5CPHA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 63
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5cphA00
3EHHA 4V25A 3TTZA 2HG1A 3OMUA 3T2SA 1MU5A 4LPBA 4HY1A 3INXA 4XIRA 3RKZA 1AH8A 3RLPA 3A0WA 1AH6A 3SL2A 4FMTA 1GKXA 3BMYA 2YE9A 3Q5KA 4U7OA 5IDJA 4ZVIA 2YEJA 2ZKJA 1UYIA 4HZ0A 1JM6A 2YK2A 2YE7A 2YJXA 4CWFA 4LWHA 3HHUA 2XHTA 4HZ5A 4CE3A 4XKKA 2H8MA 1ZWHA 3HYYA 1YC4A 2YKBA 3OPDA 4CWTA 2WEPA 1S14A 2O1WA 4JQLA 1Z5AA 4XE2A 2XX5A 4HXZA 4EFUA 3ZXQA 4GGLA 4XKOA 2YE4A 4NH9A 5D6PA 2Q8GA 2IORA 1I5AA 2XJGA 1A4HA 3U2KA 2BRCA 3EKRA 3GIFA 4CWSA 4MPEA 1UYFA 1BYQA 4K4OA 5D6QA 1YESA 3HEKA 2YE5A 3R4OA 1UYMA 2XDXA 2XK2A 2YEAA 2FXSA 3BM9A 4B7PA 5J71A 3CGZA 1S16A 5M4MA 3QTFA 2IOPA 4PRXA 2YE6A 4EMVA 2IWXA 2BYIA 2BU8A 4UROA 4EGIA 1UY6A 2XJJA 3OW6A 1YT1A 4I5SA 4KP4A 4YKWA 4LWFA 4Q20A 3TUHA 2VCIA 2YKIA 3A0ZA 3H4LA 4CE1A 1YSRA 3G7EA 3EHJA 3O6OA 1UY7A 4EGHA 2CGFA 5CTXA 3U2DA 4MBCA 4YKUA 4LP0A 4GEEA 5IN9A 4E02A 2CCTA 1BGQA 4YKZA 3A0XA 4MOTA 3WHAA 3CRLA 4AS9A 1ZW9A 3K97A 1B3QA 1Z5BA 1Y8NA 3LPSA 4URNA 2ZBKB 2YGAA 2YJWA 2ZDYA 1I59A 4P8OA 4E01A 1KIJA 2FWZA 3TZ0A 4QPJA 2WEQA 1OSFA 3O0IA 3EHGA 1YERA 3A0YA 2CG9A 1I5DA 4YKXA 3VHCA 3DGEA 2Q2EB 2PNRA 1TH8A 1UY8A 4HYPA 4ASGA 2CCSA 4YKRA 3IEDA 4P7AA 3FV5A 1YC3A 1PVGA 4KSGA 1YC1A 3GIGA 1ID0A 2VWCA 2YGEA 2YEEA 1UYEA 4H7QA 4KQVA 1UY9A 4XIPA 4HYMA 4HY6A 2YKJA 5D7RA 2HCHA 4BAEA 3D2RA 4L91A 2XJXA 3TZ4A 4KFGA 3ZKBA 4DUHA 1BKNA 2XCMA 3PEJA 2BU5A 4URMA 2FYPA 3GIEA 1UYCA 2BYHA 4X9LA 3CWVA 2HKJA 1TBWA 3K99A 2VW5A 2Q8IA 5M4KA 3D36A 4U93A 4R3MA 2YKEA 1QY8A 3HZ5A 2YEGA 3G75A 3R4NA 4BXIA 2H55A 3ZM7A 2CH4A 2Q8FA 1I5BA 3JZ3A 4YKYA 3ZKDA 4CWQA 2WI3A 3FT8A 4KTNA 3B25A 4WUBA 1I58A 3CGYA 3OWBA 4O09A 2XHRA 2XX4A 4XIQA 5CPHA 1THNA 2YI0A 1TIDA 4W7TA 5FNCA 4XCJA 1EI1A 3NMQA 2WERA 2YE2A 3T10A 1QZRA 4I3HA 4NH8A 2UWDA 2E0AA 1Z5CA 1YSZA 5FNDA 2WI2A 5D7CA 4LWEA 2BTZA 4EEHA 2WI6A 2CCUA 3Q5JA 4JAUA 5D7DA 1AM1A 4WUDA 3FT5A 2IOQA 3R4PA 3B26A 1NHHA 2BU6A 1B62A 3CRKA 1TILA 4ZKIA 4QPKA 4MB9A 4DZYA 4PRVA 4LWGA 3VHAA 3TZ2A 2YKCA 2WI1A 2JJCA 4FPPA 4KSHA 2YEBA 2O1VA 3MNRP 4BIZA 2YE3A 5M4PA 2XDUA 2XD6A 3Q5LA 3K60A 4GFNA 4L8ZA 2QFOA 4FCRA 3R4MA 1BXDA 2WI7A 4ASAA 1UYLA 3C11A 4XKAA 2ZDXA 4ASFA 5M4NA 1ZXMA 1UYGA 1U2OA 4YKTA 3R91A 4PU9A 2YI5A 2BU2A 1I5CA 2YEIA 4O04A 4L93A 2GFDA 2YGFA 1B63A 3RLQA 2WI5A 2ESAA 1H7UA 4O0BA 2IWSA 3PEHA 3TZ5A 1UYHA 3C0EA 1GKZA 2QG2A 5F5RA 3LNUA 3A0TA 1KZNA 2XDLA 4YKQA 2GQPA 1YETA 4XD8A 4CWNA 1NHJA 5M4HA 4R3AA 4B6CA 5FWKA 5CTYA 3INWA 3QDDA 5C93A 1Y8OA 1Y4UA 1Y4SA 2YECA 4BQJA 4XTJA 4PL9A 2XDKA 4GCZA 2XX2A 4FCQA 4R1FA 1U0ZA 2XDSA 2YI6A 1QYEA 4L90A 5CTWA 3ZXOA 1TC0A 3R92A 5L3JA 4WUCA 1TC6A 1YT0A 2QF6A 4MPNA 3B28A 4O05A 4MP2A 2EXLA 1GJVA 4XDMA 3HZ1A 2BZ5A 3U67A 4AWOA 2XABA 4FCPA 4AWPA 4URLA 4MPCA 4AWQA 2IWUA 4E00A 3B27A 4L94A 5CF0A 2BREA 2AKPA 3EHFA 2BU7A 1MX0A 2YEFA 4BIUA 1UYDA 4CWRA 1US7A 5BOCA 1H7SA 5GGZA 3GIGB 3T1KA 1AMWA 3K98A 2WI4A 4JASA 3OWDA 3WQ9A 2K5BA 3HYZA 2YEHA 5CTUA 2BSMA 4GQTA 4MP7A 3G7BA 5IDMA 1EA6A 3T0HA 1YS3A 3T0ZA 4CWOA 1Y8PA 5M4EA 2VCJA 1ZXNA 4XITA 4V26A 1R62A 5F3KA 5BODA 2Q8HA 2QG0A 3VHDA 2JKIA 3A0RA 4CWPA 3RLRA 4BQGA 4H81A 1AJ6A 2BT0A 2YE8A 1Z59A 4LWIA 2YK9A 3KE6A 4U7NA 3O2FA 4JAVA 3D0BA 1L0OA 4EM7A 5J6AA 2O1UA 3B24A 3H80A 4EFTA 3EKOA 1YT2A 5FNFA 4GT8A 2XHXA 4XCLA 4EGKA 4ASBA 4H85A 2C2AA 2FWYA 4NH7A 4HXWA 4CE2A 4O07A 1UYKA 2YI7A 3VADA 2YEDA 4XC0A 1NHIA
