5CP7A

Crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPITLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSRVPDRFTGSGAGTDFTLKISRVEAEDLGIYYCWQGTHFPQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSETDQDSKDSTYSMSSTLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light Chain of Antigen-Binding Fragment of Monoclonal Antibo
publication title Class-specific Monoclonal Antibodies and Dihydropteroate Synthase in Bioassays used for the Detection of Sulfonamides: Structural Insights into Recognition Diversity.
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 218
sequence length 218
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cp7A01
1DANU 4Y8AA 1EK3A 5ACLA 1VFUA 1S8DB 3FOMB 1LD9B 1AXSB 2Y4SA 1PQZA 2IPUG 4F57H 4JG1L 3ARBD 4R0LA 4FHBD 3OKOA 5CS7A 5CJQL 4I0PC 1SJXA 1NMBH 2GEEA 4K94L 3UJIL 4PLKC 5I19H 5EN2A 4Q7DA 1YEIL 2VR5A 4XTRC 3MLZH 4C83A 5GGQH 1A21A 3O8XB 3B9KC 3MFGB 2CK0H 4D8PA 4NIKB 1H3TA 1X5AA 3OKMB 5FGBA 1RUMH 4LCYA 3QPQD 1M7DA 2H6PA 4P5KB 2P4AB 3MLVH 3I84A 1YUHA 3F58L 3B2VL 3FZUC 2JJUA 2FLBT 3ZE2F 4AENA 5DQ9A 4WU5A 5KSAD 1BQLL 5L0QB 4L3CB 5GIRA 3F7VA 4ODVL 3MCG1 4OM1L 2R1WB 5SX4H 1IE5A 5GS2D 3T2NL 1I4FB 2FJGB 1JZ5A 3DVFA 3N9GL 5KS9E 3QDJD 4NO0A 1YNTA 1FGNL 2BNRA 3WLWC 1IGJB 1RJZA 2NY0D 4NWUH 1FAIL 5E2JA 5GGVL 2DM3A 1SY6L 2HFTA 1AIFB 3INUL 1WCQA 4AEEA 2XPGA 2V2TB 3CVHA 2JJSA 2UZIH 4MJ6A 4HK3N 2J6EA 3PDOB 5KSBF 3JV6A 4GRLC 4ZFZB 3U4AA 1A4KA 5B38B 1G9MC 4N0YL 1ZSDB 3D3VB 3EYVA 3QUZC 2EIEA 1G0XA 4B0MM 4NHUA 1JCKA 5FA3A 4F58H 1KGCD 2RCSL 2IBGA 4WO4D 1AQKL 5DHVA 3W2DH 4HXAL 2BOBA 2IG2H 3IDNB 3IDJB 4U1IB 4M1DL 3DV6A 5HGAA 3QDJE 4QGTA 1UA6L 2MPAL 3MA7B 1EJOL 4RAVB 1SEQH 3V9FA 4X7SH 1TCRB 1WWCA 4KQ3L 3FB5B 2GSIB 3FQRA 4JY4B 1HIML 3DROA 4XBEH 4LSPL 5GXBB 1J1PL 1BZ7B 4GRMB 4M5ZL 4XRCA 4QXTB 2BNQB 4OUUB 5LKNA 4EEEA 1ONQA 3VXQB 5E00A 43C9B 4Y1AA 1KV3A 4PJGB 1MCOH 5I1CL 3WJJA 5I17A 2AJZA 3PQYD 2BRRL 1HILA 1A6AA 5D2NE 4XCCL 1KGCE 3ROLA 3WJLC 1NAMB 3ZHLA 2F19L 1O0VA 3U0PB 1HOCB 4LPWA 5TDOB 4OFKA 2KKQA 3VFMA 4J1UA 3WDJA 1IL1B 3HC3L 4XWGL 2GQHA 1ULVA 4LP4A 3D9AH 3HZVB 2Z35B 3L1OH 1CGSH 5DZLA 1KYOJ 5INCA 4IMLA 1MJ8H 3LQAH 2WUBH 3D39B 3WKNA 2OSLA 5GJTH 1LO0H 1HHJA 1KJMA 2ARJB 1TQBB 3DURB 5D71L 1QBML 2A6DA 4YK4C 5JOFA 4X4XA 5MP6L 3PV7A 3AREB 1UCBH 4O9HL 5C0EA 5HYFA 1VPOL 4AM0B 1IJ9A 1LEKA 1F8TH 4NZUL 3WUWG 2ZCLH 3U9PL 4XZUB 3PQYE 2Z92B 3AGVA 2YPLB 3OHXB 3WFCH 2HFFA 3EKCA 3BH9B 3MRJA 4A6YH 1I1AB 1INDL 3QCTH 4EUPH 5E6ZA 1G1CA 3TVMB 2ICEA 2V2WA 1L0YA 2G2RB 4HIJB 4MNQD 1ZT7A 1XIWC 4D9RD 4JFXB 3MROA 1IC4H 3WIIH 3FB7B 2EE3A 1DE4B 1M71B 4JN2A 4JFFD 3IRZA 1JK8A 4P4KB 3HR6A 1GXEA 2BVPB 2QQLH 3N85H 5GS0D 3R4DA 2WZPD 1AP2A 2VN4A 2FZ3A 4K9EL 4CDHA 4R2GC 1NGWB 3WN5A 1EEYA 3QG7H 5IB1A 1OTTD 4R7DB 1B0GA 3UAJD 4Y5YC 4PRDB 2WSKA 2WBJB 2YWZA 1ZHBB 4DKEH 3MTRA 4UIMA 4NQEB 5TGBB 4F7MB 4LDLB 4OAWA 3OKDB 5IEHA 1C12B 1P69B 4V1DD 4MQXC 4ORZC 3T77B 5GGSY 3GSRB 1R5WA 5F7DA 1PX4A 1A5FL 4MNQE 4EOWH 4ZOCA 3N1QC 2HKHL 4D9RE 1U8IA 4ZTOL 2O93L 1MJ7H 3KHOA 4GH7B 5CD5D 1IAIM 3DVIA 2XZZA 4GW4A 5JDSB 1W0YT 4JFFE 3WFHA 4K3DH 3H0TA 3J7HA 3DBXB 1KJ2L 2GCYB 1U6AL 2Y5TA 3G6JB 1NL0L 4F9LC 1AE6H 2Q3AA 3QYCA 2OZ4L 3DPBA 1IGFL 3ZMRA 2BSTA 3P77B 3KAAA 2X4NB 3LOWA 3VCLA 4CNIB 4LPUA 4PJ9C 2I27N 1WFOA 3T0VA 5HYQA 4Z95L 5LAXB 4U3HA 5JORA 1IFHH 3UYRL 3DX6A 3TF7C 4FZEL 1PZ5A 3EIFA 3L6FA 3N1MC 1JHKL 2DWDB 5B21A 4V1DE 3O4LD 3PL6A 5F1NB 4RX4A 1FH5H 4XXDA 1GIGH 5JPMB 4J4PD 3UTTB 1FNHA 3SE3C 3MRIB 4MJIB 1RJYB 1W0VB 3TCLB 3B3IA 4QT5A 4UILL 2O5YL 4M6OL 4AL8H 3VJ6A 1F6AA 3LRGA 4KHXL 4J7RA 2PTVA 2ID5A 2F54B 4ZUVB 3NH7H 4RMTA 5D1ZD 3BZFB 4HQQL 5FO7B 1M05A 3JXAA 3ZDZE 4D9QD 4PGEA 1MFEH 4X98A 4WIQA 5FF6A 4JRXD 2NY2B 5B4MC 3ZTNH 1KULA 4HXBH 4N5EC 2V7HA 1EO8H 4CVXB 3NFPA 3BXNB 3O4LE 3OPZL 4GAYA 4WJ5B 1ZT1A 3BRDA 3HAEA 5DJZA 3O9WC 1F6LL 1FGVH 1NFDB 1NMBL 4M3KB 5DJ8B 1QPPA 3MLZL 5GGQL 4BFBD 3KPQA 3G5ZA 3EOTH 5T1LD 5C9JA 2Y36L 1OW0C 3JWDH 3JBG7 4Z76B 5EFIA 1JP5A 2XKNA 5D70H 2A9ML 1KPVA 2DIBA 1RUML 2QQNH 4LEXH 4LU5L 1JYVA 3WO4C 5DJ2B 1OPGL 3GSVA 1EERB 3G9AB 4D9QE 1LK3H 3MLVL 4TUJB 3UTZA 4APQD 5H94A 5I30H 1JTTA 2ITDB 4G8EB 4JRXE 3RA7H 5IHBA 5IFJA 2NY1B 2IH3B 4XAKD 2ATPB 2WINB 3FOLB 1H3PH 3JTTB 2XY1A 3OBAA 4G6KH 2I07A 4OZFH 3BEVA 2D7QA 2XFXA 5J7CC 5HI4D 5T1KD 3HRZA 4WFFD 5EPMA 1FZMB 3WNLA 4AQOA 1N6QH 5CEYB 1EHAA 4W4OA 4X7EC 4NWUL 4QHUA 1Q94B 4QNPE 5EU6B 3RWJB 4HBCH 5D1XC 3QG6B 2DD8L 2WWKO 5C2UB 3CH1B 2OTUA 4BA8A 4NUGH 3ARPA 4HKBB 4LCWA 4KUCD 5IQ9A 4WTZG 5HY9A 3OX8A 3EYUH 3QNXA 3UZQA 4CVZB 4F58L 1BFOB 2YD6A 3C5ZB 1F58L 3O3EA 3W2DL 5F6HJ 3DRQB 3GUTB 4XAKE 4OV5A 2IG2L 4XCYA 3HI6H 2EDDA 3Q0HA 3UXFA 2VDLH 5FUZH 4TNVF 3S97C 2OL3H 5D5MF 4QHNB 4DOHE 4XGZA 3QUYD 2HLFC 3ARFD 4WFFE 4X7SL 5GJSL 3QJHA 4XBEL 1A8JH 2AK1H 1NCTA 4NRZB 5DHXB 4AIZA 3D69A 4U6XB 1KB5A 3PWNB 2LTQC 4QYOA 1E6JH 4FQIH 1U42A 2WAHA 5C92A 4JFDA 4ZYKA 1NAKL 4L9LC 3S3SA 4Z7VE 3KPPB 2ZG1A 3CMOL 3AU1A 3RWCA 5HHPB 1T89C 2HJKB 3NIDF 4OZHB 1HQRB 4OF6A 3ZKXC 5ILTL 3ARRA 2CLRA 3DVNB 1HK6A 1UYWH 2FGZA 5KOVC 3VGBA 5L2KA 5DD5H 1A7RH 4TVPH 4HUWB 3OXSB 3ULVC 