5CPIC

Nucleosome containing unmethylated sat2r dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
molecule keywords Histone H3.1
molecule tags Structural protein/dna
source organism Homo sapiens
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpiC00
3VH5W 1P3MA 3TU4A 5CPKC 3X1TC 1M18C 3WKJB 4EO5B 3AYWD 1KX3B 3B6GD 3B6FD 3W97C 2YFVB 1KX5A 4WU8A 3KXBD 3LZ0C 3AZMB 3B6FC 3KUYC 3B6GC 5GT3D 3C1CD 5CPJB 5CP6B 3AZGA 5B31D 1AOIB 3AZND 1P3KA 3LELB 2AROD 3AV1C 3MGRC 4J8VD 1HQ3B 5B31C 5B40A 4R8PB 3AZNC 3W99D 3AV2A 4H9SA 1P3MD 3AZHA 5DNMC 2CV5A 5B0YC 1S32B 4WU9B 5CPKB 2HIOA 5BNVA 2IO5B 3AZJA 3W98D 3AZGD 3AYWB 1WWIA 3B6FB 3B6GB 5AV9A 4WZSB 3AZEA 1P3GD 3W98C 3KXBB 3AZKC 1WWSA 5B40D 5GT0A 5GT3B 5B24D 3C1CB 5E5AA 5GSUC 3AV1B 1P3GC 5B31B 1P3FA 3AV2D 3AZNB 4J8UC 2CV5D 5G49A 5KDMB 2YFWA 4J8VB 5AV8D 5B0YB 4XZQD 2HIOD 3W99B 3UT9C 3REJA 3AZJD 5AV8C 5B1MA 4YS3A 3VH5T 1P34C 1M19C 5AV9D 4Z2MH 3B0DC 3W98B 5GT0D 3AFAC 3VH5A 5E5AD 5AVBD 4UUZB 5BO0A 1P3OC 5GSUB 3MGSC 1P3GB 5AVCD 3LJAD 4J8UB 5B24B 3W96C 1P3PA 1P3AA 2LY8A 5AVCC 3LJAC 4G92B 3REJD 2CV5B 5B1MD 5B0ZC 5AV8B 4XZQB 2HIOB 5CHLB 1P3BD 3UTBD 4Z66C 1P34B 4LD9A 3AZJB 3B0DB 3X1SD 3KWQD 4AWLB 3UTBC 5B33A 4H9RA 2BYMB 4J8XC 3X1SC 3KWQC 1P3OB 5AV5A 4QLCA 2L5AA 1P3PD 5AVBB 1BFMA 4J8WC 4KUDA 5AVCB 3LJAB 1F1EA 1ULYA 1TZYD 3AZFA 3WKJA 1TZYC 3LZ1C 4YM6D 1KX3A 2F8NH 2YFVA 2JSSA 5B1MB 4Z66B 3RELC 5JRGC 5B33D 1P3BB 1EQZC 4YM6C 3NQUB 5DNND 3UTBB 5CP6A 5CPJA 1N1JB 1AOIA 3NQJB 5AV5D 4HGAC 3LELA 4QLCD 3X1SB 3KWQB 5DNNC 1M1AD 1HQ3A 4R8PA 3VH6W 4DRBA 3AZFD 1M1AC 1S32A 1P3PB 5CPKA 5AY8C 4E45A 1M18A 3O62D 1TZYB 3LZ1B 4ZUXC 5CPJD 3LZ0A 5JRGB 3MVDC 1ZLAD 3AYWA 3B6GA 3KUYA 4YM6B 1AOID 3B6FA 3REHD 3LELD 4G91C 4NFTA 1ZLAC 4HGAB 1HQ3D 1B67A 5GT3A 5DNNB 3REHC 3AV1A 4H9RB 5B31A 3AZNA 4QLCB 4J8VA 5B0YA 1M1AB 3X1TD 3AZLD 1M18D 3W99A 4Z5TD 3W97D 2BYKB 3AZFB 5FUGA 4KGCC 3AZLC 3LZ0D 4Z5TC 3KUYD 2NQBC 5F99C 3O62B 1BH8A 3W98A 3AZKA 4X23C 3AV1D 3MGRD 3X1VC 1ZLAB 5B1LD 4UUZA 3REHB 5GSUA 1P3GA 