chains in the Genus database with same CATH superfamily
3EHHA 4V25A 3TTZA 2HG1A 3OMUA 3T2SA 1MU5A 4LPBA 4HY1A 3INXA 4XIRA 3RKZA 1AH8A 3RLPA 3A0WA 1AH6A 3SL2A 4FMTA 1GKXA 3BMYA 2YE9A 3Q5KA 4U7OA 5IDJA 4ZVIA 2YEJA 2ZKJA 1UYIA 4HZ0A 1JM6A 2YK2A 2YE7A 2YJXA 4CWFA 4LWHA 3HHUA 2XHTA 4HZ5A 4CE3A 4XKKA 2H8MA 1ZWHA 3HYYA 1YC4A 2YKBA 3OPDA 4CWTA 2WEPA 1S14A 2O1WA 4JQLA 1Z5AA 4XE2A 2XX5A 4HXZA 4EFUA 3ZXQA 4GGLA 4XKOA 2YE4A 4NH9A 5D6PA 2Q8GA 2IORA 1I5AA 2XJGA 1A4HA 3U2KA 2BRCA 3EKRA 3GIFA 4CWSA 4MPEA 1UYFA 1BYQA 4K4OA 5D6QA 1YESA 3HEKA 2YE5A 3R4OA 1UYMA 2XDXA 2XK2A 2YEAA 2FXSA 3BM9A 4B7PA 5J71A 3CGZA 1S16A 2C1IA 5M4MA 3QTFA 2IOPA 4PRXA 2YE6A 4EMVA 2IWXA 2BYIA 2BU8A 4UROA 4EGIA 2HHIA 1UY6A 2XJJA 3OW6A 1YT1A 4I5SA 4KP4A 4YKWA 4LWFA 4Q20A 3TUHA 2VCIA 2YKIA 3A0ZA 3H4LA 4CE1A 1YSRA 3G7EA 3EHJA 3O6OA 1UY7A 4EGHA 2CGFA 5CTXA 3U2DA 4MBCA 4YKUA 4LP0A 4GEEA 5IN9A 4E02A 2CCTA 1BGQA 4YKZA 3A0XA 4MOTA 3WHAA 3CRLA 4AS9A 1ZW9A 3K97A 1B3QA 1Z5BA 1Y8NA 3LPSA 4URNA 2ZBKB 2YGAA 2YJWA 2ZDYA 1I59A 4P8OA 4E01A 1KIJA 2FWZA 3TZ0A 4QPJA 2WEQA 1OSFA 3O0IA 3EHGA 1YERA 3A0YA 2CG9A 1I5DA 4YKXA 3VHCA 3DGEA 2Q2EB 2PNRA 1TH8A 1UY8A 4HYPA 4ASGA 2CCSA 4YKRA 3IEDA 4P7AA 3FV5A 1YC3A 1PVGA 4KSGA 1YC1A 3GIGA 1ID0A 2VWCA 2YGEA 2YEEA 1UYEA 4H7QA 4KQVA 1UY9A 4XIPA 4HYMA 4HY6A 2YKJA 5D7RA 2HCHA 4BAEA 3D2RA 4L91A 2XJXA 3TZ4A 4KFGA 3ZKBA 4DUHA 1BKNA 2XCMA 3PEJA 2BU5A 4URMA 2FYPA 3GIEA 1UYCA 2BYHA 4X9LA 3CWVA 2HKJA 1TBWA 3K99A 2VW5A 2Q8IA 5M4KA 3D36A 4U93A 4R3MA 2YKEA 1QY8A 3HZ5A 2YEGA 3G75A 3R4NA 4BXIA 2H55A 3ZM7A 2CH4A 2Q8FA 1I5BA 3JZ3A 4YKYA 3ZKDA 4CWQA 2WI3A 3FT8A 4KTNA 2C1GA 3B25A 4WUBA 1I58A 3CGYA 3OWBA 4O09A 2XHRA 2XX4A 4XIQA 5CPHA 1THNA 2YI0A 1TIDA 4W7TA 5FNCA 4XCJA 1EI1A 3NMQA 2WERA 3CYGA 2YE2A 3T10A 1QZRA 4I3HA 4NH8A 2UWDA 2E0AA 1Z5CA 1YSZA 5FNDA 2WI2A 5D7CA 3S5TA 4LWEA 2BTZA 4EEHA 2WI6A 2CCUA 3Q5JA 4JAUA 1F51A 5D7DA 1AM1A 4WUDA 3FT5A 2IOQA 3R4PA 3B26A 1NHHA 2BU6A 1B62A 3CRKA 1TILA 4ZKIA 4QPKA 4MB9A 4DZYA 4PRVA 4LWGA 3VHAA 3TZ2A 2YKCA 2WI1A 2JJCA 4FPPA 4KSHA 2YEBA 2O1VA 3MNRP 4BIZA 2YE3A 5M4PA 2XDUA 2XD6A 3Q5LA 3K60A 4GFNA 4L8ZA 2QFOA 4FCRA 3R4MA 1BXDA 2WI7A 4ASAA 1UYLA 3C11A 4XKAA 2ZDXA 4ASFA 5M4NA 1ZXMA 1UYGA 1U2OA 4YKTA 3R91A 4PU9A 2YI5A 2BU2A 1I5CA 2YEIA 4O04A 4L93A 2GFDA 2YGFA 1B63A 3RLQA 2WI5A 2ESAA 1H7UA 4O0BA 2IWSA 3PEHA 3TZ5A 4E72A 1UYHA 3C0EA 1GKZA 2QG2A 5F5RA 3LNUA 3A0TA 1KZNA 2XDLA 4YKQA 2GQPA 1YETA 4XD8A 4CWNA 1NHJA 5M4HA 4R3AA 4B6CA 5FWKA 5CTYA 3INWA 3QDDA 5C93A 1Y8OA 1Y4UA 1Y4SA 2YECA 4BQJA 4XTJA 4PL9A 2XDKA 4GCZA 2XX2A 4FCQA 4R1FA 1U0ZA 2XDSA 2YI6A 1QYEA 4L90A 5CTWA 3ZXOA 1TC0A 3R92A 5L3JA 4WUCA 1TC6A 1YT0A 2QF6A 4MPNA 3B28A 4O05A 4MP2A 2EXLA 1GJVA 4XDMA 3HZ1A 2BZ5A 3U67A 4AWOA 2XABA 4FCPA 4AWPA 4URLA 4MPCA 4AWQA 2IWUA 4E00A 3B27A 4L94A 5CF0A 2BREA 2AKPA 3EHFA 2BU7A 2FTKA 1MX0A 2YEFA 4BIUA 1UYDA 4CWRA 1US7A 5BOCA 1H7SA 5GGZA 3GIGB 