5CP7A

Crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
218
structure length
218
Chain Sequence
b'DVVMTQTPITLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSRVPDRFTGSGAGTDFTLKISRVEAEDLGIYYCWQGTHFPQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSETDQDSKDSTYSMSSTLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light Chain of Antigen-Binding Fragment of Monoclonal Antibo
publication title Class-specific Monoclonal Antibodies and Dihydropteroate Synthase in Bioassays used for the Detection of Sulfonamides: Structural Insights into Recognition Diversity.
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 218
sequence length 218
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7A01
1FSKB 4UT6H 2H9GA 3ARGA 4YHML 3X11A 1EA9C 4YBHA 2Q7YA 1ND0A 4YGAB 1K5NB 5I1AA 4LLQB 4PV9B 3VD4A 3VFUA 1AFVL 1MVUB 3PGCA 4UQ3B 4L8DB 4OF7A 1F3DJ 1HZHH 4YXKL 4OZFA 1DLHB 2PNDA 4NNPH 1FO0B 2B1AL 1PG7W 4KTDH 3CFBB 1MCSA 5TDPA 3MNVA 3IU4H 4WTWA 1J1OL 4D0DB 4YGVB 2JJTC 2BNRE 5C0CB 3VA6A 2NXYC 5HHQA 2A0LC 4XBGA 4Z7NF 3TESA 3D9AH 4QNPE 3O45A 2DI8A 1IGCL 4QF1A 3RTQC 4PJ5E 4KAQL 4JFDE 3NFSH 4HIEA 4RNRB 4HFUL 5J9PB 3L7EA 4PR5B 4X80L 4FHBD 3OGCB 2P42B 1WZ1L 3VFSB 2OM5A 3IETB 3QWRD 1RV6X 3RIFF 1YEJH 3OJ2C 2R15A 2A6JA 4KI5D 1JHTA 1T1YB 3RY6C 3NGBB 3WCYA 3MRFB 4PB9H 3HNSH 3SCMB 4PJHF 4KTYA 1ZA3A 5C6TH 1C5DB 1BFTA 4D0BA 1DN0A 3HC0B 3IFLH 3KYNA 3OX8A 4BH7A 2FX7L 3MBXL 3B9KD 3DBXB 3QULB 1BVKA 4YNYA 4LP4A 1NH6A 1D5IH 3S5LG 4K9EH 4RFOL 5IB3B 5K93A 3U9PL 4JDTH 4OIBA 4O2CA 3MREA 1VGEL 2Z31B 3RKDC 1GRWA 1JWMB 2D7TH 1S5IL 5CP3H 2DQJH 3NZHH 1NFDF 5D1XD 5DFTA 3RL2B 1ZHBB 3LQZA 3DIFA 3SDCD 3ZDZF 3MV11 1EEQA 1XZ0A 1S7RA 3QUZA 5CJQH 3V5DB 1A02N 5I6XC 1UZ6E 2VDPH 4MXWL 1ZGLA 4U1KA 3SHSA 3HMXL 2UZIH 4PGBA 2D4FA 3OB0K 1HHGA 1S9VA 4Y19A 3SDXE 4TVPE 5HHVH 2Z4QB 2I9LA 4D0CB 1ZANH 2IANE 5KVDL 1K4DB 3GB7A 3IDYB 1TJHH 1Y0LA 1S7XB 1FN4B 2Y6SC 3O4OC 3MRDA 4QWWC 3FFCD 1DQQB 2R2HB 4Z9KB 1E4WH 3L3KB 3B9VA 3ULUD 3IDIB 3CU1A 3OXSA 1U2CA 4PV8B 3UZQA 1ZA6A 2JJSC 4XBPA 2NY5H 2IMMA 5KVGH 3MXVL 1BFVL 3P9LA 4ZNCD 4XPBL 1EZVY 3NBNA 1M7IA 3QFDA 4LQFL 3P40A 3GI8L 1JGEB 1QLFB 1WC7A 3BPNC 4KK9C 1CD0A 4G42B 4H25A 2V5TA 3PL6D 5MEND 2V17H 4CAGA 4Y5VB 2HLFC 1P9MC 5JIHA 4TSCH 3RVWD 1YJDC 1KCUL 4YBLC 2H3NB 3KS0H 2HH0L 5A1AA 5C70A 1WZKA 1HQRA 5F89A 2OL3L 2ZSWB 1P9MA 1SJHA 1KJ3H 4TSBH 3G6DL 5SV3A 5SWZD 5E5UB 5IHLB 4C54A 3I6LD 4PJXB 3LH2H 3PNWA 4LPUA 2OP4H 3ARBD 1Y6MR 1AQDA 4F3FB 3MLYH 5DMGD 3ILQC 4P5MA 1VESA 1TCRA 5FO8B 1B0GA 1N59A 1GGUA 4OZIF 5T3ZL 3DUUB 1UB6B 5FYKH 1MCPH 4JFHD 3B2UD 1BX2B 4YO0A 1HHJB 1S8DB 3VXUA 3QIWD 1XF4A 5HDOA 1V3JA 4F7MA 1FJ1B 2G2RB 4UQ2B 2Y5EA 5E8OA 4OBRA 1XMWA 5GSRA 3FOLB 5JIPA 4OD3L 2XYCA 4JRYA 2QSCL 5HYSA 3OPZH 4XTRC 4J8RA 4F8TA 2ICWB 5DUBB 4GRLD 5I1JL 1G0XA 1NCCL 3MCKB 1IM9B 3BZ4A 4UDUB 5FO7A 3D39A 3BN9C 2WQ8A 5AG8A 1T0MA 5IB5B 5SWSD 3QCUL 3WE6A 5FECA 3BXNB 3QHFL 5KSBE 3DX7A 4P0DA 4PP2B 2AERT 5FEBA 3P9MB 1S7WA 4U6XA 3TBYA 5IKCB 3DROA 5LXGL 4WI6A 1IE5A 3MLVH 5DJXA 3KLAA 5D72H 5I73B 1T22A 4DW2L 5I30H 1F90L 5A2IH 2V9QA 3WJJC 2XZQL 4LVEA 1KCKA 3IJHA 3RGVC 4FQXC 5LCVH 3MV7D 5IJVB 4X7CC 4MLSA 4P5TC 3IDGB 2HJKA 3KPPA 4GBXC 5E9DA 3V6OC 2AJSL 3AU1A 4HQQH 4WI5A 1K8IA 3RI5F 4QCIB 5FB8A 4MJ4A 5F1NB 4WRLA 3E2HB 3KVQA 4FQXA 4DGIL 3CFIC 2B39A 2CGRH 4P5TA 1BVLB 2ZOLB 4GBXA 2WBJC 3K8KA 3KPTA 3V7AG 2EYRB 2D7OA 2VH5H 1G7LA 3HUJA 4HPYH 4W81A 1FG9C 2JCCA 1OLLA 4DN4L 1KJ2A 2IWGA 2BOCB 4KMLB 3O8XA 5C08D 4CN1A 5HHXH 1KULA 1A6WL 2DLHA 3DYMA 4S2SA 4XNUL 2PYFA 4I0PB 2KZWA 3VWJC 4NWUL 4OCXH 1OM3H 5K59E 3KPQA 5ICYB 2F15A 5L7XL 3BIKB 4YDVB 5L2KA 2DF3A 1JNJA 4LHUD 5FYLD 5F9JB 1CLOH 2GJZB 2HT2C 1M1SA 5EBGA 3QR2A 3A67L 3VWJA 1H0DB 1YA5A 5T3ZE 5EPMB 1YPZF 4OAWB 1I1CA 4ZDHB 4AQOA 5TQ2H 2Z8RA 2HRPH 4ISVB 3VA2C 3ARDB 4N9OB 4HGMA 3O2WL 3GMQB 4HG4K 1MQKL 5F1IB 1NCBH 1WFOA 2Y07H 4J6RH 4FS0A 4PJ8B 4NQVA 3D2UD 1YMMD 3KYOB 4XCCH 1K6QH 5CD5D 2UYLB 1SEQL 1UJ3B 2Z92B 5TPWL 1U8LA 5E7BA 2F54B 1JI2A 3BD5A 5JNYB 1S78C 4P2RD 1IAKB 1DQMH 3LEVL 4ZQKB 2NXZD 5D96C 1BFOA 2J8UA 4LCUB 2VC2L 5CJXC 1UZ8B 2MQ0A 2LU3A 3FO1A 3O41A 1P69B 1MFAH 3TPUA 4BKLA 1BF8A 1CT8B 4ENEC 2WLZA 3ULVH 1KN4H 3ARXA 1P7KA 3FCTB 4DKFH 1HINH 1U8IA 3RIAF 3MBEC 1FFNB 4XP6H 3VFVB 1RK0A 4LPTA 5C09A 1MWAA 1RFDH 2NY6B 3LD8B 1G0YR 3LKSB 1XGUA 5GZOC 2Y6SD 1NGXB 1C16A 3GBNH 3FJTA 4E5XA 1ODAA 2ERJB 4U1GB 4P9MH 2VDRL 1SEBA 2FD6L 5EOCJ 4P2YA 5E2WL 4QHLA 5GGVL 1BF2A 2VXVL 5D2NA 4U3XA 1Q1JL 4OCYL 4U1HB 2YD1A 2HN7A 3TO4C 1DUZA 2V5SA 1H3GA 4ZUWA 2UUDH 4G6AC 4WY7H 5K9OB 1KPUA 4N5EC 1MHPH 5KTEH 1EEYA 3LPGA 2GAZA 4HWUA 4KK9D 1KB5L 5A2KH 4UV4H 3WS3B 3LEXB 1A64A 5DJYA 1JRHH 1WTGT 3TO4A 4P99A 3VI3F 2FLRT 5IMOB 1INQB 4F7EA 2WIMA 1FFPA 3BQUD 3U4EA 1BQHG 3DV6B 3CC5A 4HV8A 4K7FA 4Y16A 5JXED 5F70A 1WCBA 4XCYB 3T2NL 3IJSB 5E8NA 4LSRL 4QO1A 4AK1A 1CFNA 1MFEL 5JHDA 1MCOL 3RX5A 1KN2L 1JPSL 2BVOB 4RMUA 3MJ7A 4U6TA 5FDWB 5EA0H 2OQJB 3CFKA 1EGJH 5DT1L 4ORGA 1HYRC 1NFIB 3O9WB 1MCFA 1H5BB 1QSZA 1R6VA 2FH8A 1NGWB 3S35X 5JOFA 1IGIH 1MY5A 3NACL 5F3HB 1CI5A 3G08A 3OR6B 4EZMA 3PP3K 4XP1L 1ERNA 3MZTA 1CDJA 