5CPIB

Nucleosome containing unmethylated sat2r dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpiB00
2RVQC 5FUGB 3MNNC 3AV2D 1P3PD 2HUEC 5F99D 3TU4C 3W97C 1P3FC 2HIOC 5GSUD 3REHA 5AV6A 5GT3D 5DNMD 4WU8B 1TZYA 3B0CT 5B2IC 1M18D 3AZIB 5B2IB 5B2JA 3UTBB 1B67A 5B31D 3MGPA 1P3IC 4Z5TC 1JFIA 4LD9A 2NZDB 4HGAC 3LZ1A 3KUYC 3C1BA 3W98D 3X1UA 3LJAD 1ID3A 4KGCC 3WA9B 5B1LC 5AV5A 3B6FC 4EO5C 3RELB 3B0BA 4DRBA 3AN2D 3B0CW 1A7WA 3W96D 5B1LA 5AV5C 3MGPD 1HQ3B 1M18B 4XUJA 4G92C 1P3FD 1KX3B 2PYOA 4R8PA 3AZKA 4NE5A 1P3LC 4WNNA 5F99A 4QLCC 3KXBB 3WA9A 2PYOD 4WZSB 4X23A 3W97D 3AN2A 3AFAA 3REIC 5B1LD 1P3OD 5AV9C 4LD9C 5GSUB 4CAYB 4JJNA 3AZMA 4M6BA 1EQZA 4J8UD 5B33D 3AN2C 3LZ1C 1KX5C 4AWLC 3AZED 1WWIA 4J8UC 4AWLB 4Z66D 3UT9D 2L5AA 3UTBD 3WKJD 3W98A 5AVBA 3LJAB 3X1UD 3AZMB 1WWSA 4WU8A 3LELD 3X1VA 1EQZB 1KX3D 2NZDC 3B0DC 4DRAA 5B32A 2F8NB 1HQ3C 5CP6D 3MGPB 4Z2MH 1P3OA 2CWEA 3TU4A 1HQ3A 1P34A 4XUJC 1M1AC 5GXQA 2HIOB 3AV2C 1P3PC 4KGCB 3AZKB 5B32B 4KUDB 3W99C 4KUDC 3X1VB 3AV2A 1P3PA 3WA9C 4E44A 3X1TA 1P3BB 1M19B 1BH9B 4QLCD 3TU4D 1BFMA 4KUDA 4Z5TB 2F8NH 1HTAA 1S32C 3KUYB 1ID3B 3AZEC 3KXBD 5AY8A 5B0ZD 1H3OA 4KHAA 4WV4B 3AZND 3C1CA 5GT0C 4J8XA 5AY8C 5E5AA 2YFVA 1TAFB 2AROB 3AZLA 2FJ7B 3WKJA 4WU9D 4J8XB 1ID3C 1H3OB 1KX5D 5GSUC 4KHAB 3KXBA 1F1EA 5JA4A 2NQBB 2AROA 5AV9D 4YM6A 4Z5TD 2YFWB 3NQUA 1P3AC 3O62C 3MGQD 5DNNC 3C1CB 3WTPC 3MVDA 4G91B 3MGQB 2CV5B 4QLCB 4J8VB 3WTPB 4X23D 5CPID 2PYOC 5DNMC 1F66D 3WTPD 5B32G 3X1TB 1P3LA 4JJNC 5B2JC 1M1AB 1KX4D 5AV9B 4Z5TA 2YFWA 3AYWB 2CV5D 2HIOA 3AZIC 1ID3D 4WU8C 4XZQD 3MGRD 5G49B 4EO5B 4XZQB 1U35B 1KU5A 1TZYB 5KDMB 2F8ND 2BYKA 3VH6W 4YS3A 3X1VD 5CPJD 4J8XD 1M18C 3KWQB 5G49A 3UT9C 3VH6A 3UTBA 3KSYA 3MNNB 2JSSA 3MGRA 2HIOD 3UTAA 5B40C 3AYWA 5JRGA 5CPIB 1TZYD 1BH8B 5BS7A 4E45A 3AZFA 4J8VD 4J8WA 3AZHA 1P3ID 3AV1D 3B6GC 2FJ7C 5BS7C 4H9QB 3X1TD 1M19D 5BO0A 4QLCA 5B0ZB 3MNNA 4CSRB 4X23B 4X23C 1AOIC 5B1MC 3W99A 5B24D 3REHB 1M1AD 5JA4B 2NQBA 3UTAB 3WAAB 5JRGB 3O62B 5CP6B 3WAAD 3NQJB 3AZIA 5BT1C 3AYWD 3AZNB 5CPKD 5B40D 5B1LB 3REIB 1P3GC 1B6WA 1P3BC 3RELD 3LELC 3KUYA 2IO5B 2PYOB 4KGCD 3AZJD 4H9SA 5E5AD 5GT3B 1P3MB 1KX5B 4ZUXB 3AZNA 3X1SD 3MGSD 5CPKA 5BNXB 4YM6C 3VH5T 3WAAA 4XZQC 4J8UA 4NE3A 3REKB 3MVDC 3RELA 4H9OB 3REKC 5B0YC 3AZJC 3W97A 3AFAD 2AROC 4H9QA 4ZBJC 4H9PB 5GT3C 3A6NA 5B2JB 3NQUB 1P3FB 1P3OB 3X1TC 4ZUXC 1U35D 2HUEB 3VH5A 4G92B 3AZKD 5F99C 4WNNB 1P34C 4R8PD 1P34B 1P3FA 3W96C 4XUJD 3A6NB 4YS3C 5B32D 3AZGC 5AV6B 1P3GA 4CAYA 4NFTA 4J8XC 5JRGD 4H9RB 3B6FA 1N1JB 3AZEA 3W98C 4Z66B 1P3MD 1ZLAB 4Z66C 3AV2B 1P3PB 5CPJA 3X1UB 3AZMD 1EQZD 4H9RA 2CV5C 5B33C 5GT0A 3B6GB 5B0YA 5B1MD 2BYMA 1ZLAA 4R8PB 1S32B 5AVCD 5B2JD 5B2ID 1N1JA 1P3BD 3WTPA 3KWQC 1P3KD 5F99B 5GT3A 3WTPE 3AZFC 5DNMA 1P3KB 5B24B 3W99D 3REHD 1P3KC 3B6GD 3AZLB 5AV6D 3AFAC 3REIA 4G91C 2RVQD 5E5AB 5CPJB 3A6ND 3AZKC 1P34D 1TZYC 5B2IA 5AVCA 4Z2MG 5DNNA 3REKD 5B0YB 4ZBJB 5B1MA 3MGQA 4WU9C 1ZLAD 4H9NB 4YM6D 5AV8C 3AZGA 3AZLD 3AZJB 5AVBC 3W98B 3UTAD 1ULYA 5B1MB 3X1SB 3MGSB 5AVBD 3X1UC 3AFAB 5AVCB 5DNNB 3C1CC 3AZMC 1EQZC 3LZ0A 3LJAC 3AZJA 3AZGB 2YFVB 3C1CD 3A6NC 5B31A 1KX4C 5KDMA 4XZQA 4ZUXA 1M18A 4XUJB 3REHC 3KWQA 5CPIC 2NQBD 3WA9D 5B31B 5BT1D 5B24A 3AYWC 1U35A 5BNVA 3W99B 2FJ7D 4H9PA 3VH6T 5AY8B 3NQJA 4ZUXD 3MVDD 1U35C 2BYMB 5AV6C 1P3IB 5AV9A 5AV5B 3AZFD 4JJNB 3KWQD 2F8NK 1AOIA 3LELA 5E5AC 5CPJC 1P3MA 5B40B 3X1SA 3MGSA 3VH5W 5AV8D 3AZLC 5BNVB 5CP6A 1P3GB 2F8NA 3REJC 3R45A 4NE6A 4YS3B 2IO5C 1S32D 3AN2B 1P3OC 4HGAB 4R8PC 4H9SC 5B40A 5FUGA 3O62A 5JRGC 3UTAC 1KX3C 1AOID 2F8NG 3R45B 5B33A 1AOIB 3AZNC 3WKJC 1ZLAC 3WAAC 5GT0B 5GSUA 3B6GA 3KXBC 5AVCC 3AV1B 3REKA 3AV1C 3REJB 3MGQC 5B31G 5CPKB 5BNXA 1M19A 3MNND 1BH9A 1Q9CA 3W96A 3REID 4UUZA 5AV8B 4J8VA 3AV1A 4J8WD 3AZHD 1P3IA 2NQBC 3LZ1B 3O62D 5GXQB 5C3IC 3X1VC 3C1BC 4WU9A 3B6FB 5B32C 5B0YD 4YS3D 3LZ1D 5AV5D 3MGPC 3KUYD 4KGCA 3MGRC 1TAFA 5B0ZC 3LZ0D 4LD9D 3LZ0B 5AVBB 3LJAA 5AY8D 5BO0B 3V9RB 5B0ZA 3C1BD 4JJND 3RELC 3C1BB 3UTBC 1KX4A 4YM6B 5CHLB 4CSRA 1P3LD 4KUDD 1BH8A 3B0DB 1F66A 1R4VA 3MGRB 5CPIA 3LELB 5B24C 2FJ7A 3AZFB 1F66C 4H9NA 5GXQD 3V9RA 1P3AB 1P3KA 2AROD 1P3AD 1P3BA 1HQ3D 5CP6C 3WKJB 1KX5A 2NZDD 4WU9B 1S32A 5GT0D 2BYKB 3LZ0C 2LY8A 5CPKC 4H9OA 5DNMB 3REJD 4WU8D 1P3MC 1KX3A 3MGSC 5AV8A 3X1SC 4J8UB 1P3LB 3UT9A 3TU4B 3W97B 3B6FD 5B31C 3AZEB 4Z66A 1P3AA 3REJA 3MVDB 2CV5A 3AZGD 1M1AA 1P3GD 5C3IB 5GXQC 4J8WB 3AZHB 3W96B 4UUZB 1KX4B 1M19C 4J8WC 3AZHC 1JFIB 4LD9B 2NZDA 5DNND 5B33B 3UT9B 4J8VC 3AZID 1F66B