1D5MB 1Z6JT 3FQWB 3L3DA 3Q3GA 4L8BA 1QOKA 5JA8B 5B39G 2Z31A 1XGTB 4XPFH 3JTSB 1VKXA 3UDWC 1P7QB 1MJ8L 3O4OC 1Q9OB 3LQAL 2DLFH 3K0WA 4MWFB 1K5NB 5EO9B 5GJTL 3D25A 3U30C 3HUJB 1Y6KR 5FOBB 4Y4KB 3OF6A 4J6RL 3QDGB 5GHWH 1UCBL 1IM9A 2I26N 1JZ3A 1FNSH 1DBJL 1ZLVK 4KKBD 2B8OT 1F8TL 2ZCLL 5TQ2H 1KPUA 1YEDB 2WLZA 2YXMA 3RUGF 5JR1L 1AQDB 3M45A 1JF1A 4F15B 3WFCL 1URLA 3RVXC 2O26U 3VXRD 2A2QT 4IRSB 4A6YL 5FHBH 2I9LA 3GM0A 2WQRA 1BHGA 3QCTL 4WI3A 3CH8A 3TO4B 5I6XC 3KYMA 4PJDA 4QRUB 3TZVD 5E7FA 4ZDHA 5D5MA 1NC2B 3MRFB 3MO1A 4M4PA 1AY1H 2KQMA 5JHLL 4UUJB 4NYLA 1JWSB 4KAQL 5FO9A 2DYPD 3SGEI 1A9BA 4JFQA 5BV7H 4Y5VC 5KANI 3QG7L 3BUTA 4J3OC 5IG7B 4PJHB 1NGYB 1JPTL 3LHPH 4JFEA 5F3HA 2PR4H 4EN3D 4HG4K 3HZMB 2OS7A 1C5DB 4DKEL 1A6WH 4F8TA 3C2SA 2DLIA 2BVOA 4XHJC 4LHQB 4IDJH 3UTSA 3VXRE 4OCLC 1ES0A 2YC1A 1OGTA 3QWRD 3FQTB 5E2VH 1KTKE 5HHXH 1PX3A 5HHMD 5HGBA 3RGHA 4UDUA 2NY3D 3LEVH 3D0VB 1YYLH 4AIXA 1CXFA 4WTXA 1RMFH 4XWOC 3WHXA 1MJ7L 1CXIA 1GJIA 3VRLE 2YEZA 4YNYA 1J8HB 3L3GB 4JZNB 5EZLB 5D7IF 3CX5K 4Z7UF 4WRLA 3RVUD 5I75B 5DGQA 1AE6L 3W9EA 2EC9T 1QLRA 2FYYA 1X9QA 1OGAA 4LEOB 1KPRB 4XP4L 3QBTB 1I3GH 4G3YL 5DD6A 5F7MC 3HHRB 3T3MF 1IFHL 5CIPH 2ZJSH 3ZYIA 2DMKA 3MV8A 3FN9A 5HHME 4PREA 5CHNB 2FJHA 1KBGL 2HWZH 3L7FB 1QFPA 1YN6B 3D18A 1A1OB 1D5XB 4LSQH 4XNQA 4NFCA 3RGVC 2G75B 3KLAB 5FUCE 2OTPA 2AVGA 2CJUH 3L9RB 4P4RB 4Q58C 3VGFA 1MH5A 1HN1A 1CDHA 2MMXA 4FQCH 4AL8L 5BRZA 2R1XB 3X3GL 3T0EB 1A22B 3O6FB 1CICA 3MUGA 3V6OC 4E5XB 5TH2A 3X12B 3CLEL 3BPCA 5CEZD 2X4OA 1CE6A 4HUXA 2E9JA 4QRTA 4YHPA 2IJ0C 2ERJB 1JPST 4IHOA 2FATL 4OGYL 3MRNA 2Q1EA 2BOCA 5JHDA 4W68A 3RL2A 3VXUB 2W0LA 1VFBB 1PSKH 1EFXA 2DB8A 4HXBL 3S96A 4Q9BA 1EO8L 3SKOB 4PRBB 2AI0H 1WBYA 1I8IA 1M6OB 1EXUA 3I3BA 3V6BR 4XBPA 4H1LG 2DWEA 4EI6B 3QIBB 2NMSA 4R4FH 3ZKMC 3G08A 3TN0D 3K4ZA 4PJBB 4RISH 5AZEH 4HUMB 3EOTL 1IGTB 2XQBH 4YDJA 4ZUSA 2N4IA 3BZEA 2R2EA 5D7IA 5D70L 5D7JC 5MHSD 1LP9E 3BMWA 2DICA 2QQNL 3GSWA 4N8CL 2XZQH 5CEZE 2BC4A 4DUVA 1LK3L 4PRAA 1I75A 4U1SB 1INEH 3BMVA 5I30L 1KIRB 3RA7L 3EFDL 4I0PA 2Q86B 3BWAA 5DGRA 5CBEA 1Q9WB 4NC2B 4NN7B 3IDIA 4YX2H 4D3CH 1XGRB 4AEFA 3UEZA 2FH8A 4D9LH 3B9KA 1CGVA 3ZE1E 2ZNWA 1KEMH 1BLNB 5A3ID 1GAFL 1N6QL 4GKSA 3JWOC 3G5VB 5H8DA 3O45A 4I4WB 4RGND 3KGRA 1FNGB 4UV7H 5CGMA 5TF1L 1WAAF 5MHSE 1YEGH 4WWID 4HBCL 2W0FA 5E1AB 2QADD 4Z77B 3QIUB 1XR9B 4XMLL 2YD5A 1E6OH 5INDB 3GRWA 1FZOB 5CKGA 2ZUXA 4LCCC 4POZD 4I18C 3SDDB 4DAGH 1D9KC 1JI1A 3EYUL 5DTFB 4BKLA 5IB4A 1XGYH 3QDAA 1ZHNA 4KKCD 2Y7QA 5D96C 4CJ0A 5IB3A 3MRHA 1YPZE 2AEWA 3GIVB 4MNGA 3GJFA 1MLCA 3HI6L 4YR6A 2DQHH 2XY2A 3RVTC 1CDYA 4HH8A 3H6JA 2ZWLT 5EC1A 1EGJL 3HS0A 1S7XB 1RZJC 2B4CH 1FVDB 2AK1L 1SQ2N 4GRLA 2R1YA 5EUOB 4UT7H 1AGEB 4RGNE 2GTWB 5FECB 3SPVA 1E6JL 3QUZA 4FQIL 2WBKA 1OSZB 3O3BB 4S1SH 5F7LB 4Q74A 1OWRM 7FABH 4HLZH 3LB6C 2Y6SD 1WBXA 2ZG3A 2R0KL 4MQSB 4U0QB 5TFSH 1ZLSH 4DEPB 5D1QB 1CE1L 4PGDA 3LN9A 2BNRD 2UY7A 4KRPD 4G8IA 1RUPH 2QR0B 4KGJA 5E24E 5FK9B 4IOFD 4JPVL 1UYWL 2R39A 3Q1SH 5DD5L 5F9WB 3RTQC 4QY8B 1K8IA 1A7RL 2ESVD 4PJFF 4TVPL 3RVVC 4EVNB 2YUVA 3CSGA 3U6RA 3R0NA 1CD1B 2MHAB 1CZ8H 1ZLUH 2WUCH 4XPFL 3QDMD 3QQ3B 2J1KA 1MRDH 5DLMH 4FQQB 5FB8A 2W9EL 2DLFL 3KJ4C 2YWYA 4IS6A 1WAAA 3EUUA 4HBQA 1MCCA 1CG9A 1CK0L 4ODUA 2DLGA 2Q20A 5GHWL 5IUSA 1U8PA 1PKQB 2RHEA 5CMAA 1U36A 4MD5A 5F7WC 4ZODA 2E9WA 1ADQA 2BNRE 5TQ2L 4PP2B 4ZMAT 3OAUL 4RQQA 5TE7L 2H2PD 4OZIF 1Q72L 4A6YB 4NCC1 3QFJB 1FNEA 2ESVE 4EUPB 5JXED 4YDVA 1G7LA 3CSPA 3IFLH 2VLKD 3IGAA 2FGWL 4DKDC 4XXCC 1RU9H 5CD3B 4Y1AD 4LRIA 1GZPA 3RPIA 3EZJB 3V5DA 5GSVA 3I3DA 4QTIH 5GS1C 5IJKC 3IDGB 4FQXB 3TIEB 3QWQB 1EVTC 4JZJB 1AY1L 4FTVB 1YEFH 2AXGB 1TITA 1UCTA 2EXWD 1AFVH 2VIRB 4XMPH 1RZKH 1VERA 2XG5A 4DZBB 5F44A 3QI9C 4NZRH 3ZTJH 3MMEB 4J3UA 4OCYL 2JK5A 5GS2H 3VA6A 4UU9B 3FO2B 3K2MC 3RNQB 2PR4L 3K4DA 5IHLB 2F8VA 5E8OA 1U3HB 5KVMC 3FRPG 1ZMYA 4WV1B 4IDJL 2NY6D 5KSUA 3EYSL 4FQLH 4CN4A 2C1OB 5E2VL 4PJFA 4PP1D 5DD0H 5TQ0H 4Y1AE 4Q2ZA 1OM3H 3QIWC 3AMKA 2SEBB 1YYLL 1Q0XH 2AEPH 4OI8A 1EX0A 2NY4D 4YHOL 1RMFL 3VFWA 2BY1A 2ADJA 3EBAA 2HTKD 1L7IH 4ELKB 5C1MB 4Y5YA 1Y0LB 3MRMA 2DJ4A 4HPOL 4RFOH 1L9MA 2QEJA 5D6CA 3FKUS 3HG1A 4I3RH 4KDVA 1UH4A 3VXOB 1IGIH 4OF7A 1ZA6A 5H35B 1TPXB 2LV4A 3QEHA 1S7TB 1YECH 3V2AR 4HJGA 2APWA 4GXUM 4NQDA 3WFEH 1GGCH 3RX5A 1DR9A 4JM2D 1U92A 4U6YB 5ENWA 1GHFL 2XTJD 2ZJSL 4OZIA 4R96B 3JVGA 3FT2A 3QNZA 1G6RA 3IDYB 2CKBH 4R4BA 5DQJB 4Z18A 1VFOA 3DRTA 1DQQA 2OXHA 3RIAK 2HWZL 3KLSA 4N0UB 4PJ8C 1HQ4B 1XF4A 4OM0H 5F7KC 4AT6A 2H9GA 1E4WH 1T5XB 3C6LA 3VFPA 5A43C 3AXLA 4P46D 1DL7H 1UWGH 3TBSB 1OT1A 2APFA 4FQCL 1BIHA 1RJLB 3MCKA 3AM8C 5LGHH 4OZGA 4QHKJ 5GGVY 5EIIB 1YEEH 4I2XB 2VXQH 3GJEA 1NANI 3P4NB 5F6HI 1UZ8A 2IH1A 4JHWH 5TDNA 2FJFB 1R3JB 1LO5A 1YJDH 3SDAB 2B7DT 3IVKB 5SWSD 1NQBA 3TBVA 3GSXA 1DBMH 2VQ1A 3TJEH 1AJ7H 2XTJE 4KVNL 3BQUA 4JPIB 4XVJH 2R69H 3VRIA 1MFBH 3S5LA 3SDCB 1FZKA 3O41A 1CDJA 3RDTC 4JQIH 5ISZB 2XKUA 4TSCH 3EYFB 3ZO0A 4NN5C 5GZOD 2AK4A 4R4FL 4M9OA 4RFEB 4PYGA 1EZVX 1LE9B 3QSKB 4RISL 1HHKB 5AZEL 4M3JA 1G7QB 3MC0A 2VC2L 5J3HD 1QKZH 3VXNA 4PGZA 1J5OL 3VFVB 5BS0D 2VISA 4ZPVB 