2EKSA 3QRGH 4TPRL 3QO1A 1Z0MA 2DB8A 4Y5XC 1S7QA 4O5LH 2AEPH 4XH2B 4FZ8L 4UB0H 5C0GA 4X9BA 5E1AB 4WV1C 5IB4B 4NKIL 5LWYL 5JORA 2IPUK 3Q6FB 1DL7H 3NCJH 4Y5XA 3WN5B 1NUGA 5FCUH 1JZ8A 4Y1AD 1P5VA 2VL5A 4YXLL 4L3ED 1NCAL 4YDLB 1MF2L 4JN2B 2G9HA 4IM8A 2B8OT 5MHSE 3GO1H 3VGGA 1ED3A 3NH7H 1T3FB 5F1SA 1DQLL 1QTYT 2BNUB 1MRDL 5KS9B 4UNTA 4X9GA 1G7QB 3FOMA 3LEYH 3OKLA 5E08L 4OGYL 1N6VA 2V2XA 1AHWB 4QYOA 5MP6H 5IHBA 1UA6L 3MZGB 1SBSH 3EYQC 5KG9B 1SBBA 4Z5RA 2PUQT 4FZEH 3O2DL 5IIEA 4APQD 2HVJA 2VITB 3CSGA 5EU4B 3CH1B 3ARUA 2DQUH 4GAJH 3KYMB 3H0TB 3ZHLA 1T0PB 2VQ1B 4NHUB 3UTZB 4NQTA 3KJ4C 4Y0GA 5LQBL 3W9DA 2ED9A 3DETC 3PWLB 4OF5A 4M4PA 4JKKA 1P7QD 4JFXA 3Q6GL 1N8ZA 4L4VE 5EU6B 3X14A 3JWNC 3FN9A 4PGEB 1FLRH 3INUH 1CE6B 1CXFA 4LEXL 2VLJD 5I1GH 4OD1H 2YN5A 1T2QL 2VXQH 2MHAB 2LABA 3VXTA 1RUML 5I19L 4TNVK 1PFCA 3QPQC 2APFA 5DJCA 3VJ6B 4Z7VA 1E6OL 4NNYA 1H3UA 4X6CF 2XRAH 3HC3H 4HEME 1AY1L 1NGPH 5IVZB 3PWNA 4Y8AA 5HPOA 1CBVL 1HCVA 3TCLA 1A3LH 2AQ3A 4JGJA 1BZ9B 3GJFB 5TH2A 4K23L 3JTTA 5JHLH 1J0IA 1F6LL 2F54E 5BRZD 1U95B 3QDJD 5FUZH 4AH2B 1OARL 1A0QL 2EEAA 1JGDB 5DR5H 2DMCA 2Q8AH 2ATKA 4GFTB 2ADGA 5LJYH 3BGMA 2C26A 3ULUL 2ICEB 3BPOC 3EOYG 4EI6B 1EJ6A 2CRIA 1BEYL 3P11L 5ICXB 4K3DL 4KVNH 5C2BH 4LNRB 32C2A 3I9GL 1ZEAH 4KK5C 3UTPD 4GS7B 3IFNH 4I18B 3V6ZA 4C4KT 5CILH 3OR7B 2VXSL 4GKNA 5D1QA 1N0XL 2QSQA 1JL8A 4F58H 5ESQB 1KEGL 4R3SA 1QSFD 2Q6WA 4JO1H 1DE4A 5EU3A 5HGDB 3RDTB 4H8WC 3V8OA 2DM3A 3IVKA 4HKJA 3RZCB 3T77B 1BM3L 4O02H 5C71A 3CFJA 1OGTB 1YQ2A 3ZT5A 2VLKE 5CFHA 2EYTB 2OZ4L 1FZKA 1E27A 3MBED 5IGXL 1RURH 4IJ3C 5DVNA 2DQFA 3NIFF 4HIXL 4AM0B 4LU5H 2DQGL 3MFFA 1XGTB 2NLJB 4YR6A 4NZTL 1CGSL 5GGRY 3QIUA 3H9YA 2EDLA 3UZVB 3V0WL 2C3GA 1Z9LA 3LHPL 4RA0C 4CGTA 3GI9H 5F96L 1VFUA 4WI3A 1URLA 1AGCA 3OBAA 4HH8A 2EE9A 1DUYA 3FT3B 4QEGA 3PWUB 1TCMA 3P4OA 2P5WB 5KSUB 4JQXC 4LCCC 4Y4KC 3SKNB 3MUJA 5DJ0A 4YFLF 1A7RL 4I13B 1A6AB 1OLZA 1LDSA 4NO0B 1JGUH 5C9JA 4JQXA 5INDB 4PJGA 1XGYL 5T33H 4NZRH 1MCKA 2ZUWA 3D18B 5C86A 1CD9B 1IL1B 5DK3A 5ERWB 3W0WB 2R8SH 1NEZG 5CIPA 1SQ2N 1GYAA 1NQBA 3HCVA 1MLBA 2AJUL 4FXKB 2MCPL 2VR9A 3DVGB 1IZJA 3HPLB 4JJ5A 3P0VL 4NCDA 3RX7A 5D6CB 3QEGL 3HE7D 2D31A 5D6DC 3EOBA 4XWGH 2BC4A 1G9NH 1R3LA 2J3SA 4DVRL 1CDYA 3QEUA 4JREB 4WDIA 4FABH 1MCNA 4F7TB 3GHBL 1NGYA 3G5YA 5TQ0L 1SY6A 4F8QA 2GTZB 5JLZB 5F8RC 5H35A 5KS9E 3TM6A 1NKRA 1F4HA 4XRCB 5DWUL 1GAFH 1J05A 5HYFA 3LKNB 1NCDL 1XGRA 1C1EL 1E4XL 1RY7B 4FQIL 1HYSD 3FT4B 2GT9A 1I1AC 4UILH 4E42B 4N0YH 2F19H 4RAUA 1GPOH 3TZVA 1OQXA 1E0OB 1HXYA 2EE6A 4OZFG 3B2VH 4ODXB 3VRLF 1MI5B 1PZUB 1NKOA 1I1AA 4OZFH 2XWTB 1YEDA 2YUWA 4IS6A 4P4KD 5CINL 4A2MA 5A2FA 3VXSB 2AEQH 5D70H 5FKAA 5B4MC 4PJ9C 3SJVB 4PYHA 5I1CL 4CRPA 1W72L 3H7BA 1G7JB 1LVEA 4RBPH 1NLBL 1BECA 3JWOH 1NAKH 4M7KL 4EIGB 4PJ9A 5D5MB 4P23A 2AXFA 3NAAL 3OB8A 1UM6H 4J1UB 2DWEA 1WBXA 1F4WL 4XNQA 1IAIL 2OMBA 1EAPB 1N6UA 2VAAB 2WUBH 5IW1B 5BV7H 2Q76A 3TFKD 1K4CA 1X6NA 1HXMB 2AJXL 4JG1L 3SO5A 3KPRB 5JA9A 1KGCD 1CXLA 1PEWA 2XTJB 3VXOA 5F93C 4V1DD 4XGZB 1TIUA 3VH8A 3QI9C 5LBSH 5DFVC 5CEZH 4F7PB 2WLYA 4TRPL 5FO9A 3T0EB 3BGAA 5HHOD 3LZFL 3X13B 1MH5A 3TNMA 4ZUTB 1NL0L 5EUOF 3IFOB 1VACA 2Y1VA 1T89A 4X6EA 4H88H 3ILPA 4LHJB 5CWSB 1II4E 4RISL 2DMBA 3C6LB 4OIIH 3A6BL 4UV7L 5FYKD 4NRXB 5C07B 5IW6A 5IFJA 3T0WA 1ORSB 5D7IA 1OT1A 1CG9B 4AENA 1ES0B 5LG1A 1SMAA 1T20A 2YA1A 2FEEI 4M43L 5HBBA 3I75B 3DARA 4MA8L 3V52H 1U2HA 3H9SE 1F58H 1WBYB 3MRCB 4NUGH 3UYOD 5IM7B 1QKZL 4GRMA 4O9HL 4R4ND 4KROD 2ED7A 4Y5YC 2VABA 5BZDB 3ZE0F 3ZE1F 4HK3N 4NKDA 5EC2B 2W07A 4HLZG 4NZUH 2DKUA 4GSDH 5CZVH 3VFPB 5DGQA 4HLZH 4GRWF 3CSYA 4YHYC 1FGNH 3FB7A 1AXTH 1NC2B 3UTTA 1TQCB 4L29B 4XP5H 2CUMA 3IJYB 1IEBA 1MCDA 1MCEA 4WTXA 3QXAB 5JDSB 3MXWL 4XX1G 3T0DA 1NMBH 5AYUH 3T3MF 3P4NA 4PJDE 2HKFH 4ODWA 5ID1A 4MA7L 3H6JA 2OR8A 3PWPA 2A77L 1QRKA 1X5YA 4HXAH 2GJ6A 4AG4H 3CFCH 3LKPB 3CXDH 5GJSL 5FHAL 2JB6B 1A6UH 4ZFFB 2PTTB 1JBJA 5ANMB 1T6VN 1KCLA 3PE9A 3Q5YA 3QQ4B 4PG2C 2ARJB 3PHOA 1FAIH 2YMXL 2MPAL 4JQIL 3FO0H 4GMTL 1YEGH 2H1PH 1FGVH 5KSVA 5B8CC 1AGDB 4GG6A 1VEMA 4PJAE 1PJ9A 1T1XA 3SGKC 1Q9KB 4BFIB 4WUKH 3C6SB 2PXYC 2OBGA 4WI8A 4PJFA 3IDXH 4S1QL 3L6FA 4JFPB 2AP2A 5HHMD 1KB9J 3G6JF 3GSNA 1HHHA 3SGKA 1MCHA 2PXYA 3HLAB 3FQXB 3IGAA 4QRTA 4ODUA 3PGDB 4RFNB 5GRYA 4BFBD 3L5JA 5HYSG 4XPTL 3OKNB 4BFGA 4S1DD 2FYYB 4HJJH 4L4TB 4WNQB 3MMEB 1N7MH 4YXHL 4OLYL 5T1DL 5C0RL 3SDDA 2DLTA 3ISWA 1A5FH 4WI9A 5F88A 1MIEL 2I24N 4M6MH 4X4YB 1P4LB 4XNZC 5E8PB 3IAPA 4JFDA 4ZYKB 3S7GA 1FIEA 4Z7WF 2DQTL 3BWAB 2M26A 4MD0A 5FYJU 4XHJC 3HAEB 4OFVA 5EO0A 1LEIB 3KPOB 4OBSA 1MI5E 2Z93B 4HCRA 1XCTB 4QXUL 4JG0H 4PJBE 5H94B 2QHLA 2O5ZL 1G0DA 3SBWC 2A1WL 3MJGX 4Q9RH 4ZD3H 1DVFC 2WWKO 2NW2B 3K4ZA 3WEXA 4H20H 2D7MA 4QXGL 4NN7B 5GGSB 2PYEB 2EDFA 4M6NL 4WTZA 1DBML 4ZS7H 1Y18B 1DVFA 3O4LE 3HHRB 4LSPH 3ULVD 1U58A 4E9LA 2FIKB 4OGXH 4RWYL 5D7LD 4DGYH 5K9KB 3JV6B 4QRSA 5D5ME 4O4YH 4ETYA 4XVUD 3RWIB 4M6OH 3VWKC 3TIEA 2Y72A 3EJYC 3THMH 1S9XB 2NY4B 2LV4A 2PKDA 3L3OB 1JZ4A 2X9XA 3BYTA 3LB6D 2YSSB 1MCIA 3WIIL 2YA2A 2BSTB 3KPRE 4Z77B 5F3BB 3BZEB 2BZDA 3BKJL 3HS0A 3VWKA 2DQDL 1RSFA 4JZNA 