2PYOD 3R45B 4J8UA 5DNMD 5B1LC 5B0YD 3MGQC 5B24A 2PYOC 4ZBJC 3VH6T 5JA4B 5AV8A 4XZQA 3AZLB 3X1TB 1M18B 4Z5TB 1P34A 1M19A 3W97B 2FJ7C 5F99B 3VH6A 1R4VA 5B2ID 3AZKD 3LZ0B 4XUJC 3KUYB 3AFAA 5AV6C 3X1VB 5GSUD 5B2IC 2BYMA 4J8UD 5B2JD 3MGSA 1P3OA 3MGRB 3A6NC 5B1LB 5AVBA 5B2JC 2PYOB 5AVCA 3LJAA 3UT9D 5DNMB 4ZBJB 1P34D 1M19D 5BS7C 3MGPC 5FUGB 4Z66A 1ID3D 1Q9CA 1P3BA 5B32D 3AFAD 3NQUA 3REKC 3UTBA 1BH8B 3AZID 1KX5C 4WU8C 1N1JA 3WTPD 1ID3C 1P3OD 3NQJA 3MGSD 5B2IB 3AZKB 5B32C 3X1SA 3KWQA 3AZIC 3REIC 3WTPC 3W96D 3A6NB 4H9NB 5B2JB 5B0ZD 2F8NG 5C3IC 3AZHC 4Z66D 3UT9B 1B6WA 1TZYA 2HUEC 3LZ1A 3RELA 1P3ID 5JRGA 1M19B 1EQZA 3WTPE 1KU5A 4YM6A 2NZDD 1P3IC 4J8XD 1ID3B 5B32B 3AFAB 3AZIB 4H9QB 5DNNA 3REIB 2F8NK 2NZDC 3WTPB 1JFIA 1TAFB 3MGSB 4J8WD 1P3LD 1M1AA 2F8ND 3W96B 1P3LC 5AY8A 5C3IB 3LZ1D 1HTAA 2BYKA 3RELD 5B0ZB 2HUEB 3V9RB 5JRGD 1EQZD 5BNXB 3O62A 3MVDA 3B0CW 4CAYA 5BT1D 4YS3C 1P3IB 1H3OB 1ZLAA 5BT1C 2NZDB 3REHA 4J8XB 3R45A 1U35D 3C1BC 1KX4C 5AY8D 1U35C 4J8WB 3UTAD 1P3LB 5JA4A 2F8NB 4ZUXD 3UTAC 3AZLA 3X1TA 3MVDD 4Z5TA 3WA9C 3W97A 5F99A 4CSRB 3RELB 4KHAB 1EQZB 4X23A 3X1VA 3MGRA 3X1UD 4JJNC 3WAAC 5B1LA 3C1BB 3AN2D 1JFIB 2PYOA 5CPIC 1U35B 5DNMA 3X1UC 3AN2C 4KGCD 2RVQC 5AY8B 3UTAB 2NQBD 5F99D 1BH9B 5GXQD 3WKJC 4EO5C 4ZUXB 4X23D 3X1VD 3MVDB 4CAYB 5AV6A 5GXQC 4WNNB 5B2IA 1F66C 3AZMC 4G91B 4H9PB 5CP6C 3B0CT 3MGQD 4JJNB 3A6NA 4H9NA 3MNND 5B2JA 4E44A 2CWEA 3X1UB 3MNNC 3AN2B 4H9OB 4NE3A 3UT9A 1S32C 2FJ7D 4WU9C 5BS7A 4WV4B 3MGPA 4KGCB 4XUJD 4Z2MG 2NQBB 2IO5C 5AV6D 3REKA 1ID3A 5GXQB 1F66B 5B32G 4X23B 3AYWC 5B32A 3AZIA 4H9QA 3A6ND 3REIA 3WTPA 3KXBC 1TAFA 5GT3C 3C1CC 3MGQB 3W96A 4NE6A 3MNNB 2AROC 3TU4D 3MGPD 4J8VC 5B0ZA 3W99C 3V9RA 1P3MC 3TU4C 5BNXA 3REKD 1KX5D 4WU8D 2FJ7B 1P3IA 4XUJB 1H3OA 3REID 5AV6B 2NZDA 1P3KD 4J8XA 3AZGC 1P3KC 4J8WA 3AZHD 1P3LA 5B40C 2AROB 5B24C 4G92C 3AV2C 4H9SC 2F8NA 2CV5C 1P3MB 3TU4B 4M6BA 3MGPB 4CSRA 1A7WA 4XZQC 2HIOC 4KHAA 3REKB 3AZJC 3AZED 1KX5B 4WU8B 4AWLC 5AV9C 3AZEC 3AZGB 1P3FD 3C1BA 1KX4A 