1MFCH 2KUTA 3HZKB 3PL6D 5C0RH 4RX4D 5K9OB 4F3FA 2BERA 5L0QC 3CFIC 2XZQL 4FFVC 2GT9A 2J8UE 1OAQL 1N0XH 4WEUD 3MRLA 3NVQA 5SWSE 4OLYL 3RBGA 3O9WA 4OGXH 4X7DC 1U91B 2GJ6B 4NT6A 3WE6A 1F2XK 2Y23A 5KVDH 5FV1L 3SKNB 3ES6A 4D3CL 1OW0A 3F5WB 1CDUA 3AS2A 3LKRA 1S5HA 4OZFB 1T0MA 3P0VH 1PG7L 4JQXC 5GS0H 5E6YA 3I02B 4H5SA 1Q9LB 5B8CC 1KEML 1JTOA 4U3CA 3L5XH 5B3NA 3MV01 3DTXB 4DW2H 2ED8A 1ZGLP 3TFKC 5BS0E 2H3NA 5M95B 5KVFH 3VFSA 1CTOA 1YEGL 3NZ8A 3P0YH 1MVFA 5DWUL 4WHDA 4CUCA 3ULVF 2ZOLA 1SJHB 1SEBB 4J8RB 1UXSB 3BYYA 4MSWA 4KV5F 5HYEA 1XGYL 3UPCA 3FT4B 4P23C 5K33A 4X6CF 3TEUA 3A67H 3B5HA 2V5RA 5AUMB 4N68A 2DAVA 4I0CC 1TVBA 4I5BB 3TJHC 4AK1A 4PRNB 4I9WD 4ZFFB 2WP3O 5DDHB 4ZUTA 2OL3B 3V0WL 5GRJL 4NO5A 1MHCB 4ZPTA 3GMLA 3U82B 2R23A 3GMMA 5D1XA 5I73B 5E0QA 2B4CL 4M48H 5CJXA 5M7QA 1H3WM 1CFQA 3T0XA 2ZCKH 5J57B 3CFBA 5DUPH 5HYSG 2PXYD 4JDVB 4UT7L 1G9NH 1JRHI 3CZFB 4HSQA 3PWPD 3S4SA 5IOPB 5E5MB 1HKFA 4PJXB 5HHOB 7FABL 3GMNB 4XCEA 1ZLSL 5T3ZL 2BSSB 4KK6C 4XMKH 3UX9B 2D4FA 3BO8A 3KXFB 4UOW1 1DBAL 4HWBH 4JFOA 3SDXE 4Y19A 3UC0H 1T7ZA 4YWGL 3CXDH 3D2UA 2P47B 5KZCD 4JDTH 5DRNB 3H9HA 3M17A 3IFOA 4LVNB 4KJQC 1S5IH 4D94A 2FSEA 4WY7H 1CDGA 1BVKB 4YZFF 1V5JA 1I8KA 2XOTA 4LCWD 1BQHG 1UACH 1CZ8L 3QHFH 3B6SB 1YY9D 3AREC 5C08A 3KPMB 1MRDL 1Q1JH 3VWKB 5DLML 3K4AA 3SDYH 5J1AB 1T89A 3PWPE 1CR9H 4U0RC 3UTQB 4JHAH 2HMIC 1ZHKA 2BY3A 1RZGA 4CU8A 1U8NB 1TQCC 3E6FA 3BIKB 1CGUA 1JI2A 2VO5A 3RZCB 1KCUH 2MQCA 3CFCH 4OQ1A 1CXLA 3BPOC 4X6CA 4LSSL 5D2LF 3K81A 3UDWA 3B2UD 3I9GH 3MREA 4L8CB 1G7HB 4D0DB 3U36A 4FQ2H 3EO0B 1RU9L 1E4XI 4Y2DB 3FT3A 4Q9QH 4P5TB 3U83A 1MJJB 4LCWE 5FGCB 2J12B 5HGDA 4LL9A 5HPMA 1ZWIB 3BIBX 2CDEA 4K3JH 4YE4H 3O6LH 4WU7B 4FXKA 4G7YH 1ZGLA 4JKMA 5K9QG 4N0RA 3PGDA 1DDHA 3GRWH 1I8MB 4WW2B 3WEXA 2Q8BH 1Z9OA 4ZOAA 4GG8A 5BV7B 5T5FH 1JF6A 2HVKA 4YHYB 5BQ7A 4CJ1A 5E8DH 3GK8L 1BQUA 1MRCH 2IALA 2Z31D 1EAJA 1BMGA 2R0LL 1KCSH 2ICWJ 4M8QA 1VCAA 1Y18B 4H88H 5C86A 3LRHA 1SJEA 3DUUB 1OVZA 2HYMA 5IVXB 3HPLA 3EO9H 1IAOA 4JFDE 4XP9L 4HS6B 5AYUH 5E8EA 3ARVA 3FAWA 3VFTB 3IF1A 4P9ML 1J05B 3U7AA 1KB5L 4ZUUB 2HVJB 4Y89A 4Z78A 1YDPB 2V9TA 1L7IL 2P8PB 1T66D 1BIIA 1DQDL 4RFOL 4TSAH 3MOAL 2X2YA 4KTDH 2NZIA 3GMOB 4M6MH 1OQXA 4YIQB 4I3RL 2QKIA 4OZ4B 2E7BA 1FIGH 5IMOB 1G7MB 1IGIL 1NC4B 1K6QH 3QO0B 4WUUB 3DX8B 1YECL 4CL7A 5H2BB 3HE7D 3HC0A 4Y5XC 1P7KB 1MRFH 5ID0A 3LKPA 1T5WB 5DRZA 4PRIB 5A2LH 2IPKA 3PP3K 3PF2A 2CKBL 4M7LH 3SGDI 3SKMB 4FP8H 3O81A 3W9DA 1F02I 5EBMA 2IANA 1WICA 5C0JB 1NGZB 3QCUH 4OM0L 3QULB 1A7PL 4X8JB 1QR1A 4P2OD 3VD5A 2VXVH 3ARDB 1DL7L 2P5EA 5E6IB 4NUJA 1HH9A 2X7LB 5E56A 4DTGH 3V52H 1YEEL 4PJDE 2VXQL 3N50A 2KPNA 3P4OB 3X14A 2X09A 3DIFA 4JHWL 3V4PH 2C9AA 4HF5H 3VXSA 1V7NH 3RVWC 1QR4A 1YJDL 3VFNB 3A0OA 4K94C 2BDNH 1DBML 4FABH 4HIEB 1N8ZB 2F74B 1AJ7L 1RK1A 3DETD 5I8KH 2Z91B 1KJVA 4MJ2A 1BQHB 3RGVA 4HS3A 2ADIB 5ANME 4XVJL 5F1IA 4C57C 2R69L 3BPNB 1MFBL 2OTWA 3VW3H 3C5JA 4JQIL 5J8OA 3EHBC 4TSCL 3V6ZA 4FOMA 1GVIA 4GKNB 3KG5A 4MJ5A 3OG4B 1YMHB 4JFEE 3DI2B 4O02H 1CDIA 2LVEA 3PNWB 1MCIA 5GGSA 2YMXH 2FWOB 3U2SB 1VACA 1FORL 5F1SA 5DHYB 5IB5B 3BESR 1TMCB 4CN1A 1FYTA 1QKZL 3MV8D 5AYQA 3SCMA 2EZ0C 3MQIA 4QGYA 1JJUA 1MFCL 5C0RL 4PGCB 1N5AB 1I7TB 2NY1C 1DEEA 4GW1A 4GG6F 5D8JL 1R5IB 1N0XL 1VGKA 1LE5A 3JV4A 4X4YA 4ELMF 2OJEB 1KXVC 1IAII 4OGXL 4YXKH 1I9EA 4AMKH 2BNUB 4FQJL 1NJ9B 4NKOB 5BJTB 3PWVB 5KVDL 1OB1A 4EDWL 1VFAA 4PBXA 3LVEA 5C0BB 5F71A 3RWFA 3P30H 4HX1A 4I1NB 3UJTH 3P0VL 3ARYA 4HUNB 3NN8A 1JPFB 4YC2C 5DFVC 4F7EB 5IF0A 3GI9L 1ETZA 2PYEA 4HIXH 3L5XL 4K8RD 1JNHB 1HCVA 4DW2L 4HWUA 4U6HB 5DJDB 3BUYB 3VI3F 3G5XA 5J13C 3MV8E 3TWCH 2NXYB 2QJDA 2D9CA 3TA3A 1WCBB 2VE6B 3SGJA 5KVFL 5I1EL 4M61A 3P0YL 3KPSB 4KK8D 1CLOL 4QCIB 2VSCA 3PWUA 3QNYA 1RK0B 4RNRA 3SGEH 4LSRH 1U8KB 3DYOA 4HJ0C 2AQ1A 4GKZB 4KY1H 1F4AA 2HRPH 3CCHB 1FVEB 5SWZB 5I18H 4K7PX 2C4XA 3A67L 2OR9L 4WI8A 1IZKA 1H0DA 4NQVB 4S1DC 3ETBF 3FQUB 4UT9H 4MXQC 2P8LA 2QV2A 1KF9B 4JFYB 2OP4L 4M48L 4NZTH 5BZDA 4FFWC 5J9PB 4D0BA 1TVHA 4PLKD 3FMGL 4RBPH 3CFJB 1G9NL 2IAMA 5E4IA 4LCCA 4PRHA 4I18A 2VAAA 1U8JA 2X40A 1ZEAL 3KPRD 4XTRD 5KOMC 1ZVSA 1D9KA 4LLVB 5JTWA 1N59A 2HAZA 4QOKA 3B9KD 1DLHB 4GG6A 3BH8B 1N0LA 3GNML 5IWLA 2X4PB 3DV4B 2C1PB 2KDGA 3O6MH 2FO4A 1IGMH 1IC7H 3UC0L 3CXDL 1QRNA 4XVSH 4QHLB 3LAFA 4JDTL 1S7UA 1YMMD 4JO3H 32C2A 4Z5RA 3FZUD 3N1PC 3LEYH 4BFIB 1S5IL 3NA4A 3VXTA 3WIHA 3KPNB 3S37H 4M1GH 4Y4KC 1JF5A 5MEQA 4L4TA 5EBWB 3QHFL 3L5WA 1J12A 1Q1JL 4LCIH 4W6YB 3T08A 4MX7A 3H9SD 1S7WA 1LVEA 3SDYL 3KPRE 4X4MA 4UOJA 3WLWD 4HV8A 4D0CB 2QHLA 3GSNB 4F15C 3ARBB 5B3JE 4G6MH 2NW3A 3RY5A 5T33H 1T6VN 1HXMB 1T1ZB 2QSCL 5HSFA 5KS9B 4FXLA 2DJUA 4GRLD 5DFTA 3RAJH 4M62H 3NMEA 1KCUL 1P4IL 2OR7A 3NFSH 2P24A 1YMME 5HVGB 4JREC 3CFCL 3QUZD 5HYJA 3MXWH 3T0DA 2WWMC 4W70A 2AKRA 4FXGA 3I9GL 3T0AA 1LO4L 1BREA 1P84J 1TJIH 4QHKI 4OI9A 5IR1A 4K9EC 5FKAA 4YE4L 1UKTA 4DCQA 4S11A 1AD9B 1RUQH 3TBYB 4M00A 3TNNB 3P9WB 3ULUF 1XGPA 1I7RB 3LD8C 1RY7B 3H9SE 3GRWL 2Q8BL 5KSAB 1WZ1H 4MNGE 5T5FL 2A6KB 4OCWL 5AZ2H 4NP4H 1G9EA 2IBZY 8FABB 3CMGA 3OKYA 1MRCL 4L5FH 4PY8J 3FQNB 3QDJB 3GM8A 2PN5A 4G6JH 