4Z0XA 1KIRB 3JUZA 4PRAB 1G9MC 43C9A 4NWTL 2IFFH 1IQDB 2O61B 4GT7A 4JDVA 4MQXC 1J18A 4NQDD 4PRDA 5IFHL 5HI5D 2P48B 5HI3D 3SDXA 5C6PB 1N6QL 1P5UA 2IANA 2GCYA 2X4UA 4UBDC 5GRXG 4NOBA 3CX2A 4LF3B 1Q9LA 4TUJB 1NC4D 4NQEA 1J10A 1S5HA 5EU7E 2V7NB 4JKPL 3SDAD 1QZ1A 4XAKE 4LSUL 1KCRL 1I9JH 3U2SB 3ELAT 3Q0HA 1O7VA 4OLUH 4WEBL 5DK0B 5DA4A 1G7HB 3REWA 1JVKA 4UOW1 4L3EE 3RQ3A 3WKNA 3WKML 1INEL 5IEHB 1QVOA 2ZPKL 2EH8H 4K3EL 2VDOL 1DDHA 2A6DA 5A3ID 4I4WA 4I48B 1FDLL 3EDFA 3D3VB 5BMFH 1IC7H 2EO9A 4X98A 5DYOB 2OJEB 3E3QE 3NCBB 1VGKB 3T65B 1ETZB 1OP5H 3VDBA 1MHEB 3NFNA 1W0WB 15C8L 4MJ5B 4HS3A 4OKVA 3EYFB 3BEWA 5DRNA 1EHLH 4NDMA 4WHTB 5E6YA 4EDWH 3RPKA 1RJZB 4AMKL 2N7AA 3QDGB 4UU9B 1GH7A 1HKLH 4HJGA 4RGNC 2H45A 1UZ6F 2YPLB 5FHBH 2FNBA 3VW3H 1D6EB 2PW1B 1LP9E 2EYSA 4BSVB 3GRWH 3MRMA 2D9CA 1MCLA 3OKDB 4NNPL 2OLDA 3NOIA 1MWAH 1KTLA 2VDKL 1JTOA 1ROWA 1N2RB 3FRPA 3F7VB 1CK0H 2LE9A 3D9AL 2DOCA 4JRXE 4XC3L 1YY8B 1Q38A 2YUZA 3ZKXB 5EBMA 3MYJB 3D1MC 5KVMC 2CLVB 1WIPA 4IRJB 2R0KH 4PREB 1M71A 2H26B 5J12B 1OAXL 3HZKB 3PQYD 5DZNA 3WFCH 1A7NH 1D7FA 4CN6A 3MNZB 2DBLH 1YEJL 2NYYD 1K5NA 4LLQA 4PV9A 2CR3A 3QDHA 1GJIA 4WFFE 1MVUA 3V5HB 2X42A 4UQ3A 3V0VB 4M1DH 3C60D 3B9AA 3P3YA 1FNSL 3D85D 3GJFK 4HC1H 5E2UL 1DLFL 4KDWA 5C2UB 1UQSB 1FO0A 4MS8D 1NSNH 3CFBA 4FFWC 5FUCC 4L5FL 5CZXC 3E8UH 4XB8A 4CVXB 2OS7A 3HB3C 4D0DA 4YGVA 4K9EL 4P2OC 4HPOL 5BXFB 5C0CA 2DBJA 2EICA 3SKMB 4ZFOB 3VFGL 2J4WH 2WW8A 3QEQB 1ZT7B 4NJAH 2D7TL 5IEKB 2DQJL 3BJLA 4KY1H 3C8HA 2DLFH 5CLWA 1TFHA 4RNRA 5J9PA 4GG8B 4PR5A 2R0WL 1U6AL 4BQ8A 3OGCA 4D9RE 3SCMC 3GJEB 3QP3A 5C0BD 3IETA 5HHVL 3VFSA 1FZJB 4R26L 2YXFA 3QXWA 4Q2ZA 1TJHL 3EGSB 1T1YA 4N8VB 2EEDA 1MRFL 3VG0H 3MRFA 1OSPH 2LVEA 4G9FD 3SCMA 4PRHD 4QRRB 1C5DA 1PDKA 4ZAKD 5KSBF 3T0VA 4PRPD 1KIPB 3HC0A 2QR0A 3DBXA 2E9BA 5ADOH 1YYLH 2NY5L 5I1IL 4DKEL 3AB0B 3WXVL 4OCRH 5IB3A 1HWGB 2Z31A 4R4FH 4UT9H 1NCUA 1JWMA 4JM2B 3RL2A 4U2YA 4UMGA 2W92A 2BDNH 2FGWH 3CVIH 2P7TB 2QADD 1G6RH 1EERB 1UACL 3IDYC 1WVZA 3QUMB 1WEJH 2CXGA 5BW7A 3LS4L 3WLBB 2R56L 1EJOL 4OZGB 3TV3H 1L6XA 2Z4QA 5CGMA 3VFMB 4D0CA 1X5HA 4TSBL 3U46B 1K4DA 1HHIB 9CGTA 5CHNB 3STLB 3ZSSA 1FN4A 3N85H 3LH2L 1MCRA 4WFHE 2ZZUT 2IF7A 2X4NB 5F7WC 1DQQA 1JNHB 2R2HA 3ZTNH 3DMMD 3MLYL 3VXRD 3L3KA 1ZVSB 1UEMA 3IDIA 2IH3B 3KR3H 3U7WH 4PV8A 2YK1H 3H3PL 1G7IB 3MA9L 4Q9BA 4PB0H 1MCPL 3QHZL 3UJJL 4KQ3H 1F4YH 4ZMAT 1NBYA 4HBCH 4MB4A 3G5XB 3WMSA 1GGBH 5I74C 5JR1H 5CCKH 1JGEA 1QLFA 3D3VE 1F11B 1DZBA 4G42A 2WQRA 4Y5VA 4AEEA 2Z0BA 4TN9A 3RA7H 5L88H 2H3NA 2ZCLH 2UWEB 3D0LB 1LO4H 4LSVL 1JPST 2A9NH 3UMTA 1J8HB 3CD4A 2DRUA 3BRDA 4GW1B 5EULV 2C9AA 5DUMH 2ESVD 1XCQB 4IOFC 2CDFB 4PJXA 3OKMB 4NKQB 4OKDA 2YN3A 4V2CB 3QDGE 2FJHB 3GGWB 5CUSL 1I8IB 2YPLE 1JHLH 1YEKL 3ETBF 2EXWD 4F80A 4LPXA 5FO8A 1QSEB 3KJ6L 5FGSA 1ZT1A 5I30L 1INDH 5ILTH 2E9WA 3SGJA 2R69H 3DUUA 4AIZB 1BX2A 1VKXB 1HHJA 4JVUA 4NQCB 3QNZB 5MEOA 4LBEB 5J6GB 1FJ1A 2G2RA 4UQ2A 2FJFB 2X7LB 1M4KA 2QSTA 2BRRH 3FOLA 5DFWH 5LAXB 4JR9H 4CVZB 1V7NH 2GYSA 1T1WB 5IBTH 4HQQL 5DUBA 1PKOA 2F58H 4YDKH 5A2JH 1T66C 5GS0H 1AGEB 4HH9B 3MCKA 3MRNB 1IM9A 2CGRL 4PJIB 4UDUA 4M61A 4CUCA 5IB5A 1MPAL 4KK8C 1WTLA 3BXNA 3U0TB 4ZXBC 3M17B 2VH5L 4PP2A 3ARGD 3UEZA 1P4BL 4LIQH 3P9MA 5HHXL 2FBJL 3QIBB 4C56B 3BDYH 4F2MB 2HWZH 5IKCA 4OF8A 2EDDA 4ZXBA 1N5AB 1FVCB 1JCKA 1OM3L 2V5YA 3UJTH 4ONFL 2BSSB 3S35H 4HIHB 3OB0H 1CLOL 3KPSE 4G6ML 3SKOB 4JO3H 2NCMA 1JGLL 2FECL 1AP2A 2OX5A 4LARH 4KH2A 1QHPA 3RUGF 3PWVB 4Z7QE 5IJVA 3IDGA 2VLLB 3QFJB 5TQ2L 2HRPL 1UB5B 4KK6D 3KYAA 3QEQE 1RZFH 4FQPA 3SGEH 4QCIA 5F1NA 1FZMB 1FNAA 2Y07L 3MR9B 5J1TC 1JPFB 5D2LB 4MMXC 4OB5H 2ZOLA 2AJYH 3H3BC 4ZO6A 4YJZL 5F8QC 4F57H 5F7HA 5I1KH 2XG4A 3B3IB 4Z7UB 4YLQT 5D1ZD 1PEZA 3GSUB 3BUTA 2BOCA 5KBNC 3QISA 4DKAA 5J11C 1CR9L 4I0PA 4QOKB 3HE6C 2DQIH 4ZODA 3U9UB 2J7LA 4PLKC 5CEZD 2J88H 3BIKA 4QRRE 4P59H 4YDVA 3WLWC 4PTUB 2GJZA 3MRBB 4I77H 3UTSD 2CLZB 4WO4B 1H0DA 2VXUH 4PLJC 5EPMA 1SY6H 1I3UA 1Z9SA 4ZDHA 5T1LB 5ITBH 3QJHB 4ELMB 1H15B 4ISVA 3Q3GB 3GMQA 1CFVH 1UJ3C 1CQKA 4M62H 5F1IA 4D9QE 3DTXB 1MRCH 2I9TB 3G9AB 2VNCA 3GBNL 4X9FA 1CFTB 4F9LC 4PJ8A 3KYOA 2HFFB 5LGHH 4JO4L 1ORQB 2UYLA 1UJ3A 3IS1X 4OZGE 5HHPB 4LAJH 1FIGH 4GAYB 4Y19D 2F54A 4G9DB 4HKBA 1YNLH 2EEBA 5JNYA 1TNNA 1TJIL 2OI9B 4CKVX 3WNOA 4J2XA 2WUCH 3EYOB 4ZQKA 3V7AE 3BKMH 4F9PC 1OTSC 2J6EL 3MGAA 1OL0A 3UDWA 3BP6B 4ZS6D 1WCQA 4LCUA 1GGCL 3AS0A 3VXME 1UZ8A 2BY0A 4MNGB 3ALXA 4UV4L 3GIVB 1PBYA 5SX5K 1JRHL 5D4QA 5I0DA 1FE8H 1CT8A 4WFEE 1JV5B 2NY6C 5LGKA 1MQ8A 1ZHKB 1A7BA 4PLNC 3FCTA 1R3JB 2CO7B 3K3QA 2MWCA 3LQAH 2L7JA 1FFNA 4U1GC 2AVGA 1MFCH 3NN8B 4Z18A 3VFVA 1RZ8B 4CMMB 2R2CA 5D7JC 3MLSH 4MB3A 5KZCD 3DO3A 3EDKA 1WT5C 5DGRA 3BKYH 4MJID 2MNUA 1YECH 2OJZL 3VH8G 2L7UA 4OJFH 1RUKH 1ZV5A 1PYWB 1UG9A 4R96B 4U1HA 1IGIL 1WT5A 3GMRB 1Z2KA 5DD1H 3WHE1 2R2BB 4FFVC 4JANB 4X6DB 5GIRB 5K9OA 1MFBH 1RJYB 3EYVB 4OLXH 3PDGA 3QRGL 4WWKD 4D94A 2AEPL 2X10A 3NCYP 2UY7A 5AD0B 3WS3A 3LEXA 4UB0L 1QSEE 1KCSH 3FB6B 2PTVA 4P2QB 5IR1B 5IMOA 1INQA 4M1GL 2HLAB 3BZFB 4YHKH 1BD2B 5FA3B 4NQCE 5K33A 3DV6A 5GXBB 3DX9B 5FCUL 3TYGH 1UENA 4DGVL 1AI1L 4K3JH 