3T1KA 1AMWA 3K98A 2WI4A 4JASA 3OWDA 3WQ9A 2K5BA 3HYZA 2YEHA 5CTUA 2BSMA 4GQTA 4MP7A 3G7BA 5IDMA 1EA6A 3T0HA 1YS3A 3T0ZA 4CWOA 1Y8PA 5M4EA 2VCJA 1ZXNA 4XITA 4V26A 1R62A 5F3KA 5BODA 2Q8HA 2QG0A 3VHDA 2JKIA 3A0RA 4CWPA 3RLRA 4BQGA 4H81A 1AJ6A 2BT0A 3LMMA 2YE8A 1Z59A 4LWIA 2YK9A 3KE6A 4U7NA 3O2FA 4JAVA 3D0BA 1L0OA 4EM7A 1IXMA 5J6AA 2O1UA 3B24A 3H80A 4EFTA 3EKOA 1YT2A 5FNFA 5JENA 4GT8A 2XHXA 4XCLA 4EGKA 4ASBA 4H85A 2C2AA 2FWYA 4NH7A 4HXWA 4CE2A 4O07A 1UYKA 2YI7A 3VADA 2YEDA 4XC0A 1NHIA
chains in the Genus database with same CATH topology
3EHHA 4V25A 3TTZA 2HG1A 3OMUA 3T2SA 1MU5A 4LPBA 4HY1A 3INXA 4XIRA 3RKZA 1AH8A 3RLPA 3A0WA 1AH6A 3SL2A 4FMTA 1GKXA 3BMYA 2YE9A 3Q5KA 4U7OA 5IDJA 4ZVIA 2YEJA 2ZKJA 1UYIA 4HZ0A 1JM6A 2YK2A 2YE7A 2YJXA 4CWFA 4LWHA 3HHUA 2XHTA 4HZ5A 4CE3A 4XKKA 2H8MA 1ZWHA 3HYYA 1YC4A 2YKBA 3OPDA 4CWTA 2WEPA 1S14A 2O1WA 4JQLA 1Z5AA 4XE2A 2XX5A 4HXZA 4EFUA 3ZXQA 4GGLA 4XKOA 2YE4A 4NH9A 5D6PA 2Q8GA 2IORA 1I5AA 2XJGA 1A4HA 3U2KA 2BRCA 3EKRA 3GIFA 4CWSA 4MPEA 1UYFA 1BYQA 4K4OA 5D6QA 1YESA 3HEKA 2YE5A 3R4OA 1UYMA 2XDXA 2XK2A 2YEAA 2FXSA 3BM9A 4B7PA 5J71A 3CGZA 1S16A 5M4MA 3QTFA 2IOPA 4PRXA 2YE6A 4EMVA 2IWXA 2BYIA 2BU8A 4UROA 4EGIA 1UY6A 2XJJA 3OW6A 1YT1A 4I5SA 4KP4A 4YKWA 4LWFA 4Q20A 3TUHA 2VCIA 2YKIA 3A0ZA 3H4LA 4CE1A 1YSRA 3G7EA 3EHJA 3O6OA 1UY7A 4EGHA 2CGFA 5CTXA 3U2DA 4MBCA 4YKUA 4LP0A 4GEEA 5IN9A 4E02A 2CCTA 1BGQA 4YKZA 3A0XA 4MOTA 3WHAA 3CRLA 4AS9A 1ZW9A 3K97A 1B3QA 1Z5BA 1Y8NA 3LPSA 4URNA 2ZBKB 2YGAA 2YJWA 2ZDYA 1I59A 4P8OA 4E01A 1KIJA 2FWZA 3TZ0A 4QPJA 2WEQA 1OSFA 3O0IA 3EHGA 1YERA 3A0YA 2CG9A 1I5DA 4YKXA 3VHCA 3DGEA 2Q2EB 2PNRA 1TH8A 1UY8A 4HYPA 4ASGA 2CCSA 4YKRA 3IEDA 4P7AA 3FV5A 1YC3A 1PVGA 4KSGA 1YC1A 3GIGA 1ID0A 2VWCA 2YGEA 2YEEA 1UYEA 4H7QA 4KQVA 1UY9A 4XIPA 4HYMA 4HY6A 2YKJA 5D7RA 2HCHA 4BAEA 3D2RA 4L91A 2XJXA 3TZ4A 4KFGA 3ZKBA 4DUHA 1BKNA 2XCMA 3PEJA 2BU5A 4URMA 2FYPA 3GIEA 1UYCA 2BYHA 4X9LA 3CWVA 2HKJA 1TBWA 3K99A 2VW5A 2Q8IA 5M4KA 3D36A 4U93A 4R3MA 2YKEA 1QY8A 3HZ5A 2YEGA 3G75A 3R4NA 4BXIA 2H55A 3ZM7A 2CH4A 2Q8FA 1I5BA 3JZ3A 4YKYA 3ZKDA 4CWQA 2WI3A 3FT8A 4KTNA 3B25A 4WUBA 1I58A 3CGYA 3OWBA 4O09A 2XHRA 2XX4A 4XIQA 5CPHA 1THNA 2YI0A 1TIDA 4W7TA 5FNCA 4XCJA 1EI1A 3NMQA 2WERA 2YE2A 3T10A 1QZRA 4I3HA 4NH8A 2UWDA 2E0AA 1Z5CA 1YSZA 5FNDA 2WI2A 5D7CA 4LWEA 2BTZA 4EEHA 2WI6A 2CCUA 3Q5JA 4JAUA 5D7DA 1AM1A 4WUDA 3FT5A 2IOQA 3R4PA 3B26A 1NHHA 2BU6A 1B62A 3CRKA 1TILA 4ZKIA 4QPKA 4MB9A 4DZYA 4PRVA 4LWGA 3VHAA 3TZ2A 2YKCA 2WI1A 2JJCA 4FPPA 4KSHA 2YEBA 2O1VA 3MNRP 4BIZA 2YE3A 5M4PA 2XDUA 2XD6A 3Q5LA 3K60A 4GFNA 4L8ZA 2QFOA 4FCRA 3R4MA 1BXDA 2WI7A 4ASAA 1UYLA 3C11A 4XKAA 2ZDXA 4ASFA 5M4NA 1ZXMA 1UYGA 1U2OA 4YKTA 3R91A 4PU9A 2YI5A 2BU2A 1I5CA 2YEIA 4O04A 4L93A 2GFDA 2YGFA 1B63A 3RLQA 2WI5A 2ESAA 1H7UA 4O0BA 2IWSA 3PEHA 3TZ5A 1UYHA 3C0EA 1GKZA 2QG2A 5F5RA 3LNUA 3A0TA 1KZNA 2XDLA 4YKQA 2GQPA 1YETA 4XD8A 4CWNA 1NHJA 5M4HA 4R3AA 4B6CA 5FWKA 5CTYA 3INWA 3QDDA 5C93A 1Y8OA 1Y4UA 1Y4SA 2YECA 4BQJA 4XTJA 4PL9A 2XDKA 4GCZA 2XX2A 4FCQA 4R1FA 1U0ZA 2XDSA 2YI6A 1QYEA 4L90A 5CTWA 3ZXOA 1TC0A 3R92A 5L3JA 4WUCA 1TC6A 1YT0A 2QF6A 4MPNA 3B28A 4O05A 4MP2A 2EXLA 