1KCSL 2KBGA 3Q48A 4H88L 2AEQH 5J6HA 3HI1A 5CP3H 2PTUA 3DMMA 3KWWB 5GS1A 2NY0B 3DVGB 3NA9H 5ESAB 3ZL4H 3B9AA 3EO9L 2JCCF 1PFCA 5AYUL 1NFIB 3BP5B 2FEDC 3ARGC 4O2FA 4HKJA 2JIXD 3T1FA 4Z6AT 4RDQF 3ROOB 1X5IA 4P2QA 1GGTA 1IQWL 3KR3H 1EAPB 3QI9A 4P59L 4OFIA 5DRXA 2NZ9C 3UZEA 1NEUA 4ZSOE 3TO2A 1IEBB 5D2NB 1H15B 2EH8H 4KTDL 4WO4B 4M6ML 4U1HA 1CFVH 4YO0A 1CFBA 3E2HB 4E0RB 3PHOB 4WI2A 1K6QL 3GSQB 1K4CA 1P4LA 5F3BB 4MAYA 4KU1A 4NBYB 3N06B 4PGBB 5CSZA 1SBSH 1JUFB 1U8QA 2BSRA 3F7YB 1MRFL 2BSED 2PW2A 5E4EC 1G7PB 3I2CH 1WEJL 3WS6C 2YUWA 2W1NA 1IVLA 1IC1A 2CKBB 2CIIB 4M7LL 1HDMB 3REWB 1FRGH 1FG2A 4H8WH 3O6FC 1QLEH 1D5ZA 5EBLA 4RGOL 4HIHB 1MCJA 3GBNH 2VXVL 1XIWD 3PQYB 5E8PA 1KCVH 3MRQA 1IT9L 3U7YH 1HI6B 3IU4H 2XIDA 2UVEA 4DTGL 5C0GB 2EICA 3V52L 1UQSB 5F9JA 5IMLA 1TJHL 1QBAA 2OX5A 4G43A 5FYJD 3MRCA 2P44B 3V4PL 5DD3H 3QO1B 4CRPA 4HF5L 3FCTB 3U46A 1GGBH 3ME0A 1MFNA 3MZTA 3MLRH 2BDNL 2X4UA 3GO1L 3O0RH 5C07A 4FABL 4PJ8A 2LFGA 5I8KL 1RZIA 1XZ0A 3QUMB 3ZE0E 1MCFA 5J56B 1MSPA 4LCUA 35C8L 4BZ2H 1OTSC 4MXVE 5DI8A 1T83C 4QXGH 5E5UB 1T80A 1BJ8A 2XA8H 1OP3H 1TENA 3AM8A 4MQXD 1ZLUK 4O02L 5F96H 1S8DA 3FOMA 1A6VH 1LD9A 1AXSA 4DFHA 2YMXL 1OP5K 2YD3A 3HMXA 2DIAA 3QZWG 1WIPA 1KUMA 1WTLA 3WXWH 4LSVL 5DJ0B 1MCEA 4PPTA 1HE7A 4HGMA 3S36H 1NBVH 2UZXB 5IV2B 1H5BB 1K2DB 1C1EL 3DUSB 3PHSA 5FYJE 3BKJH 3T3PE 1FLRL 3P11H 5EDXA 3RDTA 1A4JA 3WO3B 4YXKL 1WWBX 4LNRA 4AMKL 2X4RB 4PJ9D 3OKMA 1ITBB 4CADB 4PJGF 4AIOA 4F80A 5J0BA 3DGCR 2I25N 1VADB 3NABL 4TYUA 4U7MA 2EKJA 5E1HB 2VZTA 5D7KD 4L3CA 4JRYA 4PB9H 4XPHH 1FBIH 5CLWA 3SDDC 2R1WA 3TWCL 1I4FA 2FJGA 3REVB 3GMQB 4V1DB 2HLAB 4IJ3C 1IC5L 2A1WH 1EZVY 5C09A 1IGJA 3HA0A 1PDKA 1YEHH 1FL3B 2GITB 3RI5F 3FO0L 1AIFA 3LDBB 4JQXA 4QRPA 3SGKC 2HRPL 2OI9B 4HK0B 4GAGL 3PDOA 2GTZA 5I18L 3V4VH 2XYCA 1W72B 2B20A 4ONOA 3EYQC 1CI5A 4OZGE 4PUBH 4ZFZA 5K9JL 1X5ZA 4LPXA 2VKXA 5B4MD 5IMMB 5B38A 2FB4L 4JFPA 2HKFH 2CGRL 3NCFB 1ZSDA 4LHUA 4N5ED 3D3VA 4U6VH 3Q6FB 3DI3B 4Q6IB 4UB0H 5DJAB 3O9WD 5D7KE 3T09A 5ALBH 2EKSA 3K3QA 2G5BB 4PRPD 2ICWI 2Y5EA 3IDNA 1TDQA 3IDJA 3R06B 5EO0A 4U1IA 3SBWC 5FGRA 4JN1H 5EOQH 1UGNA 5GRXG 3S6CA 5JMRA 3MA7A 2XWTB 4FFYH 4XCNB 1P1ZB 5F9WC 4RAVA 4P23A 5CEXA 4LVEA 4Z7WA 2W9DL 4LLWA 2GSIA 4JY4A 3O6ML 5ITFB 1BZ7A 1IGML 2X42A 4GRMA 3VXMD 4YHIB 1IC7L 1FQ9C 4X7TA 3U7WH 3CIQA 4QXTA 4XVSL 5GSRA 2BNQA 1BF8A 4OUUA 4WUKL 1E4JA 4JO3L 1BWMA 3VXQA 1IQDB 4LKCB 3LQAC 5CILH 2O5XH 2UUDK 3T4YB 1N6UA 1HHHB 2C3XA 1J0JA 4M1GL 5D1ZB 2AQ2A 3QJFB 3DECA 4JEGB 3CX2A 1NAMA 3QA3A 4LCIL 3U0PA 2BHYA 5TDOA 3DX9B 2VJXA 4JRXB 4PRPE 2FX9L 4IOIB 2VITB 1IL1A 4NBZB 4U7KA 1UEMA 4KVCH 4G6ML 4X5XB 5T33L 3HZVA 4WFED 2Z35A 3IB4A 1AGBB 5D1XD 3P9MB 4LLDA 3RKPA 4ZD3H 3S88H 3D39A 3VXME 5HVHC 1NANH 3RAJL 3M8OH 4M62L 3NFSL 2J5LB 2ARJA 2BXZA 3DURA 3D5OF 4FQXC 4LARH 4TNVK 1WZLA 2ARWA 3LEXB 3AREA 4G9FA 4QRRB 3MXWL 1F97A 3QZWB 4WCYL 4N8VB 2VXSH 5CGYC 4OKDA 4XZUA 2Z92A 2YPLA 1WFNA 3OHXA 4HH9B 2R29H 4Y19D 4APQB 5EO1B 3BH9A 4KDTC 1I1AA 4ORGB 3IDXL 2HLFD 1A02N 2UV3A 5I1LB 2JKXA 1U3HC 1WZ1L 5GZNC 2G2RA 2XWBA 3OXRA 4NP4L 4WV1C 4JFXA 4WFEE 2VDRH 2CIKB 4WW1B 3FB7A 3RZWA 3C2AH 1DE4A 4DOHB 2XV6B 3CVIH 1ED3B 4NM8H 4G6JL 1M71A 5T1KB 4P4KA 2BVPA 3VH8B 2AEQL 4PJEE 1J1OH 5F1KC 1W8OA 1KEGH 1U8OB 4KUZH 4OD2B 3NA9L 1RVFL 3WNNA 4YFDB 3LN5B 3VFOB 2AJUH 1XF2B 2H41A 4PRDA 4Q97A 2WBJA 1ZHBA 2W38A 4Z7VB 5DURD 3AVEA 1YN7B 4NQEA 4NQUA 4Y19E 4YBLC 4PTUB 4F7MA 3KJ6H 1ZTXH 1C12A 4OLUH 5BCAA 1P4BH 3STZA 3GSRA 1NFDF 5JW4Q 3ZDXE 3BE1H 3B8YA 2D7MA 4DKAA 1CFVL 1MCQA 5IW1B 1EEQA 1A1NB 2HJLB 4X99B 3U0TB 5JDSA 3QUYB 4YHZH 5DK0B 3ARFB 4JLRB 3DBXA 4IM8A 1JGVH 2GCYA 4JPWH 3G6JA 3I2CL 1UKSA 3IFPB 5I9QB 1G7IB 2ORBH 1PY9A 5D93C 2X4NA 2E8ZA 4CNIA 1FRGL 4H8WL 3RVXD 2XNAB 5I8EA 3F6LA 5C8JA 1QLEL 5LAXA 1Z0MA 1WBZB 2H2SC 4UINH 5LXGL 4GJTB 4X6DF 2DWDA 3GBNL 1A7NL 2E7MA 3FL7A 1ORQB 5DS8A 2J88H 3U7YL 4LLAA 5E7BA 4ZO7A 3ULVL 4Y5XA 5JPMA 5EA0L 3UTTA 1D6VH 3W39B 3BPLB 3IKKA 2BFVH 3MRIA 4MJIA 1RJYA 3VFRB 1JRHH 5DD3L 1W0VA 3TCLA 1NMCB 4PY7A 4KMTH 1R3HB 5IK3B 5CBAB 5L88L 2MQ3A 1T1WB 3MLRL 3O0RL 1JGEB 2GK0B 5F9OH 2FR4A 2V5SA 4ZUVA 4OCXL 1MQKH 1NDMA 5SX4I 3OZ9H 5FO7A 1L6XA 3H3PL 1N6VA 4QXGL 3UBXA 4HT1H 5F96L 4LGRB 1A6VL 4V2CB 5I71B 3WXWL 3ARUA 4JQVC 4CVXA 3BXNA 4P99A 8CGTA 5CGTA 3W11C 1B6DA 4XWOD 3WFZA 2Z93B 3VXRB 1NFDA 4X4ZA 4PR5B 2VDNH 4G42A 1N5YL 5DJ8A 3ZDYE 3QQ4B 5HD8C 1KG0A 4Q0XH 1A7OH 3L7EB 3TZVB 4Z7OF 1S9WB 2IQAB 4Z76A 4P5MA 1XR8B 1A6PA 1A47A 2DOCA 2FHFA 2Y07H 3HI5H 1FFRA 4GMTH 5I1AB 3OTTA 3BRFA 5DT1L 1X7QA 5DJ2A 5F6IB 2DYPB 2ZKHH 4TUJA 2JB6B 4OZHF 5IBLC 3TH3T 2ITDA 4G8EA 5IT2H 4TSBH 1YEJH 1G1YA 3LKNB 3ZHKA 3BP6B 2IH3A 4EN3B 5HDLA 4UV4L 3IAGC 3OJVC 1NH6A 3ALWA 3RGVD 3FOLA 4HHAB 4MVBC 4DK6A 3JTTA 1A7QL 4NWTL 5ACZA 5HHMB 1T2QH 2A1WL 3MNZB 2CRZA 1FZMA 3AMLA 3MYJB 2NY3B 2YUZA 5CEYA 1TZIA 1YEHL 2FL5B 1DN2A 1SY6A 4N9GB 3TIDB 3HUJF 4NNPH 5EU6A 3RWJA 1FG9C 3NPSB 5EORL 4O2EB 2LE9A 1RURH 3CH1A 5LGJB 2YZ8A 1P5VA 4PUBL 1PY4A 1S9XA 4HKBA 5I74B 3VRJB 3M1BB 2CMRH 2N7BA 4LSUH 3MRDB 3VI4F 5BO1H 4U6VL 1UM4H 4CVZA 4NKDB 4HDIB 1BFOA 3ULUH 3C5ZA 3RJDA 2APXA 3CC5A 3DRQA 