3WFDL 5LVEA 2W0PA 4XCYA 3IJSA 2QQNL 3B8YA 4WFGE 1U91B 1S7SB 5T1MB 5HD8D 2A73B 2ARWA 1K2DB 3GO1L 3O9WC 1H5BC 1H3TA 1A4JB 2BVOA 3MLWL 4IMKC 3D39D 5FDWA 2OQJA 2ZUTA 5MP6L 1NFIA 3O9WA 1H5BA 5C8JA 1AKJB 3WUZA 2R0LH 5F3HA 1YNTB 2R4SH 2QLVB 4C56E 1H8OA 5TE4L 2X2YA 3DUHA 3WN5C 1EUTA 2FR4B 4XH2A 2R1YB 4S1SH 2DQUL 2B5IC 3MJ9H 1QFHA 1RIHH 4K7PX 4QRUA 3Q6FA 3MV9E 4PD4J 3WN5A 3PL6B 5MENB 4PJCB 1UYWH 2DAVA 1DSFL 1FLRL 3INUL 2EH7H 4KI5F 1ONQB 3QFJE 2ZCKH 5CS7A 2VXQL 3V4VL 3U4BL 3GMNB 3TYFB 5DMIH 1DBAH 1QRNB 1T3FA 4PJ7E 2BNUA 2XRAL 3HC3L 5KS9A 5SWZB 1NGPL 5MI0C 1G7QA 4QHUA 4RDQF 1PX3A 4G7VL 3VGBA 2QQKH 1AHWA 2W65B 3ZKSD 2XFXB 5JHLL 4FNLH 5K9QG 1N4XH 5ALBH 3TWCH 4OV5B 3F62A 4TTDC 2HRLA 5KG9A 1XF1A 2OSLB 3EYUH 4RFEB 4BQBA 3JV4B 2PCPB 2VITA 5E2TL 2DIBA 5EU4A 3CH1A 3GSNH 4NN5C 1IAIM 3MLZL 3KYMA 5H2BA 3H0TA 2VQ1A 3UTZA 2BNQA 3IT8D 4KVNL 4UAOC 5JUEH 1IILE 5FGCB 4GRLB 3VCLB 5ESVB 1ZEAL 5EU6A 5BVPL 3O6FD 4PGEA 1CE6A 4N0CC 5KSAB 4Q9QH 2E9JA 4Z0BH 5GGTL 5DRWB 2MHAA 3L7FB 3MYZA 2NY2D 2YEZB 1J1PH 1T83A 4ODVH 4EBQH 4KMTL 3VJ6A 2F5AL 5JZ7C 1KBGH 4F58L 1U8NA 2NQCA 3HE6D 3X3FH 4G3YH 3ULUF 3B9EA 2PF6A 5GJTH 2OTUA 5DD6B 1BZ9A 2NY7H 5MERB 1OSZB 3RWGB 4M93B 1JMZA 1TJGL 1U95A 3QUYD 1J0HA 2NZ9D 2X89D 3OF6D 4O02L 1QLEH 3V5KB 4AH2A 2EECA 1QQDB 2V2TB 1JGDA 3HG1E 5ICZB 3N06B 2BY3A 4PRIE 5DQ9B 5EIIB 1ZKAA 4YFLI 2ICEA 4I18C 4NC1E 4ZG1A 3RWDA 4W6XB 1B6DA 5ICXA 4MCZB 4A6YB 5FM5O 5EOQH 3LN4B 1D5MB 2FHFA 4YE4H 2V2WB 3PP3H 4I18A 2YRZA 2LU7A 1GIGH 2ICCA 2Y25A 3OR7A 3RDTC 5HDQH 1T04B 2CIKB 1RZ7H 5C09D 5J4MA 2CKBB 5D7KE 5FA4B 3O45B 1OTSD 5ESQA 4E41E 4QF1B 2AK4D 2IEPA 2D7PA 5A43C 4BFEA 1JGUL 1YNKL 4ZOCA 5FIEA 1XF2B 1TETH 4NRZB 5HGDA 3RDTA 4HIEB 2NXYB 3VMOA 4EXKA 1FBIH 3L7EB 3EJZD 4I3SH 3RZCA 3RTQB 3T77A 4TVPH 4M03A 3S36L 3KGRA 1OGTA 5CGYC 1D3CA 3C2SA 2EYTA 4X6DE 2A6JB 5L6YL 2WSKA 1AR1D 1AFVH 1OW0C 3PHSA 1XGTA 2NLJA 3D25B 2IBGA 4YXKH 5GGVY 1EFXD 4P2QE 2DTML 4JHWH 3TPKA 1JK8B 4LSSH 1BD2E 4PP1D 1U8QB 2NY3D 4BH7B 1CL7L 1BQUA 4J3SA 3PWUA 1BVKB 4Y16D 2P5WA 1YMMB 2Q3ZA 4MNQD 5KSUA 4FABL 1WAAE 3JV0A 3SKNA 3LQMA 1HNFA 4RGOL 4NO0A 4G8GD 3QPXL 5INDA 5ISZB 2KQNA 2NXZB 1CU4L 3SGEI 1GAFL 1L0YA 1XZ0B 4HFUH 4LLUB 4P4RB 2ZP0T 3U0WH 2BMKB 4X80H 4J12A 4XZUB 3S98A 1IL1A 5DI8B 4IEFB 4M5YL 1WZ1H 5ERWA 2VZOA 3W0WA 4G8EB 5JXAH 2X05A 3ZT7A 2LTQC 5I6XB 4FXKA 4RMVA 1AC6A 3B2VL 4X99B 3BISA 3WNPA 1FNHA 2X41A 5FK9B 3HPLA 5IBUG 5FGBA 4B7IA 4AIOA 4A6YL 5D6CA 3OXSB 1I8KB 2EDYA 2FX7H 4PJCE 3LIZL 2CDEB 3MBXH 3O4OB 1KF9B 4MDIB 3VD5A 4FMFA 4RFOH 5DEZA 2OR9H 5FOBB 2CMRH 2DKSA 3U9PH 4U7MA 4MZ3A 1EO5A 3EFDL 1VGEH 3TVMD 2GTZA 1QRNE 5JLZA 1X7QA 1S5IH 1UM6L 4ESKA 2RBLA 4BELD 4KKBC 4HAFA 4G8FB 3BPNB 3FT4A 1HI6B 3EHBD 2G5RA 3U7YL 1NMAL 4PJDF 1CFQB 4P46C 4OI8A 4JFEB 2Q8BL 1LEKB 2VLMD 5I15H 4U3HA 5LBSL 4ODXA 1S3KH 1MI5A 3EYSH 3VGAB 4OT1H 2XWTA 3X12B 2GFBB 4U6HB 1A3RL 4P5MB 4JFFD 1TCRB 2WZPD 1N59B 3VXSA 2BXYA 5FGCE 3SJVA 4G6KL 5BQ7B 4ZSOB 2M1KA 3HFML 3ARFD 1BMGA 4XP9L 3MXVH 2LQRA 1P2CB 4PJAF 2B0SL 4HWNA 3ULSB 1G7JA 4FQLL 5FUOL 3I3DA 3GI8H 2FWOA 4HUNB 5D5MA 4CNIB 4Y4FD 2D7QA 1A22B 1KJVB 4J1UA 2F53E 3K81A 2XTJC 5IW1A 2VAAA 3O11A 5F7NC 1FVEB 4Y4HD 4FMKA 2HH0H 4NUGL 1AD0A 2VWEE 3KPRA 4U6YA 3T0EC 4QKXB 1ZT4B 1OF2B 1FAKT 3G6DH 5ESAB 2HT4C 4TNWK 4XGZA 5CZVL 4F7PA 1D6VL 4G6JL 5JZ7D 4KJQC 3T0EA 2XWJB 1FGNL 1QR1B 1AXTL 3ARED 5I1LB 3TNNB 3X13A 4XP5L 4HMDA 4M7LT 4IIQC 3RVXC 5T3ZH 3IFOA 4NSKB 4WW1A 2HJLB 3KG5A 4XC1H 3C6LA 5AYUL 4WW2C 4NRXA 5C07A 2VLRD 3KPPB 3D5OF 1BZQK 1ORSA 3K1DA 4PJBF 3ZKMC 2HKFL 4U3CA 1LEGA 2QSCH 1ES0A 2XIDA 4BUGA 4AEFA 1CXIA 3JWDC 2K9UA 3RGVB 3I75A 5JIIA 2EE3A 4HXAL 4AG4L 2HFEB 4FQXB 1NCCH 3CXDL 5C9KA 3MRCA 4GBXB 5IM7A 1A6UL 3WD5L 3QCUH 4BK5A 5GS0D 5HDLA 2DIAA 3TIDA 4K94C 1WK0A 4CJ0A 1YJDL 2AQ2A 5BZDA 3WS6C 1IKFL 2E27H 5EC2A 1P7QB 2WBJB 4HS8H 1HH9B 4H5SB 4DK6A 3VFPA 4YQXL 3Q1SL 2JKXA 2VLJB 3QIUD 1OVZA 1NC2A 4FG6C 4L29A 4DW2H 3IJYA 1F90H 3QXAA 5JDSA 2XZQH 5E00B 1MAJA 1ZMYA 2PW2B 2IPKB 1NBVH 2HFTA 3NA4A 3CK0L 1N7ML 1XGPB 5BRZB 1FH5H 3QDJB 1A5FL 4DGIH 5ISZE 4NQVB 2JB6A 4ZFFA 1CWVA 1CFBA 1SJEA 5ANMA 2J8OA 1E28B 3QQ4A 2ARJA 5F6HI 4OGAD 4LOUC 3MLXL 1HQ4B 4KRPD 4LFHG 4DN4H 3LMJH 4ELKA 1A6WH 4BM7A 1TLKA 3VFTA 4BFIA 1Q9KA 4JCLA 3PWJB 4RZCB 3C6SA 1D9KD 4NWUH 3RWJB 3BE1L 1HILB 1X4ZA 3UZEA 5E03A 1I9EA 4JFPA 4U7KA 5I1EH 2NNAB 1A7PL 3MRIB 4H20L 5I8KL 3HLAA 5HJ3B 3FQXA 43CAB 4XWOC 3PGDA 3CNKA 3CMOL 3OKNA 5IMMB 5FGRA 2FYYA 4L4TA 3MMEA 1DTUA 4OGXL 5EN2B 3I84A 1RK0B 3MRLB 3RHWK 3AGVA 3UAJD 3O2WH 2NY0D 4O4YL 3G5VA 1MQKH 1RAMA 4KUZH 2B4CH 3BHBA 4HS6B 4F37F 1LP9F 3MBEB 2W9EH 4X4YA 1P4LA 3QUXD 3FRUA 5E8PA 4ZYKA 3O2VH 3RX8A 1SEQH 1ZVHA 1SEBB 5TPWH 4DQOL 4Z6AT 1KJ2L 1EBAA 1F02I 4YC2C 2IFFL 3BWAA 3TZVD 5DMKB 1UH2A 4JFEE 3LEVH 5K9JL 3HAEA 5C3LD 3OXRB 1LEIA 3KPOA 3P30L 2Z93A 4P5KA 1CCZA 1V7MH 2GK0B 2VC2H 4JY5L 1A6TB 3TN0D 3OG4B 3CLEH 5ITFB 4EXPX 2NW2A 3RVUC 5CEYB 4KKBD 4ZSOE 5GGSA 2PYEA 2JELL 2X40A 3VXUE 1T7ZA 4HV8B 2CO6B 2GW5A 4OLUL 2CK0L 2XKSA 2NY4C 1HSAB 4NBYB 2HVKB 2FIKA 1EX0A 5K9KA 1T2XA 3JV6A 4P23D 3C2AH 5E8NB 4JRYE 3RWIA 1KJMB 2F8VA 2O5YL 2LFGA 5JHDB 1S9XA 