1GJVA 4XDMA 3HZ1A 2BZ5A 3U67A 4AWOA 2XABA 4FCPA 4AWPA 4URLA 4MPCA 4AWQA 2IWUA 4E00A 3B27A 4L94A 5CF0A 2BREA 2AKPA 3EHFA 2BU7A 1MX0A 2YEFA 4BIUA 1UYDA 4CWRA 1US7A 5BOCA 1H7SA 5GGZA 3GIGB 3T1KA 1AMWA 3K98A 2WI4A 4JASA 3OWDA 3WQ9A 2K5BA 3HYZA 2YEHA 5CTUA 2BSMA 4GQTA 4MP7A 3G7BA 5IDMA 1EA6A 3T0HA 1YS3A 3T0ZA 4CWOA 1Y8PA 5M4EA 2VCJA 1ZXNA 4XITA 4V26A 1R62A 5F3KA 5BODA 2Q8HA 2QG0A 3VHDA 2JKIA 3A0RA 4CWPA 3RLRA 4BQGA 4H81A 1AJ6A 2BT0A 2YE8A 1Z59A 4LWIA 2YK9A 3KE6A 4U7NA 3O2FA 4JAVA 3D0BA 1L0OA 4EM7A 5J6AA 2O1UA 3B24A 3H80A 4EFTA 3EKOA 1YT2A 5FNFA 4GT8A 2XHXA 4XCLA 4EGKA 4ASBA 4H85A 2C2AA 2FWYA 4NH7A 4HXWA 4CE2A 4O07A 1UYKA 2YI7A 3VADA 2YEDA 4XC0A 1NHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHH A;  4V25 A;  3TTZ A;  2HG1 A;  3OMU A;  3T2S A;  1MU5 A;  4LPB A;  4HY1 A;  3INX A;  4XIR A;  3RKZ A;  1AH8 A;  3RLP A;  3A0W A;  1AH6 A;  3SL2 A;  4FMT A;  1GKX A;  3BMY A;  2YE9 A;  3Q5K A;  4U7O A;  5IDJ A;  4ZVI A;  2YEJ A;  2ZKJ A;  1UYI A;  4HZ0 A;  1JM6 A;  2YK2 A;  2YE7 A;  2YJX A;  4CWF A;  4LWH A;  3HHU A;  2XHT A;  4HZ5 A;  4CE3 A;  4XKK A;  2H8M A;  1ZWH A;  3HYY A;  1YC4 A;  2YKB A;  3OPD A;  4CWT A;  2WEP A;  1S14 A;  2O1W A;  4JQL A;  1Z5A A;  4XE2 A;  2XX5 A;  4HXZ A;  4EFU A;  3ZXQ A;  4GGL A;  4XKO A;  2YE4 A;  4NH9 A;  5D6P A;  2Q8G A;  2IOR A;  1I5A A;  2XJG A;  1A4H A;  3U2K A;  2BRC A;  3EKR A;  3GIF A;  4CWS A;  4MPE A;  1UYF A;  1BYQ A;  4K4O A;  5D6Q A;  1YES A;  3HEK A;  2YE5 A;  3R4O A;  1UYM A;  2XDX A;  2XK2 A;  2YEA A;  2FXS A;  3BM9 A;  4B7P A;  5J71 A;  3CGZ A;  1S16 A;  5M4M A;  3QTF A;  2IOP A;  4PRX A;  2YE6 A;  4EMV A;  2IWX A;  2BYI A;  2BU8 A;  4URO A;  4EGI A;  1UY6 A;  2XJJ A;  3OW6 A;  1YT1 A;  4I5S A;  4KP4 A;  4YKW A;  4LWF A;  4Q20 A;  3TUH A;  2VCI A;  2YKI A;  3A0Z A;  3H4L A;  4CE1 A;  1YSR A;  3G7E A;  3EHJ A;  3O6O A;  1UY7 A;  4EGH A;  2CGF A;  5CTX A;  3U2D A;  4MBC A;  4YKU A;  4LP0 A;  4GEE A;  5IN9 A;  4E02 A;  2CCT A;  1BGQ A;  4YKZ A;  3A0X A;  4MOT A;  3WHA A;  3CRL A;  4AS9 A;  1ZW9 A;  3K97 A;  1B3Q A;  1Z5B A;  1Y8N A;  3LPS A;  4URN A;  2ZBK B;  2YGA A;  2YJW A;  2ZDY A;  1I59 A;  4P8O A;  4E01 A;  1KIJ A;  2FWZ A;  3TZ0 A;  4QPJ A;  2WEQ A;  1OSF A;  3O0I A;  3EHG A;  1YER A;  3A0Y A;  2CG9 A;  1I5D A;  4YKX A;  3VHC A;  3DGE A;  2Q2E B;  2PNR A;  1TH8 A;  1UY8 A;  4HYP A;  4ASG A;  2CCS A;  4YKR A;  3IED A;  4P7A A;  3FV5 A;  1YC3 A;  1PVG A;  4KSG A;  1YC1 A;  3GIG A;  1ID0 A;  2VWC A;  2YGE A;  2YEE A;  1UYE A;  4H7Q A;  4KQV A;  1UY9 A;  4XIP A;  4HYM A;  4HY6 A;  2YKJ A;  5D7R A;  2HCH A;  4BAE A;  3D2R A;  4L91 A;  2XJX A;  3TZ4 A;  4KFG A;  3ZKB A;  4DUH A;  1BKN A;  2XCM A;  3PEJ A;  2BU5 A;  4URM A;  2FYP A;  3GIE A;  1UYC A;  2BYH A;  4X9L A;  3CWV A;  2HKJ A;  1TBW A;  3K99 A;  2VW5 A;  2Q8I A;  5M4K A;  3D36 A;  4U93 A;  4R3M A;  2YKE A;  1QY8 A;  3HZ5 A;  2YEG A;  3G75 A;  3R4N A;  4BXI A;  2H55 A;  3ZM7 A;  2CH4 A;  2Q8F A;  1I5B A;  3JZ3 A;  4YKY A;  3ZKD A;  4CWQ A;  2WI3 A;  3FT8 A;  4KTN A;  3B25 A;  4WUB A;  1I58 A;  3CGY A;  3OWB A;  4O09 A;  2XHR A;  2XX4 A;  4XIQ A;  5CPH A;  1THN A;  2YI0 A;  1TID A;  4W7T A;  5FNC A;  4XCJ A;  1EI1 A;  3NMQ A;  2WER A;  2YE2 A;  3T10 A;  1QZR A;  4I3H A;  4NH8 A;  2UWD A;  2E0A A;  1Z5C A;  1YSZ A;  5FND A;  2WI2 A;  5D7C A;  4LWE A;  2BTZ A;  4EEH A;  2WI6 A;  2CCU A;  3Q5J A;  4JAU A;  5D7D A;  1AM1 A;  4WUD A;  3FT5 A;  2IOQ A;  3R4P A;  3B26 A;  1NHH A;  2BU6 A;  1B62 A;  3CRK A;  1TIL A;  4ZKI A;  4QPK A;  4MB9 A;  4DZY A;  4PRV A;  4LWG A;  3VHA A;  3TZ2 A;  2YKC A;  2WI1 A;  2JJC A;  4FPP A;  4KSH A;  2YEB A;  2O1V A;  3MNR P;  4BIZ A;  2YE3 A;  5M4P A;  2XDU A;  2XD6 A;  3Q5L A;  3K60 A;  4GFN A;  4L8Z A;  2QFO A;  4FCR A;  3R4M A;  1BXD A;  2WI7 A;  4ASA A;  1UYL A;  3C11 A;  4XKA A;  2ZDX A;  4ASF A;  5M4N A;  1ZXM A;  1UYG A;  1U2O A;  4YKT A;  3R91 A;  4PU9 A;  2YI5 A;  2BU2 A;  1I5C A;  2YEI A;  4O04 A;  4L93 A;  2GFD A;  2YGF A;  1B63 A;  3RLQ A;  2WI5 A;  2ESA A;  1H7U A;  4O0B A;  2IWS A;  3PEH A;  3TZ5 A;  1UYH A;  3C0E A;  1GKZ A;  2QG2 A;  5F5R A;  3LNU A;  3A0T A;  1KZN A;  2XDL A;  4YKQ A;  2GQP A;  1YET A;  4XD8 A;  4CWN A;  1NHJ A;  5M4H A;  4R3A A;  4B6C A;  5FWK A;  5CTY A;  3INW A;  3QDD A;  5C93 A;  1Y8O A;  1Y4U A;  1Y4S A;  2YEC A;  4BQJ A;  4XTJ A;  4PL9 A;  2XDK A;  4GCZ A;  2XX2 A;  4FCQ A;  4R1F A;  1U0Z A;  2XDS A;  2YI6 A;  1QYE A;  4L90 A;  5CTW A;  3ZXO A;  1TC0 A;  3R92 A;  5L3J A;  4WUC A;  1TC6 A;  1YT0 A;  2QF6 A;  4MPN A;  3B28 A;  4O05 A;  4MP2 A;  2EXL A;  1GJV A;  4XDM A;  3HZ1 A;  2BZ5 A;  3U67 A;  4AWO A;  2XAB A;  4FCP A;  4AWP A;  4URL A;  4MPC A;  4AWQ A;  2IWU A;  4E00 A;  3B27 A;  4L94 A;  5CF0 A;  2BRE A;  2AKP A;  3EHF A;  2BU7 A;  1MX0 A;  2YEF A;  4BIU A;  1UYD A;  4CWR A;  1US7 A;  5BOC A;  1H7S A;  5GGZ A;  3GIG B;  3T1K A;  1AMW A;  3K98 A;  2WI4 A;  4JAS A;  3OWD A;  3WQ9 A;  2K5B A;  3HYZ A;  2YEH A;  5CTU A;  2BSM A;  4GQT A;  4MP7 A;  3G7B A;  5IDM A;  1EA6 A;  3T0H A;  1YS3 A;  3T0Z A;  4CWO A;  1Y8P A;  5M4E A;  2VCJ A;  1ZXN A;  4XIT A;  4V26 A;  1R62 A;  5F3K A;  5BOD A;  2Q8H A;  2QG0 A;  3VHD A;  2JKI A;  3A0R A;  4CWP A;  3RLR A;  4BQG A;  4H81 A;  1AJ6 A;  2BT0 A;  2YE8 A;  1Z59 A;  4LWI A;  2YK9 A;  3KE6 A;  4U7N A;  3O2F A;  4JAV A;  3D0B A;  1L0O A;  4EM7 A;  5J6A A;  2O1U A;  3B24 A;  3H80 A;  4EFT A;  3EKO A;  1YT2 A;  5FNF A;  4GT8 A;  2XHX A;  4XCL A;  4EGK A;  4ASB A;  4H85 A;  2C2A A;  2FWY A;  4NH7 A;  4HXW A;  4CE2 A;  4O07 A;  1UYK A;  2YI7 A;  3VAD A;  2YED A;  4XC0 A;  1NHI A; 
#chains in the Genus database with same CATH topology
 3EHH A;  4V25 A;  3TTZ A;  2HG1 A;  3OMU A;  3T2S A;  1MU5 A;  4LPB A;  4HY1 A;  3INX A;  4XIR A;  3RKZ A;  1AH8 A;  3RLP A;  3A0W A;  1AH6 A;  3SL2 A;  4FMT A;  1GKX A;  3BMY A;  2YE9 A;  3Q5K A;  4U7O A;  5IDJ A;  4ZVI A;  2YEJ A;  2ZKJ A;  1UYI A;  4HZ0 A;  1JM6 A;  2YK2 A;  2YE7 A;  2YJX A;  4CWF A;  4LWH A;  3HHU A;  2XHT A;  4HZ5 A;  4CE3 A;  4XKK A;  2H8M A;  1ZWH A;  3HYY A;  1YC4 A;  2YKB A;  3OPD A;  4CWT A;  2WEP A;  1S14 A;  2O1W A;  4JQL A;  1Z5A A;  4XE2 A;  2XX5 A;  4HXZ A;  4EFU A;  3ZXQ A;  4GGL A;  4XKO A;  2YE4 A;  4NH9 A;  5D6P A;  2Q8G