5HDQL 1MHPH 3GUTA 2A38A 3ZKMD 1B4RA 2UY6A 1BBDL 4R0LC 4NN6C 4U2YA 2VB5A 5JNYB 4S2SA 1Y6NR 4QHNA 2ZUSA 4FFYL 1RUKH 2V7NB 2H32H 4JVPA 4I13B 4N90D 5D7JD 4NRZA 3V6OE 2GSGB 5I1IL 3EDJA 1EEZB 4U6XA 2WIMA 2B1HH 3PWNA 3ARXA 4U31A 4WDIB 1FL6B 3BN3B 4IIQC 1BM3H 5FGBC 5DMGC 3KPPA 4PJHF 1CQKA 1S3KL 5IM7B 1LP9B 2MTPA 5HHPA 4OZHA 2GUOA 2HJKA 1HQRA 2YPVH 3AB0C 3FO9B 1C08A 1N7MH 3LV3B 4HUWA 4X6BB 4G6FD 4HS8L 3FQWA 3RZCC 2A77L 2VDMH 3DWTA 5MEPB 1MEXH 2EXYC 5E08H 1XGTA 1KTLB 3LKQB 4LMQI 4N90E 3JTSA 1QVOB 1P7QA 4QXWA 1Q9OA 3W5MA 4ZD3L 3S88L 4RFNB 2VXUH 4Y2DC 1K5NA 3TN0B 3FFCD 5DMIH 3HUJA 3M8OL 4P5TC 5FOBA 4Y4KA 3RWGB 4LQFL 5L8LB 5CINH 4LARL 2JJSC 1D9KD 4QOKD 5ELIA 3K7UA 3S35H 2VXSL 1G0DA 3ARQA 3HLAB 1YEDA 5BV7C 3IXTB 1AQDA 3QFDB 4DFIA 2BVEA 1KCKA 2Y72A 3S36X 2R29L 3NCYS 3DARA 2DKUA 3WS3A 5BOPA 3RVTD 1QRND 1C16B 1DUZB 4MXWH 2FCBA 4FQ1H 3TO4A 4C4KO 2L4OA 3BVNB 5D6DA 2DQEL 4QRUA 2EDLA 4UQ2B 2QLVB 4ZFOL 1YPZB 3L3IB 1HZHL 1NC2A 3MRFA 4ZNCD 5IIEB 3HZYB 4DKFH 2VDRL 3SE8H 2AV1B 4NM8L 3ZHDA 3DHJA 1UZ6E 2CUMA 3FFCE 1JWSA 1FDLH 1J1OL 1KEGL 1V3MA 4K8RH 4KTYA 4RGNB 4QOKE 1HH6B 3CX5J 1TXKA 2AJUL 4HFUH 1IAIH 4PJHA 5IG7A 1NGYA 1EFQA 3DHMA 2RB8A 1HXYB 4HWNA 4GO6B 2QADB 1YC8A 3RTQD 1AH1A 1KTDB 1OARL 3HZMA 1C5DA 3WJJC 4BUHA 3BKMH 2WMPA 4XPAH 1WUNT 2NTFB 1QRNE 3KJ6L 3MNWB 3TYFB 4OLUL 1P4BL 5HYJD 3MLSL 4NPYB 2HTLC 3NGBB 4LCYB 3MACH 3LQZB 4PJBF 5KN5B 2FBJL 1OAKH 3L3GA 4JZNA 2Z0BA 3ARGA 5EZLA 3D85D 1KJ2A 5C0CA 2BMKB 2C3GA 4AENB 4JPWL 1LO2H 4DZ8B 1VHPA 1LEGA 4X4ME 2ORBL 4L9DA 4WVRA 2E9BA 3BWUC 5D7SH 5E6IC 1EUUA 4LEOA 2BRQA 1KPRA 1O5DT 3OKEB 1QD0A 5F7EL 5FXCH 5JA9A 5ECJE 1OF2A 1JV5B 5AWNH 4UINL 1ZXQA 4UDTB 1YNTB 4BJLA 1MCWW 2FBOJ 4XX1E 2BNRB 4KRPB 1MFDH 1HINL 5HYJE 3L7FA 2IMMA 2XPGB 1D5XA 2ESVB 3FTGB 1D6VL 3CVHB 2BFVL 2G75A 3WXVH 4S1QL 3QHTC 3WS6A 1JRHL 4N8PA 4KJYB 4KMTL 4P4RA 3QI9D 4Z7QF 1N64H 4O51A 4K71C 1PYWA 2DMBA 3QDMB 1QHPA 2R1XA 3T0EA 3O6FA 4NHUB 3O6KH 4LHJB 4E5XA 1F4WH 2YOCA 1QQDA 1MQKL 3X12A 3OZ9L 4GSDL 4EKXA 5E2UH 1UWEH 3WN5C 2YZ1A 1EDQA 4ZOEA 2BVYA 3DV6B 1QSZA 1QBBA 4HT1L 1WJ3A 5HGAB 4WNQA 4YHKL 3WL9B 1CLCA 1VFBA 1X6NA 3QIWD 3EGSB 4GQPH 1ND0A 4P9HL 4PRBA 4QO1A 4R97C 1QFOA 2IADA 3HTLX 1IAMA 2CH8A 4QXUL 1KN4L 4EI6A 2VDNL 2VLKB 4P2QE 5SX5K 4MD0A 3DX7B 4PJBA 1A7OL 4Y1AB 5IBUB 1O7VA 3TGXA 5EUOF 2DKSA 3B5GA 1IGTA 2MOVA 3OB8A 5CP7B 3W0WD 5I17B 2NNAA 3FB8B 2K7PA 2Y07L 2NY7H 3DO7A 4GMTL 3ROLB 3TV3H 3V4UH 5C0FB 2XICA 3IS0X 4PJ7E 4U1SA 1KIRA 5GRWA 5IT2L 1LMKA 4NO2B 2Q86A 4JO4H 2HG5B 1Q9WA 2QSVA 3GHBH 5C07D 1RFDH 4PJ8D 5INCB 1E4XL 3HAEG 2UWEE 3D1MC 1XGRA 2OSLB 1XFPA 3H42H 1I9JH 4F7PB 1KJMB 1A6TB 4HMDA 4LLMB 1T2QL 3SJVD 5C0EB 3O2VL 4NJ9H 3LIZH 3ECBB 2ZP0T 3G5VA 3W0WE 3UYOD 5D2LB 4YBHA 2FX7L 4NNPL 2NY4B 1FNGA 3B9VA 5DR5H 5HBBA 2B4CC 1RURL 2HFFB 1XR9A 5F7UA 5INDA 1C5BH 1QFUH 1FZOA 2ZOKB 2WIIB 4C4KT 4DUWA 2ICEB 3SDDA 1KYOK 4J12A 2V2WB 1ZT7B 5DTFA 1J8KA 3ULUL 1HHGB 4HMEA 4PIRF 3RDTD 3MROB 4M7KH 1YEKL 5C07E 4OFYA 5I15L 4JM2B 1FC1A 4OGAC 1CCZA 3GIVA 5I1DB 3OGCB 2NW2B 2VAJA 2XTJB 3PUCA 4G7VH 1JK8B 5KTEH 1NEZA 2X4QB 3SGKA 3MR9B 5JW4N 1S7XA 1GC1H 1RUKL 3WHE0 4ZNEA 5K59E 3CK0H 2VMFA 3PV6B 3SJVE 2YN3A 1DCLA 1FVDA 1JPGB 5EUOA 3PXHA 3IDUA 3SE9H 1AGEA 1FV1A 2GTWA 2JJTC 5FECA 4JRYD 4UIMB 3O3BA 1OSZA 2R2BB 4P46B 4RWHA 5JZ7C 1BM3L 4OAWB 4I48B 1H3GA 3HMXL 3BP4A 5C09D 3RHWK 4PFEA 3OAYK 4KI5F 2C3VB 4OD1H 3HE6D 3SBWA 5JQ6L 2QR0A 5MI0B 2J8UB 5FYJH 1JNJA 5FK9A 1MREH 4QRPD 2Q6WB 2X1OA 5SWSB 1N7ML 2EDJA 4QY8A 3U1SL 2VZSA 4EVNA 4GW4B 1JVKA 1U3ZA 4CVUA 3MGAA 1CD1A 2VDML 2MHAA 4ZTPL 1MEXL 5E08L 4LHUD 3TFKD 4LAJH 2CLZB 2AABH 3QQ3A 4AY0A 5HI3C 2EEBA 3NACH 4FQQA 4HCRH 1QTYT 4H20H 4W4OC 2G9HB 5KVGH 5HYQB 2D03L 3QPQC 5DMIL 4JRYE 5JORB 3O2WH 4ODHL 3MSPA 2I5YL 1GH7A 1JL8A 2VZ3A 4R26H 5BS0B 3CFKA 4JVUA 3PL6B 4YXHH 4P23D 5C09E 4XNYL 4OLEA 3TJHD 4PG9B 4PP2A 5JLZA 3DSFL 1H8NA 4QRPE 3ZT6A 4A6YA 4EUPA 1Q8MA 2BNQD 3ZYOA 4MXWL 4FQ1L 4QT5B 2DI8A 1ORSB 4CMHB 2PKDA 3B9DA 4ZFOB 4RWYL 2B39A 2NY0C 5ICXB 3G5YB 3SE8L 3IDGA 4FQXA 3TIEA 2V9RA 3OR7B 2Y06H 5MERA 3MLXH 2AXGA 1QFWM 5ITBH 2VIRA 4KK6D 5CJOH 3TH4T 2DL9A 4DZBA 3I6GB 4K8RL 4W6WB 4NC0B 1JGDB 3MMEA 5HVFB 4DGVH 1RIHH 4HFUL 1IAIL 4KDTA 5GGTH 1ZT1B 4UU9A 2V6HA 3FO2A 3RNQA 4Z7WE 5DJZB 2DQJH 4KJQD 3BKML 4XPAL 1U3HA 2QBWA 4NCC2 4WV1A 3E2HC 4PLOB 2BNQE 2C1OA 3SDXB 3KPQB 1T20A 3BGMB 4RGMB 5FKPB 3ARED 4G9FD 3F12B 3OB0H 2XKNB 2BHUA 4JHZA 1F4XH 1A9EB 2SEBA 1P53A 4ELMB 4NNYB 3GSVB 1T7XA 3MRPB 4EDXB 4ELKA 2HMID 4NSKB 2J7LA 2ENSA 2XN9D 2F53A 2ZPKL 4LP5A 2EYRB 1KIQA 5F21B 1LO2L 5IFJB 2PXYB 15C8L 3IETB 4N0CC 4B50A 5D7LB 5HDOA 3PWPB 3EYOB 1NAML 5D7SL 1S7TA 4HAGA 4AEHH 2VLRA 4TVSa 1CD9B 5DZOA 5AWNL 5HHVH 4K07A 4R96A 1I9RL 1YJDC 1ZK9A 3LPFA 4QHUB 3EDEA 4TTDC 5KZCB 4G9FE 3PJSB 2WNGA 1NBQA 2B5IB 3RL1B 1HQ4A 2HRLA 4LSDA 2H8PB 4X7FC 1T5XA 2HFGH 3TBSA 2XN9E 1FO0H 3I75B 5DUMH 2EO9A 2RFXB 1HHIA 5TJWK 4PJ5B 1R0AL 3P4NA 3LZFL 2FJFA 1R3JA 2CD0A 2OQJB 4LRNH 4W81A 4BSVB 5K9QI 2P7TB 1KXTB 3SDAA 1OAUH 3IVKA 5GGUB 3AS3A 1H5BC 1MQ8A 3CXHJ 3PWJB 4OLVH 4OBRA 2XG4A 4XGZB 3EFFB 5DMKA 4NOBA 5ALCL 4JPIA 4HKXB 1G6VK 3SDCA 