4J4PA 3U30C 3L3OA 3SKJL 3QCVH 5BMFL 1AQKL 2X1PA 2YSSA 2VDRH 2BSTA 5F3BA 4Z77A 3BZEA 1L7IL 1BQLL 2FD6H 1KIQB 3CSPA 1KIRA 4PRAA 1Q1JH 1IQDA 4OCYH 5E5RB 5AYQA 1RMFL 3SE3C 3EDJA 3PABA 3RNQB 5B3JE 4LF3A 2EKJA 3QO1B 1S7QB 4TUJA 4XMPH 4EDWL 3SE3A 1UFUA 5C0GB 2V7NA 1TZGL 3W9EB 3BW9B 1AO7D 3U2SA 4NYLB 1EK3A 2VISA 1CXKA 5HI4D 1G7HA 3G04A 5JW4N 3U82B 4WV1B 2RGSA 4UDTB 1MWAL 5E9DE 5IEHA 3T2NH 4LSRH 3C5ZC 4XI5C 1OD9A 4NO2B 4I48A 1MCOH 3D3VA 1KN2H 1I1FA 1UKTA 5EZJB 1JPSH 1BZ7B 2JTDA 3V6OE 3C5ZA 1KC5L 4K8RC 5DYOA 2OJEA 5DT1H 2B2XH 5CSZB 4ZTOL 3FAWA 3RWHB 3HUJE 1VGKA 2JCCE 1R3HA 3T65A 4BQ6A 1ETZA 2P8PB 5D9SB 1MHEA 4OLZL 1W0WA 3C09B 3WFCL 4HFWB 4HWBA 1X4XA 4MJ5A 1KENL 3EYFA 1EV2E 1ZLUK 1I8LA 4FZ8H 4WHTA 1CD1B 2D3VA 1RJZA 3UTTD 4FFYL 3QDGA 4UU9A 2EDKA 4NKIH 5L2KE 1FVDB 5LWYH 2YPLA 4M1DL 3ZSTA 4DN3L 1D6EA 2PW1A 5A16B 4BSVA 5AEAA 3OAYK 3OKDA 3S4SB 4ZO7A 2N1KA 2K7PA 5HYQA 1YEHL 3B6SB 4NC2B 3KJ4B 2Y36L 1N2RA 1FC2D 3F7VA 3L3JB 4LLDA 5I76B 5DJCB 1KG0B 2YUVA 4NNYB 1QP1A 2J4WL 5J12C 1MRDH 1XAUA 1YY8A 4I0CC 4DUWA 4V1DB 3MYJA 4KY1L 2CLVA 3TH4T 5GISL 5TH2B 1CQYA 3DX6A 2FL5B 1UA6H 4PREA 2W91A 5DJDB 4WHDA 4JPVH 1W0VB 4N68A 1U9KA 5JPNA 4UOW0 3HZKA 1BLNB 3MNZA 8CGTA 1IGFL 3U6RB 4NRYB 4GXUM 2ATKB 4BZ1L 5HSFA 1RZJH 3V5HA 1I85C 4RDQG 1OSPL 3CX5K 5D8JL 5DQJA 3V0VA 5J57B 5LQBH 3IKCB 2E7CA 5GS1B 1ZXQA 4RX4A 1P4IL 3Q6GH 4NFBA 1I85A 4LEXH 4CVXA 1T2QH 1RUMH 1IKNC 2BNRD 3SDDD 4KROB 4ZFOA 4J3UA 1R3KB 4MVBD 4R4FL 3QEQA 4R3SB 1ZT7A 2PO6C 1AY1H 3HZYB 2VIRB 3UC0H 4PJ5D 5IEKA 5FM8A 1CICC 2RR3A 3CDGB 1XH3B 2FGWL 4RQQB 3CVIL 4JFDD 1IKNA 2FX9H 4K23H 4GG8A 1SM3L 3KLHD 1MFDL 3EKCA 5D2NE 3CFJB 3GJEA 3WNLA 1DR9A 2DQFB 1XFPA 4P3CL 4N8VA 5E99L 3EOTH 5DZLA 4JM4L 1H3PH 3RP1A 3CUPA 3V95A 1BEYH 5IVXB 1IC4L 4MQ7A 2PTUA 3GKZA 4K3DH 4QRRA 5AG9A 3KR3L 1AGCB 1KIPA 2YK1L 1CLZL 1D5ZB 4PLOB 5E6ID 4PB0L 2FHBA 1F4YL 2VXSH 5KOVC 4X4XB 4Q7DA 4DOHB 1IZKA 5DJ0B 3FQWB 5JHDE 5JR1L 5KN5B 1KEGH 1BREA 5CCKL 4HGKC 4LCCB 4Y4KB 4EN3C 5GGQH 5J06A 5MEPB 4POUB 1B0WA 2WANA 5L88L 3QUMA 5E94B 4C4KO 2ZCLL 5SWQB 1MJJB 1BM3H 4HZLB 3WLBA 3RBGA 4OZGA 1DFBH 5HHMB 1QFPA 4OZHF 1O7SA 2OZ4H 5CIPB 4CJ1A 1PW3A 4TVPD 1I7TB 3VFMA 5IGXH 3BD3A 2YR3A 2IAND 1HHIA 2DQGH 1PZ5B 1OY3B 4XCEB 5DUML 3STLA 1QHOA 4N8CL 4NZTH 1CGSH 2DI7A 4NGHL 4U1JB 3P2TA 2X4NA 3V0WH 1JNHA 4LVNC 1JP5A 4QRPB 1JHLL 2FJGA 2GY7B 5F96H 1XF5B 2IH3A 1INDL 5ILTL 3PJSB 2R69L 1G7IA 4HUWB 4WDIB 1MJ8L 5GZND 2HTLC 3G5XA 4O2FB 1A7RH 2HMID 4GO6B 4JR9L 1PLGL 1LNUB 5LKNA 1F11A 2E6PA 3GJFH 1XGYH 2R9HC 1NUDA 5DQDH 4LEOB 2XICA 2UWEA 1BGXL 1T03L 1D5BB 4H8WL 1J8HA 4EUPB 4KQ4L 5C0ND 4OM1L 4GW1A 4RIRB 2AJUH 1HXYB 3SEPA 4JM2F 2J2ZA 4ZOEA 1XCQA 2CDFA 1SYVA 1I1AB 2HWZL 3MJ8B 4XI5D 3OKMA 4GW5A 1OAQL 2FJHA 3GGWA 1I8IA 1UKSA 3IYLW 5D7LB 1AXSB 2IBZY 3UJTL 3QEGH 5F6HJ 1QSEA 4YHPB 4QRQB 5EUKB 4ODHH 3CLFL 4MD5B 4DVRH 2KDGA 4N0UB 1VKXA 3WHXB 4NQCA 4LCYB 3SDYL 4ZOBA 4LBEA 3GHBH 4LARL 1AGBB 5J6GA 2FJFA 2X7LA 5JW3L 4WJ5A 5F7EL 4JHBA 4Z7VE 5LAXA 5F7YC 4CVZA 3BJ91 2ICWI 1T1WA 4JY6B 4NQDB 3B5TA 1NLDL 3RWCB 3DI3B 1AGEA 4HH9A 3MRNA 4PJIA 1LK2B 4OB5L 1C1EH 1E4XH 1NC4B 3SPVB 3QIBC 3U0TA 2DN7A 3RL1A 3M17A 5DJZA 5I1KL 1LO2H 4KJPD 2VOTA 2AJZB 5C0AA 3QIBA 5TDNB 4C56A 1LWRA 3A6CH 1ZE3C 2AABH 5FO9B 1N5AA 1FVCA 3O3DB 5CINH 3TNMB 1K8DB 5CBEA 3QI9B 4HF5H 3LN5B 4HIHA 4KV5F 4U2ZA 5I1CH 4M48L 1CGUA 4MNHB 1T2JA 1W72H 1FQ9C 3PWVA 1KT2B 1NLBH 1RJLA 2BHZA 1YN7B 2QSVA 1BP3B 1RHHB 2VLLA 3NAAH 3STZB 5GGUB 3OL2A 4K7PH 1F4WH 2Y06L 1IAIH 4M62L 1I3RB 1FZMA 2ZUXA 5EG6C 3EDDA 2C3VA 3MR9A 1JPFA 4JG1H 5D2LA 4M4RA 1MCCA 1JHKH 1KOAA 4JFYB 3LKOA 1FIGL 2VABB 4YK4B 2Z8VC 3B3IA 4Z7UA 1FORL 3GSUA 3NIDE 1FHGA 3VU2A 4JFZH 1XR9B 3BKML 4QOKA 4Y5YB 1J0JA 3BN3B 1LD9B 3LZFH 2PO6D 2BHYA 5IVXE 3BGFB 5A2LH 1NL0H 1FE8L 2CLZA 4OLWL 4LRIC 4WO4A 1C7TA 4YHYB 4RISH 5T3ZD 3A6BH 3GK8L 4UV7H 4X5XB 5T1LA 3I6GA 3LQAL 3QJHA 4OFYD 5ID1B 4ELMA 1H15A 3PWPB 4M43H 3BPCB 2EDWA 4YEEA 5EBLB 4MA8H 2WAHA 3DTXA 4LCIH 3WFEL 2H2SD 4Y2DD 2I9TA 1T7WA 2IC2A 3HR5A 4QHNB 1CFTA 3CH8A 1QKZH 1YC7A 2HFFA 4O9HH 1ORQA 1YECL 3ALPA 3ZMRA 4GAYA 1M6OB 1RUKL 5I1HL 3C60B 4JZJC 4YZFE 2VJXA 5J13B 2HAZA 3TP4A 4EDXB 3EYOA 2ZCHL 5DD1L 4PJ7F 4PJEB 3BP6A 4QRPE 5B8CB 4MNGA 3FHQA 4MGXA 1KCSL 2XN9B 5FV2A 3MXWH 1SHMA 2LAGB 4I5BB 1JV5A 3F7RA 5L0QB 1KACB 4UNUA 2EDRA 2BY2A 2GHWB 4NCC2 3WFHB 4FN0A 1JFQL 3H42L 1JF1A 1KUMA 3ORJA 3NN8A 4GXUN 4K3JL 1RZ8A 4MXQC 4CMMA 4KI5C 2A77H 3T08A 2VN7A 5F88B 4OCWL 2ZWLT 4X8JB 3QWRA 3M8OL 3KPNB 3CFEB 5DHYB 4ERSL 4Q6IB 2YMXH 2MPAH 5B22A 3B9KC 2EDOA 4U33A 4G9FB 5AWNL 4PRHB 1OWWA 1F4XL 1PYWA 4R96A 1IVLA 3GMRA 4PRPB 5DLML 3GSVB 2MKWA 2R2BA 4JANA 5GIRA 1RJYA 3EYVA 4NM8L 4MCYB 5D1XC 5EOTB 4LFHD 4S1QH 3VI4E 4OCLC 3SDCC 1T80A 5AD0A 3FB6A 4P2QA 5IR1A 4IMLB 2HLAA 3BZFA 2IFGA 3EZ8A 4N0UE 5FA3A 2YZ8A 4ETQB 3DX9A 3SDCA 4J3XA 3AMLA 1DVFB 3RHWF 3MRJA 4YXHH 1F97A 5T1DH 3ARRA 5D7SL 5C0RH 1IGYB 1S7SA 1MIEH 5J8OA 1A4JA 4C58B 4MQSB 4BZYA 3I02B 3OMZA 3ULUC 5CSBA 4FTVB 3HS0B 3VWKB 4XPHL 2DQTH 2H2PD 4FNLL 1AKJA 4BUHA 1WFUA 4JRWA 1HHKB 2QQLL 1YNTA 4OM0H 4CU7A 5J3HD 3EYUL 3CCHB 3R0NA 12E8L 4QXUH 2O5ZH 5FDYA 1PX4A 4NQEB 4LSQH 3GSNL 2R1YA 3MV8B 3RVWC 4DWHA 4HKZB 1JZ5A 3WO4C 3DHMA 3TA3D 3CVHB 3FTGB 4M6NH 1DBMH 3AY4C 3PL6A 1QACA 4PJCA 5MENA 3IXAB 1S9YB 3REWB 3AS1A 4X6DF 2HKHL 4K2UH 1OTUC 5B38B 4RWYH 1B6UA 2JB5L 4Q9QL 1ONQA 1NAMB 1QVOB 5D7IE 4OCSL 3WHE0 3DV4B 2E7BA 3GMNA 3TYFA 3ARBC 4MZ2A 3AY4A 4MX7B 5MHSD 3B4NA 5SX5H 2IQ9L 5SWZA 3WIIH 4U0QB 4JB9L 2DQDH 4G5ZH 2W65A 3B2UC 4EEEA 2XFXA 3QIWC 1WAAF 4XCFH 4U0RC 1LO5B 4OV5A 5IFHH 1DEEB 1WBZB 4HCRL 2OSLA 5EORL 1KB9K 3T4AB 3LKQB 4HS3B 2YD6A 4OQTA 3JV4A 2PCPA 3QIWA 4HUMB 4I0PD 4NO5B 4NDMB 2VSDA 4PUBL 1JPTL 3EW3B 4JKPH 2OXHA 2BVTA 4ZUUB 3HRZB 4LSUH 1KCRH 3JUYA 1FCCA 4GRLA 3VCLA 4DTGL 3RWEB 5ESVA 3W11C 3LS5H 3S3JA 4L4VD 3VXNB 1DBJH 2X4TB 3WKMH 1INEH 1GIGL 4PJHB 5HDBF 2ITDA 5DRWA 5SWSA 3L7FA 5CAYB 2VDOH 2YEZA 3PWPE 3ARDD 5C0IB 5HDQL 1RZ7L 2CRZA 1OP9A 2GJ6E 3BYYA 3FB8B 2AGJL 5I9QC 1FL5B 1YEEL 4PJ8D 3IKKA 2CQVA 4G7YH 1Z9OA 2GK2A 3LV3B 3HAEG 1M71B 5MERA 1RIUL 3RWGA 2F54D 1BJ8A 4GG6E 3V5KA 1NFDB 5C0JA 15C8H 1G9ML 1QQDA 2V2TA 5ADPL 4F33B 3UPRA 4PJEE 4PJFE 5ICZA 4M7LH 1IT9L 4YAQB 5DQ9A 5EIIA 4AMKH 1DN2A 2VZ1A 3PUCA 3QRFM 3BAEL 3QDMB 2XN9E 2N56A 4KVCH 3VFNB 3C08L 4JHWL 1IGTB 4LSSL 4MCZA 4A6YA 5T3XE 4KKNA 4PPTA 5KAQG 3LN4A 1C08B 2ZNXA 1D5MA 4IRSD 2V2WA 1K3IA 2CD0A 2VDKH 2KH2B 4LSTH 3REVB 1X4YA 3OJMB 2VKWA 4PGCB 5BV7B 3DJ9A 4AL8H 1T04A 2CIKA 2CKBA 5FA4A 2OXGA 4XC3H 1DQTA 2B7DT 5D1ZB 1BBDL 1VA9A 2JJTA 1XF2A 3DYOA 4P2OB 4NRZA 3QEHB 1TQBC 2ED8A 1FYHB 1U8OB 5E4EB 3WIHA 3U0WL 3RTQA 1OAXH 1E4XI 1HCFX 3P0GB 3GUTB 1WFNA 4JE4B 2VLKD 5JXAL 3HPJB 4XNXL 2ICWJ 4MXQD 4Q2ZB 1JNLH 2X4RA 1GC1C 2G5BB 3D25A 4MA1B 5E6ZA 4Q97A 1FNSH 1QD0A 4I0KA 5E2UH 1DLFH 5CD5C 1JK8A 4QTIH 1A7OL 3RY6A 1U8QA 3VD9A 4L5FH 2QR0B 1CGVA 3EZJB 4U1SB 1YMMA 2F74B 3MTRA 3OKKA 2NXZC 4HPOH 4XXDA 2OR9L 2CMRL 3VFGH 5EIQA 4OZIB 2LU4A 4HZAA 1EVUA 2O5XL 4OFDA 4JKMA 5IQ9A 5ISZA 3WDHA 1OGAB 4NFCA 3H2WA 1A6ZB 2XXMB 1IAII 1RQ5A 4ZO8A 2DYPD 4FTVE 4KI1A 5EO1A 1ACYL 4LLUA 4P4RA 1LO3L 2R0WH 2BMKA 1U6AH 4PS4L 3O3BB 4CVWA 4XZUA 2BVEA 4KJYA 5DI8A 4R26H 4G8EA 1JI1A 4A2LA 5I15L 3KXFB 1P84K 1S3KL 4NQEE 4X99A 1MRFH 3EYSL 5DZOA 4OT1L 5FK9A 3SGDH 3MV8E 5B21A 1U3HC 1FO0L 4HWEL 4WUUB 1I8KA 2DWDB 1I9IL 1NUFA 2QQQA 2CDEA 5E1HB 5CJOH 2H32B 3DRTB 4MDIA 5I1IH 4DKEH 3WXVH 1HK6A 5E4IA 1NBYB 4MJIB 3DNKA 5FOBA 3WSQH 1NGQH 3BVNB 2JJSA 1JF5A 3MLUH 1RUAL 4HT1L 1JYXA 4FQCL 4YDJB 2PN5A 4ALAL 2XNAB 5I74B 1UACH 3BQUC 3C5SB 1FNLA 3RU8H 4WWKB 3LS4H 4G8FA 4CN4A 4Z7NE 3OQ3B 2R56H 1JNNL 1EJOH 3VGAC 1HI6A 1X5GA 5JXEC 2MOVA 5IVNA 1CFQA 1OTUD 1CYGA 2EC9T 4JFEA 5T1KB 5GS2D 1LEKA 4OGZA 2RHEA 5H8DA 5IBLD 5JXEA 3AFLA 3X12A 2A6IB 1OAYL 4ONHB 2GFBA 4U6HA 1QO3B 5JPMB 1ZT1B 3H3PH 4H0IA 1DP0A 3K0WA 2FIRT 3MA9H 5BQ7A 4ZSOA 1LDPH 3QHZH 3UJJH 1UWXK 4RGNE 5MEOB 2X4PB 4XC1L 1P2CA 5DD5H 3ULSA 2HYMA 3AM8C 4CW1B 1R0AH 2YD2A 4FQ1H 2ADIB 1H3XA 4CNIA 1QFWL 5EWIL 4X6FB 4LNVA 3Q5OA 1ZTXH 1B9ZA 4ODTL 2WK2A 1KJVA 2FDBP 4UINL 1EAJA 1UH3A 1YPZB 5EU7C 1FVEA 4DZBB 4KKCD 1R24B 5IF0B 5BVJB 4PYGA 4M61B 4LSVH 3HI5L 3MRGB 2GIYA 4N8VG 1NFDE 1UJTA 2GITB 3W11D 1ZT4A 1JYWA 1OF2A 3RNKB 5ESAA 2E27L 4HS8L 1QYGH 2W9LA 4ZXBB 5CUSH 4IOSD 1BIIB 4KHXL 4AYFA 2XWJA 1YEKH 3QDME 4NFDA 1QR1A 5I1LA 1K9TA 3TNNA 3TH2T 3KJ6H 2W9DL 2CIIB 4NSKA 2HJLA 5IB2B 1QEWB 1AP2B 1CVRA 4MHHG 2C1OB 1NBVL 5C0CE 1IGMH 4APQC 3ZYIA 1B4JL 2ZUQB 4UT7H 3WJJA 1FH5L 2DICA 1IC5H 1T21B 5GGRB 1FL3B 1OAUH 3RGVA 1CGYA 4Z95H 2NX5B 2HFEA 2IG2L 4WGVB 3T1WA 1S7UB 3MSPA 3H9SD 4POZD 3V6OA 1MPAH 3LRSB 2FATH 4DZ8B 3RZCD 2ZNWA 2JJVA 1ZSDB 1P4BH 5J7CC 4JN1L 3S97C 3LMJL 2EDHA 1P7QA 1KYOJ 2WBJA 2FBJH 1W2KT 1HH9A 4H5SA 1A7QL 5HYJB 1ZHLB 2VLJA 3ECBB 4ONFH 4K07A 2NY2B 4J3WA 2C3HA 5I1EL 3DSFH 2HFGH 5IP4A 3QZWA 1TTGA 4L1HA 4G6MH 5J11B 1DQDH 5E00A 3HE6B 4XXCC 4DUXA 1JGLH 1TVHA 2UY6A 2PW2A 1U8MB 2IPKA 1GOFA 1XGPA 4OZIE 5BRZA 5TE7L 1RZIB 3QDJA 4NO0D 4H26B 4KUZL 4ZFGL 2B4CL 1OGAE 1FZOB 1X5ZA 3Q5TA 2WBKA 2W9EL 4D8PB 1CXHA 4HAGA 3VG9C 1E28A 4HUVB 1EO8H 3O2VL 1BAFL 1LK3L 5D93C 4FQ2L 1KELL 5DD3H 5IK3B 4C83B 3CJJA 4KJWD 4JAMB 4HKBB 3I50L 1N26A 1HQ4A 1RK1B 3QT2A 4IDJH 1ZHNB 4QGTA 4ZOAA 3U36B 3KXFE 4RZCA 3PWJA 5EZIL 2AXHA 4KDVA 1CR9H 2FSEB 3FT2B 3RWJA 3WUWB 1F6AB 1HILA 4ODSH 1V7ML 3DYPA 2YPVL 5I66A 3L5IA 1LQSR 3CLEL 2NNAA 4WUUE 2W1NA 5DSCB 3S3PA 3HUJF 3MRIA 5INCA 2AK4B 2JCCF 3BX7C 5HJ3A 43CAA 1QSFA 2VZVA 3SY0B 4ODBD 5HYIA 5KOMC 2WIIA 5CJXA 5IMMA 1HSBB 2FEDD 5EN2A 3MRLA 4DVBB 3MOBH 3C2AL 4UUJB 1Z5LB 3QNYB 4HS6A 3MBEA 3QCVL 1U36A 1U3HD 3GSQB 4JO4H 2WWMD 1CDGA 5D7JB 5IFAH 1GOHA 1EFXB 1EO7A 2GUOB 5DMKA 1TJIH 4MAYC 3QBTB 2DQCL 1A2YB 7FABL 2J6EH 3OXRA 5DHVH 4PJXE 1MI5D 4GQ9L 1Z3GL 2QHRL 4MNQB 2GK0A 1GGCH 1A6TA 4XMPL 2ITCA 3RAJL 5ITFA 4JGUA 3DX8B 2B1HL 3ALWA 5CEYA 1A1NA 1XEDA 3EBAA 4G8GB 1TPXC 5L2JB 3O4LD 1HSAA 1B2WH 1FPTL 2HVKA 2J8UF 3GEWB 5ECJE 1KJMA 1RUPH 1U8PB 4AZ8A 3NPSB 1V05A 3WXWL 2X1QA 4OLEA 3V4PL 1UWEH 2Z8SA 3HE7C 4NC0B 3R1GL 5E5MB 35C8L 2OJZH 3KPRD 2A74B 4Z8FL 1KIQA 3RVTD 1YMHB 2B2XL 4R90L 5C8JB 5L8JB 4S1RL 3EAKA 5CBAB 5DJAB 3HE7A 4OTXL 3L3DB 1L7TL 3RNQA 4K9EC 2CPCA 2X09A 1R5VB 5GSVB 4HXBL 3HMWH 1QBML 1L6ZA 5I17B 1KV3A 3MX0A 1QFUH 