 3B6GD 1P3ID 3WA9B 4DRAA 5F99A 3AZLA 1AOID 3AZKB 2VQRA 5AV5A 3WTPB 4J8UC 1HQ3C 1ID3A 3MGRD 2AROA 2PYOC 3UT9C 5GSUC 4J8UB 5GXQD 1HQ3B 5E5AA 5BT1D 4UUZB 3AZFD 1T3UA 1KX3A 1M18C 5AV6D 5BS7A 5B0ZC 3EPHA 3O62D 3UT9B 5GSUB 5GT3C 3AZGC 1PZRA 1M18B 5B24D 1P3LC 5B0ZB 5B2ID 1M1AC 3X1SD 3AZGB 5B1LD 4M6BA 3LELD 3MGSC 1P3LB 3C1BD 5AVBA 3B0BA 1M1AB 4WU8A 3AYWD 5DNMC 5B33C 3MGSB 5B40C 1BH8A 4QLCC 3WKJD 1KX4D 5F99C 3AZLC 3MNND 4YM6B 2JCHA 5DNMB 5B33B 4NFTA 1F66A 5AV5C 5B40B 5C3IC 4NE5A 4QLCB 4Z66D 3KXBD 2Y2LA 3B6FA 3X1TD 5F99B 1N1JA 3AZLB 1ID3C 3KWQD 3MGPA 5B31G 2F8NA 2AROC 3TU4D 3W99A 4G91C 5AV5B 5C3IB 5DNND 3C1CA 5E5AC 1ID3B 1P3PD 2NZDD 4NE3A 2AROB 5BS7C 3AV2B 5B24A 1TZYA 5E5AB 3LJAA 3AL0C 4NE6A 5AV9A 1P3BA 5AV8D 4ZUXA 3W96D 2ZY2A 2BYKA 5B1MA 5B32A 4KUDA 4YS3D 5CHLB 2YFWA 5AVBC 4X23D 3WKJA 3EPJA 4AWLC 1KX4A 5BNVA 1AOIC 3LZ1A 3LZ0A 4CAYA 3W98D 5JRGD 3KUYA 5AVBB 3AFAD 4AWLB 3B6GB 1U35D 3X1TA 1AOIB 1F66C 4Z5TA 3MGRC 2IO5C 3KSYA 1P3KA 3MGPC 4JJNA 3WA9A 4H9RB 1F66B 5BT1C 3AZKA 3MGRB 2IO5B 3C1CC 4J8XD 1N1JB 3X1UD 3MGPB 3H0RC 2F8NB 3REID 5AY8A 1ULYA 5B24C 1TZYC 5AV6B 5AV9C 1P3BC 4ZUXC 2Y2MA 4UPKA 5CP6D 3A1KA 4EO5B 3X1VD 5B24B 5B1MC 5B32C 5JA4B 5B2IB 5AV9B 1P3BB 4KUDC 2F2AC 4ZUXB 1M19A 1H3OA 3X1SB 4J8WD 2RIQA 1JFIB 1M18A 1S32A 3LELB 2BYKB 5B1MB 3EPKA 3WKJC 2RVQC 5JRGA 1KX4C 5B31D 3C1BB 4KUDB 3LZ1C 3LZ0C 3AZGA 3W97D 3AZED 3KUYC 3AZMD 2YFWB 4KGCD 3WKJB 1KX4B 3REJD 5BNVB 3X1TC 3LZ1B 2NQBD 1BH9A 4Z5TC 2ZM5A 4CAYB 2FJ7A 3KUYB 3TU4C 1P3KC 4JJNC 3A6ND 4Z66B 3X1TB 5AVCD 4Z5TB 3KWQB 1P3AD 4YM6A 4WJ3C 3NQUA 3TU4B 4Z2MG 4QLCA 1P3GA 3AZHA 5CPKD 1P3PB 5AY8C 5AV8C 4WZSB 2NZDB 2UWXA 3W96C 3AZNA 5AV8B 5AY8B 4LD9D 3AV2A 4J8WA 3W96B 1M19C 3AV1A 5B2JD 1S32C 2FFFB 4YS3B 4H9QA 5JRGC 3V9RA 3H0MC 1M19B 4KGCA 1H3OB 1B6WA 3REJA 1S32B 1ZLAA 4WU9D 1WWIA 5JRGB 3UTAD 4R8PA 2FJ7C 1U35B 3UTBD 3AZID 1BH9B 4YM6C 2FJ7B 3B6GA 4CSRB 1P3IA 1AOIA 1P3FD 2ZY5A 1P3GC 3AZHC 4H9RA 2JSSA 3NQUB 4XUJD 3MGRA 4ZBJB 1P3GB 3REIB 3WAAD 3AZNC 3AZHB 4LD9A 5G49A 5GXQA 3A1IA 3AV2C 3MVDD 4J8WC 5BNXA 3AZFA 2CWEA 5AV6A 3AZNB 3X1VB 3MGQD 3O62A 3REKD 1EQZD 3AV1C 4H9NB 5B31C 1BFMA 2DF4C 4J8WB 3AN2D 3VH6T 4H9PA 5JA4A 4KGCC 5B2IA 3AV1B 1P3MD 3REJC 5B31B 3UTAA 3X1SA 1ZLAC 3W97B 4H9QB 1JFIA 3V9RB 5B1LA 3LELA 5CPJD 4KGCB 4R8PC 3A6NC 2F8NH 3C1BA 3REJB 3AZIA 2NQBB 3AZJD 1ZLAB 3AYWA 1P3AC 3RELD 4XZQD 4R8PB 3A6NB 3EPLA 1P3IC 3B6GC 2Y2KA 4KHAA 2G5HC 5CPKC 3VH5T 1P3AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXB A;  3WTP D;  4Z66 A;  3WAA A;  3R45 A;  1P3I B;  5KDM A;  3KWQ A;  5CPK B;  3VH6 W;  3TU4 A;  4LD9 C;  4J8U D;  5DNN A;  1HQ3 D;  5GXQ C;  2HIO D;  3MGQ A;  2YFV A;  3AZF C;  1P3P A;  2PYO D;  2NZD A;  5AV6 C;  3UT9 D;  4LD9 B;  5GSU D;  3O62 C;  5G49 B;  5GXQ B;  4WV4 B;  4DRB A;  4EO5 C;  5BNX B;  3AZF B;  5AV8 A;  4E44 A;  5B2I C;  3O62 B;  5FUG A;  3W96 A;  5GT3 D;  3UTA C;  3X1S C;  3VH5 W;  5B1L C;  3LEL