chains in the Genus database with same CATH superfamily
2RVQC 5FUGB 3MNNC 3AV2D 1P3PD 2HUEC 5F99D 3TU4C 3W97C 1P3FC 2HIOC 5GSUD 3REHA 5AV6A 5GT3D 5DNMD 4WU8B 1TZYA 3B0CT 5B2IC 1M18D 3AZIB 5B2IB 5B2JA 3UTBB 1B67A 3A1IA 5B31D 3MGPA 1P3IC 4Z5TC 1JFIA 4LD9A 2NZDB 1PZRA 3EPJA 4HGAC 3LZ1A 3KUYC 3C1BA 3W98D 3X1UA 3LJAD 1ID3A 4KGCC 3WA9B 5B1LC 5AV5A 3B6FC 4EO5C 3RELB 3B0BA 4DRBA 3EPKA 3AN2D 3B0CW 1A7WA 3W96D 5B1LA 2RIQA 5AV5C 3MGPD 1HQ3B 1M18B 4XUJA 4G92C 1P3FD 1KX3B 2PYOA 4R8PA 3EG5B 2Y2LA 3AZKA 4NE5A 3A1KA 1P3LC 4WNNA 5F99A 4QLCC 3KXBB 3WA9A 2PYOD 4WZSB 3AL0C 4X23A 3W97D 1T3UA 3AN2A 3AFAA 3REIC 5B1LD 1P3OD 5AV9C 4LD9C 5GSUB 4CAYB 4JJNA 4DQYB 4M6BA 3AZMA 4J8UD 5B33D 3AN2C 1EQZA 3LZ1C 1KX5C 4AWLC 3AZED 1WWIA 4J8UC 4AWLB 4Z66D 3UT9D 2L5AA 3UTBD 3WKJD 3W98A 5AVBA 3LJAB 3X1UD 3AZMB 1WWSA 4WU8A 3LELD 3X1VA 1EQZB 1KX3D 2NZDC 3B0DC 4DRAA 5B32A 2F8NB 1HQ3C 5CP6D 3MGPB 4Z2MH 1P3OA 2CWEA 3TU4A 1HQ3A 1P34A 4XUJC 1M1AC 5GXQA 2HIOB 3AV2C 1P3PC 4KGCB 3AZKB 5B32B 4KUDB 3W99C 4KUDC 3X1VB 3AV2A 1P3PA 3WA9C 4E44A 3X1TA 1P3BB 1M19B 1BH9B 4QLCD 3TU4D 1BFMA 4KUDA 4Z5TB 2F8NH 1HTAA 1S32C 3KUYB 2ZY4A 1ID3B 3AZEC 3KXBD 5AY8A 5B0ZD 1H3OA 4KHAA 4WV4B 3AZND 3C1CA 5GT0C 4J8XA 5AY8C 5E5AA 2Y2KA 2YFVA 1TAFB 2AROB 2Y2MA 3AZLA 2FJ7B 3WKJA 4WU9D 4J8XB 1ID3C 1H3OB 1KX5D 5GSUC 4KHAB 3KXBA 1F1EA 5JA4A 2NQBB 2AROA 4UPKA 5AV9D 4YM6A 4Z5TD 2YFWB 3NQUA 1P3AC 3O62C 3MGQD 5DNNC 3C1CB 3WTPC 3MVDA 4G91B 3MGQB 2CV5B 4QLCB 4J8VB 2G5IC 3WTPB 4X23D 5CPID 2PYOC 5DNMC 1F66D 3WTPD 5B32G 2Y2GA 3X1TB 1P3LA 4JJNC 5B2JC 1M1AB 2W8SA 1KX4D 5AV9B 4Z5TA 2YFWA 3AYWB 2CV5D 2HIOA 3AZIC 1ID3D 4WU8C 4XZQD 3MGRD 2DQNC 5G49B 4EO5B 4XZQB 1U35B 1KU5A 1TZYB 5KDMB 2F8ND 2BYKA 3VH6W 4YS3A 3X1VD 5CPJD 4J8XD 1M18C 3KWQB 5G49A 3UT9C 3VH6A 3UTBA 3KSYA 3MNNB 2JSSA 3MGRA 2HIOD 3UTAA 5B40C 3AYWA 5JRGA 5CPIB 1TZYD 1BH8B 2BG1A 5BS7A 4E45A 3AZFA 4J8VD 4J8WA 3AZHA 1P3ID 3AV1D 3B6GC 2FJ7C 5BS7C 4H9QB 3X1TD 1M19D 5BO0A 2ZM5A 4QLCA 5B0ZB 3MNNA 2XD5A 4CSRB 4X23B 4X23C 1AOIC 2G5HC 5B1MC 3W99A 5B24D 3REHB 1M1AD 5JA4B 2NQBA 3UTAB 3WAAB 5JRGB 3O62B 2Y2IA 5CP6B 3WAAD 3NQJB 3AZIA 5BT1C 3AYWD 3AZNB 3EPLA 5CPKD 5B40D 2J8PA 5B1LB 3REIB 1P3GC 1B6WA 1P3BC 3RELD 3LELC 3KUYA 2IO5B 2PYOB 4KGCD 3AZJD 4H9SA 5E5AD 5GT3B 1P3MB 1KX5B 4ZUXB 3AZNA 3X1SD 3MGSD 5CPKA 5BNXB 4YM6C 3VH5T 3WAAA 4XZQC 4J8UA 4NE3A 3REKB 3MVDC 3RELA 4H9OB 3REKC 5B0YC 3AZJC 3W97A 3AFAD 2AROC 4H9QA 4ZBJC 4H9PB 5GT3C 3A6NA 5B2JB 3NQUB 1P3FB 1P3OB 3X1TC 4ZUXC 1U35D 2HUEB 2Y2OA 3VH5A 4G92B 3AZKD 5F99C 4WNNB 1P34C 4R8PD 1P34B 1P3FA 3W96C 4XUJD 2Y2JA 3A6NB 4YS3C 5B32D 3AZGC 5AV6B 1P3GA 4CAYA 4NFTA 4J8XC 5JRGD 4H9RB 3B6FA 1N1JB 3AZEA 3W98C 4Z66B 1P3MD 1ZLAB 4Z66C 3AV2B 1P3PB 5CPJA 3X1UB 3AZMD 3P5JB 1EQZD 4H9RA 2CV5C 5B33C 5GT0A 3B6GB 5B0YA 5B1MD 2BYMA 1ZLAA 4R8PB 1S32B 5AVCD 5B2JD 5B2ID 1N1JA 1P3BD 3WTPA 3KWQC 1P3KD 5F99B 3H0RC 5GT3A 3H0LC 3WTPE 3AZFC 5DNMA 1P3KB 5B24B 3W99D 3REHD 1P3KC 3B6GD 3AZLB 5AV6D 3AFAC 3REIA 4G91C 2RVQD 5E5AB 5CPJB 3A6ND 1W2EA 3AZKC 1P34D 1TZYC 5B2IA 5AVCA 4Z2MG 5DNNA 3REKD 5B0YB 4ZBJB 5B1MA 3MGQA 4WU9C 1ZLAD 4H9NB 4YM6D 5AV8C 3AZGA 3AZLD 3AZJB 5AVBC 3W98B 3UTAD 1ULYA 5B1MB 3X1SB 3MGSB 5AVBD 3X1UC 3AFAB 5AVCB 5DNNB 3C1CC 3AZMC 1EQZC 3EPHA 3LZ0A 3LJAC 3AZJA 3AZGB 2YFVB 3C1CD 3A6NC 5B31A 1KX4C 5KDMA 4XZQA 4ZUXA 1M18A 4XUJB 3REHC 3KWQA 5CPIC 2NQBD 3WA9D 5B31B 2ZY5A 5BT1D 5B24A 3AYWC 1U35A 5BNVA 3W99B 2FJ7D 4H9PA 3VH6T 5AY8B 3NQJA 3KFUG 4ZUXD 3MVDD 1U35C 2BYMB 5AV6C 3FDDA 1P3IB 5AV9A 5AV5B 3AZFD 3H0MC 4JJNB 2F2AC 3KWQD 2F8NK 1AOIA 3LELA 5E5AC 3IP4C 5CPJC 1P3MA 5B40B 3X1SA 3MGSA 3VH5W 5AV8D 1Z2CB 5BNVB 3AZLC 5CP6A 1P3GB 2Y2QA 2F8NA 3REJC 3R45A 4NE6A 4YS3B 2IO5C 1S32D 3AN2B 1P3OC 4HGAB 4R8PC 4H9SC 5B40A 5FUGA 3O62A 5JRGC 3UTAC 2Y2NA 1KX3C 1AOID 2F8NG 3R45B 5B33A 1AOIB 3AZNC 3WKJC 1ZLAC 3WAAC 5GT0B 5GSUA 3B6GA 3KXBC 5AVCC 3AV1B 3REKA 3AV1C 3REJB 3MGQC 5B31G 5CPKB 5BNXA 1M19A 3MNND 1BH9A 1Q9CA 2Y2PA 2ZY2A 3W96A 4WJ3C 3REID 4UUZA 5AV8B 4J8VA 3AV1A 2JE5A 4J8WD 3AZHD 1P3IA 2NQBC 3LZ1B 3O62D 5GXQB 2DF4C 5C3IC 3X1VC 3C1BC 4WU9A 3B6FB 2Y2HA 2FFFB 5B32C 5B0YD 4YS3D 3LZ1D 5AV5D 3MGPC 3KUYD 4KGCA 3MGRC 1TAFA 5B0ZC 3LZ0D 4LD9D 3LZ0B 5AVBB 3LJAA 2VQRA 5AY8D 5BO0B 3V9RB 5B0ZA 3C1BD 4JJND 3RELC 3C1BB 3UTBC 1KX4A 4YM6B 5CHLB 4CSRA 1P3LD 4KUDD 1BH8A 3B0DB 1F66A 1R4VA 3MGRB 5CPIA 3LELB 5B24C 2FJ7A 3AZFB 1F66C 4H9NA 5GXQD 3V9RA 1P3AB 1P3KA 2AROD 1P3AD 1P3BA 1HQ3D 2XD1A 2ZY3A 5CP6C 3WKJB 1KX5A 2NZDD 4WU9B 1S32A 3F6TA 5GT0D 2BYKB 2JCHA 3LZ0C 2LY8A 5CPKC 4H9OA 5DNMB 3REJD 4WU8D 1P3MC 1KX3A 3MGSC 5AV8A 3X1SC 4J8UB 1P3LB 3UT9A 2UWXA 3TU4B 3W97B 3B6FD 5B31C 3AZEB 4Z66A 1P3AA 3REJA 3MVDB 2CV5A 3AZGD 1M1AA 1P3GD 5C3IB 5GXQC 4J8WB 3AZHB 3W96B 4UUZB 1KX4B 1M19C 4J8WC 3AZHC 1JFIB 4LD9B 2NZDA 5DNND 5B33B 3UT9B 4J8VC 3AZID 1F66B