A;  2IOR A;  1I5A A;  2XJG A;  1A4H A;  3U2K A;  2BRC A;  3EKR A;  3GIF A;  4CWS A;  4MPE A;  1UYF A;  1BYQ A;  4K4O A;  5D6Q A;  1YES A;  3HEK A;  2YE5 A;  3R4O A;  1UYM A;  2XDX A;  2XK2 A;  2YEA A;  2FXS A;  3BM9 A;  4B7P A;  5J71 A;  3CGZ A;  1S16 A;  2C1I A;  5M4M A;  3QTF A;  2IOP A;  4PRX A;  2YE6 A;  4EMV A;  2IWX A;  2BYI A;  2BU8 A;  4URO A;  4EGI A;  2HHI A;  1UY6 A;  2XJJ A;  3OW6 A;  1YT1 A;  4I5S A;  4KP4 A;  4YKW A;  4LWF A;  4Q20 A;  3TUH A;  2VCI A;  2YKI A;  3A0Z A;  3H4L A;  4CE1 A;  1YSR A;  3G7E A;  3EHJ A;  3O6O A;  1UY7 A;  4EGH A;  2CGF A;  5CTX A;  3U2D A;  4MBC A;  4YKU A;  4LP0 A;  4GEE A;  5IN9 A;  4E02 A;  2CCT A;  1BGQ A;  4YKZ A;  3A0X A;  4MOT A;  3WHA A;  3CRL A;  4AS9 A;  1ZW9 A;  3K97 A;  1B3Q A;  1Z5B A;  1Y8N A;  3LPS A;  4URN A;  2ZBK B;  2YGA A;  2YJW A;  2ZDY A;  1I59 A;  4P8O A;  4E01 A;  1KIJ A;  2FWZ A;  3TZ0 A;  4QPJ A;  2WEQ A;  1OSF A;  3O0I A;  3EHG A;  1YER A;  3A0Y A;  2CG9 A;  1I5D A;  4YKX A;  3VHC A;  3DGE A;  2Q2E B;  2PNR A;  1TH8 A;  1UY8 A;  4HYP A;  4ASG A;  2CCS A;  4YKR A;  3IED A;  4P7A A;  3FV5 A;  1YC3 A;  1PVG A;  4KSG A;  1YC1 A;  3GIG A;  1ID0 A;  2VWC A;  2YGE A;  2YEE A;  1UYE A;  4H7Q A;  4KQV A;  1UY9 A;  4XIP A;  4HYM A;  4HY6 A;  2YKJ A;  5D7R A;  2HCH A;  4BAE A;  3D2R A;  4L91 A;  2XJX A;  3TZ4 A;  4KFG A;  3ZKB A;  4DUH A;  1BKN A;  2XCM A;  3PEJ A;  2BU5 A;  4URM A;  2FYP A;  3GIE A;  1UYC A;  2BYH A;  4X9L A;  3CWV A;  2HKJ A;  1TBW A;  3K99 A;  2VW5 A;  2Q8I A;  5M4K A;  3D36 A;  4U93 A;  4R3M A;  2YKE A;  1QY8 A;  3HZ5 A;  2YEG A;  3G75 A;  3R4N A;  4BXI A;  2H55 A;  3ZM7 A;  2CH4 A;  2Q8F A;  1I5B A;  3JZ3 A;  4YKY A;  3ZKD A;  4CWQ A;  2WI3 A;  3FT8 A;  4KTN A;  2C1G A;  3B25 A;  4WUB A;  1I58 A;  3CGY A;  3OWB A;  4O09 A;  2XHR A;  2XX4 A;  4XIQ A;  5CPH A;  1THN A;  2YI0 A;  1TID A;  4W7T A;  5FNC A;  4XCJ A;  1EI1 A;  3NMQ A;  2WER A;  3CYG A;  2YE2 A;  3T10 A;  1QZR A;  4I3H A;  4NH8 A;  2UWD A;  2E0A A;  1Z5C A;  1YSZ A;  5FND A;  2WI2 A;  5D7C A;  3S5T A;  4LWE A;  2BTZ A;  4EEH A;  2WI6 A;  2CCU A;  3Q5J A;  4JAU A;  1F51 A;  5D7D A;  1AM1 A;  4WUD A;  3FT5 A;  2IOQ A;  3R4P A;  3B26 A;  1NHH A;  2BU6 A;  1B62 A;  3CRK A;  1TIL A;  4ZKI A;  4QPK A;  4MB9 A;  4DZY A;  4PRV A;  4LWG A;  3VHA A;  3TZ2 A;  2YKC A;  2WI1 A;  2JJC A;  4FPP A;  4KSH A;  2YEB A;  2O1V A;  3MNR P;  4BIZ A;  2YE3 A;  5M4P A;  2XDU A;  2XD6 A;  3Q5L A;  3K60 A;  4GFN A;  4L8Z A;  2QFO A;  4FCR A;  3R4M A;  1BXD A;  2WI7 A;  4ASA A;  1UYL A;  3C11 A;  4XKA A;  2ZDX A;  4ASF A;  5M4N A;  1ZXM A;  1UYG A;  1U2O A;  4YKT A;  3R91 A;  4PU9 A;  2YI5 A;  2BU2 A;  1I5C A;  2YEI A;  4O04 A;  4L93 A;  2GFD A;  2YGF A;  1B63 A;  3RLQ A;  2WI5 A;  2ESA A;  1H7U A;  4O0B A;  2IWS A;  3PEH A;  3TZ5 A;  4E72 A;  1UYH A;  3C0E A;  1GKZ A;  2QG2 A;  5F5R A;  3LNU A;  3A0T A;  1KZN A;  2XDL A;  4YKQ A;  2GQP A;  1YET A;  4XD8 A;  4CWN A;  1NHJ A;  5M4H A;  4R3A A;  4B6C A;  5FWK A;  5CTY A;  3INW A;  3QDD A;  5C93 A;  1Y8O A;  1Y4U A;  1Y4S A;  2YEC A;  4BQJ A;  4XTJ A;  4PL9 A;  2XDK A;  4GCZ A;  