C;  1P3L D;  4H9P B;  4YS3 A;  4WU9 B;  3C1B C;  3UTA B;  3AZI C;  4X23 A;  3AYW C;  3VH6 A;  3MGS D;  5B1L B;  1P3F C;  3W98 A;  1P34 D;  3AZI B;  3MNN C;  3AFA A;  5DNM D;  3AYW B;  5GT0 D;  5B40 D;  3WTP E;  4XUJ C;  1U35 A;  3KXB C;  4J8V D;  1P3F B;  4Z66 C;  3WAA C;  5F99 D;  3AZL D;  4KHA B;  3KWQ C;  3MNN B;  4CSR A;  5AV5 D;  2HIO A;  4XUJ B;  3KXB B;  3MVD C;  5DNN C;  2HUE C;  3WAA B;  3R45 B;  4J8X A;  3MGQ C;  3REK C;  3VH5 A;  5KDM B;  3X1U A;  1P3P C;  2NZD C;  3MVD B;  3REI A;  2LY8 A;  5DNN B;  2HUE B;  5E5A D;  3MGQ B;  2YFV B;  3REK B;  1KX3 D;  2CV5 D;  5CP6 A;  3X1V A;  1TAF A;  4H9N A;  1P3M B;  4HGA C;  4YS3 C;  5FUG B;  4X23 C;  3B0C T;  3NQJ B;  5B31 A;  4HGA B;  3W97 A;  3AZE A;  3W98 C;  5GT0 A;  3AZM A;  4X23 B;  4WU8 D;  2L5A A;  4XZQ B;  3AFA C;  1U35 C;  2NQB A;  3W98 B;  1KU5 A;  1Q9C A;  3AFA B;  3A6N A;  1F66 D;  2HIO C;  5AVC A;  3B6F D;  1P3A A;  1WWS A;  3REH D;  4J8X C;  5B0Y D;  3MGP D;  3X1U C;  2F8N D;  3W99 D;  2HIO B;  4ZBJ C;  3C1C D;  3REI C;  5CPK A;  2PYO B;  1HTA A;  4J8X B;  2CV5 A;  3X1U B;  3B0C W;  1KX5 D;  1P3O D;  5CP6 C;  1TZY D;  3X1V C;  3LJA D;  5AV9 D;  1P3B D;  4ZUX D;  5GT3 B;  5CP6 B;  5CPI D;  5B2J A;  5B1M D;  5B32 D;  1TAF B;  4KUD D;  1P34 C;  3W97 C;  3AZE C;  5GT0 C;  3AZM C;  4H9O B;  4J8V C;  2RVQ D;  4WU9 A;  3LZ1 D;  1A7W A;  3LZ0 D;  1P34 B;  2NQB C;  4WNN B;  3KUY D;  3AZE B;  5BO0 A;  5GT0 B;  4H9S A;  3AZM B;  4J8V B;  3UTB A;  4Z5T D;  3REH A;  5B0Y A;  5AVC C;  1P3K D;  1P3F A;  3WA9 D;  4JJN D;  3AZK D;  5AVC B;  1KX3 C;  1KX5 A;  1P3O A;  4XUJ A;  4G91 B;  2CV5 C;  5AY8 D;  1KX3 B;  2BYM A;  2CV5 B;  3MVD A;  5CPI A;  3REK A;  1EQZ A;  5B2J C;  3AN2 A;  1M19 D;  4G92 C;  4WU8 C;  1M18 D;  1S32 D;  1P3M A;  5B2J B;  5B0Z D;  4WU9 C;  3AZG D;  5CPJ A;  4WU8 B;  4G92 B;  3NQJ A;  2F8N G;  4H9S C;  1BH8 B;  3UTB C;  3AZJ A;  3B6F C;  4E45 A;  1M1A D;  3REH C;  5B0Y C;  3REL A;  4XZQ A;  2FJ7 D;  5BO0 B;  3W99 C;  3UTB B;  3B6F B;  3REH B;  5B0Y B;  4YM6 D;  3WTP A;  5B33 D;  1P3O C;  1KX5 C;  4Z2M H;  4QLC D;  1R4V A;  3W99 B;  1P3G D;  3C1C B;  2F8N K;  3AZH D;  5B32 G;  3LJA C;  4J8U A;  1HQ3 A;  1KX5 B;  1P3O B;  4UUZ A;  5CPI C;  3AZN D;  2PYO A;  1TZY B;  1ID3 D;  1F1E A;  3LJA B;  3UT9 A;  5GSU A;  1EQZ C;  2ARO D;  2BYM B;  3AV2 D;  3AN2 C;  5CPI B;  5B32 B;  5B0Z A;  3B0D C;  3AV1 D;  1EQZ B;  1P3M C;  5GT3 A;  3AN2 B;  1B67 A;  1P3L A;  5CPJ C;  3B0D B;  1M1A A;  1ZLA D;  3LZ0 B;  3AZJ C;  3MGS A;  4H9O A;  5CPJ B;  3REL C;  4XZQ C;  4R8P D;  3WA9 C;  1P34 A;  3AZK C;  4WNN A;  3AZJ B;  5DNM A;  5B33 A;  5AVB D;  5B40 A;  1P3K B;  4J8V A;  3REL B;  3WTP C;  4JJN B;  3B6G D;  1P3I D;  3WA9 B;  4DRA A;  5F99 A;  3AZL A;  1AOI D;  3AZK B;  5AV5 A;  3WTP B;  4J8U C;  1HQ3 C;  1ID3 A;  3MGR D;  2ARO A;  2PYO C;  3UT9 C;  5GSU C;  4J8U B;  5GXQ D;  1HQ3 B;  