5CP9A

The structure of the nk1 fragment of hgf/sf complexed with mb605
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
173
structure length
173
Chain Sequence
TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 41
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 5cp9A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 5cp9A01
1GP9A 2Q8BA 3MKPA 4R1AA 5CS9A 5CT2A 1NL2A 1HPKA 3ZWZA 1GMNA 1NL1A 2KNFA 1KDUA 4Z09A 4BV5A 2X2ZA 1W81A 2SPTA 5CT1A 1KI0A 3SRJA 5CP9A 2QJ4A 1YXEA 5HPGA 2K4RA 1KIVA 1HKYA 3BT2A 5COEA 4O03A 4Z0DA 1W8KA 3HN4A 2Z8VA 5I25A 2PF1A 3LAQA 1CEAA 4IUAA 4BVDA 4APLA 3HMSA 2K51A 2L0SA 2KJ4A 1CEBA 4Z0EA 1GMOA 1URKA 4KIVA 5CS1A 4BV7A 5EOKA 1A0HA 2Q8AA 1PK4A 1B2IA 1PMKA 1PK2A 5CS5A 2J8LA 3SP8A 2HGFA 4BVCA 4Z0FA 3BT1A 4UV6A 3HMRA 5CSQA 4R1CA 2I9BA 2LL3A 4BVVA 1I5KA 2DOHX 3ZLEA 3HMTA 4NZQA 3U73A 4A5TS 2YIOA 2DOIA 3SRIA 1BHTA 2FD6A 2J8JA 5CT3A 2K13X 2HPQP 2PF2A 4DURA 2F83A 2FEBA 4CIKA 4BVWA 2LL4M 1Z40A 4D3CA 1NK1A 4APMA 1JFNA 1I8NA 2I9AA 3E6PL 2YIPA 3NXPA 1KRNA 4R1BA 2Z8WA 4UAOA 5EODA 4R19A 2Y8RA 3KIVA 2QJ2A 1PMLA 1TPKA 2HPPP 5CS3A 2YILA 1I71A 3K65A 4HZHA 2PK4A 1PKRA 1HPJA
chains in the Genus database with same CATH superfamily
1GP9A 2Q8BA 3MKPA 2KL5A 4R1AA 5CS9A 5CT2A 1NL2A 1HPKA 3ZWZA 1GMNA 1NL1A 2KNFA 1KDUA 4Z09A 4BV5A 2X2ZA 1W81A 2SPTA 5CT1A 1KI0A 3SRJA 5CP9A 2QJ4A 1YXEA 5HPGA 2K4RA 1KIVA 1HKYA 3BT2A 5COEA 4O03A 4Z0DA 1W8KA 4YIZA 3HN4A 2Z8VA 5I25A 2PF1A 3LAQA 1CEAA 4IUAA 4BVDA 4APLA 3HMSA 2K51A 2L0SA 2KJ4A 1CEBA 4Z0EA 1GMOA 1URKA 4KIVA 5CS1A 4BV7A 5EOKA 1A0HA 2Q8AA 1PK4A 1B2IA 1PMKA 1PK2A 5CS5A 2J8LA 3SP8A 2HGFA 4BVCA 4Z0FA 3BT1A 4UV6A 3HMRA 5CSQA 4R1CA 2I9BA 2LL3A 4BVVA 1I5KA 2DOHX 3ZLEA 3HMTA 4NZQA 3U73A 4A5TS 2YIOA 2DOIA 3SRIA 1BHTA 2FD6A 4YIVA 2J8JA 5CT3A 2K13X 2HPQP 2PF2A 4DURA 2F83A 2FEBA 4CIKA 4BVWA 2LL4M 1Z40A 4D3CA 1NK1A 4APMA 1JFNA 1I8NA 2I9AA 3E6PL 2YIPA 3NXPA 1KRNA 4R1BA 2Z8WA 4UAOA 5EODA 4R19A 2Y8RA 3KIVA 2QJ2A 1PMLA 1TPKA 2HPPP 5CS3A 2YILA 1I71A 3K65A 4HZHA 2PK4A 1PKRA 1HPJA
chains in the Genus database with same CATH topology