1Y6NR 1FYTB 4M1GH 3W9EA 4XAKD 1HYSC 3BW9A 4QRUB 1VPOH 5FYJL 1KNOB 4NYLA 3NZ8B 4WCYL 4GXVL 3ZKND 5IWLC 2B5IB 2VDLL 3B83A 4WV1A 3C6LD 4DGVH 1AI1H 4HIJB 5CP3A 3AAZB 4UDTA 3W39B 3WFDH 2I26N 2QQNH 2Z35B 2CR6A 3BUYB 4NO2A 3MO1B 5IWLA 4P4KC 2NX5E 5EZJA 1BZ7A 3MLWH 4QHUB 3C09C 1A21A 1J9CT 5CSZA 3T0AA 3RWHA 1CDHA 1RU9L 4LVOB 4JPVL 3NFPB 4P4KA 3M45A 2P8PA 4JFFB 5HHNB 5BZWB 5MI0B 2NY5C 5D9SA 1RIVL 5TF1L 4UOJA 4HFWA 5TE4H 3ARFB 5HYJE 1RZJL 1CD1A 2VZ3A 1NC2D 5H2BB 3TFKC 1FVDA 2BNQB 1I75A 3SGDI 4Y4FB 1J12A 3BT2L 5A16A 1GL4B 4I3GA 4N1EA 3IU3B 3IAGC 5I1DB 4NN5B 3S4SA 3W2DL 1DSFH 3OZ9H 4Y4HB 3B6SA 2P47B 1JYVA 3K8LA 3V4VH 3U4BH 4UAOB 3L3JA 3D69B 5I76A 4Z7OF 1KG0A 1U8NB 4JRXD 5DJ8A 1NCNA 4HEPG 1SVCP 4V1DA 3UC0L 2OTUB 2QKIB 3Q2CA 4G7VH 4NZJA 4QXWA 2FX9L 4KHTL 1QBLL 2FL5A 5DJDA 5E8DL 4Y8DC 3FO2B 1W0VA 1R5IB 4JVWA 5HGHB 2BK8A 1WZLA 3OKEB 1BLNA 5GS1C 2XPGB 1J86A 3U6RA 5E2TH 4NRYA 4Q0XL 3TGXA 3CPLB 3MLZH 1F5WA 3ARYA 3EOTL 4WFFD 3LN9A 2VLRB 4PBVC 1H3PL 3RWDB 4O2EA 3IKCA 2LVCA 5GS1A 3DGCR 1CLCA 5HPMB 3VRJB 4R4NC 4KROC 5BS0B 4S10A 5BVPH 5FYJE 4XHQA 5GGTH 1FLTX 2VE6A 4LGPB 4KMTH 1TZIB 2F5AH 5J0BA 5DC0A 1R3KA 1CIUA 3T1FB 3BRGC 3HZYA 2VIRA 1TVBB 3CDGA 1XH3A 4RQQA 3VFOA 5GGQL 3CMGA 2CLRB 4MYWB 3L3GB 2IAMD 1TJGH 4HJ0D 4HW6A 4WI2A 2XY2A 5IT2L 5DD0L 1DFBL 4D9RD 4Z7VF 1CDCA 4JPKL 5DRXB 1VFOA 5IROC 2VZTA 2BJML 2BOBA 1CZ8L 4XVJH 1UH4A 2GI7A 5GRVL 3X3GH 3EJJX 1HH6B 3M07A 5IVXA 5EH1A 5IROA 3HR6A 1OCWH 5CMAB 1D5ZA 5F7UA 3FZUD 4XMKH 8FABB 3OKOB 3V9FA 4X4XA 3TBWB 1ZLUH 4MAYD 1QLRB 2ILLA 4LLYA 3FQWA 3RFZC 3DXAB 5KN5A 4MHHI 2FLBT 2YHGA 1Q9OB 4FP8H 4J4PD 4B41A 1YNKH 4LCCA 4Y4KA 4KUCD 5IESL 1PG7L 3OAYH 2R29L 5MEPA 4GW4B 2APBA 5DQDL 5E94A 5SWQA 1MJJA 4NNXB 2CXKA 4X8XA 4HZLA 3S36H 4S1DC 3U4AA 5CP7B 2X4OB 4J3OC 5I2IB 3FKUS 3DURA 1I7TA 4LASL 1EHXA 1I7RB 3LAFA 3K80A 1CFSB 5L6YH 4XCEA 1PZ5A 2VMFA 1RZKH 4K71B 4U1JA 3G5ZB 4WFHD 2DTMH 1FYTE 4QRPA 2LTQB 2NY0B 1XF5A 2BFVH 4FQJL 2P5EB 1CL7H 3TF7C 2I27N 3PJSA 4ODHL 5IQ7H 4HUWA 3NIDF 3QUXB 2FECI 2IPTH 1G6VK 4JVPA 1BOGB 1EZVX 5D6DA 1ZLVK 4O2FA 1ZLSL 5EUOB 4I8DA 4RGOH 1X7QB 1LNUA 1V5JA 3D3VD 4L3CB 3QPXH 1CU4H 5JW5B 1YEFL 1U8HB 4WGWB 4LEOA 3UBXB 3QQ3B 4X9IA 3TN0B 4CBPA 3MCLL 1D5BA 1U8KB 4M5YH 3ULVC 4EUPA 4WU5A 1LO2L 4JFOB 3L3IB 4RIRA 1C5CL 4XVUC 1WWAX 1OTTD 3L1OH 1CE1H 4PJGF 2BP3A 3MJ8A 3A6CL 2AABL 1DBKL 3SE8L 3QDGD 2BNQE 3LB6C 5D7LA 4A6YH 1VDGA 1AXSA 4P46B 2YPLD 2VDML 4YHPA 4L8BB 4QRQA 4HF5L 5EUKA 1R3IL 3LIZH 2YRPA 4MD5A 4OV6F 5EU6E 1PKQB 4N0UA 2MFNA 3WHXA 4YZFF 4LCYA 2C4XA 3RI5K 5HI5C 2JJWA 4GRWB 5HI3C 4XMLL 1JWSB 1AGBA 1M7DA 3EFDH 4YHLL 1GSMA 1Q9WA 2FWOB 2R1WB 5E24E 4MJ6B 4JY6A 4K7PL 4NQDA 1FL6B 3TBVB 3RWCA 3DLQR 1J5OL 3O11B 3SDAC 2DIJA 4O58L 1LK2A 1AD0B 4IRJD 3S34L 1NC4A 1YY9D 3SPVA 4U6YB 1JHKL 2R23B 3U7YH 5KVEL 1NMAH 3CIQA 1X9QA 3O0RL 1S7VB 2Q8BH 1AO7B 5LGJB 1UT9A 5A3IC 4JFZL 2AJZA 5TDNA 2DJ4A 4X4MA 3I3BA 3O3DA 5TJWK 4GJTB 1A3RH 4HIIB 1K8DA 4G8IB 3UCRA 4J23A 4X5WB 3QI9A 3LN5A 3FHAA 4G6KH 5BS0E 1JRHI 3HFMH 3KPSD 4WW1B 4XP9H 4MNHA 2ZG3A 3DVIA 2B0SH 3UJIL 1PAMA 4U1LB 5KJRH 4FQLH 1CDIA 5FUOH 1KT2A 1YN7A 4IIQB 1NCWH 1RHHA 3G6JB 1LEGB 3BP5B 3IFPB 3VI4F 3STZA 5GGUA 4BSWA 4K3HA 1UWGH 3QEQD 1EGJA 1WLHA 1MELA 1I3RA 1ZS8B 4YK4C 4EI5D 4WW2B 4LCIL 1IEHA 4KKLC 3WL9A 1PSKH 4JZOB 4MAUL 4JFYA 3TIDB 4LCWB 2JF1A 2P44B 2PR4H 1WISA 4U1MB 3BGFC 1XR9A 3L5XH 3NCFB 3WBDA 1D6VH 1R5WA 3K4DA 3QG6B 4G6JH 3DWTA 3MUZ1 4Y5YA 5HGBB 1MCWM 2YBRB 3KHOA 1LD9A 1GHFL 4QRRD 2FX8L 3QSKB 2E7MA 4X0KB 3MRKB 5AZEL 5EC1B 2P5WE 1T6WA 4X5XA 2P4AB 3T2QA 2NYYC 3DXAE 1NJ9B 2R1XB 1TNMA 5TDOB 1AGFA 1XGQB 3BPCA 5DJ2B 5EBLA 4JM2D 2P43B 4D9QD 3C60C 4QHNA 2J12B 5J13C 3BSZL 2JIXB 1SJEB 3WD5H 2AAVA 3OJDB 3JSSA 4MS8C 3LDBB 4PFEA 1YJDH 3JBG7 4R7NB 1M6OA 3W0WE 7CGTA 3C60A 5D7IF 1IKFH 4ELKB 3GSWA 3VFTB 4EDXA 4PG2A 4YQXH 3QH3B 2BVYA 2ZSVB 3Q1SH 4PJEA 4JO2L 5L0QC 4HKXB 4UTAL 5B8CA 2VDQH 3VXMD 5E8EA 4X7EC 2XN9A 2DLEA 2P5EE 5J6HB 3I85A 4KFZC 2XG5A 4I5BA 4WFED 4PJ5B 2YZ1A 4L4JA 4R8WL 1JUFB 3WFHA 3CK0H 4KXZH 3QXUA 5EUOE 4Q6IC 3G5VB 3P73B 2C7UB 3UPAA 1MIML 4JPIB 3S8WA 4X8JA 3BHBB 4EQ3A 3MROB 4ZAKC 3FRUB 4URTB 2EDJA 3JWDL 3KPNA 3CFEA 5DHYA 2UV3A 4Q6IA 4RGMC 1EIBA 1BJMA 4G9FA 4PRHA 3MLXH 5DTFB 1YYML 1C12B 5KVFL 1AD9B 4PRPA 4U6VH 4OM0L 1C5BH 3GSVA 4K94L 3C9NA 4B50A 5E6IB 4QHMB 5J89A 1J1XH 3BE1H 4P5KB 4MCYA 1A14L 5AZ2H 2F5BL 5EOTA 4YC2B 1N5YL 4LSQL 2D7NA 2BRQA 2QADC 3VXSE 1A7PH 1F2XK 3IDMB 4FOMA 1QSED 4M1CD 5I8KH 5IB1B 4IMLA 3KS0J 3SJVE 3V6BR 3GM8A 3SBWA 4GG6F 3CMOH 1I7ZB 4NQCD 4ETQA 1WIOA 4OLVL 5MEQB 4K2UL 4YX2L 4S0SD 4PJFF 4RMTA 5BO1L 1IGYA 1X5IA 1CF8L 3JV5A 4WFGD 3R4DA 2XQYG 2G60H 2CJUH 3DMMC 2RQ8A 3DPBA 3I02A 4NQSB 4FTVA 4DQOH 3V7MA 4G5ZL 1BOYA 3QQ9D 1KJ2H 5SV4A 2XTJE 2YC1B 4KGLA 3U30B 5IG7A 1KCVH 4XCFL 3I2CL 4WIQA 1HHKA 2ID5A 5K9JH 3BDBA 3P30H 2NR6D 4QNPF 3PABB 4X5LA 1XIWC 2DJUA 3CCHA 3QZWG 4C56D 2VDNL 4JY5H 3T0EE 3LY6A 1PD6A 3T8XA 4BH8B 3MV8A 1AE6H 1WUNT 1WFTA 4HKZA 2CSPA 2JELH 4XPGL 3CVHA 4YIQB 3FTGA 1U8JB 3MV9D 4WI7A 4N0FB 2VISB 2CK0H 3IXAA 1S9YA 1JZ2A 3G04B 3AS2A 4M7JL 3LS5L 4HUUB 5C07E 1DBJL 5B38A 5M95B 1RHFA 1KXQE 