5E5A A;  5BT1 D;  4UUZ B;  3AZF D;  1KX3 A;  1M18 C;  5AV6 D;  5BS7 A;  5B0Z C;  3O62 D;  3UT9 B;  5GSU B;  5GT3 C;  3AZG C;  1M18 B;  5B24 D;  1P3L C;  5B0Z B;  5B2I D;  1M1A C;  3X1S D;  3AZG B;  5B1L D;  4M6B A;  3LEL D;  3MGS C;  1P3L B;  3C1B D;  5AVB A;  3B0B A;  1M1A B;  4WU8 A;  3AYW D;  5DNM C;  5B33 C;  3MGS B;  5B40 C;  1BH8 A;  4QLC C;  3WKJ D;  1KX4 D;  5F99 C;  3AZL C;  3MNN D;  4YM6 B;  5DNM B;  5B33 B;  4NFT A;  1F66 A;  5AV5 C;  5B40 B;  5C3I C;  4NE5 A;  4QLC B;  4Z66 D;  3KXB D;  3B6F A;  3X1T D;  5F99 B;  1N1J A;  3AZL B;  1ID3 C;  3KWQ D;  3MGP A;  5B31 G;  2F8N A;  2ARO C;  3TU4 D;  3W99 A;  4G91 C;  5AV5 B;  5C3I B;  5DNN D;  3C1C A;  5E5A C;  1ID3 B;  1P3P D;  2NZD D;  4NE3 A;  2ARO B;  5BS7 C;  3AV2 B;  5B24 A;  1TZY A;  5E5A B;  3LJA A;  4NE6 A;  5AV9 A;  1P3B A;  5AV8 D;  4ZUX A;  3W96 D;  2BYK A;  5B1M A;  5B32 A;  4KUD A;  4YS3 D;  5CHL B;  2YFW A;  5AVB C;  4X23 D;  3WKJ A;  4AWL C;  1KX4 A;  5BNV A;  1AOI C;  3LZ1 A;  3LZ0 A;  4CAY A;  3W98 D;  5JRG D;  3KUY A;  5AVB B;  3AFA D;  4AWL B;  3B6G B;  1U35 D;  3X1T A;  1AOI B;  1F66 C;  4Z5T A;  3MGR C;  2IO5 C;  3KSY A;  1P3K A;  3MGP C;  4JJN A;  3WA9 A;  4H9R B;  1F66 B;  5BT1 C;  3AZK A;  3MGR B;  2IO5 B;  3C1C C;  4J8X D;  1N1J B;  3X1U D;  3MGP B;  2F8N B;  3REI D;  5AY8 A;  1ULY A;  5B24 C;  1TZY C;  5AV6 B;  5AV9 C;  1P3B C;  4ZUX C;  5CP6 D;  4EO5 B;  3X1V D;  5B24 B;  5B1M C;  5B32 C;  5JA4 B;  5B2I B;  5AV9 B;  1P3B B;  4KUD C;  4ZUX B;  1M19 A;  1H3O A;  3X1S B;  4J8W D;  1JFI B;  1M18 A;  1S32 A;  3LEL B;  2BYK B;  5B1M B;  3WKJ C;  2RVQ C;  5JRG A;  1KX4 C;  5B31 D;  3C1B B;  4KUD B;  3LZ1 C;  3LZ0 C;  3AZG A;  3W97 D;  3AZE D;  3KUY C;  3AZM D;  2YFW B;  4KGC D;  3WKJ B;  1KX4 B;  3REJ D;  5BNV B;  3X1T C;  3LZ1 B;  2NQB D;  1BH9 A;  4Z5T C;  4CAY B;  2FJ7 A;  3KUY B;  3TU4 C;  1P3K C;  4JJN C;  3A6N D;  4Z66 B;  3X1T B;  5AVC D;  4Z5T B;  3KWQ B;  1P3A D;  4YM6 A;  3NQU A;  3TU4 B;  4Z2M G;  4QLC A;  1P3G A;  3AZH A;  5CPK D;  1P3P B;  5AY8 C;  5AV8 C;  4WZS B;  2NZD B;  3W96 C;  3AZN A;  5AV8 B;  5AY8 B;  4LD9 D;  3AV2 A;  4J8W A;  3W96 B;  1M19 C;  3AV1 A;  5B2J D;  1S32 C;  4YS3 B;  4H9Q A;  5JRG C;  3V9R A;  1M19 B;  4KGC A;  1H3O B;  1B6W A;  3REJ A;  1S32 B;  1ZLA A;  4WU9 D;  1WWI A;  5JRG B;  3UTA D;  4R8P A;  2FJ7 C;  1U35 B;  3UTB D;  3AZI D;  1BH9 B;  4YM6 C;  2FJ7 B;  3B6G A;  4CSR B;  1P3I A;  1AOI A;  1P3F D;  1P3G C;  3AZH C;  4H9R A;  2JSS A;  3NQU B;  4XUJ D;  3MGR A;  4ZBJ B;  1P3G B;  3REI B;  3WAA D;  3AZN C;  3AZH B;  4LD9 A;  5G49 A;  5GXQ A;  3AV2 C;  3MVD D;  4J8W C;  5BNX A;  3AZF A;  2CWE A;  5AV6 A;  3AZN B;  3X1V B;  3MGQ D;  3O62 A;  3REK D;  1EQZ D;  3AV1 C;  4H9N B;  5B31 C;  1BFM A;  4J8W B;  3AN2 D;  3VH6 T;  4H9P A;  5JA4 A;  4KGC C;  5B2I A;  3AV1 B;  1P3M D;  3REJ C;  5B31 B;  3UTA A;  3X1S A;  1ZLA C;  3W97 B;  4H9Q B;  1JFI A;  3V9R B;  5B1L A;  3LEL A;  5CPJ D;  4KGC B;  4R8P C;  3A6N C;  2F8N H;  3C1B A;  3REJ B;  3AZI A;  2NQB B;  3AZJ D;  1ZLA B;  3AYW A;  1P3A C;  3REL D;  4XZQ D;  4R8P B;  3A6N B;  3B6G C;  1P3I C;  4KHA A;  3MNN A;  5CPK C;  3VH5 T;  1P3A B; 