2XX2 A;  4FCQ A;  4R1F A;  1U0Z A;  2XDS A;  2YI6 A;  1QYE A;  4L90 A;  5CTW A;  3ZXO A;  1TC0 A;  3R92 A;  5L3J A;  4WUC A;  1TC6 A;  1YT0 A;  2QF6 A;  4MPN A;  3B28 A;  4O05 A;  4MP2 A;  2EXL A;  1GJV A;  4XDM A;  3HZ1 A;  2BZ5 A;  3U67 A;  4AWO A;  2XAB A;  4FCP A;  4AWP A;  4URL A;  4MPC A;  4AWQ A;  2IWU A;  4E00 A;  3B27 A;  4L94 A;  5CF0 A;  2BRE A;  2AKP A;  3EHF A;  2BU7 A;  2FTK A;  1MX0 A;  2YEF A;  4BIU A;  1UYD A;  4CWR A;  1US7 A;  5BOC A;  1H7S A;  5GGZ A;  3GIG B;  3T1K A;  1AMW A;  3K98 A;  2WI4 A;  4JAS A;  3OWD A;  3WQ9 A;  2K5B A;  3HYZ A;  2YEH A;  5CTU A;  2BSM A;  4GQT A;  4MP7 A;  3G7B A;  5IDM A;  1EA6 A;  3T0H A;  1YS3 A;  3T0Z A;  4CWO A;  1Y8P A;  5M4E A;  2VCJ A;  1ZXN A;  4XIT A;  4V26 A;  1R62 A;  5F3K A;  5BOD A;  2Q8H A;  2QG0 A;  3VHD A;  2JKI A;  3A0R A;  4CWP A;  3RLR A;  4BQG A;  4H81 A;  1AJ6 A;  2BT0 A;  3LMM A;  2YE8 A;  1Z59 A;  4LWI A;  2YK9 A;  3KE6 A;  4U7N A;  3O2F A;  4JAV A;  3D0B A;  1L0O A;  4EM7 A;  1IXM A;  5J6A A;  2O1U A;  3B24 A;  3H80 A;  4EFT A;  3EKO A;  1YT2 A;  5FNF A;  5JEN A;  4GT8 A;  2XHX A;  4XCL A;  4EGK A;  4ASB A;  4H85 A;  2C2A A;  2FWY A;  4NH7 A;  4HXW A;  4CE2 A;  4O07 A;  1UYK A;  2YI7 A;  3VAD A;  2YED A;  4XC0 A;  1NHI A; 
#chains in the Genus database with same CATH homology
 3EHH A;  4V25 A;  3TTZ A;  2HG1 A;  3OMU A;  3T2S A;  1MU5 A;  4LPB A;  4HY1 A;  3INX A;  4XIR A;  3RKZ A;  1AH8 A;  3RLP A;  3A0W A;  1AH6 A;  3SL2 A;  4FMT A;  1GKX A;  3BMY A;  2YE9 A;  3Q5K A;  4U7O A;  5IDJ A;  4ZVI A;  2YEJ A;  2ZKJ A;  1UYI A;  4HZ0 A;  1JM6 A;  2YK2 A;  2YE7 A;  2YJX A;  4CWF A;  4LWH A;  3HHU A;  2XHT A;  4HZ5 A;  4CE3 A;  4XKK A;  2H8M A;  1ZWH A;  3HYY A;  1YC4 A;  2YKB A;  3OPD A;  4CWT A;  2WEP A;  1S14 A;  2O1W A;  4JQL A;  1Z5A A;  4XE2 A;  2XX5 A;  4HXZ A;  4EFU A;  3ZXQ A;  4GGL A;  4XKO A;  2YE4 A;  4NH9 A;  5D6P A;  2Q8G A;  2IOR A;  1I5A A;  2XJG A;  1A4H A;  3U2K A;  2BRC A;  3EKR A;  3GIF A;  4CWS A;  4MPE A;  1UYF A;  1BYQ A;  4K4O A;  5D6Q A;  1YES A;  3HEK A;  2YE5 A;  3R4O A;  1UYM A;  2XDX A;  2XK2 A;  2YEA A;  2FXS A;  3BM9 A;  4B7P A;  5J71 A;  3CGZ A;  1S16 A;  5M4M A;  3QTF A;  2IOP A;  4PRX A;  2YE6 A;  4EMV A;  2IWX A;  2BYI A;  2BU8 A;  4URO A;  4EGI A;  1UY6 A;  2XJJ A;  3OW6 A;  1YT1 A;  4I5S A;  4KP4 A;  4YKW A;  4LWF A;  4Q20 A;  3TUH A;  2VCI A;  2YKI A;  3A0Z A;  3H4L A;  4CE1 A;  1YSR A;  3G7E A;  3EHJ A;  3O6O A;  1UY7 A;  4EGH A;  2CGF A;  5CTX A;  3U2D A;  4MBC A;  4YKU A;  4LP0 A;  4GEE A;  5IN9 A;  4E02 A;  2CCT A;  1BGQ A;  4YKZ A;  3A0X A;  4MOT A;  3WHA A;  3CRL A;  4AS9 A;  1ZW9 A;  3K97 A;  1B3Q A;  1Z5B A;  1Y8N A;  3LPS A;  4URN A;  2ZBK B;  2YGA A;  2YJW A;  2ZDY A;  1I59 A;  4P8O A;  4E01 A;  1KIJ A;  2FWZ A;  3TZ0 A;  4QPJ A;  2WEQ A;  1OSF A;  3O0I A;  3EHG A;  1YER A;  3A0Y A;  2CG9 A;  1I5D A;  4YKX A;  3VHC A;  3DGE A;  2Q2E B;  2PNR A;  1TH8 A;  1UY8 A;  4HYP A;  4ASG A;  2CCS A;  4YKR A;  3IED A;  4P7A A;  3FV5 A;  1YC3 A;  1PVG A;  4KSG A;  1YC1 A;  3GIG A;  1ID0 A;  2VWC A;  2YGE A;  2YEE A;  1UYE A;  4H7Q A;  4KQV