1GP9A 2Q8BA 3MKPA 2KL5A 4R1AA 5CS9A 5CT2A 1NL2A 1HPKA 3ZWZA 1GMNA 1NL1A 2KNFA 1KDUA 4Z09A 4BV5A 2X2ZA 1W81A 2SPTA 5CT1A 1KI0A 3SRJA 5CP9A 2QJ4A 1YXEA 5HPGA 2K4RA 1KIVA 1HKYA 3BT2A 5COEA 4O03A 4Z0DA 1W8KA 4YIZA 3HN4A 2Z8VA 5I25A 2PF1A 3LAQA 1CEAA 4IUAA 4BVDA 4APLA 3HMSA 2K51A 2L0SA 2KJ4A 1CEBA 4Z0EA 1GMOA 1URKA 4KIVA 5CS1A 4BV7A 5EOKA 1A0HA 2Q8AA 1PK4A 1B2IA 1PMKA 1PK2A 5CS5A 2J8LA 3SP8A 2HGFA 4BVCA 4Z0FA 3BT1A 4UV6A 3HMRA 5CSQA 4R1CA 2I9BA 2LL3A 4BVVA 1I5KA 2DOHX 3ZLEA 3HMTA 4NZQA 3U73A 4A5TS 2YIOA 2DOIA 3SRIA 1BHTA 2FD6A 4YIVA 2J8JA 5CT3A 2K13X 2HPQP 2PF2A 4DURA 2F83A 2FEBA 4CIKA 4BVWA 2LL4M 1Z40A 4D3CA 1NK1A 4APMA 1JFNA 1I8NA 2I9AA 3E6PL 2YIPA 3NXPA 1KRNA 4R1BA 2Z8WA 4UAOA 5EODA 4R19A 2Y8RA 3KIVA 2QJ2A 1PMLA 1TPKA 2HPPP 5CS3A 2YILA 1I71A 3K65A 4HZHA 2PK4A 1PKRA 1HPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GP9 A;  2Q8B A;  3MKP A;  4R1A A;  5CS9 A;  5CT2 A;  1NL2 A;  1HPK A;  3ZWZ A;  1GMN A;  1NL1 A;  2KNF A;  1KDU A;  4Z09 A;  4BV5 A;  2X2Z A;  1W81 A;  2SPT A;  5CT1 A;  1KI0 A;  3SRJ A;  5CP9 A;  2QJ4 A;  1YXE A;  5HPG A;  2K4R A;  1KIV A;  1HKY A;  3BT2 A;  5COE A;  4O03 A;  4Z0D A;  1W8K A;  3HN4 A;  2Z8V A;  5I25 A;  2PF1 A;  3LAQ A;  1CEA A;  4IUA A;  4BVD A;  4APL A;  3HMS A;  2K51 A;  2L0S A;  2KJ4 A;  1CEB A;  4Z0E A;  1GMO A;  1URK A;  4KIV A;  5CS1 A;  4BV7 A;  5EOK A;  1A0H A;  2Q8A A;  1PK4 A;  1B2I A;  1PMK A;  1PK2 A;  5CS5 A;  2J8L A;  3SP8 A;  2HGF A;  4BVC A;  4Z0F A;  3BT1 A;  4UV6 A;  3HMR A;  5CSQ A;  4R1C A;  2I9B A;  2LL3 A;  4BVV A;  1I5K A;  2DOH X;  3ZLE A;  3HMT A;  4NZQ A;  3U73 A;  4A5T S;  2YIO A;  2DOI A;  3SRI A;  1BHT A;  2FD6 A;  2J8J A;  5CT3 A;  2K13 X;  2HPQ P;  2PF2 A;  4DUR A;  2F83 A;  2FEB A;  4CIK A;  4BVW A;  2LL4 M;  1Z40 A;  4D3C A;  1NK1 A;  4APM A;  1JFN A;  1I8N A;  2I9A A;  3E6P L;  2YIP A;  3NXP A;  1KRN A;  4R1B A;  2Z8W A;  4UAO A;  5EOD A;  4R19 A;  2Y8R A;  3KIV A;  2QJ2 A;  1PML A;  1TPK A;  2HPP P;  5CS3 A;  2YIL A;  1I71 A;  3K65 A;  4HZH A;  2PK4 A;  1PKR A;  1HPJ A; 
#chains in the Genus database with same CATH topology