#chains in the Genus database with same CATH topology
 3KXB A;  2Y2P A;  3WTP D;  4Z66 A;  3WAA A;  2Y2J A;  1W2E A;  3R45 A;  1P3I B;  5KDM A;  3KWQ A;  5CPK B;  3VH6 W;  3TU4 A;  4LD9 C;  4J8U D;  5DNN A;  1HQ3 D;  5GXQ C;  2HIO D;  3MGQ A;  2YFV A;  3AZF C;  1P3P A;  2PYO D;  2NZD A;  5AV6 C;  3UT9 D;  4LD9 B;  5GSU D;  3O62 C;  5G49 B;  5GXQ B;  4WV4 B;  4DRB A;  4EO5 C;  5BNX B;  3AZF B;  5AV8 A;  4E44 A;  5B2I C;  3O62 B;  5FUG A;  3W96 A;  5GT3 D;  3UTA C;  3X1S C;  3VH5 W;  5B1L C;  3LEL C;  1P3L D;  4H9P B;  4YS3 A;  4WU9 B;  3C1B C;  3UTA B;  3AZI C;  4X23 A;  2ZY4 A;  3AYW C;  3VH6 A;  3MGS D;  5B1L B;  1P3F C;  3W98 A;  1P34 D;  3AZI B;  3MNN C;  3AFA A;  5DNM D;  3AYW B;  5GT0 D;  5B40 D;  3WTP E;  4XUJ C;  1U35 A;  3KXB C;  4J8V D;  1P3F B;  4Z66 C;  3WAA C;  5F99 D;  3AZL D;  2DQN C;  4KHA B;  3KWQ C;  3MNN B;  4CSR A;  5AV5 D;  2HIO A;  4XUJ B;  3KXB B;  3MVD C;  5DNN C;  2HUE C;  3WAA B;  3R45 B;  4J8X A;  3MGQ C;  3REK C;  3VH5 A;  5KDM B;  3X1U A;  1P3P C;  2NZD C;  2Y2N A;  3MVD B;  3REI A;  2LY8 A;  5DNN B;  2HUE B;  5E5A D;  3MGQ B;  2YFV B;  3REK B;  1KX3 D;  2CV5 D;  5CP6 A;  3X1V A;  1TAF A;  2J8P A;  4H9N A;  1P3M B;  4HGA C;  4YS3 C;  5FUG B;  4X23 C;  3B0C T;  3NQJ B;  5B31 A;  4HGA B;  3W97 A;  3AZE A;  3W98 C;  5GT0 A;  3AZM A;  4X23 B;  4WU8 D;  2W8S A;  2L5A A;  4XZQ B;  3AFA C;  1U35 C;  2NQB A;  3W98 B;  1KU5 A;  1Q9C A;  2XD5 A;  3AFA B;  3A6N A;  1F66 D;  2HIO C;  5AVC A;  3B6F D;  1P3A A;  1WWS A;  3REH D;  4J8X C;  5B0Y D;  3MGP D;  3X1U C;  2F8N D;  3W99 D;  2HIO B;  4ZBJ C;  3C1C D;  3REI C;  5CPK A;  2PYO B;  1HTA A;  4J8X B;  2CV5 A;  3X1U B;  3B0C W;  1KX5 D;  1P3O D;  5CP6 C;  3FDD A;  1TZY D;  3X1V C;  2Y2O A;  3LJA D;  2BG1 A;  5AV9 D;  1P3B D;  4ZUX D;  5GT3 B;  2G5I C;  5CP6 B;  5CPI D;  5B2J A;  5B1M D;  5B32 D;  1TAF B;  4KUD D;  2Y2Q A;  1P34 C;  3W97 C;  2JE5 A;  3AZE C;  5GT0 C;  3AZM C;  4H9O B;  4J8V C;  2RVQ D;  4WU9 A;  3LZ1 D;  1A7W A;  3LZ0 D;  1P34 B;  2NQB C;  3H0L C;  4WNN B;  3KUY D;  3AZE B;  5BO0 A;  5GT0 B;  4H9S A;  3AZM B;  3F6T A;  4J8V B;  3UTB A;  4Z5T D;  3REH A;  5B0Y A;  5AVC C;  1P3K D;  1P3F A;  3WA9 D;  4JJN D;  3AZK D;  5AVC B;  1KX3 C;  1KX5 A;  1P3O A;  4XUJ A;  4G91 B;  2CV5 C;  5AY8 D;  1KX3 B;  2BYM A;  2ZY3 A;  2XD1 A;  2CV5 B;  3MVD A;  5CPI A;  3REK A;  1EQZ A;  2Y2G A;  5B2J C;  1Z2C B;  3KFU G;  3AN2 A;  1M19 D;  4G92 C;  4WU8 C;  1M18 D;  1S32 D;  1P3M A;  5B2J B;  5B0Z D;  4WU9 C;  3AZG D;  5CPJ A;  4WU8 B;  4G92 B;  3NQJ A;  2F8N G;  4H9S C;  1BH8 B;  3UTB C;  3AZJ A;  3B6F C;  4E45 A;  