chains in the Genus database with same CATH topology
2RVQC 5FUGB 3MNNC 3AV2D 1P3PD 2HUEC 5F99D 3TU4C 3W97C 1P3FC 2HIOC 5GSUD 3REHA 5AV6A 5GT3D 5DNMD 4WU8B 1TZYA 3B0CT 5B2IC 1M18D 3AZIB 5B2IB 5B2JA 3UTBB 1B67A 3A1IA 5B31D 3MGPA 1P3IC 4Z5TC 1JFIA 4LD9A 2NZDB 1PZRA 3EPJA 4HGAC 3LZ1A 3KUYC 3C1BA 3W98D 3X1UA 3LJAD 1ID3A 4KGCC 3WA9B 5B1LC 5AV5A 3B6FC 4EO5C 3RELB 3B0BA 4DRBA 3EPKA 3AN2D 3B0CW 1A7WA 3W96D 5B1LA 2RIQA 5AV5C 3MGPD 1HQ3B 1M18B 4XUJA 4G92C 1P3FD 1KX3B 2PYOA 4R8PA 3EG5B 2Y2LA 3AZKA 4NE5A 3A1KA 1P3LC 4WNNA 5F99A 4QLCC 3KXBB 3WA9A 2PYOD 4WZSB 3AL0C 4X23A 3W97D 1T3UA 3AN2A 3AFAA 3REIC 5B1LD 1P3OD 5AV9C 4LD9C 5GSUB 4CAYB 4JJNA 4DQYB 4M6BA 3AZMA 4J8UD 5B33D 3AN2C 1EQZA 3LZ1C 1KX5C 4AWLC 3AZED 1WWIA 4J8UC 4AWLB 4Z66D 3UT9D 2L5AA 3UTBD 3WKJD 3W98A 5AVBA 3LJAB 3X1UD 3AZMB 1WWSA 4WU8A 3LELD 3X1VA 1EQZB 1KX3D 2NZDC 3B0DC 4DRAA 5B32A 2F8NB 1HQ3C 5CP6D 3MGPB 4Z2MH 1P3OA 2CWEA 3TU4A 1HQ3A 1P34A 4XUJC 1M1AC 5GXQA 2HIOB 3AV2C 1P3PC 4KGCB 3AZKB 5B32B 4KUDB 3W99C 4KUDC 3X1VB 3AV2A 1P3PA 3WA9C 4E44A 3X1TA 1P3BB 1M19B 1BH9B 4QLCD 3TU4D 1BFMA 4KUDA 4Z5TB 2F8NH 1HTAA 1S32C 3KUYB 2ZY4A 1ID3B 3AZEC 3KXBD 5AY8A 5B0ZD 1H3OA 4KHAA 4WV4B 3AZND 3C1CA 5GT0C 4J8XA 5AY8C 5E5AA 2Y2KA 2YFVA 1TAFB 2AROB 2Y2MA 3AZLA 2FJ7B 3WKJA 4WU9D 4J8XB 1ID3C 1H3OB 1KX5D 5GSUC 4KHAB 3KXBA 1F1EA 5JA4A 2NQBB 2AROA 4UPKA 5AV9D 4YM6A 4Z5TD 2YFWB 3NQUA 1P3AC 3O62C 3MGQD 5DNNC 3C1CB 3WTPC 3MVDA 4G91B 3MGQB 2CV5B 4QLCB 4J8VB 2G5IC 3WTPB 4X23D 5CPID 2PYOC 5DNMC 1F66D 3WTPD 5B32G 2Y2GA 3X1TB 1P3LA 4JJNC 5B2JC 1M1AB 2W8SA 1KX4D 5AV9B 4Z5TA 2YFWA 3AYWB 2CV5D 2HIOA 3AZIC 1ID3D 4WU8C 4XZQD 3MGRD 2DQNC 5G49B 4EO5B 4XZQB 1U35B 1KU5A 1TZYB 5KDMB 2F8ND 2BYKA 3VH6W 4YS3A 3X1VD 5CPJD 4J8XD 1M18C 3KWQB 5G49A 3UT9C 3VH6A 3UTBA 3KSYA 3MNNB 2JSSA 3MGRA 2HIOD 3UTAA 5B40C 3AYWA 5JRGA 5CPIB 1TZYD 1BH8B 2BG1A 5BS7A 4E45A 3AZFA 4J8VD 4J8WA 3AZHA 1P3ID 3AV1D 3B6GC 2FJ7C 5BS7C 4H9QB 3X1TD 1M19D 5BO0A 2ZM5A 4QLCA 5B0ZB 3MNNA 2XD5A 4CSRB 4X23B 4X23C 1AOIC 2G5HC 5B1MC 3W99A 5B24D 3REHB 1M1AD 5JA4B 2NQBA 3UTAB 3WAAB 5JRGB 3O62B 2Y2IA 5CP6B 3WAAD 3NQJB 3AZIA 5BT1C 3AYWD 3AZNB 3EPLA 5CPKD 5B40D 2J8PA 5B1LB 3REIB 1P3GC 1B6WA 1P3BC 3RELD 3LELC 3KUYA 2IO5B 2PYOB 4KGCD 3AZJD 4H9SA 5E5AD 5GT3B 1P3MB 1KX5B 4ZUXB 3AZNA 3X1SD 3MGSD 5CPKA 5BNXB 4YM6C 3VH5T 3WAAA 4XZQC 4J8UA 4NE3A 3REKB 3MVDC 3RELA 4H9OB 3REKC 5B0YC 3AZJC 3W97A 3AFAD 2AROC 4H9QA 4ZBJC 4H9PB 5GT3C 3A6NA 5B2JB 3NQUB 1P3FB 1P3OB 3X1TC 4ZUXC 1U35D 2HUEB 2Y2OA 3VH5A 4G92B 3AZKD 5F99C 4WNNB 1P34C 4R8PD 1P34B 1P3FA 3W96C 4XUJD 2Y2JA 3A6NB 4YS3C 5B32D 3AZGC 5AV6B 1P3GA 4CAYA 4NFTA 4J8XC 5JRGD 4H9RB 3B6FA 1N1JB 3AZEA 3W98C 4Z66B 1P3MD 1ZLAB 4Z66C 3AV2B 1P3PB 5CPJA 3X1UB 3AZMD 3P5JB 1EQZD 4H9RA 2CV5C 5B33C 5GT0A 3B6GB 5B0YA 5B1MD 2BYMA 1ZLAA 4R8PB 1S32B 5AVCD 5B2JD 5B2ID 1N1JA 1P3BD 3WTPA 3KWQC 1P3KD 5F99B 3H0RC 5GT3A 3H0LC 3WTPE 3AZFC 5DNMA 1P3KB 5B24B 3W99D 3REHD 1P3KC 3B6GD 3AZLB 5AV6D 3AFAC 3REIA 4G91C 2RVQD 5E5AB 5CPJB 3A6ND 1W2EA 3AZKC 1P34D 1TZYC 5B2IA 5AVCA 4Z2MG 5DNNA 3REKD 5B0YB 4ZBJB 5B1MA 3MGQA 4WU9C 1ZLAD 4H9NB 4YM6D 5AV8C 3AZGA 3AZLD 3AZJB 5AVBC 3W98B 3UTAD 1ULYA 5B1MB 3X1SB 3MGSB 5AVBD 3X1UC 3AFAB 5AVCB 5DNNB 3C1CC 3AZMC 1EQZC 3EPHA 3LZ0A 3LJAC 3AZJA 3AZGB 2YFVB 3C1CD 3A6NC 5B31A 1KX4C 5KDMA 4XZQA 4ZUXA 1M18A 4XUJB 3REHC 3KWQA 5CPIC 2NQBD 3WA9D 5B31B 2ZY5A 5BT1D 5B24A 3AYWC 1U35A 5BNVA 3W99B 2FJ7D 4H9PA 3VH6T 5AY8B 3NQJA 3KFUG 4ZUXD 3MVDD 1U35C 2BYMB 5AV6C 3FDDA 1P3IB 5AV9A 5AV5B 3AZFD 3H0MC 4JJNB 2F2AC 3KWQD 2F8NK 1AOIA 3LELA 5E5AC 3IP4C 5CPJC 1P3MA 5B40B 3X1SA 3MGSA 3VH5W 5AV8D 1Z2CB 5BNVB 3AZLC 5CP6A 1P3GB 2Y2QA 2F8NA 3REJC 3R45A 4NE6A 4YS3B 2IO5C 1S32D 3AN2B 1P3OC 4HGAB 4R8PC 4H9SC 5B40A 5FUGA 3O62A 5JRGC 3UTAC 2Y2NA 1KX3C 1AOID 2F8NG 3R45B 5B33A 1AOIB 3AZNC 3WKJC 1ZLAC 3WAAC 5GT0B 5GSUA 3B6GA 3KXBC 5AVCC 3AV1B 3REKA 