5CPHA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
192
Chain Sequence
b'AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 63
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5cphA00
2YEGA 1TH8A 3B28A 3EKOA 4V26A 2XJGA 4AWPA 4JQLA 3VHDA 1Y8NA 1I5BA 1YT2A 4MP7A 1KIJA 4GCZA 4O04A 1S16A 3Q5LA 2BRCA 2XK2A 1I5CA 2JKIA 2ESAA 1TIDA 1TILA 4L94A 2YEAA 5FNCA 2XHXA 3EHGA 4CWFA 4QPKA 4XDMA 4EEHA 4YKRA 2QG2A 4R3MA 3O2FA 4HY6A 2BYHA 2YJXA 1BXDA 3O6OA 3EHHA 1TBWA 4PRXA 3HYZA 3PEHA 2XDLA 4JASA 4B6CA 5L3JA 4CWQA 2XDKA 4P8OA 4UROA 3RLQA 3OW6A 2FYPA 1UYHA 2YGEA 3A0YA 4NH9A 4CE3A 4E01A 4URLA 3C11A 2WI2A 1UYDA 2YKEA 1Z5BA 4MPNA 1ZXMA 4FCQA 1YETA 4X9LA 2ZBKB 3VADA 4U7OA 4AWOA 1A4HA 3C0EA 2XD6A 4E00A 1UYCA 3TZ4A 3OMUA 3OWDA 4YKUA 4LWHA 5CPHA 4KSGA 3FT5A 4U93A 2GQPA 4EFTA 4BIUA 2YK9A 1ZXNA 3H80A 1I5AA 3D2RA 2CGFA 1AH8A 4CE2A 3Q5KA 3TTZA 5M4HA 3K97A 4QPJA 4YKWA 2XCMA 2H8MA 1US7A 1AJ6A 2E0AA 4W7TA 1B3QA 1BKNA 3T2SA 3K60A 4L93A 5F3KA 3D0BA 3TZ5A 5CF0A 2FXSA 2O1WA 2WI1A 2BU6A 3CWVA 3CGYA 1U2OA 1B63A 2IWXA 3EKRA 3FT8A 2YGAA 2CCUA 3G7EA 2BZ5A 1UYGA 1MU5A 3OWBA 4XC0A 4CE1A 4FPPA 3T0HA 2XX4A 4H81A 3IEDA 1L0OA 2IOPA 5IDMA 1YSZA 4YKQA 2Q8FA 2YEHA 4KFGA 3G75A 2YE5A 4PL9A 2YE2A 4XITA 4L91A 4V25A 4HXWA 2WI6A 3R92A 4CWNA 1Z5CA 2O1UA 2XDSA 2YE9A 2IORA 2XHTA 3LNUA 4MB9A 3GIGB 3BMYA 3HHUA 4MPEA 3MNRP 3LPSA 4XTJA 3BM9A 2XX5A 4LWGA 3EHFA 3CRLA 5CTWA 2Q8HA 2YE4A 3A0XA 4H85A 2JJCA 1GJVA 2FWZA 2YEIA 4E02A 1B62A 1GKZA 2YGFA 4JAVA 1I5DA 4U7NA 5FNDA 1OSFA 1KZNA 3T0ZA 2YE7A 2XDXA 2YEFA 5CTUA 2QG0A 3ZKBA 4CWSA 4GGLA 5D7DA 4LWEA 1R62A 2CCSA 2GFDA 2HG1A 3O0IA 4YKXA 4ASAA 2QF6A 5M4EA 2WERA 1NHHA 4GT8A 4HYMA 4ASGA 3R91A 3OPDA 2CG9A 1Y8OA 2YKIA 4XKKA 4YKTA 3A0RA 4B7PA 1I59A 3FV5A 3H4LA 3ZXOA 2O1VA 3QDDA 1Z59A 1UY9A 2WEQA 1Y8PA 4XE2A 3NMQA 1ID0A 2UWDA 4LWIA 5CTXA 3PEJA 3U2KA 2YKJA 3QTFA 3R4PA 1AH6A 3ZKDA 1Y4SA 4WUDA 2YJWA 4XIPA 2YI6A 1UYFA 5J6AA 1YSRA 3HEKA 4KTNA 5BODA 4XIRA 2IOQA 1QZRA 4K4OA 2XJXA 4HZ5A 2XDUA 2WI4A 4BAEA 2YKBA 4EMVA 4O07A 4FCPA 2H55A 2VW5A 4BQGA 5FNFA 2XABA 2YI5A 2WI5A 4GEEA 4NH7A 3RLRA 3TUHA 1Z5AA 4L8ZA 2VWCA 3INWA 4HZ0A 5M4NA 4XCJA 4R3AA 5D7RA 4DUHA 2BU5A 4KSHA 2EXLA 4BQJA 3HZ5A 4O0BA 3R4OA 2K5BA 4ASFA 4EGHA 2YK2A 2BU7A 4GQTA 4R1FA 1UYMA 2YE6A 1GKXA 4O09A 1NHIA 1THNA 1AM1A 3B25A 5M4MA 1BYQA 4FMTA 2PNRA 4URNA 2XJJA 1YS3A 1H7UA 1MX0A 2ZDXA 4EM7A 4MP2A 3EHJA 3TZ2A 3A0WA 4XCLA 2VCIA 4AWQA 3CRKA 1UYLA 3CGZA 4WUBA 3RLPA 1YC3A 2YE3A 3K98A 5M4KA 1UYIA 4P7AA 3WHAA 2YECA 3JZ3A 4FCRA 1PVGA 1YT0A 1UY6A 1EI1A 5D6QA 4MPCA 4HYPA 2YEEA 1UYEA 5BOCA 1I58A 4KQVA 1QY8A 1JM6A 3GIGA 1ZW9A 4I5SA 4URMA 4Q20A 1UY8A 4AS9A 4GFNA 4KP4A 1YT1A 4ZKIA 4CWPA 5F5RA 1Y4UA 1TC6A 4H7QA 4ASBA 3DGEA 4LP0A 1U0ZA 2QFOA 4YKZA 2BT0A 4XKOA 2IWUA 5IDJA 1TC0A 1YC4A 3WQ9A 3B26A 3INXA 3SL2A 2ZKJA 3ZXQA 1NHJA 1S14A 3ZM7A 4DZYA 4XKAA 5D7CA 4I3HA 2YEJA 5FWKA 4L90A 2BREA 3RKZA 3VHAA 2IWSA 2YEDA 4MBCA 4NH8A 3B27A 2BU8A 4XIQA 3GIFA 2HCHA 4CWOA 3A0ZA 2Q8IA 2YKCA 3GIEA 3D36A 4BIZA 1EA6A 3KE6A 3Q5JA 4PU9A 3U67A 2CCTA 2BTZA 5M4PA 5C93A 2YI7A 2HKJA 5GGZA 2ZDYA 3TZ0A 1ZWHA 4XD8A 2WI7A 2AKPA 3R4MA 2YI0A 4EGKA 4EFUA 3K99A 1YERA 4LWFA 4ZVIA 2BSMA 2BU2A 2Q8GA 2XHRA 2VCJA 1UY7A 4HY1A 2FWYA 1YESA 2YE8A 3VHCA 1UYKA 1H7SA 2C2AA 3U2DA 2XX2A 4WUCA 3B24A 4O05A 5CTYA 4CWTA 4JAUA 4PRVA 5IN9A 1AMWA 2WI3A 3R4NA 3T1KA 1YC1A 3T10A 5D6PA 2WEPA 4YKYA 4CWRA 4BXIA 4LPBA 1QYEA 3HYYA 2CH4A 2Q2EB 3G7BA 4MOTA 3HZ1A 3A0TA 2YEBA 4EGIA 4HXZA 2BYIA 1BGQA 5J71A