1M1A D;  3REH C;  5B0Y C;  3REL A;  4XZQ A;  2FJ7 D;  5BO0 B;  3W99 C;  3UTB B;  3B6F B;  3REH B;  5B0Y B;  4YM6 D;  3WTP A;  5B33 D;  1P3O C;  3P5J B;  1KX5 C;  4Z2M H;  4QLC D;  1R4V A;  3W99 B;  1P3G D;  3C1C B;  2F8N K;  3AZH D;  5B32 G;  3LJA C;  4J8U A;  1HQ3 A;  3EG5 B;  2Y2H A;  1P3O B;  1KX5 B;  4UUZ A;  5CPI C;  3AZN D;  2PYO A;  1TZY B;  1ID3 D;  1F1E A;  3LJA B;  3UT9 A;  5GSU A;  1EQZ C;  2ARO D;  2BYM B;  3IP4 C;  3AV2 D;  3AN2 C;  5CPI B;  2Y2I A;  3MNN A;  5B32 B;  5B0Z A;  3B0D C;  4DQY B;  3AV1 D;  1EQZ B;  1P3M C;  5GT3 A;  3AN2 B;  1B67 A;  1P3L A;  5CPJ C;  3B0D B;  1M1A A;  1ZLA D;  3LZ0 B;  3AZJ C;  3MGS A;  4H9O A;  5CPJ B;  3REL C;  4XZQ C;  4R8P D;  3WA9 C;  1P34 A;  3AZK C;  4WNN A;  3AZJ B;  5DNM A;  5B33 A;  5AVB D;  5B40 A;  1P3K B;  4J8V A;  3REL B;  3WTP C;  4JJN B;  3B6G D;  1P3I D;  3WA9 B;  4DRA A;  5F99 A;  3AZL A;  1AOI D;  3AZK B;  2VQR A;  5AV5 A;  3WTP B;  4J8U C;  1HQ3 C;  1ID3 A;  3MGR D;  2ARO A;  2PYO C;  3UT9 C;  5GSU C;  4J8U B;  5GXQ D;  1HQ3 B;  5E5A A;  5BT1 D;  4UUZ B;  3AZF D;  1T3U A;  1KX3 A;  1M18 C;  5AV6 D;  5BS7 A;  5B0Z C;  3EPH A;  3O62 D;  3UT9 B;  5GSU B;  5GT3 C;  3AZG C;  1PZR A;  1M18 B;  5B24 D;  1P3L C;  5B0Z B;  5B2I D;  1M1A C;  3X1S D;  3AZG B;  5B1L D;  4M6B A;  3LEL D;  3MGS C;  1P3L B;  3C1B D;  5AVB A;  3B0B A;  1M1A B;  4WU8 A;  3AYW D;  5DNM C;  5B33 C;  3MGS B;  5B40 C;  1BH8 A;  4QLC C;  3WKJ D;  1KX4 D;  5F99 C;  3AZL C;  3MNN D;  4YM6 B;  2JCH A;  5DNM B;  5B33 B;  4NFT A;  1F66 A;  5AV5 C;  5B40 B;  5C3I C;  4NE5 A;  4QLC B;  4Z66 D;  3KXB D;  2Y2L A;  3B6F A;  3X1T D;  5F99 B;  1N1J A;  3AZL B;  1ID3 C;  3KWQ D;  3MGP A;  5B31 G;  2F8N A;  2ARO C;  3TU4 D;  3W99 A;  4G91 C;  5AV5 B;  5C3I B;  5DNN D;  3C1C A;  5E5A C;  1ID3 B;  1P3P D;  2NZD D;  4NE3 A;  2ARO B;  5BS7 C;  3AV2 B;  5B24 A;  1TZY A;  5E5A B;  3LJA A;  3AL0 C;  4NE6 A;  5AV9 A;  1P3B A;  5AV8 D;  4ZUX A;  3W96 D;  2ZY2 A;  2BYK A;  5B1M A;  5B32 A;  4KUD A;  4YS3 D;  5CHL B;  2YFW A;  5AVB C;  4X23 D;  3WKJ A;  3EPJ A;  4AWL C;  1KX4 A;  5BNV A;  1AOI C;  3LZ1 A;  3LZ0 A;  4CAY A;  3W98 D;  5JRG D;  3KUY A;  5AVB B;  3AFA D;  4AWL B;  3B6G B;  1U35 D;  3X1T A;  1AOI B;  1F66 C;  4Z5T A;  3MGR C;  2IO5 C;  3KSY A;  1P3K A;  3MGP C;  4JJN A;  3WA9 A;  4H9R B;  1F66 B;  5BT1 C;  3AZK A;  3MGR B;  2IO5 B;  3C1C C;  4J8X D;  1N1J B;  3X1U D;  3MGP B;  3H0R C;  2F8N B;  3REI D;  5AY8 A;  1ULY A;  5B24 C;  1TZY C;  5AV6 B;  5AV9 C;  1P3B C;  4ZUX C;  2Y2M A;  4UPK A;  5CP6 D;  3A1K A;  4EO5 B;  3X1V D;  5B24 B;  5B1M C;  5B32 C;  5JA4 B;  5B2I B;  5AV9 B;  1P3B B;  4KUD C;  2F2A C;  4ZUX B;  1M19 A;  1H3O A;  3X1S B;  4J8W D;  2RIQ A;  1JFI B;  1M18 A;  1S32 A;  3LEL B;  2BYK B;  5B1M B;  3EPK A;  3WKJ C;  2RVQ C;  5JRG A;  1KX4 C;  5B31 D;  3C1B B;  4KUD B;  3LZ1 C;  3LZ0 C;  3AZG A;  3W97 D;  3AZE