1P3KB 1U35A 5GT0C 3B0BA 5E5AC 1P3FC 5AVBC 5B40B 3KSYA 3AV2B 3UTAA 3AZHB 1BH9A 3WA9A 4YS3D 4ZUXA 5BNVB 3REJC 5B1MC 4WNNA 1P3BC 4H9PA 3C1BD 5AV9B 1KX4D 4JJNA 3AZEB 3WAAA 5CPIA 5GT0B 5E5AB 1P3AD 3X1UA 1P3FB 3AN2A 5G49B 4H9OA 4NE5A 2YFWB 3WA9D 1P3PC 1P3AC 4KGCA 3REJB 2NQBA 4LD9D 4YS3B 5GXQA 1F66A 3AZMA 4LD9C 4JJND 3WAAD 5CPID 5B33C 5BO0B 3MGQA 1KX4B 2RVQD 5AV5C 4KUDD 3MNNA 4QLCC 4WU9A 1P3AB 4KUDC 3WKJD 1KX3D 3AZFC 3WA9B 2FJ7A 1F66D 3AZMD 1KX3C 4XUJA 3O62C 5CP6D 4LD9B 3KXBA 5CPJC 5B33B 4R8PD 1AOIC 3C1CA 5B31G 3WAAB 3LELC 5AV5B 5CPIB 5KDMA 1HQ3C 4R8PC 2AROA 1S32D 4WU9D 5CPKD 4DRAA 4KUDB
chains in the Genus database with same CATH superfamily
3VH5W 1P3MA 3TU4A 5CPKC 3X1TC 1M18C 3WKJB 4EO5B 3AYWD 1KX3B 3B6GD 3B6FD 3W97C 2YFVB 1KX5A 4WU8A 3KXBD 2W8SA 3LZ0C 3AZMB 3B6FC 3KUYC 3B6GC 5GT3D 3C1CD 5CPJB 5CP6B 3AZGA 5B31D 1AOIB 3AZND 1P3KA 3LELB 2AROD 3AV1C 3MGRC 2Y2PA 4J8VD 1HQ3B 5B31C 5B40A 4R8PB 3AZNC 3W99D 3AV2A 4H9SA 1P3MD 3AZHA 5DNMC 2CV5A 5B0YC 1S32B 4WU9B 5CPKB 2HIOA 5BNVA 2JCHA 2IO5B 3AZJA 3W98D 2XD1A 3AZGD 3AYWB 1WWIA 3B6FB 3B6GB 5AV9A 4WZSB 3AZEA 1P3GD 2Y2IA 3KXBB 3AZKC 3W98C 1WWSA 5B40D 5GT0A 5GT3B 5B24D 3C1CB 5E5AA 5GSUC 3AV1B 1P3GC 5B31B 1P3FA 3AV2D 3AZNB 4J8UC 2CV5D 5G49A 5KDMB 2YFWA 4J8VB 5AV8D 5B0YB 4XZQD 2HIOD 3W99B 3UT9C 3REJA 3AZJD 5AV8C 5B1MA 4YS3A 3VH5T 1P34C 4DQYB 1M19C 5AV9D 2DF4C 3B0DC 4Z2MH 3W98B 5GT0D 3AFAC 3VH5A 5E5AD 5AVBD 4UUZB 5BO0A 1P3OC 5GSUB 3MGSC 1P3GB 5AVCD 3LJAD 4J8UB 5B24B 3W96C 1P3PA 1P3AA 2LY8A 2FFFB 5AVCC 3LJAC 4G92B 3REJD 2CV5B 5B1MD 5B0ZC 5AV8B 4XZQB 2HIOB 5CHLB 1P3BD 3UTBD 4Z66C 1P34B 4LD9A 3AZJB 3B0DB 3X1SD 3KWQD 4AWLB 3UTBC 5B33A 4H9RA 2BYMB 4J8XC 3X1SC 3KWQC 3EPKA 5AV5A 1P3OB 4QLCA 2L5AA 1P3PD 5AVBB 1BFMA 4J8WC 4KUDA 5AVCB 3LJAB 1F1EA 1ULYA 1TZYD 3AZFA 3H0MC 3WKJA 1TZYC 3LZ1C 4YM6D 1KX3A 2F8NH 2YFVA 2JSSA 5B1MB 4Z66B 3RELC 5JRGC 5B33D 1P3BB 1EQZC 4YM6C 3NQUB 5DNND 3UTBB 5CP6A 5CPJA 1N1JB 1AOIA 3NQJB 5AV5D 3EPHA 4HGAC 3LELA 4QLCD 3X1SB 3KWQB 5DNNC 1M1AD 1HQ3A 