chains in the Genus database with same CATH superfamily
2YEGA 1TH8A 3B28A 3EKOA 4V26A 2XJGA 4AWPA 4JQLA 3VHDA 1Y8NA 1I5BA 1YT2A 4MP7A 1KIJA 4GCZA 4O04A 1S16A 3Q5LA 2BRCA 2XK2A 1I5CA 2JKIA 2ESAA 1TIDA 1TILA 4L94A 2YEAA 5FNCA 2XHXA 3EHGA 4CWFA 4QPKA 4XDMA 4EEHA 4YKRA 2QG2A 4R3MA 3O2FA 4HY6A 2BYHA 2YJXA 1BXDA 3O6OA 3EHHA 1TBWA 4PRXA 3HYZA 3PEHA 2XDLA 4JASA 4B6CA 5L3JA 4CWQA 2XDKA 4P8OA 4UROA 3RLQA 3OW6A 2FYPA 5JENA 1UYHA 2YGEA 3A0YA 4NH9A 4CE3A 4E01A 3S5TA 4URLA 3C11A 2WI2A 1UYDA 2YKEA 1Z5BA 4MPNA 1ZXMA 4FCQA 2FTKA 1YETA 4X9LA 2ZBKB 3VADA 4U7OA 4AWOA 1A4HA 3C0EA 2XD6A 4E00A 1UYCA 3TZ4A 3OMUA 3OWDA 4YKUA 4LWHA 5CPHA 4KSGA 3FT5A 4U93A 2GQPA 4EFTA 4BIUA 2YK9A 1ZXNA 3H80A 1I5AA 3D2RA 2CGFA 1AH8A 4CE2A 3Q5KA 3TTZA 5M4HA 3K97A 4QPJA 4YKWA 2XCMA 2H8MA 1US7A 1AJ6A 2E0AA 4W7TA 1B3QA 1BKNA 3T2SA 3K60A 4L93A 5F3KA 3D0BA 3TZ5A 5CF0A 2FXSA 2O1WA 2WI1A 2BU6A 3CWVA 3CGYA 1U2OA 3CYGA 1B63A 2IWXA 3EKRA 3FT8A 2YGAA 2CCUA 3G7EA 2BZ5A 1UYGA 1MU5A 3OWBA 4XC0A 4CE1A 4FPPA 3T0HA 2XX4A 4H81A 3IEDA 1L0OA 2IOPA 5IDMA 1YSZA 4YKQA 2Q8FA 2YEHA 4KFGA 3G75A 2YE5A 4PL9A 2YE2A 4XITA 4L91A 4V25A 4HXWA 2WI6A 3R92A 4CWNA 1Z5CA 2O1UA 2XDSA 2YE9A 2IORA 2XHTA 3LNUA 4MB9A 3GIGB 2C1GA 3BMYA 3HHUA 4MPEA 3MNRP 3LPSA 4XTJA 3BM9A 2XX5A 4LWGA 3EHFA 3CRLA 5CTWA 2Q8HA 2YE4A 3A0XA 4H85A 2JJCA 1GJVA 2FWZA 2YEIA 4E02A 1B62A 1GKZA 2YGFA 4JAVA 1I5DA 4U7NA 5FNDA 1OSFA 1KZNA 3T0ZA 2YE7A 2XDXA 2YEFA 5CTUA 2QG0A 3ZKBA 4CWSA 4GGLA 5D7DA 4LWEA 1R62A 2CCSA 2GFDA 2HG1A 3O0IA 4YKXA 4ASAA 2QF6A 5M4EA 2WERA 1NHHA 4GT8A 4HYMA 4ASGA 3R91A 3OPDA 2CG9A 1Y8OA 2YKIA 4XKKA 4YKTA 3A0RA 4B7PA 1I59A 3FV5A 3H4LA 3ZXOA 2O1VA 3QDDA 1Z59A 1UY9A 2WEQA 1Y8PA 4XE2A 3NMQA 4E72A 1ID0A 2UWDA 4LWIA 5CTXA 3PEJA 3U2KA 2YKJA 3LMMA 3QTFA 3R4PA 1AH6A 3ZKDA 1Y4SA 4WUDA 2YJWA 4XIPA 2YI6A 1UYFA 5J6AA 1YSRA 3HEKA 4KTNA 5BODA 4XIRA 2IOQA 1QZRA 4K4OA 2XJXA 4HZ5A 2XDUA 2WI4A 4BAEA 2YKBA 4EMVA 4O07A 4FCPA 2H55A 2VW5A 4BQGA 5FNFA 2XABA 2YI5A 2WI5A 4GEEA 4NH7A 3RLRA 3TUHA 1Z5AA 4L8ZA 2VWCA 3INWA 4HZ0A 5M4NA 4XCJA 4R3AA 5D7RA 4DUHA 2BU5A 4KSHA 2EXLA 4BQJA 3HZ5A 4O0BA 3R4OA 2K5BA 4ASFA 4EGHA 1F51A 2YK2A 2BU7A 4GQTA 4R1FA 1UYMA 2YE6A 1GKXA 4O09A 1NHIA 1THNA 1AM1A 3B25A 5M4MA 1BYQA 4FMTA 2PNRA 4URNA 2XJJA 1YS3A 1H7UA 1MX0A 2ZDXA 4EM7A 4MP2A 3EHJA 3TZ2A 3A0WA 4XCLA 2VCIA 4AWQA 3CRKA 1UYLA 3CGZA 4WUBA 3RLPA 1YC3A 2YE3A 3K98A 5M4KA 1UYIA 4P7AA 3WHAA 2YECA 3JZ3A 4FCRA 1PVGA 1YT0A 1UY6A 1EI1A 5D6QA 4MPCA 4HYPA 2YEEA 1UYEA 5BOCA 1I58A 4KQVA 1QY8A 1JM6A 3GIGA 1ZW9A 4I5SA 4URMA 4Q20A 1UY8A 4AS9A 4GFNA 4KP4A 1YT1A 4ZKIA 4CWPA 5F5RA 1Y4UA 1TC6A 4H7QA 4ASBA 3DGEA 4LP0A 1U0ZA 2QFOA 4YKZA 2BT0A 4XKOA 2IWUA 5IDJA 1TC0A 1YC4A 3WQ9A 3B26A 3INXA 3SL2A 2ZKJA 3ZXQA 1NHJA 1S14A 3ZM7A 4DZYA 4XKAA 1IXMA 5D7CA 4I3HA 2YEJA 5FWKA 4L90A 2BREA 3RKZA 3VHAA 2IWSA 2YEDA 4MBCA 4NH8A 