3AV1C 3REJB 3MGQC 5B31G 5CPKB 5BNXA 1M19A 3MNND 1BH9A 1Q9CA 2Y2PA 2ZY2A 3W96A 4WJ3C 3REID 4UUZA 5AV8B 4J8VA 3AV1A 2JE5A 4J8WD 3AZHD 1P3IA 2NQBC 3LZ1B 3O62D 5GXQB 2DF4C 5C3IC 3X1VC 3C1BC 4WU9A 3B6FB 2Y2HA 2FFFB 5B32C 5B0YD 4YS3D 3LZ1D 5AV5D 3MGPC 3KUYD 4KGCA 3MGRC 1TAFA 5B0ZC 3LZ0D 4LD9D 3LZ0B 5AVBB 3LJAA 2VQRA 5AY8D 5BO0B 3V9RB 5B0ZA 3C1BD 4JJND 3RELC 3C1BB 3UTBC 1KX4A 4YM6B 5CHLB 4CSRA 1P3LD 4KUDD 1BH8A 3B0DB 1F66A 1R4VA 3MGRB 5CPIA 3LELB 5B24C 2FJ7A 3AZFB 1F66C 4H9NA 5GXQD 3V9RA 1P3AB 1P3KA 2AROD 1P3AD 1P3BA 1HQ3D 2XD1A 2ZY3A 5CP6C 3WKJB 1KX5A 2NZDD 4WU9B 1S32A 3F6TA 5GT0D 2BYKB 2JCHA 3LZ0C 2LY8A 5CPKC 4H9OA 5DNMB 3REJD 4WU8D 1P3MC 1KX3A 3MGSC 5AV8A 3X1SC 4J8UB 1P3LB 3UT9A 2UWXA 3TU4B 3W97B 3B6FD 5B31C 3AZEB 4Z66A 1P3AA 3REJA 3MVDB 2CV5A 3AZGD 1M1AA 1P3GD 5C3IB 5GXQC 4J8WB 3AZHB 3W96B 4UUZB 1KX4B 1M19C 4J8WC 3AZHC 1JFIB 4LD9B 2NZDA 5DNND 5B33B 3UT9B 4J8VC 3AZID 1F66B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVQ C;  5FUG B;  3MNN C;  3AV2 D;  1P3P D;  2HUE C;  5F99 D;  3TU4 C;  3W97 C;  1P3F C;  2HIO C;  5GSU D;  3REH A;  5AV6 A;  5GT3 D;  5DNM D;  4WU8 B;  1TZY A;  3B0C T;  5B2I C;  1M18 D;  3AZI B;  5B2I B;  5B2J A;  3UTB B;  1B67 A;  5B31 D;  3MGP A;  1P3I C;  4Z5T C;  1JFI A;  4LD9 A;  2NZD B;  4HGA C;  3LZ1 A;  3KUY C;  3C1B A;  3W98 D;  3X1U A;  3LJA D;  1ID3 A;  4KGC C;  3WA9 B;  5B1L C;  5AV5 A;  3B6F C;  4EO5 C;  3REL B;  3B0B A;  4DRB A;  3AN2 D;  3B0C W;  1A7W A;  3W96 D;  5B1L A;  5AV5 C;  3MGP D;  1HQ3 B;  1M18 B;  4XUJ A;  4G92 C;  1P3F D;  1KX3 B;  2PYO A;  4R8P A;  3AZK A;  4NE5 A;  1P3L C;  4WNN A;  5F99 A;  4QLC C;  3KXB B;  3WA9 A;  2PYO D;  4WZS B;  4X23 A;  3W97 D;  3AN2 A;  3AFA A;  3REI C;  5B1L D;  1P3O D;  5AV9 C;  4LD9 C;  5GSU B;  4CAY B;  4JJN A;  3AZM A;  4M6B A;  1EQZ A;  4J8U D;  5B33 D;  3AN2 C;  3LZ1 C;  1KX5 C;  4AWL C;  3AZE D;  1WWI A;  4J8U C;  4AWL B;  4Z66 D;  3UT9 D;  2L5A A;  3UTB D;  3WKJ D;  3W98 A;  5AVB A;  3LJA B;  3X1U D;  3AZM B;  1WWS A;  4WU8 A;  3LEL D;  3X1V A;  1EQZ B;  1KX3 D;  2NZD C;  3B0D C;  4DRA A;  5B32 A;  2F8N B;  1HQ3 C;  5CP6 D;  3MGP B;  4Z2M H;  1P3O A;  2CWE A;  3TU4 A;  1HQ3 A;  1P34 A;  4XUJ C;  1M1A C;  5GXQ A;  2HIO B;  3AV2 C;  1P3P C;  4KGC B;  3AZK B;  5B32 B;  4KUD B;  3W99 C;  4KUD C;  3X1V B;  3AV2 A;  1P3P A;  3WA9 C;  4E44 A;  3X1T A;  1P3B B;  1M19 B;  1BH9 B;  4QLC D;  3TU4 D;  1BFM A;  4KUD A;  4Z5T B;  2F8N H;  1HTA A;  1S32 C;  3KUY B;  1ID3 B;  3AZE C;  3KXB D;  5AY8 A;  5B0Z D;  1H3O A;  4KHA A;  4WV4 B;  3AZN D;  3C1C A;  5GT0 C;  4J8X A;  5AY8 C;  5E5A A;  2YFV A;  1TAF B;  2ARO B;  3AZL A;  2FJ7 B;  3WKJ A;  4WU9 D;  4J8X B;  1ID3 C;  1H3O B;  1KX5 D;  5GSU C;  4KHA B;  3KXB A;  1F1E A;  5JA4 A;  2NQB B;  2ARO A;  5AV9 D;  4YM6 A;  4Z5T D;  2YFW B;  3NQU A;  1P3A C;  3O62 C;  3MGQ D;  5DNN C;  3C1C B;  3WTP C;  3MVD A;  4G91 B;  3MGQ B;  2CV5 B;  4QLC B;  4J8V B;  3WTP B;  4X23 D;  5CPI D;  2PYO C;  5DNM C;  1F66 D;  3WTP D;  5B32 G;  3X1T B;  1P3L A;  4JJN C;  5B2J C;  1M1A B;  1KX4 D;  5AV9 B;  4Z5T A;  2YFW A;  3AYW B;  2CV5 D;  2HIO A;  3AZI C;  1ID3 D;  4WU8 C;  4XZQ D;  3MGR D;  5G49 B;  4EO5 B;  4XZQ B;  1U35 B;  1KU5 A;  1TZY B;  5KDM B;  2F8N D;  2BYK A;  3VH6 W;  4YS3 A;  3X1V D;  5CPJ D;  4J8X D;  1M18 C;  3KWQ B;  5G49 A;  3UT9 C;  3VH6 A;  3UTB A;  3KSY A;  3MNN B;  2JSS A;  3MGR A;  2HIO D;  3UTA A;  5B40 C;  3AYW A;  5JRG A;  5CPI B;  1TZY D;  1BH8 B;  5BS7 A;  4E45 A;  3AZF A;  4J8V D;  4J8W A;  3AZH A;  1P3I D;  3AV1 D;  3B6G C;  2FJ7 C;  5BS7 C;  4H9Q B;  3X1T D;  1M19 D;  5BO0 A;  4QLC A;  5B0Z B;  3MNN A;  4CSR B;  4X23 B;  4X23 C;  1AOI C;  5B1M C;  3W99 A;  5B24 D;  3REH B;  1M1A D;  5JA4 B;  2NQB A;  3UTA B;  3WAA B;  5JRG B;  3O62 B;  5CP6 B;  3WAA D;  3NQJ B;  3AZI A;  5BT1 C;  3AYW D;  3AZN B;  5CPK D;  5B40 D;  5B1L B;  3REI B;  1P3G C;  1B6W A;  1P3B C;  3REL D;  3LEL C;  3KUY A;  2IO5 B;  2PYO B;  4KGC D;  3AZJ D;  4H9S A;  5E5A D;  5GT3 B;  1P3M B;  1KX5 B;  4ZUX B;  3AZN A;  3X1S D;  3MGS D;  5CPK A;  5BNX B;  4YM6 C;  3VH5 T;  3WAA A;  4XZQ C;  4J8U A;  4NE3 A;  3REK B;  3MVD C;  3REL A;  4H9O B;  3REK C;  5B0Y C;  3AZJ C;  3W97 A;  3AFA D;  2ARO C;  4H9Q A;  4ZBJ C;  4H9P B;  5GT3 C;  3A6N A;  5B2J B;  3NQU B;  1P3F B;  1P3O B;  3X1T C;  4ZUX C;  1U35 D;  2HUE B;  