4R8PA 3VH6W 2UWXA 4DRBA 3AZFD 1M1AC 1S32A 1P3PB 5CPKA 5AY8C 4E45A 1M18A 3O62D 4WJ3C 2VQRA 1TZYB 3LZ1B 2ZY3A 4ZUXC 5CPJD 3LZ0A 5JRGB 3MVDC 1ZLAD 3AYWA 3B6GA 3KUYA 4YM6B 1AOID 3B6FA 3REHD 3LELD 4G91C 4NFTA 1ZLAC 4HGAB 1HQ3D 1B67A 2Y2OA 3IP4C 5GT3A 5DNNB 3REHC 4H9RB 3AV1A 5B31A 3AZNA 4QLCB 4J8VA 5B0YA 1M1AB 3X1TD 3AZLD 1M18D 3W99A 4Z5TD 3W97D 2BYKB 3AZFB 5FUGA 4KGCC 3AZLC 3LZ0D 4Z5TC 3KUYD 2NQBC 5F99C 3O62B 1BH8A 3W98A 3AZKA 4X23C 3AV1D 3MGRD 3X1VC 1ZLAB 5B1LD 4UUZA 2ZY2A 3REHB 3H0LC 5GSUA 1P3GA 3R45B 2PYOD 4J8UA 5DNMD 5B1LC 5B0YD 3MGQC 5B24A 2PYOC 4ZBJC 3VH6T 5JA4B 5AV8A 4XZQA 3AZLB 3X1TB 1M18B 4Z5TB 1P34A 2Y2MA 1M19A 3W97B 2FJ7C 5F99B 3VH6A 1R4VA 5B2ID 3AZKD 3LZ0B 4XUJC 3KUYB 3AFAA 5AV6C 3X1VB 5GSUD 5B2IC 2BYMA 4J8UD 5B2JD 3MGSA 1P3OA 3MGRB 3A6NC 5B1LB 5AVBA 5B2JC 2PYOB 5AVCA 3LJAA 3UT9D 3EPLA 5DNMB 4ZBJB 3FDDA 1P34D 1M19D 5BS7C 3MGPC 5FUGB 4Z66A 1ID3D 1Q9CA 1P3BA 5B32D 3AFAD 3NQUA 3REKC 3UTBA 1BH8B 3AZID 1KX5C 4WU8C 1N1JA 3WTPD 1ID3C 1P3OD 3NQJA 3MGSD 5B2IB 3AZKB 5B32C 3X1SA 3KWQA 3AZIC 3REIC 3WTPC 3W96D 3A6NB 4H9NB 3AL0C 5B2JB 2Y2QA 5B0ZD 2F8NG 5C3IC 3AZHC 4Z66D 3UT9B 1B6WA 1TZYA 2HUEC 3LZ1A 3RELA 1P3ID 5JRGA 1M19B 1EQZA 4YM6A 1KU5A 3WTPE 2NZDD 1P3IC 4J8XD 1ID3B 1W2EA 1T3UA 5B32B 3AFAB 3AZIB 4H9QB 5DNNA 3REIB 2F8NK 2NZDC 3WTPB 1JFIA 1TAFB 3MGSB 4J8WD 1P3LD 1M1AA 2F8ND 3W96B 1P3LC 2ZM5A 5AY8A 5C3IB 3LZ1D 2BG1A 1HTAA 2BYKA 3RELD 5B0ZB 2HUEB 3V9RB 5JRGD 1EQZD 5BNXB 3O62A 3MVDA 3B0CW 4CAYA 5BT1D 4YS3C 1P3IB 1H3OB 1ZLAA 5BT1C 2NZDB 3REHA 4J8XB 3R45A 1U35D 3C1BC 1KX4C 5AY8D 1U35C 4J8WB 3UTAD 1P3LB 2G5HC 2Y2LA 5JA4A 2F8NB 4ZUXD 3UTAC 3AZLA 3X1TA 3MVDD 4Z5TA 3WA9C 3W97A 5F99A 4CSRB 3RELB 4KHAB 1EQZB 4X23A 2ZY4A 3X1VA 3A1IA 3MGRA 3X1UD 4JJNC 3WAAC 5B1LA 3C1BB 3AN2D 1JFIB 2PYOA 5CPIC 1U35B 5DNMA 3X1UC 1Z2CB 3AN2C 4KGCD 2RVQC 2Y2NA 5AY8B 3UTAB 2NQBD 5F99D 1BH9B 5GXQD 3WKJC 4EO5C 4ZUXB 4X23D 3X1VD 3MVDB 4CAYB 5AV6A 5GXQC 4WNNB 5B2IA 1F66C 3AZMC 4G91B 3P5JB 4H9PB 2ZY5A 5CP6C 3B0CT 3MGQD 4JJNB 3A6NA 