3B27A 2BU8A 4XIQA 3GIFA 2HCHA 4CWOA 3A0ZA 2Q8IA 2YKCA 3GIEA 3D36A 4BIZA 1EA6A 3KE6A 3Q5JA 4PU9A 3U67A 2CCTA 2BTZA 5M4PA 5C93A 2YI7A 2HKJA 5GGZA 2ZDYA 3TZ0A 1ZWHA 4XD8A 2WI7A 2AKPA 3R4MA 2YI0A 4EGKA 4EFUA 3K99A 1YERA 4LWFA 4ZVIA 2BSMA 2BU2A 2Q8GA 2XHRA 2VCJA 1UY7A 4HY1A 2FWYA 1YESA 2HHIA 2YE8A 3VHCA 1UYKA 1H7SA 2C2AA 3U2DA 2XX2A 4WUCA 3B24A 4O05A 5CTYA 4CWTA 4JAUA 4PRVA 5IN9A 1AMWA 2WI3A 3R4NA 3T1KA 1YC1A 3T10A 5D6PA 2WEPA 4YKYA 4CWRA 2C1IA 4BXIA 4LPBA 1QYEA 3HYYA 2CH4A 2Q2EB 3G7BA 4MOTA 3HZ1A 3A0TA 2YEBA 4EGIA 4HXZA 2BYIA 1BGQA 5J71A
chains in the Genus database with same CATH topology
2YEGA 1TH8A 3B28A 3EKOA 4V26A 2XJGA 4AWPA 4JQLA 3VHDA 1Y8NA 1I5BA 1YT2A 4MP7A 1KIJA 4GCZA 4O04A 1S16A 3Q5LA 2BRCA 2XK2A 1I5CA 2JKIA 2ESAA 1TIDA 1TILA 4L94A 2YEAA 5FNCA 2XHXA 3EHGA 4CWFA 4QPKA 4XDMA 4EEHA 4YKRA 2QG2A 4R3MA 3O2FA 4HY6A 2BYHA 2YJXA 1BXDA 3O6OA 3EHHA 1TBWA 4PRXA 3HYZA 3PEHA 2XDLA 4JASA 4B6CA 5L3JA 4CWQA 2XDKA 4P8OA 4UROA 3RLQA 3OW6A 2FYPA 1UYHA 2YGEA 3A0YA 4NH9A 4CE3A 4E01A 4URLA 3C11A 2WI2A 1UYDA 2YKEA 1Z5BA 4MPNA 1ZXMA 4FCQA 1YETA 4X9LA 2ZBKB 3VADA 4U7OA 4AWOA 1A4HA 3C0EA 2XD6A 4E00A 1UYCA 3TZ4A 3OMUA 3OWDA 4YKUA 4LWHA 5CPHA 4KSGA 3FT5A 4U93A 2GQPA 4EFTA 4BIUA 2YK9A 1ZXNA 3H80A 1I5AA 3D2RA 2CGFA 1AH8A 4CE2A 3Q5KA 3TTZA 5M4HA 3K97A 4QPJA 4YKWA 2XCMA 2H8MA 1US7A 1AJ6A 2E0AA 4W7TA 1B3QA 1BKNA 3T2SA 3K60A 4L93A 5F3KA 3D0BA 3TZ5A 5CF0A 2FXSA 2O1WA 2WI1A 2BU6A 3CWVA 3CGYA 1U2OA 1B63A 2IWXA 3EKRA 3FT8A 2YGAA 2CCUA 3G7EA 2BZ5A 1UYGA 1MU5A 3OWBA 4XC0A 4CE1A 4FPPA 3T0HA 2XX4A 4H81A 3IEDA 1L0OA 2IOPA 5IDMA 1YSZA 4YKQA 2Q8FA 2YEHA 4KFGA 3G75A 2YE5A 4PL9A 2YE2A 4XITA 4L91A 4V25A 4HXWA 2WI6A 3R92A 4CWNA 1Z5CA 2O1UA 2XDSA 2YE9A 2IORA 2XHTA 3LNUA 4MB9A 3GIGB 3BMYA 3HHUA 4MPEA 3MNRP 3LPSA 4XTJA 3BM9A 2XX5A 4LWGA 3EHFA 3CRLA 5CTWA 2Q8HA 2YE4A 3A0XA 4H85A 2JJCA 1GJVA 2FWZA 2YEIA 4E02A 1B62A 1GKZA 2YGFA 4JAVA 1I5DA 4U7NA 5FNDA 1OSFA 1KZNA 3T0ZA 2YE7A 2XDXA 2YEFA 5CTUA 2QG0A 3ZKBA 4CWSA 4GGLA 5D7DA 4LWEA 1R62A 2CCSA 2GFDA 2HG1A 3O0IA 4YKXA 4ASAA 2QF6A 5M4EA 2WERA 1NHHA 4GT8A 4HYMA 4ASGA 3R91A 3OPDA 2CG9A 1Y8OA 2YKIA 4XKKA 4YKTA 3A0RA 4B7PA 1I59A 3FV5A 3H4LA 3ZXOA 2O1VA 3QDDA 1Z59A 1UY9A 2WEQA 1Y8PA 4XE2A 3NMQA 1ID0A 2UWDA 4LWIA 5CTXA 3PEJA 3U2KA 2YKJA 3QTFA 3R4PA 1AH6A 3ZKDA 1Y4SA 4WUDA 2YJWA 4XIPA 2YI6A 1UYFA 5J6AA 1YSRA 3HEKA 4KTNA 5BODA 4XIRA 2IOQA 1QZRA 4K4OA 2XJXA 4HZ5A 2XDUA 2WI4A 4BAEA 2YKBA 4EMVA 4O07A 4FCPA 2H55A 2VW5A 4BQGA 5FNFA 2XABA 2YI5A 2WI5A 4GEEA 4NH7A 3RLRA 3TUHA 1Z5AA 4L8ZA 2VWCA 3INWA 4HZ0A 5M4NA 4XCJA 4R3AA 5D7RA 4DUHA 2BU5A 4KSHA 2EXLA 4BQJA 3HZ5A 4O0BA 3R4OA 2K5BA 4ASFA 4EGHA 2YK2A 2BU7A 4GQTA 4R1FA 1UYMA 2YE6A 1GKXA 4O09A 1NHIA 1THNA 1AM1A 3B25A 5M4MA 1BYQA 4FMTA 2PNRA 4URNA 2XJJA 1YS3A 1H7UA 1MX0A 2ZDXA 4EM7A 4MP2A 3EHJA 3TZ2A 3A0WA 4XCLA 2VCIA 4AWQA 3CRKA 1UYLA 3CGZA 4WUBA 3RLPA 1YC3A 2YE3A 3K98A 5M4KA 1UYIA 4P7AA 3WHAA 2YECA 3JZ3A 4FCRA 1PVGA 1YT0A 1UY6A 1EI1A 5D6QA 4MPCA 4HYPA 2YEEA 1UYEA 5BOCA 1I58A 4KQVA 1QY8A 1JM6A 3GIGA 1ZW9A 4I5SA 4URMA 4Q20A 1UY8A 4AS9A 4GFNA 4KP4A 1YT1A 4ZKIA 4CWPA 5F5RA 1Y4UA 1TC6A 4H7QA 4ASBA 3DGEA 4LP0A 1U0ZA 2QFOA 4YKZA 