D;  3KUY C;  3AZM D;  2YFW B;  4KGC D;  3WKJ B;  1KX4 B;  3REJ D;  5BNV B;  3X1T C;  3LZ1 B;  2NQB D;  1BH9 A;  4Z5T C;  2ZM5 A;  4CAY B;  2FJ7 A;  3KUY B;  3TU4 C;  1P3K C;  4JJN C;  3A6N D;  4Z66 B;  3X1T B;  5AVC D;  4Z5T B;  3KWQ B;  1P3A D;  4YM6 A;  4WJ3 C;  3NQU A;  3TU4 B;  4Z2M G;  4QLC A;  1P3G A;  3AZH A;  5CPK D;  1P3P B;  5AY8 C;  5AV8 C;  4WZS B;  2NZD B;  2UWX A;  3W96 C;  3AZN A;  5AV8 B;  5AY8 B;  4LD9 D;  3AV2 A;  4J8W A;  3W96 B;  1M19 C;  3AV1 A;  5B2J D;  1S32 C;  2FFF B;  4YS3 B;  4H9Q A;  5JRG C;  3V9R A;  3H0M C;  1M19 B;  4KGC A;  1H3O B;  1B6W A;  3REJ A;  1S32 B;  1ZLA A;  4WU9 D;  1WWI A;  5JRG B;  3UTA D;  4R8P A;  2FJ7 C;  1U35 B;  3UTB D;  3AZI D;  1BH9 B;  4YM6 C;  2FJ7 B;  3B6G A;  4CSR B;  1P3I A;  1AOI A;  1P3F D;  2ZY5 A;  1P3G C;  3AZH C;  4H9R A;  2JSS A;  3NQU B;  4XUJ D;  3MGR A;  4ZBJ B;  1P3G B;  3REI B;  3WAA D;  3AZN C;  3AZH B;  4LD9 A;  5G49 A;  5GXQ A;  3A1I A;  3AV2 C;  3MVD D;  4J8W C;  5BNX A;  3AZF A;  2CWE A;  5AV6 A;  3AZN B;  3X1V B;  3MGQ D;  3O62 A;  3REK D;  1EQZ D;  3AV1 C;  4H9N B;  5B31 C;  1BFM A;  2DF4 C;  4J8W B;  3AN2 D;  3VH6 T;  4H9P A;  5JA4 A;  4KGC C;  5B2I A;  3AV1 B;  1P3M D;  3REJ C;  5B31 B;  3UTA A;  3X1S A;  1ZLA C;  3W97 B;  4H9Q B;  1JFI A;  3V9R B;  5B1L A;  3LEL A;  5CPJ D;  4KGC B;  4R8P C;  3A6N C;  2F8N H;  3C1B A;  3REJ B;  3AZI A;  2NQB B;  3AZJ D;  1ZLA B;  3AYW A;  1P3A C;  3REL D;  4XZQ D;  4R8P B;  3A6N B;  3EPL A;  1P3I C;  3B6G C;  2Y2K A;  4KHA A;  2G5H C;  5CPK C;  3VH5 T;  1P3A B; 
#chains in the Genus database with same CATH homology
 3KXB A;  2Y2P A;  3WTP D;  4Z66 A;  3WAA A;  2Y2J A;  1W2E A;  3R45 A;  1P3I B;  5KDM A;  3KWQ A;  5CPK B;  3VH6 W;  3TU4 A;  4LD9 C;  4J8U D;  5DNN A;  1HQ3 D;  5GXQ C;  2HIO D;  3MGQ A;  2YFV A;  3AZF C;  1P3P A;  2PYO D;  2NZD A;  5AV6 C;  3UT9 D;  4LD9 B;  5GSU D;  3O62 C;  5G49 B;  5GXQ B;  4WV4 B;  4DRB A;  4EO5 C;  5BNX B;  3AZF B;  5AV8 A;  4E44 A;  5B2I C;  3O62 B;  5FUG A;  3W96 A;  5GT3 D;  3UTA C;  3X1S C;  3VH5 W;  5B1L C;  3LEL C;  1P3L D;  4H9P B;  4YS3 A;  4WU9 B;  3C1B C;  3UTA B;  3AZI C;  4X23 A;  2ZY4 A;  3AYW C;  3VH6 A;  3MGS D;  5B1L B;  1P3F C;  3W98 A;  1P34 D;  3AZI B;  3MNN C;  3AFA A;  5DNM D;  3AYW B;  5GT0 D;  5B40 D;  3WTP E;  4XUJ C;  1U35 A;  3KXB C;  4J8V D;  1P3F B;  4Z66 C;  3WAA C;  5F99 D;  3AZL D;  2DQN C;  4KHA B;  3KWQ C;  3MNN B;  4CSR A;  5AV5 D;  2HIO A;  4XUJ B;  3KXB B;  3MVD C;  5DNN C;  2HUE C;  3WAA B;  3R45 B;  4J8X A;  3MGQ C;  3REK C;  3VH5 A;  5KDM B;  3X1U A;  1P3P C;  2NZD C;  2Y2N A;  3MVD B;  3REI A;  2LY8 A;  5DNN B;  2HUE B;  5E5A D;  3MGQ B;  2YFV B;  3REK B;  1KX3 D;  2CV5 D;  5CP6 A;  3X1V A;  1TAF A;  2J8P A;  4H9N A;  1P3M B;  4HGA C;  4YS3 C;  5FUG B;  4X23 C;  3B0C T;  3NQJ B;  5B31 A;  4HGA B;  3W97 A;  3AZE A;  3W98 C;  5GT0 A;  3AZM A;  4X23 