A;  1UY9 A;  4XIP A;  4HYM A;  4HY6 A;  2YKJ A;  5D7R A;  2HCH A;  4BAE A;  3D2R A;  4L91 A;  2XJX A;  3TZ4 A;  4KFG A;  3ZKB A;  4DUH A;  1BKN A;  2XCM A;  3PEJ A;  2BU5 A;  4URM A;  2FYP A;  3GIE A;  1UYC A;  2BYH A;  4X9L A;  3CWV A;  2HKJ A;  1TBW A;  3K99 A;  2VW5 A;  2Q8I A;  5M4K A;  3D36 A;  4U93 A;  4R3M A;  2YKE A;  1QY8 A;  3HZ5 A;  2YEG A;  3G75 A;  3R4N A;  4BXI A;  2H55 A;  3ZM7 A;  2CH4 A;  2Q8F A;  1I5B A;  3JZ3 A;  4YKY A;  3ZKD A;  4CWQ A;  2WI3 A;  3FT8 A;  4KTN A;  3B25 A;  4WUB A;  1I58 A;  3CGY A;  3OWB A;  4O09 A;  2XHR A;  2XX4 A;  4XIQ A;  5CPH A;  1THN A;  2YI0 A;  1TID A;  4W7T A;  5FNC A;  4XCJ A;  1EI1 A;  3NMQ A;  2WER A;  2YE2 A;  3T10 A;  1QZR A;  4I3H A;  4NH8 A;  2UWD A;  2E0A A;  1Z5C A;  1YSZ A;  5FND A;  2WI2 A;  5D7C A;  4LWE A;  2BTZ A;  4EEH A;  2WI6 A;  2CCU A;  3Q5J A;  4JAU A;  5D7D A;  1AM1 A;  4WUD A;  3FT5 A;  2IOQ A;  3R4P A;  3B26 A;  1NHH A;  2BU6 A;  1B62 A;  3CRK A;  1TIL A;  4ZKI A;  4QPK A;  4MB9 A;  4DZY A;  4PRV A;  4LWG A;  3VHA A;  3TZ2 A;  2YKC A;  2WI1 A;  2JJC A;  4FPP A;  4KSH A;  2YEB A;  2O1V A;  3MNR P;  4BIZ A;  2YE3 A;  5M4P A;  2XDU A;  2XD6 A;  3Q5L A;  3K60 A;  4GFN A;  4L8Z A;  2QFO A;  4FCR A;  3R4M A;  1BXD A;  2WI7 A;  4ASA A;  1UYL A;  3C11 A;  4XKA A;  2ZDX A;  4ASF A;  5M4N A;  1ZXM A;  1UYG A;  1U2O A;  4YKT A;  3R91 A;  4PU9 A;  2YI5 A;  2BU2 A;  1I5C A;  2YEI A;  4O04 A;  4L93 A;  2GFD A;  2YGF A;  1B63 A;  3RLQ A;  2WI5 A;  2ESA A;  1H7U A;  4O0B A;  2IWS A;  3PEH A;  3TZ5 A;  1UYH A;  3C0E A;  1GKZ A;  2QG2 A;  5F5R A;  3LNU A;  3A0T A;  1KZN A;  2XDL A;  4YKQ A;  2GQP A;  1YET A;  4XD8 A;  4CWN A;  1NHJ A;  5M4H A;  4R3A A;  4B6C A;  5FWK A;  5CTY A;  3INW A;  3QDD A;  5C93 A;  1Y8O A;  1Y4U A;  1Y4S A;  2YEC A;  4BQJ A;  4XTJ A;  4PL9 A;  2XDK A;  4GCZ A;  2XX2 A;  4FCQ A;  4R1F A;  1U0Z A;  2XDS A;  2YI6 A;  1QYE A;  4L90 A;  5CTW A;  3ZXO A;  1TC0 A;  3R92 A;  5L3J A;  4WUC A;  1TC6 A;  1YT0 A;  2QF6 A;  4MPN A;  3B28 A;  4O05 A;  4MP2 A;  2EXL A;  1GJV A;  4XDM A;  3HZ1 A;  2BZ5 A;  3U67 A;  4AWO A;  2XAB A;  4FCP A;  4AWP A;  4URL A;  4MPC A;  4AWQ A;  2IWU A;  4E00 A;  3B27 A;  4L94 A;  5CF0 A;  2BRE A;  2AKP A;  3EHF A;  2BU7 A;  1MX0 A;  2YEF A;  4BIU A;  1UYD A;  4CWR A;  1US7 A;  5BOC A;  1H7S A;  5GGZ A;  3GIG B;  3T1K A;  1AMW A;  3K98 A;  2WI4 A;  4JAS A;  3OWD A;  3WQ9 A;  2K5B A;  3HYZ A;  2YEH A;  5CTU A;  2BSM A;  4GQT A;  4MP7 A;  3G7B A;  5IDM A;  1EA6 A;  3T0H A;  1YS3 A;  3T0Z A;  4CWO A;  1Y8P A;  5M4E A;  2VCJ A;  1ZXN A;  4XIT A;  4V26 A;  1R62 A;  5F3K A;  5BOD A;  2Q8H A;  2QG0 A;  3VHD A;  2JKI A;  3A0R A;  4CWP A;  3RLR A;  4BQG A;  4H81 A;  1AJ6 A;  2BT0 A;  2YE8 A;  1Z59 A;  4LWI A;  2YK9 A;  3KE6 A;  4U7N A;  3O2F A;  4JAV A;  3D0B A;  1L0O A;  4EM7 A;  5J6A A;  2O1U A;  3B24 A;  3H80 A;  4EFT A;  3EKO A;  1YT2 A;  5FNF A;  4GT8 A;  2XHX A;  4XCL A;  4EGK A;  4ASB A;  4H85 A;  2C2A A;  2FWY A;  4NH7 A;  4HXW A;  4CE2 A;  4O07 A;  1UYK A;  2YI7 A;  3VAD A;  2YED A;  4XC0 A;  1NHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...