2BT0A 4XKOA 2IWUA 5IDJA 1TC0A 1YC4A 3WQ9A 3B26A 3INXA 3SL2A 2ZKJA 3ZXQA 1NHJA 1S14A 3ZM7A 4DZYA 4XKAA 5D7CA 4I3HA 2YEJA 5FWKA 4L90A 2BREA 3RKZA 3VHAA 2IWSA 2YEDA 4MBCA 4NH8A 3B27A 2BU8A 4XIQA 3GIFA 2HCHA 4CWOA 3A0ZA 2Q8IA 2YKCA 3GIEA 3D36A 4BIZA 1EA6A 3KE6A 3Q5JA 4PU9A 3U67A 2CCTA 2BTZA 5M4PA 5C93A 2YI7A 2HKJA 5GGZA 2ZDYA 3TZ0A 1ZWHA 4XD8A 2WI7A 2AKPA 3R4MA 2YI0A 4EGKA 4EFUA 3K99A 1YERA 4LWFA 4ZVIA 2BSMA 2BU2A 2Q8GA 2XHRA 2VCJA 1UY7A 4HY1A 2FWYA 1YESA 2YE8A 3VHCA 1UYKA 1H7SA 2C2AA 3U2DA 2XX2A 4WUCA 3B24A 4O05A 5CTYA 4CWTA 4JAUA 4PRVA 5IN9A 1AMWA 2WI3A 3R4NA 3T1KA 1YC1A 3T10A 5D6PA 2WEPA 4YKYA 4CWRA 4BXIA 4LPBA 1QYEA 3HYYA 2CH4A 2Q2EB 3G7BA 4MOTA 3HZ1A 3A0TA 2YEBA 4EGIA 4HXZA 2BYIA 1BGQA 5J71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEG A;  1TH8 A;  3B28 A;  3EKO A;  4V26 A;  2XJG A;  4AWP A;  4JQL A;  3VHD A;  1Y8N A;  1I5B A;  1YT2 A;  4MP7 A;  1KIJ A;  4GCZ A;  4O04 A;  1S16 A;  3Q5L A;  2BRC A;  2XK2 A;  1I5C A;  2JKI A;  2ESA A;  1TID A;  1TIL A;  4L94 A;  2YEA A;  5FNC A;  2XHX A;  3EHG A;  4CWF A;  4QPK A;  4XDM A;  4EEH A;  4YKR A;  2QG2 A;  4R3M A;  3O2F A;  4HY6 A;  2BYH A;  2YJX A;  1BXD A;  3O6O A;  3EHH A;  1TBW A;  4PRX A;  3HYZ A;  3PEH A;  2XDL A;  4JAS A;  4B6C A;  5L3J A;  4CWQ A;  2XDK A;  4P8O A;  4URO A;  3RLQ A;  3OW6 A;  2FYP A;  1UYH A;  2YGE A;  3A0Y A;  4NH9 A;  4CE3 A;  4E01 A;  4URL A;  3C11 A;  2WI2 A;  1UYD A;  2YKE A;  1Z5B A;  4MPN A;  1ZXM A;  4FCQ A;  1YET A;  4X9L A;  2ZBK B;  3VAD A;  4U7O A;  4AWO A;  1A4H A;  3C0E A;  2XD6 A;  4E00 A;  1UYC A;  3TZ4 A;  3OMU A;  3OWD A;  4YKU A;  4LWH A;  5CPH A;  4KSG A;  3FT5 A;  4U93 A;  2GQP A;  4EFT A;  4BIU A;  2YK9 A;  1ZXN A;  3H80 A;  1I5A A;  3D2R A;  2CGF A;  1AH8 A;  4CE2 A;  3Q5K A;  3TTZ A;  5M4H A;  3K97 A;  4QPJ A;  4YKW A;  2XCM A;  2H8M A;  1US7 A;  1AJ6 A;  2E0A A;  4W7T A;  1B3Q A;  1BKN A;  3T2S A;  3K60 A;  4L93 A;  5F3K A;  3D0B A;  3TZ5 A;  5CF0 A;  2FXS A;  2O1W A;  2WI1 A;  2BU6 A;  3CWV A;  3CGY A;  1U2O A;  1B63 A;  2IWX A;  3EKR A;  3FT8 A;  2YGA A;  2CCU A;  3G7E A;  2BZ5 A;  1UYG A;  1MU5 A;  3OWB A;  4XC0 A;  4CE1 A;  4FPP A;  3T0H A;  2XX4 A;  4H81 A;  3IED A;  1L0O A;  2IOP A;  5IDM A;  1YSZ A;  4YKQ A;  2Q8F A;  2YEH A;  4KFG A;  3G75 A;  2YE5 A;  4PL9 A;  2YE2 A;  4XIT A;  4L91 A;  4V25 A;  4HXW A;  2WI6 A;  3R92 A;  4CWN A;  1Z5C A;  2O1U A;  2XDS A;  2YE9 A;  2IOR A;  2XHT A;  3LNU A;  4MB9 A;  3GIG B;  3BMY A;  3HHU A;  4MPE A;  3MNR P;  3LPS A;  4XTJ A;  3BM9 A;  2XX5 A;  4LWG A;  3EHF A;  3CRL A;  5CTW A;  2Q8H A;  2YE4 A;  3A0X A;  4H85 A;  2JJC A;  1GJV A;  2FWZ A;  2YEI A;  4E02 A;  1B62 A;  1GKZ A;  2YGF A;  4JAV A;  1I5D A;  4U7N A;  5FND A;  1OSF A;  1KZN A;  3T0Z A;  2YE7 A;  2XDX A;  2YEF A;  5CTU A;  2QG0 A;  3ZKB A;  4CWS A;  4GGL A;  5D7D A;  4LWE A;  1R62 A;  2CCS A;  2GFD A;  2HG1 A;  3O0I A;  4YKX A;  4ASA A;  2QF6 A;  5M4E A;  2WER A;  1NHH A;  4GT8 A;  4HYM A;  4ASG A;  3R91 A;  3OPD A;  2CG9 A;  1Y8O A;  2YKI A;  4XKK A;  4YKT A;  3A0R A;  4B7P A;  1I59 A;  3FV5 A;  3H4L A;  3ZXO A;  2O1V A;  3QDD A;  1Z59 A;  1UY9 