1X6LA 1S78C 4X8XA 5ISZA 3EYFA 3MNVB 1LE9A 4ONFL 4XNZB 1HHKA 2R9HC 3E6HB 3H3BC 5GS0C 4MA1B 1WWWX 5DEFB 1MWAH 3VFVA 4ZPVA 4PJXF 3TBTB 4MLSA 2NY7L 1BGXH 1DBKL 3Q6GL 4PJAA 3TV3L 5K9OA 3V4UL 1FIEA 3TPUA 3JUYA 4ZFGH 3RX7A 5FYLD 4JQVA 3WIFB 4MJID 4G80B 3NAAH 3L3DB 4RAUA 3NCEB 1NCCH 1U91A 3P9LB 2GJ6A 2Z31B 4ENEC 3L3KB 2C5DC 2IFGA 1RFDL 2COQA 3G6JE 4OCRH 1QBLH 2EIBA 1BFSA 1IMHC 4MAUL 1MFAH 3F5WA 3BFOA 3H42L 3LDBC 4OZFA 3I02A 4X80L 2OI9C 2UYLB 5TDPB 2BJMH 1GCFA 4BYHA 2NX5D 4NJ9L 3LIZL 3BAEH 3DTXA 1KPUB 1KC5H 5DR5L 4JR9H 3RVWD 4Y2OA 1CICC 4J3SA 4R3SB 2J2ZA 4XHQA 3RQ3A 5ICZB 2I9LB 2L7UA 2V2XB 4WHTB 5F72S 3NZHH 5FYLE 1OD7A 1G9NC 2FH6A 4MJIE 5JXAH 1FHGA 3KYMB 1SJHA 3Q2CA 4PJDB 1UXSA 1DP0A 4BSWB 5GPRA 5E99H 1AO7B 3VG0H 3LKSB 3RWEA 3EHBD 3FT4A 4M7KL 3U9UA 1DN0A 5AUMA 3HE7B 4I5BA 3DJ9A 4YPJA 4QHMA 4PRNA 1V8HA 4G7VL 2OL3A 5FO9B 1MHCA 5KTEL 5ANMB 2H32B 1GC1L 1II4E 3DXAA 3CK0L 4W6XB 2VNCA 2NX5E 1QLFA 1MI5D 3BN9C 2NY1D 5F3HB 4WW2F 1FP5A 4GRWE 3CZFA 4Z7NE 3BOVA 5D1ZC 4P2OB 3QAZB 5EOCJ 5HHOA 5DJ6B 3S8WA 1ES0B 4DVBB 1YA5A 3GMNA 3MV9D 3L3HB 2BSSA 1QSFD 3KXFA 1GRWA 5HXMA 4UDUB 3C87A 1J0IA 3EDKA 3O3AB 2CK2A 4GQ9H 1MREL 1OCWL 2B2XL 5DRNA 1Q0YH 5DQDL 5IVXF 5I1JL 4XPTL 4O58H 4PS4H 4YNYB 5DFVD 4GW5B 2MCPH 4FQPA 3D87B 1D5BA 1PGRB 3B6SA 2AABL 2VQUA 2EDWA 4IIQA 3CAFA 3KPMA 1IRAY 1MCDA 1NGQH 2FYYB 1MI5E 1DVFB 4HCRL 4TQEH 4H20L 4OT1L 4YHLH 3UTQA 3O2WL 5DEGA 2P46B 5C2BL 2Z8RA 4HJ0D 2BK8A 2XTLA 3MV8B 3MV9E 1QSFE 4YXHL 3BIKA 3KDMB 5I16B 1DQLH 2YS4A 2FEEI 4H25B 4S1DD 3RZCA 4L8DB 1F13A 4ZAKB 4LAQL 5TE4L 4G8FB 4MXQD 5CUSL 1MH5B 2FHBA 4L8CA 1G7HA 1QA9A 4D0DA 2BVTA 3EO0A 4FFWD 2Y9RT 4Y2DA 2K9UA 4PJIA 4I77H 4P5TA 1MJJA 4K23H 1RV6X 1I9IH 1ZWIA 3BPCB 4MCYB 4U05A 3C60D 4WU7A 5JUEH 3MLXL 2OM5A 4GS7B 4YHPB 5ESQB 3VG9C 1UJTA 5ITBL 3MRNB 3OJDA 1DQMH 1SVZA 5CJOL 1F90L 4N0FA 5DD1L 1LGVA 5IHUH 3MBEC 1BPVA 4DVRH 1QNZH 3S96B 4YHNB 1RI8A 5EC2B 2EE2A 5GGTL 3MLPA 1M7XA 1PD6A 4JRWA 1TZHB 2DQJL 5FUOH 2EDOA 4HGWB 5CAYB 4TRPL 4KKAD 4C54A 5EUKB 2IQ9H 3NIGE 3LCYA 3DUUA 4Y4KD 1AHWB 4HZLB 2XT1B 5K9KA 3BHBA 2YUXA 1S7QA 4HS6A 4HJJH 3BZEB 3HRPA 4KZEH 3ARFC 1U0QA 1AGCB 3GZKA 3VFTA 1F4XL 2OMNA 2ZSVB 2YD2A 1KB9J 4ZUUA 2BVQA 2HVJA 4GUPA 4LFHG 1YDPA 4UMGA 43CAA 3TESA 2P8PA 4NQCD 4KZDH 4XPGH 5C7XL 3WCYA 2X1QA 4Y4FB 1ZLWK 3CSYB 1EUTA 5ADPL 4JO2H 4OZ4A 3IDIB 5IMOA 1F11B 5DA0B 2L0DA 1QRKA 3KPRB 3QO0A 4WUUA 2IF7A 3DX8A 2XZCH 2DBLL 4TOYL 5EZIL 3WNKA 1YQVH 2MKWA 4QKXB 5DC9B 2D7NA 5HDBF 4AEHL 5LQBH 3HC4L 2WWMD 5CIPA 5HHVL 2VWEC 5KVEL 2OBGA 1T5WA 4PRIA 5MENA 2JLLA 1M1SA 4LPYA 5ESVB 4WEBH 3O45B 1YMMB 1FNAA 4MGXA 4PJCE 4LRIC 5C0JA 4GBXC 2CR3A 1IZJA 2C7UB 3QULA 4X8JA 2PYFA 1P2CA 4NQCE 3ARDA 3LMJH 5KSBA 5E6IA 5DUML 1LWRA 3IJYB 2X7LA 3RU8H 1ZHNB 3N0PB 4YH6A 1YYMH 1A1MB 3P4OA 3H9SB 4TPRH 3VDBA 4H1LH 4LRNL 1K8DA 3GJFB 3VFNA 1OAUL 2BZDA 2DDQL 3ARSA 1GGIH 5IW6B 4CW1B 4HIEA 1E28B 1N8ZA 2FEDD 1JGUL 3ARGD 3UTPD 2Z91A 5C0CD 3H7BB 3ZT5A 4GRLB 3MLUH 4FRWA 1ZANH 2CXKA 2NZ9D 3OKLB 4GKNA 4CVWA 4JZOA 1U58B 2HN7B 3MPCA 3PNWA 5FYJU 3MUZ1 2IEPA 2P48B 1FN4B 3U2SA 5DHYA 5IB5A 1BJ1J 4PGDB 1CVRA 1KJ3H 4HLJA 3WD5H 1F4HA 4AG4H 1I1YB 1KLGB 4OUOA 4ZSOB 4PGCA 1N5AA 1I7TA 1MCRA 5F88B 1R5IA 1RZJH 5EIVA 1VESA 1R6VA 3NAAL 1OAXH 1GPOL 4X5LA 2OJEA 3BP7A 1NCCL 5E2WH 2GY7B 4KFZC 3NTCH 2CQVA 3UTPE 2BNUA 5C0CE 3S5LG 3VFGH 4E42A 2EH7L 1NJ9A 1XCQB 3CPLB 3O6FD 3PWVA 1RZ8B 4NKOA 5BJTA 3JVGC 1AC0A 1KCRH 2D0FA 5ABDE 1MFAL 2F5BL 4RMRA 4NC1E 1JPFA 2NLJB 1N2RB 5BVPH 1HSBB 1CG9B 4ODUB 5DVKA 3KYNA 4F7EA 2BJML 2JIXB 2KZWA 3KPOB 4MDJA 1HNGA 5FM8A 5CMAB 3BAEL 3C6LC 3RVUC 1JNHA 4B7IA 5CKAA 5I74C 5JQHC 4J2XA 3BUYA 1F2QA 4J3WA 2IPTH 1F00I 1KC5L 2ZUYA 3EJJX 3PABB 1WCBA 4F7CA 5C6TH 3PG2A 4WWKC 1CXEA 3NCYP 3K74B 4YDVB 5KS9F 1RK0A 2DQCH 2GAZA 5JXAL 1CT8B 1U8KA 1IGYB 1GZPB 2EIZB 1OTSD 4LVOB 5GSVB 3VG0L 5SWZA 4C56B 4YK4B 1CFNB 3FN0H 3VGAC 2VLJA 3BQUC 3KHQA 4TNWF 4NQVA 4TUOB 3MLYH 4BH8A 3FQUA 3TT3H 4JFYA 1ZS8B 4P2RD 2FIKB 3QHZH 4IRJC 5AEAA 5D4QA 5J9PA 3OJMB 4OF3A 5L6YL 4JY5H 4G8GB 1RULL 3G04B 5E8OB 4LLVA 1SMOA 3T2PA 2BXYA 5EZJA 1XIWB 1DLHA 3BH8A 4F57L 1AGFB 2NXZD 4JY6B 4PV8B 1CFSA 4GQ9L 3MJGX 1Q0YL 5I19L 4BFIA 4WHCA 4PS4L 4RFNC 4Y5YB 3MRMB 3KPNA 4F9PC 1UG9A 5D6CB 2JJTA 2CK0L 5EBWA 3RI5K 3SDDD 4P2RE 3WUWB 1C8PA 2HH0H 1FNFA 1NGQL 5J11C 3I6KB 3UZVB 3S4SG 4YHLL 2E8YA 3OAZH 4D0CA 1CGWA 4X9IA 3ARBA 2AJXH 3MRKB 2N56A 3LPWA 3PIQB 1CQYA 4R7NB 4ESKA 4ETQA 5DVMA 1HXMA 4P3WA 2O5ZH 4R4BB 5KS9A 12E8H 4J3TA 4X6DB 1OWWA 1DQQB 4E41D 3EYQD 3RIFF 4HKZA 5KG9B 1S7SB 5L2JB 3ABZA 1EBPA 3DO3A 1VFMA 3VFPB 2EIDA 4ALAH 4HC1H 1UM5H 4OLWH 5BXFB 1FSKC 4R4NC 4PJ9B 4MHHI 1WIOA 4ONGH 2LABA 4OZGB 4M1CD 1BX2B 1E27B 4K23L 1BD2D 2LU3A 3LRSA 3MJ9H 5IGXH 1X4ZA 4EXKA 2UZIL 2XZAH 2IH1B 5JUEL 5TDNB 5CJXC 3QXDB 2G60H 3TBYA 2XA3A 4MA7H 2QADC 1I7RA 1DQML 3KYOA 3UP1A 4KTEH 4LKXA 4KH2A 5KSAA 4ZO9A 4P2YA 3S7GA 3WKMH 4K55A 1NUFA 3B8SA 3HN3A 4DVRL 1QNZL 8FABA 1MCHA 5SWQB 5ETUB 4E41E 5LWYH 5I1GH 3KWWA 5EBGA 5E95B 3E3QC 2K1MA 3DVGA 5ESAA 4BH7B 2R2HB 1SEQL 1SYVB 2N1KA 2DIJA 1I7ZB 3MJ6A 4Y7MA 3BP5A 2YR3A 3SHSA 3ROOA 1KACB 5JW4R 1FC2D 3QPXH 