4H9NA 3MNND 5B2JA 4E44A 2CWEA 3X1UB 3MNNC 3AN2B 4H9OB 4NE3A 3UT9A 1S32C 2FJ7D 4WU9C 5BS7A 4WV4B 3MGPA 4KGCB 4XUJD 4Z2MG 4UPKA 2NQBB 2IO5C 5AV6D 3REKA 1ID3A 5GXQB 1F66B 5B32G 4X23B 3AYWC 5B32A 3AZIA 4H9QA 3A6ND 3REIA 3WTPA 3KXBC 1TAFA 5GT3C 3C1CC 3MGQB 3W96A 4NE6A 3EPJA 3MNNB 2AROC 3TU4D 3MGPD 4J8VC 5B0ZA 3W99C 3V9RA 1P3MC 3TU4C 3EG5B 5BNXA 3REKD 1KX5D 4WU8D 2FJ7B 1P3IA 4XUJB 1H3OA 3REID 5AV6B 2NZDA 1P3KD 4J8XA 3F6TA 3AZGC 1P3KC 2F2AC 4J8WA 3AZHD 1P3LA 5B40C 2AROB 5B24C 4G92C 3AV2C 4H9SC 2F8NA 2CV5C 1P3MB 3TU4B 4M6BA 3MGPB 4CSRA 1A7WA 4XZQC 2HIOC 4KHAA 3H0RC 3REKB 3AZJC 3AZED 1KX5B 4WU8B 4AWLC 5AV9C 3AZEC 3AZGB 1P3FD 3C1BA 1KX4A 1P3KB 2RIQA 1U35A 5GT0C 2DQNC 3B0BA 5E5AC 2Y2JA 5AVBC 1P3FC 5B40B 2Y2GA 3KSYA 2G5IC 3AV2B 3UTAA 3AZHB 1BH9A 3WA9A 4YS3D 2Y2KA 4ZUXA 5BNVB 3REJC 5B1MC 4WNNA 1P3BC 4H9PA 3C1BD 5AV9B 1KX4D 4JJNA 3AZEB 3WAAA 5CPIA 5GT0B 5E5AB 1P3AD 3X1UA 1P3FB 3AN2A 5G49B 4H9OA 4NE5A 2YFWB 3WA9D 1P3PC 1P3AC 3A1KA 4KGCA 1PZRA 3REJB 2NQBA 4LD9D 4YS3B 5GXQA 1F66A 3AZMA 4LD9C 4JJND 2XD5A 3WAAD 2JE5A 3KFUG 5CPID 5B33C 5BO0B 3MGQA 1KX4B 2RVQD 5AV5C 4KUDD 3MNNA 4QLCC 4WU9A 1P3AB 4KUDC 3WKJD 1KX3D 2J8PA 3AZFC 3WA9B 2FJ7A 1F66D 3AZMD 1KX3C 4XUJA 3O62C 5CP6D 4LD9B 3KXBA 5CPJC 5B33B 4R8PD 1AOIC 3C1CA 5B31G 3WAAB 3LELC 5AV5B 2Y2HA 5CPIB 5KDMA 1HQ3C 4R8PC 2AROA 1S32D 4WU9D 5CPKD 4DRAA 4KUDB
chains in the Genus database with same CATH topology
3VH5W 1P3MA 3TU4A 5CPKC 3X1TC 1M18C 3WKJB 4EO5B 3AYWD 1KX3B 3B6GD 3B6FD 3W97C 2YFVB 1KX5A 4WU8A 3KXBD 2W8SA 3LZ0C 3AZMB 3B6FC 3KUYC 3B6GC 5GT3D 3C1CD 5CPJB 5CP6B 3AZGA 5B31D 1AOIB 3AZND 1P3KA 3LELB 2AROD 3AV1C 3MGRC 2Y2PA 4J8VD 1HQ3B 5B31C 5B40A 4R8PB 3AZNC 3W99D 3AV2A 4H9SA 1P3MD 3AZHA 5DNMC 2CV5A 5B0YC 1S32B 4WU9B 5CPKB 2HIOA 5BNVA 2JCHA 2IO5B 3AZJA 3W98D 2XD1A 3AZGD 3AYWB 1WWIA 3B6FB 3B6GB 5AV9A 4WZSB 3AZEA 1P3GD 2Y2IA 3KXBB 3AZKC 3W98C 1WWSA 5B40D 5GT0A 5GT3B 5B24D 3C1CB 5E5AA 5GSUC 3AV1B 1P3GC 5B31B 1P3FA 3AV2D 3AZNB 4J8UC 2CV5D 5G49A 5KDMB 2YFWA 4J8VB 