A;  2WEQ A;  1Y8P A;  4XE2 A;  3NMQ A;  1ID0 A;  2UWD A;  4LWI A;  5CTX A;  3PEJ A;  3U2K A;  2YKJ A;  3QTF A;  3R4P A;  1AH6 A;  3ZKD A;  1Y4S A;  4WUD A;  2YJW A;  4XIP A;  2YI6 A;  1UYF A;  5J6A A;  1YSR A;  3HEK A;  4KTN A;  5BOD A;  4XIR A;  2IOQ A;  1QZR A;  4K4O A;  2XJX A;  4HZ5 A;  2XDU A;  2WI4 A;  4BAE A;  2YKB A;  4EMV A;  4O07 A;  4FCP A;  2H55 A;  2VW5 A;  4BQG A;  5FNF A;  2XAB A;  2YI5 A;  2WI5 A;  4GEE A;  4NH7 A;  3RLR A;  3TUH A;  1Z5A A;  4L8Z A;  2VWC A;  3INW A;  4HZ0 A;  5M4N A;  4XCJ A;  4R3A A;  5D7R A;  4DUH A;  2BU5 A;  4KSH A;  2EXL A;  4BQJ A;  3HZ5 A;  4O0B A;  3R4O A;  2K5B A;  4ASF A;  4EGH A;  2YK2 A;  2BU7 A;  4GQT A;  4R1F A;  1UYM A;  2YE6 A;  1GKX A;  4O09 A;  1NHI A;  1THN A;  1AM1 A;  3B25 A;  5M4M A;  1BYQ A;  4FMT A;  2PNR A;  4URN A;  2XJJ A;  1YS3 A;  1H7U A;  1MX0 A;  2ZDX A;  4EM7 A;  4MP2 A;  3EHJ A;  3TZ2 A;  3A0W A;  4XCL A;  2VCI A;  4AWQ A;  3CRK A;  1UYL A;  3CGZ A;  4WUB A;  3RLP A;  1YC3 A;  2YE3 A;  3K98 A;  5M4K A;  1UYI A;  4P7A A;  3WHA A;  2YEC A;  3JZ3 A;  4FCR A;  1PVG A;  1YT0 A;  1UY6 A;  1EI1 A;  5D6Q A;  4MPC A;  4HYP A;  2YEE A;  1UYE A;  5BOC A;  1I58 A;  4KQV A;  1QY8 A;  1JM6 A;  3GIG A;  1ZW9 A;  4I5S A;  4URM A;  4Q20 A;  1UY8 A;  4AS9 A;  4GFN A;  4KP4 A;  1YT1 A;  4ZKI A;  4CWP A;  5F5R A;  1Y4U A;  1TC6 A;  4H7Q A;  4ASB A;  3DGE A;  4LP0 A;  1U0Z A;  2QFO A;  4YKZ A;  2BT0 A;  4XKO A;  2IWU A;  5IDJ A;  1TC0 A;  1YC4 A;  3WQ9 A;  3B26 A;  3INX A;  3SL2 A;  2ZKJ A;  3ZXQ A;  1NHJ A;  1S14 A;  3ZM7 A;  4DZY A;  4XKA A;  5D7C A;  4I3H A;  2YEJ A;  5FWK A;  4L90 A;  2BRE A;  3RKZ A;  3VHA A;  2IWS A;  2YED A;  4MBC A;  4NH8 A;  3B27 A;  2BU8 A;  4XIQ A;  3GIF A;  2HCH A;  4CWO A;  3A0Z A;  2Q8I A;  2YKC A;  3GIE A;  3D36 A;  4BIZ A;  1EA6 A;  3KE6 A;  3Q5J A;  4PU9 A;  3U67 A;  2CCT A;  2BTZ A;  5M4P A;  5C93 A;  2YI7 A;  2HKJ A;  5GGZ A;  2ZDY A;  3TZ0 A;  1ZWH A;  4XD8 A;  2WI7 A;  2AKP A;  3R4M A;  2YI0 A;  4EGK A;  4EFU A;  3K99 A;  1YER A;  4LWF A;  4ZVI A;  2BSM A;  2BU2 A;  2Q8G A;  2XHR A;  2VCJ A;  1UY7 A;  4HY1 A;  2FWY A;  1YES A;  2YE8 A;  3VHC A;  1UYK A;  1H7S A;  2C2A A;  3U2D A;  2XX2 A;  4WUC A;  3B24 A;  4O05 A;  5CTY A;  4CWT A;  4JAU A;  4PRV A;  5IN9 A;  1AMW A;  2WI3 A;  3R4N A;  3T1K A;  1YC1 A;  3T10 A;  5D6P A;  2WEP A;  4YKY A;  4CWR A;  4BXI A;  4LPB A;  1QYE A;  3HYY A;  2CH4 A;  2Q2E B;  3G7B A;  4MOT A;  3HZ1 A;  3A0T A;  2YEB A;  4EGI A;  4HXZ A;  2BYI A;  1BGQ A;  5J71 A; 
#chains in the Genus database with same CATH topology
 2YEG A;  1TH8 A;  3B28 A;  3EKO A;  4V26 A;  2XJG A;  4AWP A;  4JQL A;  3VHD A;  1Y8N A;  1I5B A;  1YT2 A;  4MP7 A;  1KIJ A;  4GCZ A;  4O04 A;  1S16 A;  3Q5L A;  2BRC A;  2XK2 A;  1I5C A;  2JKI A;  2ESA A;  1TID A;  1TIL A;  4L94 A;  2YEA A;  5FNC A;  2XHX A;  3EHG A;  4CWF A;  4QPK A;  4XDM A;  4EEH A;  4YKR A;  2QG2 A;  4R3M A;  3O2F A;  4HY6 A;  2BYH A;  2YJX A;  1BXD A;  3O6O A;  3EHH A;  1TBW A;  4PRX A;  3HYZ A;  3PEH A;  2XDL A;  4JAS A;  4B6C A;  5L3J A;  4CWQ A;  2XDK A;  4P8O A;  4URO A;  3RLQ A;  3OW6 A;  2FYP A;  