3VH5 A;  4G92 B;  3AZK D;  5F99 C;  4WNN B;  1P34 C;  4R8P D;  1P34 B;  1P3F A;  3W96 C;  4XUJ D;  3A6N B;  4YS3 C;  5B32 D;  3AZG C;  5AV6 B;  1P3G A;  4CAY A;  4NFT A;  4J8X C;  5JRG D;  4H9R B;  3B6F A;  1N1J B;  3AZE A;  3W98 C;  4Z66 B;  1P3M D;  1ZLA B;  4Z66 C;  3AV2 B;  1P3P B;  5CPJ A;  3X1U B;  3AZM D;  1EQZ D;  4H9R A;  2CV5 C;  5B33 C;  5GT0 A;  3B6G B;  5B0Y A;  5B1M D;  2BYM A;  1ZLA A;  4R8P B;  1S32 B;  5AVC D;  5B2J D;  5B2I D;  1N1J A;  1P3B D;  3WTP A;  3KWQ C;  1P3K D;  5F99 B;  5GT3 A;  3WTP E;  3AZF C;  5DNM A;  1P3K B;  5B24 B;  3W99 D;  3REH D;  1P3K C;  3B6G D;  3AZL B;  5AV6 D;  3AFA C;  3REI A;  4G91 C;  2RVQ D;  5E5A B;  5CPJ B;  3A6N D;  3AZK C;  1P34 D;  1TZY C;  5B2I A;  5AVC A;  4Z2M G;  5DNN A;  3REK D;  5B0Y B;  4ZBJ B;  5B1M A;  3MGQ A;  4WU9 C;  1ZLA D;  4H9N B;  4YM6 D;  5AV8 C;  3AZG A;  3AZL D;  3AZJ B;  5AVB C;  3W98 B;  3UTA D;  1ULY A;  5B1M B;  3X1S B;  3MGS B;  5AVB D;  3X1U C;  3AFA B;  5AVC B;  5DNN B;  3C1C C;  3AZM C;  1EQZ C;  3LZ0 A;  3LJA C;  3AZJ A;  3AZG B;  2YFV B;  3C1C D;  3A6N C;  5B31 A;  1KX4 C;  5KDM A;  4XZQ A;  4ZUX A;  1M18 A;  4XUJ B;  3REH C;  3KWQ A;  5CPI C;  2NQB D;  3WA9 D;  5B31 B;  5BT1 D;  5B24 A;  3AYW C;  1U35 A;  5BNV A;  3W99 B;  2FJ7 D;  4H9P A;  3VH6 T;  5AY8 B;  3NQJ A;  4ZUX D;  3MVD D;  1U35 C;  2BYM B;  5AV6 C;  1P3I B;  5AV9 A;  5AV5 B;  3AZF D;  4JJN B;  3KWQ D;  2F8N K;  1AOI A;  3LEL A;  5E5A C;  5CPJ C;  1P3M A;  5B40 B;  3X1S A;  3MGS A;  3VH5 W;  5AV8 D;  3AZL C;  5BNV B;  5CP6 A;  1P3G B;  2F8N A;  3REJ C;  3R45 A;  4NE6 A;  4YS3 B;  2IO5 C;  1S32 D;  3AN2 B;  1P3O C;  4HGA B;  4R8P C;  4H9S C;  5B40 A;  5FUG A;  3O62 A;  5JRG C;  3UTA C;  1KX3 C;  1AOI D;  2F8N G;  3R45 B;  5B33 A;  1AOI B;  3AZN C;  3WKJ C;  1ZLA C;  3WAA C;  5GT0 B;  5GSU A;  3B6G A;  3KXB C;  5AVC C;  3AV1 B;  3REK A;  3AV1 C;  3REJ B;  3MGQ C;  5B31 G;  5CPK B;  5BNX A;  1M19 A;  3MNN D;  1BH9 A;  1Q9C A;  3W96 A;  3REI D;  4UUZ A;  5AV8 B;  4J8V A;  3AV1 A;  4J8W D;  3AZH D;  1P3I A;  2NQB C;  3LZ1 B;  3O62 D;  5GXQ B;  5C3I C;  3X1V C;  3C1B C;  4WU9 A;  3B6F B;  5B32 C;  5B0Y D;  4YS3 D;  3LZ1 D;  5AV5 D;  3MGP C;  3KUY D;  4KGC A;  3MGR C;  1TAF A;  5B0Z C;  3LZ0 D;  4LD9 D;  3LZ0 B;  5AVB B;  3LJA A;  5AY8 D;  5BO0 B;  3V9R B;  5B0Z A;  3C1B D;  4JJN D;  3REL C;  3C1B B;  3UTB C;  1KX4 A;  4YM6 B;  5CHL B;  4CSR A;  1P3L D;  4KUD D;  1BH8 A;  3B0D B;  1F66 A;  1R4V A;  3MGR B;  5CPI A;  3LEL B;  5B24 C;  2FJ7 A;  3AZF B;  1F66 C;  4H9N A;  5GXQ D;  3V9R A;  1P3A B;  1P3K A;  2ARO D;  1P3A D;  1P3B A;  1HQ3 D;  5CP6 C;  3WKJ B;  1KX5 A;  2NZD D;  4WU9 B;  1S32 A;  5GT0 D;  2BYK B;  3LZ0 C;  2LY8 A;  5CPK C;  4H9O A;  5DNM B;  3REJ D;  4WU8 D;  1P3M C;  1KX3 A;  3MGS C;  5AV8 A;  3X1S C;  4J8U B;  1P3L B;  3UT9 A;  3TU4 B;  3W97 B;  3B6F D;  5B31 C;  3AZE B;  4Z66 A;  1P3A A;  3REJ A;  3MVD B;  2CV5 A;  3AZG D;  1M1A A;  1P3G D;  5C3I B;  5GXQ C;  4J8W B;  3AZH B;  3W96 B;  4UUZ B;  1KX4 B;  1M19 C;  4J8W C;  3AZH C;  1JFI B;  4LD9 B;  2NZD A;  5DNN D;  5B33 B;  3UT9 B;  4J8V C;  3AZI D;  1F66 B; 
#chains in the Genus database with same CATH topology
 2RVQ C;  5FUG B;  3MNN C;  3AV2 D;  1P3P D;  2HUE C;  5F99 D;  3TU4 C;  3W97 C;  1P3F C;  2HIO C;  5GSU D;  3REH A;  5AV6 A;  5GT3 D;  5DNM D;  4WU8 B;  1TZY A;  3B0C T;  5B2I C;  1M18 D;  3AZI B;  5B2I B;  5B2J A;  3UTB B;  1B67 A;  3A1I A;  5B31 D;  3MGP A;  1P3I C;  4Z5T C;  1JFI A;  4LD9 A;  2NZD B;  1PZR A;  3EPJ A;  4HGA C;  3LZ1 A;  3KUY C;  3C1B A;  3W98 D;  3X1U A;  3LJA D;  1ID3 A;  4KGC C;  3WA9 B;  5B1L C;  5AV5 A;  3B6F C;  4EO5 C;  3REL B;  3B0B A;  4DRB A;  3EPK A;  3AN2 D;  3B0C W;  1A7W A;  3W96 D;  5B1L A;  2RIQ A;  5AV5 C;  3MGP D;  1HQ3 B;  1M18 B;  4XUJ A;  4G92 C;  1P3F D;  1KX3 B;  2PYO A;  4R8P A;  3EG5 B;  2Y2L A;  3AZK A;  4NE5 A;  3A1K A;  1P3L C;  4WNN A;  5F99 A;  4QLC C;  3KXB B;  3WA9 A;  2PYO D;  4WZS B;  3AL0 C;  4X23 A;  3W97 D;  1T3U A;  3AN2 A;  3AFA A;  3REI C;  5B1L D;  1P3O D;  5AV9 C;  4LD9 C;  5GSU B;  4CAY B;  4JJN A;  4DQY B;  4M6B A;  3AZM A;  4J8U D;  5B33 D;  3AN2 C;  1EQZ A;  3LZ1 C;  1KX5 C;  4AWL C;  3AZE D;  1WWI A;  4J8U C;  4AWL B;  4Z66 D;  3UT9 D;  2L5A A;  3UTB D;  3WKJ D;  3W98 A;  5AVB A;  3LJA B;  3X1U D;  3AZM B;  1WWS A;  