B;  4WU8 D;  2W8S A;  2L5A A;  4XZQ B;  3AFA C;  1U35 C;  2NQB A;  3W98 B;  1KU5 A;  1Q9C A;  2XD5 A;  3AFA B;  3A6N A;  1F66 D;  2HIO C;  5AVC A;  3B6F D;  1P3A A;  1WWS A;  3REH D;  4J8X C;  5B0Y D;  3MGP D;  3X1U C;  2F8N D;  3W99 D;  2HIO B;  4ZBJ C;  3C1C D;  3REI C;  5CPK A;  2PYO B;  1HTA A;  4J8X B;  2CV5 A;  3X1U B;  3B0C W;  1KX5 D;  1P3O D;  5CP6 C;  3FDD A;  1TZY D;  3X1V C;  2Y2O A;  3LJA D;  2BG1 A;  5AV9 D;  1P3B D;  4ZUX D;  5GT3 B;  2G5I C;  5CP6 B;  5CPI D;  5B2J A;  5B1M D;  5B32 D;  1TAF B;  4KUD D;  2Y2Q A;  1P34 C;  3W97 C;  2JE5 A;  3AZE C;  5GT0 C;  3AZM C;  4H9O B;  4J8V C;  2RVQ D;  4WU9 A;  3LZ1 D;  1A7W A;  3LZ0 D;  1P34 B;  2NQB C;  3H0L C;  4WNN B;  3KUY D;  3AZE B;  5BO0 A;  5GT0 B;  4H9S A;  3AZM B;  3F6T A;  4J8V B;  3UTB A;  4Z5T D;  3REH A;  5B0Y A;  5AVC C;  1P3K D;  1P3F A;  3WA9 D;  4JJN D;  3AZK D;  5AVC B;  1KX3 C;  1KX5 A;  1P3O A;  4XUJ A;  4G91 B;  2CV5 C;  5AY8 D;  1KX3 B;  2BYM A;  2ZY3 A;  2XD1 A;  2CV5 B;  3MVD A;  5CPI A;  3REK A;  1EQZ A;  2Y2G A;  5B2J C;  1Z2C B;  3KFU G;  3AN2 A;  1M19 D;  4G92 C;  4WU8 C;  1M18 D;  1S32 D;  1P3M A;  5B2J B;  5B0Z D;  4WU9 C;  3AZG D;  5CPJ A;  4WU8 B;  4G92 B;  3NQJ A;  2F8N G;  4H9S C;  1BH8 B;  3UTB C;  3AZJ A;  3B6F C;  4E45 A;  1M1A D;  3REH C;  5B0Y C;  3REL A;  4XZQ A;  2FJ7 D;  5BO0 B;  3W99 C;  3UTB B;  3B6F B;  3REH B;  5B0Y B;  4YM6 D;  3WTP A;  5B33 D;  1P3O C;  3P5J B;  1KX5 C;  4Z2M H;  4QLC D;  1R4V A;  3W99 B;  1P3G D;  3C1C B;  2F8N K;  3AZH D;  5B32 G;  3LJA C;  4J8U A;  1HQ3 A;  3EG5 B;  2Y2H A;  1P3O B;  1KX5 B;  4UUZ A;  5CPI C;  3AZN D;  2PYO A;  1TZY B;  1ID3 D;  1F1E A;  3LJA B;  3UT9 A;  5GSU A;  1EQZ C;  2ARO D;  2BYM B;  3IP4 C;  3AV2 D;  3AN2 C;  5CPI B;  2Y2I A;  3MNN A;  5B32 B;  5B0Z A;  3B0D C;  4DQY B;  3AV1 D;  1EQZ B;  1P3M C;  5GT3 A;  3AN2 B;  1B67 A;  1P3L A;  5CPJ C;  3B0D B;  1M1A A;  1ZLA D;  3LZ0 B;  3AZJ C;  3MGS A;  4H9O A;  5CPJ B;  3REL C;  4XZQ C;  4R8P D;  3WA9 C;  1P34 A;  3AZK C;  4WNN A;  3AZJ B;  5DNM A;  5B33 A;  5AVB D;  5B40 A;  1P3K B;  4J8V A;  3REL B;  3WTP C;  4JJN B;  3B6G D;  1P3I D;  3WA9 B;  4DRA A;  5F99 A;  3AZL A;  1AOI D;  3AZK B;  2VQR A;  5AV5 A;  3WTP B;  4J8U C;  1HQ3 C;  1ID3 A;  3MGR D;  2ARO A;  2PYO C;  3UT9 C;  5GSU C;  4J8U B;  5GXQ D;  1HQ3 B;  5E5A A;  5BT1 D;  4UUZ B;  3AZF D;  1T3U A;  1KX3 A;  1M18 C;  5AV6 D;  5BS7 A;  5B0Z C;  3EPH A;  3O62 D;  3UT9 B;  5GSU B;  5GT3 C;  3AZG C;  1PZR A;  1M18 B;  5B24 D;  1P3L C;  5B0Z B;  5B2I D;  1M1A C;  3X1S D;  3AZG B;  5B1L D;  4M6B A;  3LEL D;  3MGS C;  1P3L B;  3C1B D;  5AVB A;  3B0B A;  1M1A B;  4WU8 A;  3AYW D;  5DNM C;  5B33 C;  3MGS B;  5B40 C;  1BH8 A;  4QLC C;  3WKJ D;  1KX4 D;  5F99 C;  3AZL C;  3MNN D;  4YM6 B;  2JCH A;  5DNM B;  5B33 B;  4NFT A;  1F66 A;  5AV5 C;  5B40 B;  5C3I C;  4NE5 A;  4QLC B;  4Z66 D;  3KXB D;  