5JEN A;  1UYH A;  2YGE A;  3A0Y A;  4NH9 A;  4CE3 A;  4E01 A;  3S5T A;  4URL A;  3C11 A;  2WI2 A;  1UYD A;  2YKE A;  1Z5B A;  4MPN A;  1ZXM A;  4FCQ A;  2FTK A;  1YET A;  4X9L A;  2ZBK B;  3VAD A;  4U7O A;  4AWO A;  1A4H A;  3C0E A;  2XD6 A;  4E00 A;  1UYC A;  3TZ4 A;  3OMU A;  3OWD A;  4YKU A;  4LWH A;  5CPH A;  4KSG A;  3FT5 A;  4U93 A;  2GQP A;  4EFT A;  4BIU A;  2YK9 A;  1ZXN A;  3H80 A;  1I5A A;  3D2R A;  2CGF A;  1AH8 A;  4CE2 A;  3Q5K A;  3TTZ A;  5M4H A;  3K97 A;  4QPJ A;  4YKW A;  2XCM A;  2H8M A;  1US7 A;  1AJ6 A;  2E0A A;  4W7T A;  1B3Q A;  1BKN A;  3T2S A;  3K60 A;  4L93 A;  5F3K A;  3D0B A;  3TZ5 A;  5CF0 A;  2FXS A;  2O1W A;  2WI1 A;  2BU6 A;  3CWV A;  3CGY A;  1U2O A;  3CYG A;  1B63 A;  2IWX A;  3EKR A;  3FT8 A;  2YGA A;  2CCU A;  3G7E A;  2BZ5 A;  1UYG A;  1MU5 A;  3OWB A;  4XC0 A;  4CE1 A;  4FPP A;  3T0H A;  2XX4 A;  4H81 A;  3IED A;  1L0O A;  2IOP A;  5IDM A;  1YSZ A;  4YKQ A;  2Q8F A;  2YEH A;  4KFG A;  3G75 A;  2YE5 A;  4PL9 A;  2YE2 A;  4XIT A;  4L91 A;  4V25 A;  4HXW A;  2WI6 A;  3R92 A;  4CWN A;  1Z5C A;  2O1U A;  2XDS A;  2YE9 A;  2IOR A;  2XHT A;  3LNU A;  4MB9 A;  3GIG B;  2C1G A;  3BMY A;  3HHU A;  4MPE A;  3MNR P;  3LPS A;  4XTJ A;  3BM9 A;  2XX5 A;  4LWG A;  3EHF A;  3CRL A;  5CTW A;  2Q8H A;  2YE4 A;  3A0X A;  4H85 A;  2JJC A;  1GJV A;  2FWZ A;  2YEI A;  4E02 A;  1B62 A;  1GKZ A;  2YGF A;  4JAV A;  1I5D A;  4U7N A;  5FND A;  1OSF A;  1KZN A;  3T0Z A;  2YE7 A;  2XDX A;  2YEF A;  5CTU A;  2QG0 A;  3ZKB A;  4CWS A;  4GGL A;  5D7D A;  4LWE A;  1R62 A;  2CCS A;  2GFD A;  2HG1 A;  3O0I A;  4YKX A;  4ASA A;  2QF6 A;  5M4E A;  2WER A;  1NHH A;  4GT8 A;  4HYM A;  4ASG A;  3R91 A;  3OPD A;  2CG9 A;  1Y8O A;  2YKI A;  4XKK A;  4YKT A;  3A0R A;  4B7P A;  1I59 A;  3FV5 A;  3H4L A;  3ZXO A;  2O1V A;  3QDD A;  1Z59 A;  1UY9 A;  2WEQ A;  1Y8P A;  4XE2 A;  3NMQ A;  4E72 A;  1ID0 A;  2UWD A;  4LWI A;  5CTX A;  3PEJ A;  3U2K A;  2YKJ A;  3LMM A;  3QTF A;  3R4P A;  1AH6 A;  3ZKD A;  1Y4S A;  4WUD A;  2YJW A;  4XIP A;  2YI6 A;  1UYF A;  5J6A A;  1YSR A;  3HEK A;  4KTN A;  5BOD A;  4XIR A;  2IOQ A;  1QZR A;  4K4O A;  2XJX A;  4HZ5 A;  2XDU A;  2WI4 A;  4BAE A;  2YKB A;  4EMV A;  4O07 A;  4FCP A;  2H55 A;  2VW5 A;  4BQG A;  5FNF A;  2XAB A;  2YI5 A;  2WI5 A;  4GEE A;  4NH7 A;  3RLR A;  3TUH A;  1Z5A A;  4L8Z A;  2VWC A;  3INW A;  4HZ0 A;  5M4N A;  4XCJ A;  4R3A A;  5D7R A;  4DUH A;  2BU5 A;  4KSH A;  2EXL A;  4BQJ A;  3HZ5 A;  4O0B A;  3R4O A;  2K5B A;  4ASF A;  4EGH A;  1F51 A;  2YK2 A;  2BU7 A;  4GQT A;  4R1F A;  1UYM A;  2YE6 A;  1GKX A;  4O09 A;  1NHI A;  1THN A;  1AM1 A;  3B25 A;  5M4M A;  1BYQ A;  4FMT A;  2PNR A;  4URN A;  2XJJ A;  1YS3 A;  1H7U A;  1MX0 A;  2ZDX A;  4EM7 A;  4MP2 A;  3EHJ A;  3TZ2 A;  3A0W A;  4XCL A;  2VCI A;  4AWQ A;  3CRK A;  1UYL A;  3CGZ A;  4WUB A;  3RLP A;  1YC3 A;  2YE3 A;  3K98 A;  5M4K A;  1UYI A;  4P7A A;  3WHA A;  2YEC A;  3JZ3 A;  4FCR A;  1PVG A;  1YT0 A;  1UY6 A;  1EI1 A;  5D6Q A;  4MPC A;  4HYP A;  2YEE A;  1UYE A;  5BOC A;  1I58 A;  4KQV A;  1QY8 A;  1JM6 A;  3GIG A;  1ZW9 A;  4I5S A;  4URM A;  4Q20 A;  