4WU8 A;  3LEL D;  3X1V A;  1EQZ B;  1KX3 D;  2NZD C;  3B0D C;  4DRA A;  5B32 A;  2F8N B;  1HQ3 C;  5CP6 D;  3MGP B;  4Z2M H;  1P3O A;  2CWE A;  3TU4 A;  1HQ3 A;  1P34 A;  4XUJ C;  1M1A C;  5GXQ A;  2HIO B;  3AV2 C;  1P3P C;  4KGC B;  3AZK B;  5B32 B;  4KUD B;  3W99 C;  4KUD C;  3X1V B;  3AV2 A;  1P3P A;  3WA9 C;  4E44 A;  3X1T A;  1P3B B;  1M19 B;  1BH9 B;  4QLC D;  3TU4 D;  1BFM A;  4KUD A;  4Z5T B;  2F8N H;  1HTA A;  1S32 C;  3KUY B;  2ZY4 A;  1ID3 B;  3AZE C;  3KXB D;  5AY8 A;  5B0Z D;  1H3O A;  4KHA A;  4WV4 B;  3AZN D;  3C1C A;  5GT0 C;  4J8X A;  5AY8 C;  5E5A A;  2Y2K A;  2YFV A;  1TAF B;  2ARO B;  2Y2M A;  3AZL A;  2FJ7 B;  3WKJ A;  4WU9 D;  4J8X B;  1ID3 C;  1H3O B;  1KX5 D;  5GSU C;  4KHA B;  3KXB A;  1F1E A;  5JA4 A;  2NQB B;  2ARO A;  4UPK A;  5AV9 D;  4YM6 A;  4Z5T D;  2YFW B;  3NQU A;  1P3A C;  3O62 C;  3MGQ D;  5DNN C;  3C1C B;  3WTP C;  3MVD A;  4G91 B;  3MGQ B;  2CV5 B;  4QLC B;  4J8V B;  2G5I C;  3WTP B;  4X23 D;  5CPI D;  2PYO C;  5DNM C;  1F66 D;  3WTP D;  5B32 G;  2Y2G A;  3X1T B;  1P3L A;  4JJN C;  5B2J C;  1M1A B;  2W8S A;  1KX4 D;  5AV9 B;  4Z5T A;  2YFW A;  3AYW B;  2CV5 D;  2HIO A;  3AZI C;  1ID3 D;  4WU8 C;  4XZQ D;  3MGR D;  2DQN C;  5G49 B;  4EO5 B;  4XZQ B;  1U35 B;  1KU5 A;  1TZY B;  5KDM B;  2F8N D;  2BYK A;  3VH6 W;  4YS3 A;  3X1V D;  5CPJ D;  4J8X D;  1M18 C;  3KWQ B;  5G49 A;  3UT9 C;  3VH6 A;  3UTB A;  3KSY A;  3MNN B;  2JSS A;  3MGR A;  2HIO D;  3UTA A;  5B40 C;  3AYW A;  5JRG A;  5CPI B;  1TZY D;  1BH8 B;  2BG1 A;  5BS7 A;  4E45 A;  3AZF A;  4J8V D;  4J8W A;  3AZH A;  1P3I D;  3AV1 D;  3B6G C;  2FJ7 C;  5BS7 C;  4H9Q B;  3X1T D;  1M19 D;  5BO0 A;  2ZM5 A;  4QLC A;  5B0Z B;  3MNN A;  2XD5 A;  4CSR B;  4X23 B;  4X23 C;  1AOI C;  2G5H C;  5B1M C;  3W99 A;  5B24 D;  3REH B;  1M1A D;  5JA4 B;  2NQB A;  3UTA B;  3WAA B;  5JRG B;  3O62 B;  2Y2I A;  5CP6 B;  3WAA D;  3NQJ B;  3AZI A;  5BT1 C;  3AYW D;  3AZN B;  3EPL A;  5CPK D;  5B40 D;  2J8P A;  5B1L B;  3REI B;  1P3G C;  1B6W A;  1P3B C;  3REL D;  3LEL C;  3KUY A;  2IO5 B;  2PYO B;  4KGC D;  3AZJ D;  4H9S A;  5E5A D;  5GT3 B;  1P3M B;  1KX5 B;  4ZUX B;  3AZN A;  3X1S D;  3MGS D;  5CPK A;  5BNX B;  4YM6 C;  3VH5 T;  3WAA A;  4XZQ C;  4J8U A;  4NE3 A;  3REK B;  3MVD C;  3REL A;  4H9O B;  3REK C;  5B0Y C;  3AZJ C;  3W97 A;  3AFA D;  2ARO C;  4H9Q A;  4ZBJ C;  4H9P B;  5GT3 C;  3A6N A;  5B2J B;  3NQU B;  1P3F B;  1P3O B;  3X1T C;  4ZUX C;  1U35 D;  2HUE B;  2Y2O A;  3VH5 A;  4G92 B;  3AZK D;  5F99 C;  4WNN B;  1P34 C;  4R8P D;  1P34 B;  1P3F A;  3W96 C;  4XUJ D;  2Y2J A;  3A6N B;  4YS3 C;  5B32 D;  3AZG C;  5AV6 B;  1P3G A;  4CAY A;  4NFT A;  4J8X C;  5JRG D;  4H9R B;  3B6F A;  1N1J B;  3AZE A;  3W98 C;  4Z66 B;  1P3M D;  1ZLA B;  4Z66 C;  3AV2 B;  1P3P B;  5CPJ A;  3X1U B;  3AZM D;  3P5J B;  1EQZ D;  4H9R A;  2CV5 C;  5B33 C;  5GT0 A;  3B6G B;  5B0Y A;  5B1M D;  2BYM A;  1ZLA A;  4R8P B;  1S32 B;  5AVC D;  5B2J D;  5B2I D;  1N1J A;  1P3B D;  3WTP A;  3KWQ C;  1P3K D;  5F99 B;  3H0R C;  5GT3 A;  3H0L C;  3WTP E;  3AZF C;  5DNM A;  1P3K B;  5B24 B;  3W99 D;  3REH D;  1P3K C;  3B6G D;  3AZL B;  5AV6 D;  3AFA C;  3REI A;  4G91 C;  2RVQ D;  5E5A B;  5CPJ B;  3A6N D;  1W2E A;  3AZK C;  1P34 D;  1TZY C;  5B2I A;  5AVC A;  4Z2M G;  5DNN A;  3REK D;  5B0Y B;  4ZBJ B;  5B1M A;  3MGQ A;  4WU9 C;  1ZLA D;  4H9N B;  4YM6 D;  5AV8 C;  3AZG A;  3AZL D;  3AZJ B;  5AVB C;  3W98 B;  3UTA D;  1ULY A;  5B1M B;  3X1S B;  3MGS B;  5AVB D;  3X1U C;  3AFA B;  5AVC B;  5DNN B;  3C1C C;  3AZM C;  1EQZ C;  3EPH A;  3LZ0 A;  3LJA C;  3AZJ A;  3AZG B;  2YFV B;  3C1C D;  3A6N C;  5B31 A;  1KX4 C;  5KDM A;  4XZQ A;  4ZUX A;  1M18 A;  4XUJ B;  3REH C;  3KWQ A;  5CPI C;  2NQB D;  3WA9 D;  5B31 B;  2ZY5 A;  5BT1 D;  5B24 A;  3AYW C;  1U35 A;  5BNV A;  3W99 B;  2FJ7 D;  4H9P A;  3VH6 T;  5AY8 B;  3NQJ A;  3KFU G;  4ZUX D;  3MVD D;  1U35 C;  2BYM B;  5AV6 C;  3FDD A;  1P3I B;  5AV9 A;  5AV5 B;  3AZF D;  3H0M C;  4JJN B;  2F2A C;  3KWQ D;  2F8N K;  1AOI A;  3LEL A;  5E5A C;  3IP4 C;  5CPJ C;  1P3M A;  5B40 B;  3X1S A;  3MGS A;  3VH5 W;  5AV8 D;  1Z2C B;  5BNV B;  3AZL C;  5CP6 A;  1P3G B;  2Y2Q A;  2F8N A;  3REJ C;  3R45 A;  4NE6 A;  4YS3 B;  2IO5 C;  1S32 D;  3AN2 B;  1P3O C;  4HGA B;  4R8P C;  4H9S C;  5B40 A;  5FUG A;  3O62 A;  5JRG C;  3UTA C;  2Y2N