 1GP9 A;  2Q8B A;  3MKP A;  2KL5 A;  4R1A A;  5CS9 A;  5CT2 A;  1NL2 A;  1HPK A;  3ZWZ A;  1GMN A;  1NL1 A;  2KNF A;  1KDU A;  4Z09 A;  4BV5 A;  2X2Z A;  1W81 A;  2SPT A;  5CT1 A;  1KI0 A;  3SRJ A;  5CP9 A;  2QJ4 A;  1YXE A;  5HPG A;  2K4R A;  1KIV A;  1HKY A;  3BT2 A;  5COE A;  4O03 A;  4Z0D A;  1W8K A;  4YIZ A;  3HN4 A;  2Z8V A;  5I25 A;  2PF1 A;  3LAQ A;  1CEA A;  4IUA A;  4BVD A;  4APL A;  3HMS A;  2K51 A;  2L0S A;  2KJ4 A;  1CEB A;  4Z0E A;  1GMO A;  1URK A;  4KIV A;  5CS1 A;  4BV7 A;  5EOK A;  1A0H A;  2Q8A A;  1PK4 A;  1B2I A;  1PMK A;  1PK2 A;  5CS5 A;  2J8L A;  3SP8 A;  2HGF A;  4BVC A;  4Z0F A;  3BT1 A;  4UV6 A;  3HMR A;  5CSQ A;  4R1C A;  2I9B A;  2LL3 A;  4BVV A;  1I5K A;  2DOH X;  3ZLE A;  3HMT A;  4NZQ A;  3U73 A;  4A5T S;  2YIO A;  2DOI A;  3SRI A;  1BHT A;  2FD6 A;  4YIV A;  2J8J A;  5CT3 A;  2K13 X;  2HPQ P;  2PF2 A;  4DUR A;  2F83 A;  2FEB A;  4CIK A;  4BVW A;  2LL4 M;  1Z40 A;  4D3C A;  1NK1 A;  4APM A;  1JFN A;  1I8N A;  2I9A A;  3E6P L;  2YIP A;  3NXP A;  1KRN A;  4R1B A;  2Z8W A;  4UAO A;  5EOD A;  4R19 A;  2Y8R A;  3KIV A;  2QJ2 A;  1PML A;  1TPK A;  2HPP P;  5CS3 A;  2YIL A;  1I71 A;  3K65 A;  4HZH A;  2PK4 A;  1PKR A;  1HPJ A; 
#chains in the Genus database with same CATH homology
 1GP9 A;  2Q8B A;  3MKP A;  2KL5 A;  4R1A A;  5CS9 A;  5CT2 A;  1NL2 A;  1HPK A;  3ZWZ A;  1GMN A;  1NL1 A;  2KNF A;  1KDU A;  4Z09 A;  4BV5 A;  2X2Z A;  1W81 A;  2SPT A;  5CT1 A;  1KI0 A;  3SRJ A;  5CP9 A;  2QJ4 A;  1YXE A;  5HPG A;  2K4R A;  1KIV A;  1HKY A;  3BT2 A;  5COE A;  4O03 A;  4Z0D A;  1W8K A;  4YIZ A;  3HN4 A;  2Z8V A;  5I25 A;  2PF1 A;  3LAQ A;  1CEA A;  4IUA A;  4BVD A;  4APL A;  3HMS A;  2K51 A;  2L0S A;  2KJ4 A;  1CEB A;  4Z0E A;  1GMO A;  1URK A;  4KIV A;  5CS1 A;  4BV7 A;  5EOK A;  1A0H A;  2Q8A A;  1PK4 A;  1B2I A;  1PMK A;  1PK2 A;  5CS5 A;  2J8L A;  3SP8 A;  2HGF A;  4BVC A;  4Z0F A;  3BT1 A;  4UV6 A;  3HMR A;  5CSQ A;  4R1C A;  2I9B A;  2LL3 A;  4BVV A;  1I5K A;  2DOH X;  3ZLE A;  3HMT A;  4NZQ A;  3U73 A;  4A5T S;  2YIO A;  2DOI A;  3SRI A;  1BHT A;  2FD6 A;  4YIV A;  2J8J A;  5CT3 A;  2K13 X;  2HPQ P;  2PF2 A;  4DUR A;  2F83 A;  2FEB A;  4CIK A;  4BVW A;  2LL4 M;  1Z40 A;  4D3C A;  1NK1 A;  4APM A;  1JFN A;  1I8N A;  2I9A A;  3E6P L;  2YIP A;  3NXP A;  1KRN A;  4R1B A;  2Z8W A;  4UAO A;  5EOD A;  4R19 A;  2Y8R A;  3KIV A;  2QJ2 A;  1PML A;  1TPK A;  2HPP P;  5CS3 A;  2YIL A;  1I71 A;  3K65 A;  4HZH A;  2PK4 A;  1PKR A;  1HPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...