1UY8 A;  4AS9 A;  4GFN A;  4KP4 A;  1YT1 A;  4ZKI A;  4CWP A;  5F5R A;  1Y4U A;  1TC6 A;  4H7Q A;  4ASB A;  3DGE A;  4LP0 A;  1U0Z A;  2QFO A;  4YKZ A;  2BT0 A;  4XKO A;  2IWU A;  5IDJ A;  1TC0 A;  1YC4 A;  3WQ9 A;  3B26 A;  3INX A;  3SL2 A;  2ZKJ A;  3ZXQ A;  1NHJ A;  1S14 A;  3ZM7 A;  4DZY A;  4XKA A;  1IXM A;  5D7C A;  4I3H A;  2YEJ A;  5FWK A;  4L90 A;  2BRE A;  3RKZ A;  3VHA A;  2IWS A;  2YED A;  4MBC A;  4NH8 A;  3B27 A;  2BU8 A;  4XIQ A;  3GIF A;  2HCH A;  4CWO A;  3A0Z A;  2Q8I A;  2YKC A;  3GIE A;  3D36 A;  4BIZ A;  1EA6 A;  3KE6 A;  3Q5J A;  4PU9 A;  3U67 A;  2CCT A;  2BTZ A;  5M4P A;  5C93 A;  2YI7 A;  2HKJ A;  5GGZ A;  2ZDY A;  3TZ0 A;  1ZWH A;  4XD8 A;  2WI7 A;  2AKP A;  3R4M A;  2YI0 A;  4EGK A;  4EFU A;  3K99 A;  1YER A;  4LWF A;  4ZVI A;  2BSM A;  2BU2 A;  2Q8G A;  2XHR A;  2VCJ A;  1UY7 A;  4HY1 A;  2FWY A;  1YES A;  2HHI A;  2YE8 A;  3VHC A;  1UYK A;  1H7S A;  2C2A A;  3U2D A;  2XX2 A;  4WUC A;  3B24 A;  4O05 A;  5CTY A;  4CWT A;  4JAU A;  4PRV A;  5IN9 A;  1AMW A;  2WI3 A;  3R4N A;  3T1K A;  1YC1 A;  3T10 A;  5D6P A;  2WEP A;  4YKY A;  4CWR A;  2C1I A;  4BXI A;  4LPB A;  1QYE A;  3HYY A;  2CH4 A;  2Q2E B;  3G7B A;  4MOT A;  3HZ1 A;  3A0T A;  2YEB A;  4EGI A;  4HXZ A;  2BYI A;  1BGQ A;  5J71 A; 
#chains in the Genus database with same CATH homology
 2YEG A;  1TH8 A;  3B28 A;  3EKO A;  4V26 A;  2XJG A;  4AWP A;  4JQL A;  3VHD A;  1Y8N A;  1I5B A;  1YT2 A;  4MP7 A;  1KIJ A;  4GCZ A;  4O04 A;  1S16 A;  3Q5L A;  2BRC A;  2XK2 A;  1I5C A;  2JKI A;  2ESA A;  1TID A;  1TIL A;  4L94 A;  2YEA A;  5FNC A;  2XHX A;  3EHG A;  4CWF A;  4QPK A;  4XDM A;  4EEH A;  4YKR A;  2QG2 A;  4R3M A;  3O2F A;  4HY6 A;  2BYH A;  2YJX A;  1BXD A;  3O6O A;  3EHH A;  1TBW A;  4PRX A;  3HYZ A;  3PEH A;  2XDL A;  4JAS A;  4B6C A;  5L3J A;  4CWQ A;  2XDK A;  4P8O A;  4URO A;  3RLQ A;  3OW6 A;  2FYP A;  1UYH A;  2YGE A;  3A0Y A;  4NH9 A;  4CE3 A;  4E01 A;  4URL A;  3C11 A;  2WI2 A;  1UYD A;  2YKE A;  1Z5B A;  4MPN A;  1ZXM A;  4FCQ A;  1YET A;  4X9L A;  2ZBK B;  3VAD A;  4U7O A;  4AWO A;  1A4H A;  3C0E A;  2XD6 A;  4E00 A;  1UYC A;  3TZ4 A;  3OMU A;  3OWD A;  4YKU A;  4LWH A;  5CPH A;  4KSG A;  3FT5 A;  4U93 A;  2GQP A;  4EFT A;  4BIU A;  2YK9 A;  1ZXN A;  3H80 A;  1I5A A;  3D2R A;  2CGF A;  1AH8 A;  4CE2 A;  3Q5K A;  3TTZ A;  5M4H A;  3K97 A;  4QPJ A;  4YKW A;  2XCM A;  2H8M A;  1US7 A;  1AJ6 A;  2E0A A;  4W7T A;  1B3Q A;  1BKN A;  3T2S A;  3K60 A;  4L93 A;  5F3K A;  3D0B A;  3TZ5 A;  5CF0 A;  2FXS A;  2O1W A;  2WI1 A;  2BU6 A;  3CWV A;  3CGY A;  1U2O A;  1B63 A;  2IWX A;  3EKR A;  3FT8 A;  2YGA A;  2CCU A;  3G7E A;  2BZ5 A;  1UYG A;  1MU5 A;  3OWB A;  4XC0 A;  4CE1 A;  4FPP A;  3T0H A;  2XX4 A;  4H81 A;  3IED A;  1L0O A;  2IOP A;  5IDM A;  1YSZ A;  4YKQ A;  2Q8F A;  2YEH A;  4KFG A;  3G75 A;  2YE5 A;  4PL9 A;  2YE2 A;  4XIT A;  4L91 A;  4V25 A;  4HXW A;  2WI6 A;  3R92 A;  4CWN A;  1Z5C A;  2O1U A;  2XDS A;  2YE9 A;  2IOR A;  2XHT A;  3LNU A;  4MB9 A;  3GIG B;  3BMY A;  3HHU A;  4MPE A;  3MNR P;  3LPS A;  4XTJ A;  3BM9 A;  2XX5 A;  4LWG A;  3EHF A;  3CRL A;  5CTW A;  