5AV8D 5B0YB 4XZQD 2HIOD 3W99B 3UT9C 3REJA 3AZJD 5AV8C 5B1MA 4YS3A 3VH5T 1P34C 4DQYB 1M19C 5AV9D 2DF4C 3B0DC 4Z2MH 3W98B 5GT0D 3AFAC 3VH5A 5E5AD 5AVBD 4UUZB 5BO0A 1P3OC 5GSUB 3MGSC 1P3GB 5AVCD 3LJAD 4J8UB 5B24B 3W96C 1P3PA 1P3AA 2LY8A 2FFFB 5AVCC 3LJAC 4G92B 3REJD 2CV5B 5B1MD 5B0ZC 5AV8B 4XZQB 2HIOB 5CHLB 1P3BD 3UTBD 4Z66C 1P34B 4LD9A 3AZJB 3B0DB 3X1SD 3KWQD 4AWLB 3UTBC 5B33A 4H9RA 2BYMB 4J8XC 3X1SC 3KWQC 3EPKA 5AV5A 1P3OB 4QLCA 2L5AA 1P3PD 5AVBB 1BFMA 4J8WC 4KUDA 5AVCB 3LJAB 1F1EA 1ULYA 1TZYD 3AZFA 3H0MC 3WKJA 1TZYC 3LZ1C 4YM6D 1KX3A 2F8NH 2YFVA 2JSSA 5B1MB 4Z66B 3RELC 5JRGC 5B33D 1P3BB 1EQZC 4YM6C 3NQUB 5DNND 3UTBB 5CP6A 5CPJA 1N1JB 1AOIA 3NQJB 5AV5D 3EPHA 4HGAC 3LELA 4QLCD 3X1SB 3KWQB 5DNNC 1M1AD 1HQ3A 4R8PA 3VH6W 2UWXA 4DRBA 3AZFD 1M1AC 1S32A 1P3PB 5CPKA 5AY8C 4E45A 1M18A 3O62D 4WJ3C 2VQRA 1TZYB 3LZ1B 2ZY3A 4ZUXC 5CPJD 3LZ0A 5JRGB 3MVDC 1ZLAD 3AYWA 3B6GA 3KUYA 4YM6B 1AOID 3B6FA 3REHD 3LELD 4G91C 4NFTA 1ZLAC 4HGAB 1HQ3D 1B67A 2Y2OA 3IP4C 5GT3A 5DNNB 3REHC 4H9RB 3AV1A 5B31A 3AZNA 4QLCB 4J8VA 5B0YA 1M1AB 3X1TD 3AZLD 1M18D 3W99A 4Z5TD 3W97D 2BYKB 3AZFB 5FUGA 4KGCC 3AZLC 3LZ0D 4Z5TC 3KUYD 2NQBC 5F99C 3O62B 1BH8A 3W98A 3AZKA 4X23C 3AV1D 3MGRD 3X1VC 1ZLAB 5B1LD 4UUZA 2ZY2A 3REHB 3H0LC 5GSUA 1P3GA 3R45B 2PYOD 4J8UA 5DNMD 5B1LC 5B0YD 3MGQC 5B24A 2PYOC 4ZBJC 3VH6T 5JA4B 5AV8A 4XZQA 3AZLB 3X1TB 1M18B 4Z5TB 1P34A 2Y2MA 1M19A 3W97B 2FJ7C 5F99B 3VH6A 1R4VA 5B2ID 3AZKD 3LZ0B 4XUJC 3KUYB 3AFAA 5AV6C 3X1VB 5GSUD 5B2IC 2BYMA 4J8UD 5B2JD 3MGSA 1P3OA 3MGRB 3A6NC 5B1LB 5AVBA 5B2JC 2PYOB 5AVCA 3LJAA 3UT9D 3EPLA 5DNMB 4ZBJB 3FDDA 1P34D 1M19D 5BS7C 3MGPC 5FUGB 4Z66A 1ID3D 1Q9CA 1P3BA 5B32D 3AFAD 3NQUA 3REKC 3UTBA 1BH8B 3AZID 1KX5C 4WU8C 1N1JA 3WTPD 1ID3C 1P3OD 3NQJA 3MGSD 5B2IB 3AZKB 5B32C 3X1SA 3KWQA 3AZIC 3REIC 3WTPC 3W96D 3A6NB 4H9NB 3AL0C 5B2JB 2Y2QA 5B0ZD 2F8NG 5C3IC 3AZHC 4Z66D 3UT9B 1B6WA 1TZYA 2HUEC 3LZ1A 3RELA 1P3ID 5JRGA 1M19B 1EQZA 4YM6A 1KU5A 3WTPE 2NZDD 1P3IC 4J8XD 1ID3B 1W2EA 1T3UA 5B32B 3AFAB 