A;  1KX3 C;  1AOI D;  2F8N G;  3R45 B;  5B33 A;  1AOI B;  3AZN C;  3WKJ C;  1ZLA C;  3WAA C;  5GT0 B;  5GSU A;  3B6G A;  3KXB C;  5AVC C;  3AV1 B;  3REK A;  3AV1 C;  3REJ B;  3MGQ C;  5B31 G;  5CPK B;  5BNX A;  1M19 A;  3MNN D;  1BH9 A;  1Q9C A;  2Y2P A;  2ZY2 A;  3W96 A;  4WJ3 C;  3REI D;  4UUZ A;  5AV8 B;  4J8V A;  3AV1 A;  2JE5 A;  4J8W D;  3AZH D;  1P3I A;  2NQB C;  3LZ1 B;  3O62 D;  5GXQ B;  2DF4 C;  5C3I C;  3X1V C;  3C1B C;  4WU9 A;  3B6F B;  2Y2H A;  2FFF B;  5B32 C;  5B0Y D;  4YS3 D;  3LZ1 D;  5AV5 D;  3MGP C;  3KUY D;  4KGC A;  3MGR C;  1TAF A;  5B0Z C;  3LZ0 D;  4LD9 D;  3LZ0 B;  5AVB B;  3LJA A;  2VQR A;  5AY8 D;  5BO0 B;  3V9R B;  5B0Z A;  3C1B D;  4JJN D;  3REL C;  3C1B B;  3UTB C;  1KX4 A;  4YM6 B;  5CHL B;  4CSR A;  1P3L D;  4KUD D;  1BH8 A;  3B0D B;  1F66 A;  1R4V A;  3MGR B;  5CPI A;  3LEL B;  5B24 C;  2FJ7 A;  3AZF B;  1F66 C;  4H9N A;  5GXQ D;  3V9R A;  1P3A B;  1P3K A;  2ARO D;  1P3A D;  1P3B A;  1HQ3 D;  2XD1 A;  2ZY3 A;  5CP6 C;  3WKJ B;  1KX5 A;  2NZD D;  4WU9 B;  1S32 A;  3F6T A;  5GT0 D;  2BYK B;  2JCH A;  3LZ0 C;  2LY8 A;  5CPK C;  4H9O A;  5DNM B;  3REJ D;  4WU8 D;  1P3M C;  1KX3 A;  3MGS C;  5AV8 A;  3X1S C;  4J8U B;  1P3L B;  3UT9 A;  2UWX A;  3TU4 B;  3W97 B;  3B6F D;  5B31 C;  3AZE B;  4Z66 A;  1P3A A;  3REJ A;  3MVD B;  2CV5 A;  3AZG D;  1M1A A;  1P3G D;  5C3I B;  5GXQ C;  4J8W B;  3AZH B;  3W96 B;  4UUZ B;  1KX4 B;  1M19 C;  4J8W C;  3AZH C;  1JFI B;  4LD9 B;  2NZD A;  5DNN D;  5B33 B;  3UT9 B;  4J8V C;  3AZI D;  1F66 B; 
#chains in the Genus database with same CATH homology
 2RVQ C;  5FUG B;  3MNN C;  3AV2 D;  1P3P D;  2HUE C;  5F99 D;  3TU4 C;  3W97 C;  1P3F C;  2HIO C;  5GSU D;  3REH A;  5AV6 A;  5GT3 D;  5DNM D;  4WU8 B;  1TZY A;  3B0C T;  5B2I C;  1M18 D;  3AZI B;  5B2I B;  5B2J A;  3UTB B;  1B67 A;  3A1I A;  5B31 D;  3MGP A;  1P3I C;  4Z5T C;  1JFI A;  4LD9 A;  2NZD B;  1PZR A;  3EPJ A;  4HGA C;  3LZ1 A;  3KUY C;  3C1B A;  3W98 D;  3X1U A;  3LJA D;  1ID3 A;  4KGC C;  3WA9 B;  5B1L C;  5AV5 A;  3B6F C;  4EO5 C;  3REL B;  3B0B A;  4DRB A;  3EPK A;  3AN2 D;  3B0C W;  1A7W A;  3W96 D;  5B1L A;  2RIQ A;  5AV5 C;  3MGP D;  1HQ3 B;  1M18 B;  4XUJ A;  4G92 C;  1P3F D;  1KX3 B;  2PYO A;  4R8P A;  3EG5 B;  2Y2L A;  3AZK A;  4NE5 A;  3A1K A;  1P3L C;  4WNN A;  5F99 A;  4QLC C;  3KXB B;  3WA9 A;  2PYO D;  4WZS B;  3AL0 C;  4X23 A;  3W97 D;  1T3U A;  3AN2 A;  3AFA A;  3REI C;  5B1L D;  1P3O D;  5AV9 C;  4LD9 C;  5GSU B;  4CAY B;  4JJN A;  4DQY B;  4M6B A;  3AZM A;  4J8U D;  5B33 D;  3AN2 C;  1EQZ A;  3LZ1 C;  1KX5 C;  4AWL C;  3AZE D;  1WWI A;  4J8U C;  4AWL B;  4Z66 D;  3UT9 D;  2L5A A;  3UTB D;  3WKJ D;  3W98 A;  5AVB A;  3LJA B;  3X1U D;  3AZM B;  1WWS A;  4WU8 A;  3LEL D;  3X1V A;  1EQZ B;  1KX3 D;  2NZD C;  3B0D C;  4DRA A;  5B32 A;  2F8N B;  1HQ3 C;  5CP6 D;  3MGP B;  4Z2M H;  1P3O A;  2CWE A;  3TU4 A;  1HQ3 A;  1P34 A;  4XUJ C;  1M1A C;  5GXQ A;  2HIO B;  3AV2 C;  1P3P C;  4KGC B;  3AZK B;  5B32 B;  4KUD B;  3W99 C;  4KUD C;  3X1V B;  3AV2 A;  1P3P A;  3WA9 C;  4E44 A;  3X1T A;  1P3B B;  1M19 B;  1BH9 B;  4QLC D;  3TU4 D;  1BFM A;  4KUD A;  4Z5T B;  2F8N H;  1HTA A;  1S32 C;  3KUY B;  2ZY4 A;  1ID3 B;  3AZE C;  3KXB D;  5AY8 A;  5B0Z D;  1H3O A;  4KHA A;  4WV4 B;  3AZN D;  3C1C A;  5GT0 C;  4J8X A;  5AY8 C;  5E5A A;  2Y2K A;  2YFV A;  1TAF B;  2ARO B;  2Y2M A;  3AZL A;  2FJ7 B;  3WKJ A;  4WU9 D;  4J8X B;  1ID3 C;  1H3O B;  1KX5 D;  5GSU C;  4KHA B;  3KXB A;  1F1E A;  5JA4 A;  2NQB B;  2ARO A;  4UPK A;  5AV9 D;  4YM6 A;  4Z5T D;  2YFW B;  3NQU A;  1P3A C;  3O62 C;  3MGQ D;  5DNN C;  3C1C B;  3WTP C;  3MVD A;  4G91 B;  3MGQ B;  2CV5 B;  4QLC B;  4J8V B;  2G5I C;  3WTP B;  4X23 D;  5CPI D;  2PYO C;  5DNM C;  1F66 D;  3WTP D;  5B32 G;  2Y2G A;  3X1T B;  1P3L A;  4JJN C;  5B2J C;  1M1A B;  2W8S A;  1KX4 D;  5AV9 B;  4Z5T A;  2YFW A;  3AYW B;  2CV5 D;  2HIO A;  3AZI C;  1ID3 D;  4WU8 C;  4XZQ D;  3MGR D;  2DQN C;  5G49 B;  4EO5 B;  4XZQ B;  1U35 B;  1KU5 A;  1TZY B;  5KDM B;  2F8N D;  2BYK A;  3VH6 W;  4YS3 A;  3X1V D;  5CPJ D;  4J8X D;  1M18 C;  3KWQ B;  5G49 A;  3UT9 C;  3VH6 A;  3UTB A;  3KSY A;  3MNN B;  2JSS A;  3MGR A;  2HIO D;  3UTA A;  5B40 C;  3AYW A;  5JRG A;  5CPI B;  1TZY D;  1BH8 B;  2BG1 A;  5BS7 A;  4E45 A;  3AZF A;  4J8V D;  4J8W A;  3AZH A;  1P3I