2Q8H A;  2YE4 A;  3A0X A;  4H85 A;  2JJC A;  1GJV A;  2FWZ A;  2YEI A;  4E02 A;  1B62 A;  1GKZ A;  2YGF A;  4JAV A;  1I5D A;  4U7N A;  5FND A;  1OSF A;  1KZN A;  3T0Z A;  2YE7 A;  2XDX A;  2YEF A;  5CTU A;  2QG0 A;  3ZKB A;  4CWS A;  4GGL A;  5D7D A;  4LWE A;  1R62 A;  2CCS A;  2GFD A;  2HG1 A;  3O0I A;  4YKX A;  4ASA A;  2QF6 A;  5M4E A;  2WER A;  1NHH A;  4GT8 A;  4HYM A;  4ASG A;  3R91 A;  3OPD A;  2CG9 A;  1Y8O A;  2YKI A;  4XKK A;  4YKT A;  3A0R A;  4B7P A;  1I59 A;  3FV5 A;  3H4L A;  3ZXO A;  2O1V A;  3QDD A;  1Z59 A;  1UY9 A;  2WEQ A;  1Y8P A;  4XE2 A;  3NMQ A;  1ID0 A;  2UWD A;  4LWI A;  5CTX A;  3PEJ A;  3U2K A;  2YKJ A;  3QTF A;  3R4P A;  1AH6 A;  3ZKD A;  1Y4S A;  4WUD A;  2YJW A;  4XIP A;  2YI6 A;  1UYF A;  5J6A A;  1YSR A;  3HEK A;  4KTN A;  5BOD A;  4XIR A;  2IOQ A;  1QZR A;  4K4O A;  2XJX A;  4HZ5 A;  2XDU A;  2WI4 A;  4BAE A;  2YKB A;  4EMV A;  4O07 A;  4FCP A;  2H55 A;  2VW5 A;  4BQG A;  5FNF A;  2XAB A;  2YI5 A;  2WI5 A;  4GEE A;  4NH7 A;  3RLR A;  3TUH A;  1Z5A A;  4L8Z A;  2VWC A;  3INW A;  4HZ0 A;  5M4N A;  4XCJ A;  4R3A A;  5D7R A;  4DUH A;  2BU5 A;  4KSH A;  2EXL A;  4BQJ A;  3HZ5 A;  4O0B A;  3R4O A;  2K5B A;  4ASF A;  4EGH A;  2YK2 A;  2BU7 A;  4GQT A;  4R1F A;  1UYM A;  2YE6 A;  1GKX A;  4O09 A;  1NHI A;  1THN A;  1AM1 A;  3B25 A;  5M4M A;  1BYQ A;  4FMT A;  2PNR A;  4URN A;  2XJJ A;  1YS3 A;  1H7U A;  1MX0 A;  2ZDX A;  4EM7 A;  4MP2 A;  3EHJ A;  3TZ2 A;  3A0W A;  4XCL A;  2VCI A;  4AWQ A;  3CRK A;  1UYL A;  3CGZ A;  4WUB A;  3RLP A;  1YC3 A;  2YE3 A;  3K98 A;  5M4K A;  1UYI A;  4P7A A;  3WHA A;  2YEC A;  3JZ3 A;  4FCR A;  1PVG A;  1YT0 A;  1UY6 A;  1EI1 A;  5D6Q A;  4MPC A;  4HYP A;  2YEE A;  1UYE A;  5BOC A;  1I58 A;  4KQV A;  1QY8 A;  1JM6 A;  3GIG A;  1ZW9 A;  4I5S A;  4URM A;  4Q20 A;  1UY8 A;  4AS9 A;  4GFN A;  4KP4 A;  1YT1 A;  4ZKI A;  4CWP A;  5F5R A;  1Y4U A;  1TC6 A;  4H7Q A;  4ASB A;  3DGE A;  4LP0 A;  1U0Z A;  2QFO A;  4YKZ A;  2BT0 A;  4XKO A;  2IWU A;  5IDJ A;  1TC0 A;  1YC4 A;  3WQ9 A;  3B26 A;  3INX A;  3SL2 A;  2ZKJ A;  3ZXQ A;  1NHJ A;  1S14 A;  3ZM7 A;  4DZY A;  4XKA A;  5D7C A;  4I3H A;  2YEJ A;  5FWK A;  4L90 A;  2BRE A;  3RKZ A;  3VHA A;  2IWS A;  2YED A;  4MBC A;  4NH8 A;  3B27 A;  2BU8 A;  4XIQ A;  3GIF A;  2HCH A;  4CWO A;  3A0Z A;  2Q8I A;  2YKC A;  3GIE A;  3D36 A;  4BIZ A;  1EA6 A;  3KE6 A;  3Q5J A;  4PU9 A;  3U67 A;  2CCT A;  2BTZ A;  5M4P A;  5C93 A;  2YI7 A;  2HKJ A;  5GGZ A;  2ZDY A;  3TZ0 A;  1ZWH A;  4XD8 A;  2WI7 A;  2AKP A;  3R4M A;  2YI0 A;  4EGK A;  4EFU A;  3K99 A;  1YER A;  4LWF A;  4ZVI A;  2BSM A;  2BU2 A;  2Q8G A;  2XHR A;  2VCJ A;  1UY7 A;  4HY1 A;  2FWY A;  1YES A;  2YE8 A;  3VHC A;  1UYK A;  1H7S A;  2C2A A;  3U2D A;  2XX2 A;  4WUC A;  3B24 A;  4O05 A;  5CTY A;  4CWT A;  4JAU A;  4PRV A;  5IN9 A;  1AMW A;  2WI3 A;  3R4N A;  3T1K A;  1YC1 A;  3T10 A;  5D6P A;  2WEP A;  4YKY A;  4CWR A;  4BXI A;  4LPB A;  1QYE A;  3HYY A;  2CH4 A;  2Q2E B;  3G7B A;  4MOT A;  3HZ1 A;  3A0T A;  2YEB A;  4EGI A;  4HXZ A;  2BYI A;  1BGQ A;  5J71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...