3AZIB 4H9QB 5DNNA 3REIB 2F8NK 2NZDC 3WTPB 1JFIA 1TAFB 3MGSB 4J8WD 1P3LD 1M1AA 2F8ND 3W96B 1P3LC 2ZM5A 5AY8A 5C3IB 3LZ1D 2BG1A 1HTAA 2BYKA 3RELD 5B0ZB 2HUEB 3V9RB 5JRGD 1EQZD 5BNXB 3O62A 3MVDA 3B0CW 4CAYA 5BT1D 4YS3C 1P3IB 1H3OB 1ZLAA 5BT1C 2NZDB 3REHA 4J8XB 3R45A 1U35D 3C1BC 1KX4C 5AY8D 1U35C 4J8WB 3UTAD 1P3LB 2G5HC 2Y2LA 5JA4A 2F8NB 4ZUXD 3UTAC 3AZLA 3X1TA 3MVDD 4Z5TA 3WA9C 3W97A 5F99A 4CSRB 3RELB 4KHAB 1EQZB 4X23A 2ZY4A 3X1VA 3A1IA 3MGRA 3X1UD 4JJNC 3WAAC 5B1LA 3C1BB 3AN2D 1JFIB 2PYOA 5CPIC 1U35B 5DNMA 3X1UC 1Z2CB 3AN2C 4KGCD 2RVQC 2Y2NA 5AY8B 3UTAB 2NQBD 5F99D 1BH9B 5GXQD 3WKJC 4EO5C 4ZUXB 4X23D 3X1VD 3MVDB 4CAYB 5AV6A 5GXQC 4WNNB 5B2IA 1F66C 3AZMC 4G91B 3P5JB 4H9PB 2ZY5A 5CP6C 3B0CT 3MGQD 4JJNB 3A6NA 4H9NA 3MNND 5B2JA 4E44A 2CWEA 3X1UB 3MNNC 3AN2B 4H9OB 4NE3A 3UT9A 1S32C 2FJ7D 4WU9C 5BS7A 4WV4B 3MGPA 4KGCB 4XUJD 4Z2MG 4UPKA 2NQBB 2IO5C 5AV6D 3REKA 1ID3A 5GXQB 1F66B 5B32G 4X23B 3AYWC 5B32A 3AZIA 4H9QA 3A6ND 3REIA 3WTPA 3KXBC 1TAFA 5GT3C 3C1CC 3MGQB 3W96A 4NE6A 3EPJA 3MNNB 2AROC 3TU4D 3MGPD 4J8VC 5B0ZA 3W99C 3V9RA 1P3MC 3TU4C 3EG5B 5BNXA 3REKD 1KX5D 4WU8D 2FJ7B 1P3IA 4XUJB 1H3OA 3REID 5AV6B 2NZDA 1P3KD 4J8XA 3F6TA 3AZGC 1P3KC 2F2AC 4J8WA 3AZHD 1P3LA 5B40C 2AROB 5B24C 4G92C 3AV2C 4H9SC 2F8NA 2CV5C 1P3MB 3TU4B 4M6BA 3MGPB 4CSRA 1A7WA 4XZQC 2HIOC 4KHAA 3H0RC 3REKB 3AZJC 3AZED 1KX5B 4WU8B 4AWLC 5AV9C 3AZEC 3AZGB 1P3FD 3C1BA 1KX4A 1P3KB 2RIQA 1U35A 5GT0C 2DQNC 3B0BA 5E5AC 2Y2JA 5AVBC 1P3FC 5B40B 2Y2GA 3KSYA 2G5IC 3AV2B 3UTAA 3AZHB 1BH9A 3WA9A 4YS3D 2Y2KA 4ZUXA 5BNVB 3REJC 5B1MC 4WNNA 1P3BC 4H9PA 3C1BD 5AV9B 1KX4D 4JJNA 3AZEB 3WAAA 5CPIA 5GT0B 5E5AB 1P3AD 3X1UA 1P3FB 3AN2A 5G49B 4H9OA 4NE5A 2YFWB 3WA9D 1P3PC 1P3AC 3A1KA 4KGCA 1PZRA 3REJB 2NQBA 4LD9D 4YS3B 5GXQA 1F66A 3AZMA 4LD9C 4JJND 2XD5A 3WAAD 2JE5A 3KFUG 5CPID 5B33C 5BO0B 3MGQA 1KX4B 2RVQD 5AV5C 4KUDD 3MNNA 4QLCC 4WU9A 1P3AB 4KUDC 3WKJD 1KX3D 2J8PA 3AZFC 3WA9B 2FJ7A 1F66D 3AZMD 1KX3C 4XUJA 3O62C 5CP6D 4LD9B 3KXBA 5CPJC 5B33B 4R8PD 1AOIC 