4XC1H 1BD2E 1EAPA 4YAQB 2YD9A 1MY5A 4H8WC 4KZDL 2R56H 3NCJH 1IEBA 2HT3C 4XPGL 1H15A 4LLQB 2Y6SC 3O9WB 2BVUA 1MCOL 5BZWB 4JO2L 4PRPB 1MHEB 4Z0BH 2EDQA 4E0RA 2W60B 3PHOA 4KRPC 2XZCL 1EHLH 5F3BA 1B4JH 2M26A 2D9QB 1OTUC 2YPKB 1T0MB 4PGBA 3BKCH 1CF8H 1JUFA 2YSSB 1U93B 3F7YA 1L0XA 3HNTH 5CGYD 1C7SA 1G7PA 4L8SB 3VXMB 3WO4B 3D9AL 4M7LT 3MRBB 4LVHC 2CKBA 2CIIA 3L1OL 1CGSL 3FONB 1HDMA 3REWA 3RFZC 4FQHA 4L4VB 2WUBL 1MUJB 2XRAH 2ATKA 2ZUUA 3KLHC 1LO0L 1JYNA 1MNUH 2ICWB 2C4FT 1FFNB 2JJVA 3IYLW 5I1HH 5IFHH 5E94A 1U3HD 5GZND 5F9AC 1FO0B 1D5IH 1L0QA 1T21A 1HI6A 4HW6A 1QO3A 5BMFH 5E9DD 3RU8L 3FRUA 1UQSA 1YYML 1IGCH 3VMNA 2OK0H 4TPRL 1TVBB 4HEME 4PBVC 3BRGC 2LU7A 3B4NA 4ZUTB 5IEKB 5JXEC 2F53D 5D1XB 3B83A 4RRPG 4KRLB 3CFBB 2B1AH 1IC4L 3WIIL 3MLUL 1KFAH 4PJEB 1ZANL 1U8LB 2VLMD 3ZDZF 4XAWH 2VZ1A 1NFKA 2VLRD 2QQLL 3N85L 3AAZB 3MV7D 3T8XB 3KS0J 1MWAB 2ITCA 1KJ3L 1F4YH 2C26A 2EDHA 4UI2A 1TZGH 2E6JA 4Y19B 5IV2A 1H5BA 5E9DE 1K2DA 2FIRT 3GKZA 3DUSA 4S1RH 2CDFB 5DJXB 1VB9A 2FSEB 3SE4C 1OAXL 1V3JA 4HIIB 3C08H 1B0RB 1I8KB 3C09B 2LTQB 3NTCL 2DQUH 2F53E 5EOTB 2A73B 3VD7A 2X4RA 2PO6D 4EOWL 5C0AA 1WIUA 4L9LB 2LQRA 4HPYH 4M43H 2H2SD 3QQNA 4GXVH 4UBDC 2AW2A 4TN9A 1NCAH 3MGTB 2R0ZH 2VLME 3ZKXB 4Q9RH 1VADA 5T1MA 4K3DL 5HGHB 1RZGB 2VLRE 4H26B 5TE6H 3P40A 5D72H 3MV7E 4LIQH 2D3VA 5DURB 2Z4QB 1UWXH 2IPTL 4XC3H 2I24N 4U1JB 4Z8FH 3R8QA 2RAMA 5C6TL 3GMQA 4QTHB 3T0BA 2HLAA 3RUGA 3PE9A 4JM2C 1EO5A 2DQCL 3O4OB 2GITA 1B88A 2A0LC 3U30B 2VN7A 3K8LA 4NRXB 4LLUB 1FH5L 1GIGL 5HPMB 4QNPF 2CDEB 3FN0L 4YFEA 1PEZA 2WWKT 3MLYL 5JPNA 5IMMA 3OB0K 4YDLC 4BZ1H 5T5NF 3CFEB 4XBGB 3TCXA 4Q6IA 2AJVH 4YPGB 2VR9A 5DJAA 3W11D 2AAVA 3NH7L 2G5BA 4WTWA 5HD8D 1MFEL 3R06A 4YLQT 2VDPH 3SCMC 5MI0C 2FDBP 3OKKB 4XCNA 2GIYA 5DSCB 3UROR 3ZTNL 3HPLB 4RMWA 5B39B 4HWBA 5E8EB 5F8RC 5ITFA 1MIMH 4YHIA 5JDJA 3E1F1 1FGVL 5JOPD 3AS0A 4Y5VB 4YQXH 4AEIH 5IBLD 1BOGB 2W9LA 4PJAE 4LKCA 4AYFA 1HHHA 2BP3A 5FDWB 4DJMA 1AR1C 3JWDL 4Z7VF 1J87A 5EULV 2YA0A 5DMJB 5D1ZA 4Y4HC 2QKIB 4MVBD 4HEPG 3QJFA 4RAHA 4Z7UA 4KUCF 4LEXL 4XVUC 4JRXA 4NZDA 1S7RB 4HWZB 3F62A 5CZXC 2VITA 3TA3C 3SGJC 2KZ1B 3LKPB 4X5XA 4XCFH 1G7JA 5C3LD 2HT2C 1AGBA 4R6UA 3DXAD 3EO1B 3P9MA 2CRMA 3W9DB 1DFBH 1H3PL 4PTTA 3CZJA 4G6KL 5JOPE 3SO5A 5CJ5A 3U4EB 5FCUH 3LEXA 4QRRA 1OAYH 3NIFE 4X6FA 4ALAL 5DK2A 4HC1L 1UM5L 1TCMA 4OLWL 4N8VA 1UM6H 4HUUA 5J4MA 2BY2A 4ONGL 4CN6A 5L8KB 5DVNA 3MJ9L 5J06A 2BHZA 4ZXBC 2XZAL 1JGLH 4APQA 5EO1A 3CFDA 4NQXA 4C55A 3QRGH 5I8OH 4TVPD 5I0ZA 5I1LA 4NUGL 4FNLH 2IAMC 1C5CH 3ALPA 1Z0NA 3MLTB 3RGVB 2CIKA 4WW1A 2OTWB 5EG6C 3DXAE 5IWLC 1ED3A 2EYTB 4XP1H 1T22B 1ZLVH 5J12B 4XX1G 5DMGD 4MJ5B 3VH8A 2VDLL 5FUZL 5I1GL 2E7HA 2OL3L 1U8OA 4OD2A 1FAKT 5T3XH 3LN5A 1XF2A 1LO3H 2EECA 3QPXL 3MJ7B 4Z7VA 4XC1L 3OV6A 1XCTA 4MJ4A 3UJIH 4MDIB 2PXYC 3MBEA 5FDYA 1EHXA 4PTUA 3RZCD 4G5ZH 5C9KA 2R56L 2EXYD 1QSEA 4TVPE 4NO0D 1OOAA 4WHYG 1CIDA 1ZGLM 5IMKB 4JVWA 1P9MC 3T65B 4Y2DD 4P5TD 1OB1B 5GS3A 1U2HA 2E5EA 2HJFB 1A1NA 2HJLA 3LH2H 1B4JL 3RWFB 3U0TA 3F58H 3B2VH 1NCNA 3ARFA 3QEQB 1SJVA 2AJSH 5D7JB 3VRLF 3HNTL 1Z9LA 3IFPA 1HSAB 5EU4B 3ISWA 4ZUWA 5JIIA 2R4RH 4OV6F 1KNOB 3T2NH 1YY9C 2XNAA 2XRAL 1MNUL 3C6SB 4OBSA 5I1HL 5EU7C 1FGNH 5F93C 3GSNH 3QNYB 4JCMA 4S0TD 1YQ2A 5IFHL 1A3LH 4RNRB 1ORQA 1FAIH 1FNSL 2GJZA 3WMSA 3QXAA 3INUH 5BMFL 4ZQKB 4GXUN 3W39A 2ENYA 3ILQC 4G6FB 4P9HC 2OK0L 4PJIE 3VFRA 2H26B 4H1LB 4BSJA 5HGGS 2QSQA 1BZQK 4OF0A 3VGGA 5FHBL 5CBAA 3R8BB 1T1WA 2DBJA 1JGEA 2P8LB 4ODWA 2ILLA 1QFWI 4GBXA 4MMZC 3V6FB 3DMMC 3QH3B 1AQKH 2XXMB 4LSTH 4J3VA 2B1AL 3FFCB 4D0BB 1TVHB 1UVQA 1KFAL 3QCVH 4NQSB 4WUUD 3B43A 1T4KB 1D9KB 1N59B 3DYMA 4QOKB 2GFBB 4EI5C 5BV7L 5D96B 1JWMB 4KQ3H 1FNLA 2HTLD 4LSPH 1JIBA 1INQB 2Q87A 5MEND 3LHPL 1TZGL 1DZBA 2I60H 2Z93A 3VXRA 1QRNB 2NTSP 2IWGA 3MX0A 1I8LA 4M6AA 1A6WL 1U8MA 4Z5RB 4K2UH 3QQ4A 3L7EA 3VXTB 2IQAA 3N1GC 4MAYC 5HHXL 5I1CH 2EDKA 3MRGA 1DUYB 1XR8A 3C08L 3MYZA 5E6ID 2DQUL 2BRRH 5T1DH 4XCCH 5I1AA 4K7PH 3LEVL 2CXGA 4PV9B 4HPYL 4M43L 5GGRA 2MQ0A 2HFEB 1LP9F 4B53A 1S7WB 3ZE2E 1NCAL 4WUUE 2R0ZL 2X9WA 2ZUQC 4HV8B 4IDLA 1T66C 5TE6L 2CLVB 1CXHA 3LKNA 5D72L 3BP6A 3RTQB 2XI9A 1WVZA 4LIQL 1J0KA 1OY3B 1IM3A 4XC3L 4OKVA 5MENE 2KH2B 3ULUC 1I3GL 3QWRA 1QBMH 5MP6H 3MNZA 5HYJB 1V7MH 1EVUA 3GEWB 3MYJA 3ZE1F 2FL5A 2AXHA 4N9GA 3KJ4B 5KSBE 4O2EA 2WQ8A 4LSQL 2EDXA 3BISA 1RHHA 5LGJA 3D85B 1CYGA 1INDH 4FMFA 4ETYA 2CJUL 2X1WL 3VRJA 3M1BA 2AJVL 4HDIA 4WWKA 2VZVA 4UNVA 4XH2B 3QWOA 3LS4H 4KROB 3TPKA 2W65B 3OKNA 4HMCA 1YPZF 2VDPL 3ALXA 1B90A 1P84K 2V7NA 4QRQB 2DI7A 1DTUA 3QUXB 1PSKL 1I1FB 4RZCB 4NRYB 1UEYA 3QUKB 3T1FB 3QUMH 2AI0L 3D6GA 1EEZA 3IDMB 5I76B 3O8XC 4G9DB 4AEIL 4YQXL 1FL6A 2JTDA 4ODXB 1IEAB 4IRJA 5B38G 1J7VR 1DVFC 4LHUG 3TO2B 2EYSA 3PHQB 5LCVH 5IM7A 1LP9A 2XQBL 4GAFB 4EQ3A 3VGEA 1MCNA 3P73B 2HKHH 3X13A 3FO9A 4PJ7B 5SWZD 2QHRH 4X6BA 1NUGA 2VLJD 5EH1A 3BX7C 5CSZB 5IFAH 3NFNB 5C6WH 3QIWB 1INEL 2E27H 5MEPA 3G6AB 1NL0H 2QL1A 5IJVB 2UWEB 2I9TA 4ZAKC 2OZ4H 3HPJB 3LKQA 1T2JA 1QVOA 2Z8VC 4YX2L 3RBSA 3PXJA 2DLTA 4MS8C 4OD3H 4HGKC 2CUHA 2AXFB 3TN0A 4Z95H 4LLYB 4F9PA 4D9LL 3UYRH 3QRFM 1T1YB 