D;  3AV1 D;  3B6G C;  2FJ7 C;  5BS7 C;  4H9Q B;  3X1T D;  1M19 D;  5BO0 A;  2ZM5 A;  4QLC A;  5B0Z B;  3MNN A;  2XD5 A;  4CSR B;  4X23 B;  4X23 C;  1AOI C;  2G5H C;  5B1M C;  3W99 A;  5B24 D;  3REH B;  1M1A D;  5JA4 B;  2NQB A;  3UTA B;  3WAA B;  5JRG B;  3O62 B;  2Y2I A;  5CP6 B;  3WAA D;  3NQJ B;  3AZI A;  5BT1 C;  3AYW D;  3AZN B;  3EPL A;  5CPK D;  5B40 D;  2J8P A;  5B1L B;  3REI B;  1P3G C;  1B6W A;  1P3B C;  3REL D;  3LEL C;  3KUY A;  2IO5 B;  2PYO B;  4KGC D;  3AZJ D;  4H9S A;  5E5A D;  5GT3 B;  1P3M B;  1KX5 B;  4ZUX B;  3AZN A;  3X1S D;  3MGS D;  5CPK A;  5BNX B;  4YM6 C;  3VH5 T;  3WAA A;  4XZQ C;  4J8U A;  4NE3 A;  3REK B;  3MVD C;  3REL A;  4H9O B;  3REK C;  5B0Y C;  3AZJ C;  3W97 A;  3AFA D;  2ARO C;  4H9Q A;  4ZBJ C;  4H9P B;  5GT3 C;  3A6N A;  5B2J B;  3NQU B;  1P3F B;  1P3O B;  3X1T C;  4ZUX C;  1U35 D;  2HUE B;  2Y2O A;  3VH5 A;  4G92 B;  3AZK D;  5F99 C;  4WNN B;  1P34 C;  4R8P D;  1P34 B;  1P3F A;  3W96 C;  4XUJ D;  2Y2J A;  3A6N B;  4YS3 C;  5B32 D;  3AZG C;  5AV6 B;  1P3G A;  4CAY A;  4NFT A;  4J8X C;  5JRG D;  4H9R B;  3B6F A;  1N1J B;  3AZE A;  3W98 C;  4Z66 B;  1P3M D;  1ZLA B;  4Z66 C;  3AV2 B;  1P3P B;  5CPJ A;  3X1U B;  3AZM D;  3P5J B;  1EQZ D;  4H9R A;  2CV5 C;  5B33 C;  5GT0 A;  3B6G B;  5B0Y A;  5B1M D;  2BYM A;  1ZLA A;  4R8P B;  1S32 B;  5AVC D;  5B2J D;  5B2I D;  1N1J A;  1P3B D;  3WTP A;  3KWQ C;  1P3K D;  5F99 B;  3H0R C;  5GT3 A;  3H0L C;  3WTP E;  3AZF C;  5DNM A;  1P3K B;  5B24 B;  3W99 D;  3REH D;  1P3K C;  3B6G D;  3AZL B;  5AV6 D;  3AFA C;  3REI A;  4G91 C;  2RVQ D;  5E5A B;  5CPJ B;  3A6N D;  1W2E A;  3AZK C;  1P34 D;  1TZY C;  5B2I A;  5AVC A;  4Z2M G;  5DNN A;  3REK D;  5B0Y B;  4ZBJ B;  5B1M A;  3MGQ A;  4WU9 C;  1ZLA D;  4H9N B;  4YM6 D;  5AV8 C;  3AZG A;  3AZL D;  3AZJ B;  5AVB C;  3W98 B;  3UTA D;  1ULY A;  5B1M B;  3X1S B;  3MGS B;  5AVB D;  3X1U C;  3AFA B;  5AVC B;  5DNN B;  3C1C C;  3AZM C;  1EQZ C;  3EPH A;  3LZ0 A;  3LJA C;  3AZJ A;  3AZG B;  2YFV B;  3C1C D;  3A6N C;  5B31 A;  1KX4 C;  5KDM A;  4XZQ A;  4ZUX A;  1M18 A;  4XUJ B;  3REH C;  3KWQ A;  5CPI C;  2NQB D;  3WA9 D;  5B31 B;  2ZY5 A;  5BT1 D;  5B24 A;  3AYW C;  1U35 A;  5BNV A;  3W99 B;  2FJ7 D;  4H9P A;  3VH6 T;  5AY8 B;  3NQJ A;  3KFU G;  4ZUX D;  3MVD D;  1U35 C;  2BYM B;  5AV6 C;  3FDD A;  1P3I B;  5AV9 A;  5AV5 B;  3AZF D;  3H0M C;  4JJN B;  2F2A C;  3KWQ D;  2F8N K;  1AOI A;  3LEL A;  5E5A C;  3IP4 C;  5CPJ C;  1P3M A;  5B40 B;  3X1S A;  3MGS A;  3VH5 W;  5AV8 D;  1Z2C B;  5BNV B;  3AZL C;  5CP6 A;  1P3G B;  2Y2Q A;  2F8N A;  3REJ C;  3R45 A;  4NE6 A;  4YS3 B;  2IO5 C;  1S32 D;  3AN2 B;  1P3O C;  4HGA B;  4R8P C;  4H9S C;  5B40 A;  5FUG A;  3O62 A;  5JRG C;  3UTA C;  2Y2N A;  1KX3 C;  1AOI D;  2F8N G;  3R45 B;  5B33 A;  1AOI B;  3AZN C;  3WKJ C;  1ZLA C;  3WAA C;  5GT0 B;  5GSU A;  3B6G A;  3KXB C;  5AVC C;  3AV1 B;  3REK A;  3AV1 C;  3REJ B;  3MGQ C;  5B31 G;  5CPK B;  5BNX A;  1M19 A;  3MNN D;  1BH9 A;  1Q9C A;  2Y2P A;  2ZY2 A;  3W96 A;  4WJ3 C;  3REI D;  4UUZ A;  5AV8 B;  4J8V A;  3AV1 A;  2JE5 A;  4J8W D;  3AZH D;  1P3I A;  2NQB C;  3LZ1 B;  3O62 D;  5GXQ B;  2DF4 C;  5C3I C;  3X1V C;  3C1B C;  4WU9 A;  3B6F B;  2Y2H A;  2FFF B;  5B32 C;  5B0Y D;  4YS3 D;  3LZ1 D;  5AV5 D;  3MGP C;  3KUY D;  4KGC A;  3MGR C;  1TAF A;  5B0Z C;  3LZ0 D;  4LD9 D;  3LZ0 B;  5AVB B;  3LJA A;  2VQR A;  5AY8 D;  5BO0 B;  3V9R B;  5B0Z A;  3C1B D;  4JJN D;  3REL C;  3C1B B;  3UTB C;  1KX4 A;  4YM6 B;  5CHL B;  4CSR A;  1P3L D;  4KUD D;  1BH8 A;  3B0D B;  1F66 A;  1R4V A;  3MGR B;  5CPI A;  3LEL B;  5B24 C;  2FJ7 A;  3AZF B;  1F66 C;  4H9N A;  5GXQ D;  3V9R A;  1P3A B;  1P3K A;  2ARO D;  1P3A D;  1P3B A;  1HQ3 D;  2XD1 A;  2ZY3 A;  5CP6 C;  3WKJ B;  1KX5 A;  2NZD D;  4WU9 B;  1S32 A;  3F6T A;  5GT0 D;  2BYK B;  2JCH A;  3LZ0 C;  2LY8 A;  5CPK C;  4H9O A;  5DNM B;  3REJ D;  4WU8 D;  1P3M C;  1KX3 A;  3MGS C;  5AV8 A;  3X1S C;  4J8U B;  1P3L B;  3UT9 A;  2UWX A;  3TU4 B;  3W97 B;  3B6F D;  5B31 C;  3AZE B;  4Z66 A;  1P3A A;  3REJ A;  3MVD B;  2CV5 A;  3AZG D;  1M1A A;  1P3G D;  5C3I B;  5GXQ C;  4J8W B;  3AZH B;  3W96 B;  4UUZ B;  1KX4 B;  1M19 C;  4J8W C;  3AZH C;  1JFI B;  4LD9 B;  2NZD A;  5DNN D;  5B33 B;  3UT9 B;  4J8V C;  3AZI D;  1F66 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...