2Y2L A;  3B6F A;  3X1T D;  5F99 B;  1N1J A;  3AZL B;  1ID3 C;  3KWQ D;  3MGP A;  5B31 G;  2F8N A;  2ARO C;  3TU4 D;  3W99 A;  4G91 C;  5AV5 B;  5C3I B;  5DNN D;  3C1C A;  5E5A C;  1ID3 B;  1P3P D;  2NZD D;  4NE3 A;  2ARO B;  5BS7 C;  3AV2 B;  5B24 A;  1TZY A;  5E5A B;  3LJA A;  3AL0 C;  4NE6 A;  5AV9 A;  1P3B A;  5AV8 D;  4ZUX A;  3W96 D;  2ZY2 A;  2BYK A;  5B1M A;  5B32 A;  4KUD A;  4YS3 D;  5CHL B;  2YFW A;  5AVB C;  4X23 D;  3WKJ A;  3EPJ A;  4AWL C;  1KX4 A;  5BNV A;  1AOI C;  3LZ1 A;  3LZ0 A;  4CAY A;  3W98 D;  5JRG D;  3KUY A;  5AVB B;  3AFA D;  4AWL B;  3B6G B;  1U35 D;  3X1T A;  1AOI B;  1F66 C;  4Z5T A;  3MGR C;  2IO5 C;  3KSY A;  1P3K A;  3MGP C;  4JJN A;  3WA9 A;  4H9R B;  1F66 B;  5BT1 C;  3AZK A;  3MGR B;  2IO5 B;  3C1C C;  4J8X D;  1N1J B;  3X1U D;  3MGP B;  3H0R C;  2F8N B;  3REI D;  5AY8 A;  1ULY A;  5B24 C;  1TZY C;  5AV6 B;  5AV9 C;  1P3B C;  4ZUX C;  2Y2M A;  4UPK A;  5CP6 D;  3A1K A;  4EO5 B;  3X1V D;  5B24 B;  5B1M C;  5B32 C;  5JA4 B;  5B2I B;  5AV9 B;  1P3B B;  4KUD C;  2F2A C;  4ZUX B;  1M19 A;  1H3O A;  3X1S B;  4J8W D;  2RIQ A;  1JFI B;  1M18 A;  1S32 A;  3LEL B;  2BYK B;  5B1M B;  3EPK A;  3WKJ C;  2RVQ C;  5JRG A;  1KX4 C;  5B31 D;  3C1B B;  4KUD B;  3LZ1 C;  3LZ0 C;  3AZG A;  3W97 D;  3AZE D;  3KUY C;  3AZM D;  2YFW B;  4KGC D;  3WKJ B;  1KX4 B;  3REJ D;  5BNV B;  3X1T C;  3LZ1 B;  2NQB D;  1BH9 A;  4Z5T C;  2ZM5 A;  4CAY B;  2FJ7 A;  3KUY B;  3TU4 C;  1P3K C;  4JJN C;  3A6N D;  4Z66 B;  3X1T B;  5AVC D;  4Z5T B;  3KWQ B;  1P3A D;  4YM6 A;  4WJ3 C;  3NQU A;  3TU4 B;  4Z2M G;  4QLC A;  1P3G A;  3AZH A;  5CPK D;  1P3P B;  5AY8 C;  5AV8 C;  4WZS B;  2NZD B;  2UWX A;  3W96 C;  3AZN A;  5AV8 B;  5AY8 B;  4LD9 D;  3AV2 A;  4J8W A;  3W96 B;  1M19 C;  3AV1 A;  5B2J D;  1S32 C;  2FFF B;  4YS3 B;  4H9Q A;  5JRG C;  3V9R A;  3H0M C;  1M19 B;  4KGC A;  1H3O B;  1B6W A;  3REJ A;  1S32 B;  1ZLA A;  4WU9 D;  1WWI A;  5JRG B;  3UTA D;  4R8P A;  2FJ7 C;  1U35 B;  3UTB D;  3AZI D;  1BH9 B;  4YM6 C;  2FJ7 B;  3B6G A;  4CSR B;  1P3I A;  1AOI A;  1P3F D;  2ZY5 A;  1P3G C;  3AZH C;  4H9R A;  2JSS A;  3NQU B;  4XUJ D;  3MGR A;  4ZBJ B;  1P3G B;  3REI B;  3WAA D;  3AZN C;  3AZH B;  4LD9 A;  5G49 A;  5GXQ A;  3A1I A;  3AV2 C;  3MVD D;  4J8W C;  5BNX A;  3AZF A;  2CWE A;  5AV6 A;  3AZN B;  3X1V B;  3MGQ D;  3O62 A;  3REK D;  1EQZ D;  3AV1 C;  4H9N B;  5B31 C;  1BFM A;  2DF4 C;  4J8W B;  3AN2 D;  3VH6 T;  4H9P A;  5JA4 A;  4KGC C;  5B2I A;  3AV1 B;  1P3M D;  3REJ C;  5B31 B;  3UTA A;  3X1S A;  1ZLA C;  3W97 B;  4H9Q B;  1JFI A;  3V9R B;  5B1L A;  3LEL A;  5CPJ D;  4KGC B;  4R8P C;  3A6N C;  2F8N H;  3C1B A;  3REJ B;  3AZI A;  2NQB B;  3AZJ D;  1ZLA B;  3AYW A;  1P3A C;  3REL D;  4XZQ D;  4R8P B;  3A6N B;  3EPL A;  1P3I C;  3B6G C;  2Y2K A;  4KHA A;  2G5H C;  5CPK C;  3VH5 T;  1P3A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...