1YNKH 2VH5H 4YDKH 1WC7B 3W0WB 1JHKH 5FCUL 1OAYL 2AV7B 3STLA 2Q76B 2DLHA 1BVZA 5T3ZD 3L3JB 1W2KT 4OFDA 3HLAA 2FLRT 2DQIH 3IXTA 4B7LA 4K8RC 3QFDA 1FCGA 4OGAD 4UV7L 4MZ3A 5F9JB 2W92A 1L6ZA 1MCBA 4WEMB 2X4SA 4Y88A 1H3VA 1C16A 5SWZE 1DUZA 3FHAA 1E6OL 3BGAA 3QRGL 2VLJE 4UILH 2NR6D 2O5YH 4M6OH 1U8HB 2X4UB 4DAGL 1KIPB 1YPZA 2A83A 4ZS7H 1RZIB 1XZ0B 3HZYA 2ZZUT 3LN4B 1AHWC 4HQQH 3V5KA 2AV1A 4L29B 1W72H 5JZ7D 1I85A 2A6JB 3EOAB 5CP3A 3SJVB 2DQHL 2KL6A 3SKJH 5C0DB 5JIPA 3HB3C 5T3XL 1HH6A 3OPZH 1U3YA 3JV5A 5T3ZE 1HXYA 3P4LA 3ZKQD 4JJHA 4JJ5B 1KTDA 1LO3L 1AKJA 4Y4FC 5DO2C 4B41A 4S1SL 2NTFA 3ZLQC 2VZUA 4G5ZL 3MNWA 1CGXA 3TYFA 5TFSL 2Y36H 2D31B 1MCKA 3RDTB 1A4JB 5HI3D 2A9MH 4LNRB 4NN5B 4X0KA 1IILE 4NPYA 1RUPL 3J8F7 1T3FB 4LU5H 3LQZA 1FZJB 1OPGH 3JWNC 5KN5A 3Q1SL 2YK1H 1FJ1B 3LH2L 2X5PA 1Y6MR 3V0VB 1TTUA 1R3LA 5AG8A 2BMKA 2AJSL 3I85A 4DZ8A 4Y16B 4XI5C 1TQBC 2WUCL 4F8QA 1CGTA 2MCG1 4JRYB 2R4RL 3OKEA 4GMSH 1LK2B 4TULH 1JZ4A 1T7YA 1JV5A 1LNUB 4UDTA 2CDGA 3O3DB 5C09B 3GSNL 4NZJA 3HE6B 3V79C 1A3LL 1IKFH 4A2LA 1I1AC 4PBWD 1KOAA 4JANA 3TVMC 1B2WH 4QRPB 5A2IH 4L1DA 3TC9A 3FTGA 2ESVA 5B8CB 2DD8H 2GTZB 5HPOA 1AGDB 1MAKA 4KJYA 5IW3A 3G6DH 1A3QA 4JFPB 4GAJH 4LHUB 4JFDD 3IFLL 3QDMA 4P4KC 4O5LH 1Z3GH 4QF1B 4X9GA 1F58H 2X70A 1U2CA 4QTIL 4LSTL 2EKSB 1UADC 1QG3A 3QCVL 1HWHB 3B5TA 4LF3B 1YEFL 2IC2A 3BGFB 5EO0B 5L2KD 1AFVL 2WBJC 4XMPL 1RZKL 3WL9A 1ZT4B 2K3TA 4P23B 5CEXB 2VL4A 4JM2F 4NZRL 3EGSA 5GJSH 4Z7WB 4LLWB 2ZNXA 1DQJB 2CO7B 1IAKA 2I60L 3OAZK 4X7TB 5GSRB 5JXEA 3GMRA 1NAKH 2VLKA 4K2UL 3WBDA 1NCWH 3DX7A 3CMOH 4FQLL 3UMTA 3OF6D 3RY6C 5CP7A 2P8MB 3K2UH 5DD0L 4JGMA 4N0CD 5ILTH 3FB8A 2ZSWB 1IM9D 1K9TA 5TQ0L 5T1DL 2BX5A 1OM3L 4K7PL 4NJAH 3QA3B 1Q0XL 5C0FA 2AEPL 2FEEL 3UBXG 3P0GB 1RJCA 2P43B 5L2KE 2J8UF 2F8OA 2X10A 4NO2A 4TTDD 2HG5A 4NKMB 4LLDB 3MOQA 1CL7I 3SE4A 1YZZA 3C9NB 3WFEL 4F7PA 4LVOC 1GGCL 1A6TA 5EZOH 4LLMA 4J6RH 5AD0B 4ISVB 3RWDA 1W8NA 3VGHA 4G9FB 1V7ML 3RKDC 1DBJH 3GSUA 3ECBA 3PWLB 4HUVB 5D2LA 5JR1H 1GC1C 4U0RB 5HYSB 1PVHA 4JFED 4GLRI 5FO8A 2XN9B 2OXGA 4BFGA 1E4WL 2ZOKA 1TQCB 2WIIA 1UWGL 3UTSD 3P3YA 4N5UA 1S78D 2XWBB 3OXRB 5LGHL 1HHGA 2NY2C 3U0WH 2YN5A 2W0PA 3BPOB 3IJSB 1NPUA 4JFZH 4JM2A 2VQTA 5C0AD 3LS4L 5D5ME 5BW7C 5I1DA 3OGCA 4NO3A 2NW2A 5JHLH 4KAQH 2X4QA 2R9HD 3MR9A 2WP3T 1K4DB 4NFDA 3EOYG 3TJEL 1MHHB 2AXJA 3A6OA 1H9VA 3PV6A 2X9YA 4OFVA 4CU6A 4L1HA 1JPTH 1JPGA 3QUML 4KXZH 4FS0A 4U1LB 4X9BA 3CUPB 4U1KA 1HYSC 5C70A 2R2BA 3VXPB 3MCLH 1OGAD 4P46A 3AY4A 1J9CT 4I48A 1VEOA 3NIDE 1OP9A 4JKKA 1X5HA 5I2IA 3QXWA 5LCVL 5DJCB 4ENED 3STZB 3VWJB 3UTSE 2C3VA 2J8UA 4WI4A 1LILA 2Q6WA 3SDXF 5SWSA 3K1DA 5IHZA 2QHRL 5C0AE 2CRYA 3GMPB 1T0NB 4K3EH 4MA3B 5IFAL 3F7PC 2E27L 5ID1B 3L3OB 1DJSA 2X89A 2CLZA 4U1NA 5DMYA 4R90H 5BRZD 3WLBB 1JMXA 1CICD 1N3NA 4XP4H 2G9HA 4OD3L 5I8EB 1TLKA 4G3YH 5C8JB 5GS0L 1QEWB 1HEZA 1YNKL 2VH5L 1JTPA 4Y4HA 4YDKL 1OGAE 4GFTB 3TBWA 5BS0A 1QYGH 1HKLH 5DS8B 3RUGE 3HR5B 5JHDD 1KBGH 1I3RB 2DQIL 1EFXD 3MRRB 4PG9A 4Y5XB 4JHBA 2OMBA 4XNXH 3IXAB 3C5ZC 3D0LB 2VSDA 1T04B 4PY7B 5EOCH 1QP1A 3ESVF 2W91A 1ORSA 2DM2A 3X3GH 4ZFOA 4H0IA 2E7LA 1BZ9B 3BN9D 3IAQA 4ZS7L 2FR4B 5ICXA 3G5YA 1FFPA 1HWGB 1NDMB 3CLEH 4BQBA 4JKPH 3OR7A 5BRZE 3EOBB 5F1OB 4QRSB 1AR2A 1W72L 2FATH 4OGYH 5A16B 5ERWA 2HT4C 3BD3A 2ZUTA 3UBXB 3S3PA 2NX5B 1UXWA 3SKJL 1JMZA 3I6GA 3QQ9C 1JGDA 3WV0A 4X6EA 4ZXBA 1GL4B 4GRWB 4ZG1A 1FL5B 2ZCKL 5JHDE 4I0PD 5DUPL 2YBRB 3PGCB 5KAQF 2NYYC 4G42B 1I1RA 2M8XA 1KG0B 1JN6B 4Z0XA 3SDXA 3CDGB 3BGMA 5CWSA 5FKPA 3MZGB 4XMKL 1UWXK 4P5MB 4QRRD 1BBJB 3F12A 1DANT 1TFHA 1RIUH 4HWBL 1A9EA 3R1GH 4ELMA 3S34H 4M02A 4L8SC 4N8CH 4I3GA 5JW3H 1X7QB 4NNYA 3MRPA 1XF3B 2EDYA 2YK1L 5D7IE 4EDXA 2OLDA 4NSKA 4Z7UE 1MJUH 1R3IH 4WY7L 2EYRA 4N9OB 3DLQR 3EFDH 1MI5B 1XGUB 4M6NH 5E8NA 1UACL 3ULSA 2PXYA 5CEZH 4OQTH 3IETA 5D7LA 3GHEH 3PWPA 3EYOA 3OR6A 2PCPB 1ZHLB 1BEYH 3T3ME 4FG6C 4QWWC 4GMSL 4TULL 1GZQA 3MV9B 1QSFB 5ACZB 1CR9L 3NCMA 3SO3B 1P9MA 4JHAL 1GAFH 2XWJB 1IKFL 4IRSC 1TZIB 2D7TH 1AD0B 4QRRE 5GQBA 3TO4C 3PJSA 5D6DC 1B2WL 5DYOB 3BEWB 5TF1H 3RL1A 1IKNC 4YC2B 2H8PA 1NGXB 2AGJH 4XMLH 2WK2A 2IBBA 3V7AG 1S9XB 3G6DL 3CGTA 3MBED 4GAJL 2IFFH 5J13B 2R15A 5H37G 1I1CA 3I75A 4U33A 4FQ2L 3UPRB 1QSED 2RFXA 3U48A 4Q9QL 4O5LL 1Z3GL 3IKCB 4PJ5A 3O2DH 1UB6B 3CC5B 1J1XH 4K3JL 3K8MA 3O6LL 3PP3H 2OQJA 4G7YL 4BSVA 5CFHA 4PJDF 2P7TA 2EDTA 1UJ3B 2Z8WC 5GGUA 4S2SB 3BD4A 3PWJA 1EGJH 1Z9MA 3EFFA 2J3SA 3FB6B 4CMMB 3L95B 4HKXA 5E8DL 1F3JA 3WFDH 1A6UH 3C09C 3MNVA 3LS5H 3S98A 5JW5B 2P1YA 1NCWL 2R0KH 4CDGC 1CE1H 3E6HA 3R0MA 3UTOA 5DEFA 3HCVB 3K2UL 2GUOB 1KLUB 1QSEE 2F58H 3C60B 3TBTA 5JOEA 4RIRB 4JPVH 3FO1A 5I75C 4EI5A 2VTFA 4NJAL 1C08B 4F7TA 3GSOB 3QEUB 4XNMB 3WIFA 4U2ZA 4G80A 1LQSR 2FO1A 5FA4B 3UCRA 2EEAA 3FQXA 4TSAL 3P9LA 3L3KA 3MUHL 1FIGL 4GBXD 2W9EH 3BJLA 1XGQA 5C6PB 5AG9A 4JAMB 3C8KB 5EZOL 1J0ZA 2UYLA 5KSVA 4LFHD 4MCZB 1CFTB 5TDPA 1CK0H 4PLJC 2Y25A 4MQ7B 1YNLH 2AQ3A 2BCKB 4PJCB 1UB5A 1WAAE 2YXFA 1EA9C 1R3KB 3CDYA 2DF3A 3GB7A 4FP8L 1E4KC 3LSOB 1WZMA 3MXVH 1NKRA 3OAUH 3RRQA 5TE7H 3T0EC 3QXTA 4NQCB 1RAMA 1Q72H 4R3SA 3EDFA 3WS3B 3ARWA 3FHQA