3G6JE 1F4AA 1NAMA 3OG6B 3QFJD 3DV4A 3TT1H 3HNTH 2O5YH 4MX7A 3NPZB 1I1FB 3SKJH 3GIZH 2EXWC 1AQKH 1BWMA 2ESVA 3GBLA 3C5ZB 1L7IH 4G7YL 1BQLH 2DLIA 3UO1L 4LCWE 4R0LB 1R3HB 4R97C 2HG5B 1LO5A 1RMFH 4Q6YA 1G9NC 5ACLA 4LGSB 1DEEA 5E2VL 1L4IA 1WBZA 1HN1A 1QFWM 1T1ZB 5I18L 3T4AA 3LKQA 2E6QA 4NO5A 4M7LL 1AJ7H 1C8PA 2XA8L 3IDJB 1TZGH 1A6PA 4ZUUA 3HRZA 1GXEA 4KVCL 3FQTB 3PGFL 4KKLD 4LLMB 1NDGB 3R8BB 4DJMA 3RWEA 3SDXF 2DQHH 5AUMB 5HYQB 3ARGC 3VXNA 1CL7I 2X4TA 4LSTL 4PJHA 4E0RB 4LLDB 5C0IA 4AL8L 4F15C 1KLGB 5KSBB 3BKCL 3GMMB 1ZLWK 3VGDA 4JDZB 4DFIA 3EO9L 5EU5B 4FA8A 3FB8A 2VB5A 1FL5A 5ANME 4ZTPH 3MODL 5GRVK 1KC5H 4M9PA 5L9DH 1A1MA 3GMLB 3DX6B 4ZTOH 3LV3A 2V9RA 4W6WB 1PQZB 5CJ5A 3KWWA 5ID0A 5JPNB 2ZKHH 4OLZH 1NFDA 1NDMA 3NA9H 1KENH 4HHAB 4KK6C 4F33A 1T7XA 3JWOC 5TGBB 1JNLL 3HG1D 4YAQA 4MB5A 3QUKB 4FFYH 4PRID 1X6LA 1P7HL 5DQJB 5C1MB 5GRJL 4DN3H 3QDMA 3VFNA 5DEGB 1IMHC 2W0LA 5BV7C 1IGTA 4QTIL 2XZAL 1UEYA 2DKMA 1C08A 1YEHH 3KYKH 1MUJB 4L4TE 5D1ZC 1I4FB 2Y36H 3REVA 4TNVF 5JMRA 4WI4A 4PGCA 1G1CA 1MAML 4Z76B 5E4EC 5D7KD 5DO2D 3SOBH 4X83A 2D03L 4E41D 5D1ZA 2OL3B 3MC0A 4YHZH 3DOSA 4P2OA 5GISH 3QEHA 2FCBA 4Q58C 1BWWA 1U8OA 4M8VA 2PO6B 4IOIA 3GUTA 1MJ7L 1CICB 4MA1C 4HWBL 2AJVH 4K8RL 3UX9B 3UTSA 1IGFH 3HPJA 3TBSA 5DHXB 1MHHB 1CGTA 1OAZL 4JLRB 4NKMB 3TJHD 4BZ1H 3C8KB 3GKWH 3O3EB 5DRZA 5T5NG 5D8JH 2G5BA 4MJ2A 2YD3A 5DXWA 3CUPB 3QUZC 4MQ7B 2KBGA 4P2QD 1P4IH 2PYEE 1BD2D 1B0RB 2IMNA 4Y2DB 5CJOL 4QGYA 4U1SA 2ZJSL 2Q86B 2F74A 3BPLB 1ZAGA 3C87A 3WSQL 2D0GA 1NGQL 4ZS6C 4CVUA 1MJUL 4OZIA 3MLUL 3GSOB 2P45B 1ADQA 2X6MA 1UC6A 5ACZB 3NCCB 2VERN 1G7MB 1OGAA 4JPWL 1A6ZA 5GPRA 3AS3A 4KRNA 3RU8L 1SM3H 2DD8H 1MFDH 1GZPB 3O3BA 3ZDYE 1AKJD 3A6OA 4EN3B 4KKAD 2VR4A 1SMOA 1MHCB 4P3CH 3C5JB 3KXFA 2O93L 1VSCA 5E99H 1EDQA 1NMCC 4JM4H 4TULL 3S4SG 4F7CB 1IC4H 1KXTB 2FJGB 3VRIB 5IUSA 2IBBA 4YHNB 5B3NA 4WUUA 1LE9B 2DWDA 1CLZH 2Q7NA 2H32A 1LDPL 3DRTA 4PTTB 3S88L 4LVNB 5F71A 2X44D 1VHPA 4MJIA 3B9DA 5DD5L 4ZFOL 3QWQB 1R0AL 4FQ1L 3BVNA 4WWKC 5K59F 1VERA 1XIWD 2X9YA 2EZ0C 1QRND 1ZTXL 2NY1D 3CFDB 4PY7B 4YDJA 2XNAA 1MSPA 3RUGB 3C5SA 4WWKA 3CDFA 2MCG1 4KC3B 4NM4L 4M6AA 6FABL 1P53A 1KIUA 5T1KA 1B90A 2WBWB 5HD8C 4NHCH 4N8CH 1QYGL 1SYVB 4QLRA 4NGHH 4POYA 4GW5B 3TC9A 3FN0H 2A6IA 4ONHA 4HUKB 1QO3A 3KPMB 5JPMA 1OPGL 3T2OA 1IAMA 3F6LA 5HTSA 3HA0A 4PBXA 4CDHA 3CAFA 4HWZB 5SX4H 1MJ8H 4MSWB 2X4PA 4V2BA 5KSAD 4YUEL 4CW1A 4L1DA 4WJ5B 2ADIA 1IGML 5IV2B 3N1MC 1PLGH 4KXZI 1YN6B 4X6FA 3GBML 4UT7L 5DURB 2W0KA 1IC5L 2Y5TA 1OAUL 2F53D 3N9GH 1YPZA 4Z95L 3QUML 4OF3A 4DZBA 1R24A 2J5LC 3SO3C 5IF0A 1RZGB 5BVJA 1BGXH 1KTDB 3BP7A 3ZL4L 1WITA 2DTSA 4WU7B 1T03H 5I71C 2FATL 4H8WH 3MRGA 3RL1B 5DJZB 2EDBA 4J7RA 4KQ4H 3TT3H 2GITA 3MA7B 4OM1H 3N1QC 3LKRB 3RNKA 3TA3B 1QPXA 4D9LL 5C0AB 3VFRB 2FRGP 5IHZB 1OAQH 3MOQA 3P4MB 1BIIA 2EXYC 4JFQB 1BIHA 5CBEB 5JQ6L 3DSFL 2HFGL 2DDQH 3CLFH 2AXJA 2CIIA 3ME0A 1B88A 2ZUQC 1Q72H 1DQDL 3SDYH 5IB2A 3L9RB 5EO9A 1QEWA 1VADB 1EMTH 3O8XC 5JW3H 4PJXF 1RJLB 2C1OA 3TEUA 5F7EH 3MLPA 2QBWA 5DVKA 5GGRA 1T21A 2ZOKB 1FL3A 1NLDH 5CKAA 3LSOB 2QEJA 2NX5A 5DVOA 1S7UA 2C3VB 5AAMA 1E6JH 2WINB 3V6FB 2NXYD 2A0LD 4TUOB 3RBSA 4DCQB 3LRSA 4DUVA 1EO8L 5CIPH 4DZ8A 3O6FC 3RTQD 3LKOB 5DD3L 1ZSDA 2ORBL 4PGZA 1KB5B 2NY2C 4IDJL 5GHWL 4ONGL 4JHAL 4OFKA 3O6FA 4L4VB 5HYJA 1AXIB 4ODSL 1ZHLA 3ECBA 4P9HL 5GS3A 1FCGA 2W60A 4FFZL 3N1GC 1MNUH 2WM0A 2F8OA 1A9BA 4M48H 2R39A 3Q48A 3WJLC 3HE6A 3QUYC 2NZ9C 4JKLA 3H3KA 1U8MA 3F8UB 4KTEH 3I6GB 5JW4R 3MRHB 3WJLA 2OTWB 3MOBL 3QUYA 1YEIH 2X89A 1RZIA 3OF6A 3RWFB 3WO3B 2Y06H 1T5WB 1KSRA 4H26A 1VB9A 5ISZD 3HR5B 1FZOA 2FZ3B 4EUPG 4D8PA 3QUZD 1UWXH 4HUVA 4EUPH 3RKDD 5IFAL 1UXWB 4HDIB 4C83A 5IK3A 3F58L 5B39A 1YZZA 3BEVB 4JAMA 4RRPA 1FORH 3E6HB 1QBBA 1RK1A 4LDLB 4F9LA 1ZHNA 4XAWL 1RULH 3U36A 3D0VB 2H41A 4IRSB 2FSEA 3GRWA 4B0MM 3FT2A 3WUWA 1F6AA 1GGYA 4JZJB 4X7TB 3QDAA 5KANG 1D5XB 5DSCA 4WEMB 2AW2A 2CK2A 3NIGE 4YHIB 4F9PA 3EJZC 4OLWH 2G75B 2AK4A 2H6PA 1PG7X 3SY0A 4QWWD 5D2NC 5JOPE 3WYRA 3GK8H 1HSBA 2XZZA 1B2WL 1JF1B 4N90E 2AQ1A 5FF6B 4DVBA 1AR1C 4KZEH 4NP4L 1JPGB 1RUPL 3NTCH 3WFEH 4UUJA 1Z5LA 2EO1A 1CN4A 2VLKB 3MQIA 3QNYA 5JOEA 3RUGE 5EB9A 1UWEL 4PP1C 2UWEE 3GSQA 2NY3C 5D7JA 5C6WH 6CGTA 25C8H 5I1HH 1J8HE 4BQCA 4LLVB 4Y16C 1EFXA 3OWEA 2GUOA 2HLFD 1WGOA 3CZFB 4GAFB 5I8OL 3HC4L 3OTTA 2ZCHH 4JFED 4UIKL 1A2YA 1N64H 3B9KB 2GSIB 1MVFA 3CX5J 4HC1A 5HY9A 2Q87A 5IMKB 1IFHL 2YD9A 4MNQA 3HMWL 2EZ0D 2XWBB 1QFUL 3DX8A 3DVFA 1TITA 1VCAA 4NKOB 5J1AB 1VPOL 1WF5A 5D1XB 3VXUD 4G8GA 3SDCB 3NPSC 1PGRB 1PY4A 2P24A 5L2JA 3I3EA 3MRJB 2CRYA 2DYPB 1UCBH 3ILQD 1JFQH 3H42H 4QY8B 1RUQL 4JRYD 4OCWH 1U8PA 3MUGB 3WV0A 2ATPB 1UVQB 3M8OH 4PJIE 4ERSH 5E5MA 3PIQB 4MLIA 1HDMB 3CXHK 2A74A 4H1LB 4XTRD 1YMHA 3FFCB 5AWNH 2WP3T 1F4XH 3GNML 3S6CA 4X6CA 5CBAA 5DUPH 3KHQA 5DLMH 5DJAA 4IMKA 4YHOL 3BN9D 5C0AE 3TVMC 3N0PB 3L3DA 4NM8H 4OZ4B 1R5VA 1A9EB 5GSVA 1SJXA 3G6AB 5I17A 4CMHC 3C8DA 4RMRA 4S11A 1OP3K 1FYTA 3TVMA 3MV01 4FXGB 4KGJA 3B8SA 5BOPA 1KNOA 3EHBC 4GKZB 5HVFB 1BFSA 3NZ8A 3QCTL 1I1YB 5DC9B 2AV7B 4C57C 3OZ9L 3T09A 4HIJA 3AAZA 5D7SH 3VGFA 3W39A 3WO4B 2FGZA