3C1CA 5B31G 3WAAB 3LELC 5AV5B 2Y2HA 5CPIB 5KDMA 1HQ3C 4R8PC 2AROA 1S32D 4WU9D 5CPKD 4DRAA 4KUDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VH5 W;  1P3M A;  3TU4 A;  5CPK C;  3X1T C;  1M18 C;  3WKJ B;  4EO5 B;  3AYW D;  1KX3 B;  3B6G D;  3B6F D;  3W97 C;  2YFV B;  1KX5 A;  4WU8 A;  3KXB D;  3LZ0 C;  3AZM B;  3B6F C;  3KUY C;  3B6G C;  5GT3 D;  3C1C D;  5CPJ B;  5CP6 B;  3AZG A;  5B31 D;  1AOI B;  3AZN D;  1P3K A;  3LEL B;  2ARO D;  3AV1 C;  3MGR C;  4J8V D;  1HQ3 B;  5B31 C;  5B40 A;  4R8P B;  3AZN C;  3W99 D;  3AV2 A;  4H9S A;  1P3M D;  3AZH A;  5DNM C;  2CV5 A;  5B0Y C;  1S32 B;  4WU9 B;  5CPK B;  2HIO A;  5BNV A;  2IO5 B;  3AZJ A;  3W98 D;  3AZG D;  3AYW B;  1WWI A;  3B6F B;  3B6G B;  5AV9 A;  4WZS B;  3AZE A;  1P3G D;  3W98 C;  3KXB B;  3AZK C;  1WWS A;  5B40 D;  5GT0 A;  5GT3 B;  5B24 D;  3C1C B;  5E5A A;  5GSU C;  3AV1 B;  1P3G C;  5B31 B;  1P3F A;  3AV2 D;  3AZN B;  4J8U C;  2CV5 D;  5G49 A;  5KDM B;  2YFW A;  4J8V B;  5AV8 D;  5B0Y B;  4XZQ D;  2HIO D;  3W99 B;  3UT9 C;  3REJ A;  3AZJ D;  5AV8 C;  5B1M A;  4YS3 A;  3VH5 T;  1P34 C;  1M19 C;  5AV9 D;  4Z2M H;  3B0D C;  3W98 B;  5GT0 D;  3AFA C;  3VH5 A;  5E5A D;  5AVB D;  4UUZ B;  5BO0 A;  1P3O C;  5GSU B;  3MGS C;  1P3G B;  5AVC D;  3LJA D;  4J8U B;  5B24 B;  3W96 C;  1P3P A;  1P3A A;  2LY8 A;  5AVC C;  3LJA C;  4G92 B;  3REJ D;  2CV5 B;  5B1M D;  5B0Z C;  5AV8 B;  4XZQ B;  2HIO B;  5CHL B;  1P3B D;  3UTB D;  4Z66 C;  1P34 B;  4LD9 A;  3AZJ B;  3B0D B;  3X1S D;  3KWQ D;  4AWL B;  3UTB C;  5B33 A;  4H9R A;  2BYM B;  4J8X C;  3X1S C;  3KWQ C;  1P3O B;  5AV5 A;  4QLC A;  2L5A A;  1P3P D;  5AVB B;  1BFM A;  4J8W C;  4KUD A;  5AVC B;  3LJA B;  1F1E A;  1ULY A;  1TZY D;  3AZF A;  3WKJ A;  1TZY C;  3LZ1 C;  4YM6 D;  1KX3 A;  2F8N H;  2YFV A;  2JSS A;  5B1M B;  4Z66 B;  3REL C;  5JRG C;  5B33 D;  1P3B B;  1EQZ C;  4YM6 C;  3NQU B;  5DNN D;  3UTB B;  5CP6 A;  5CPJ A;  1N1J B;  1AOI A;  3NQJ B;  5AV5 D;  4HGA C;  3LEL A;  4QLC D;  3X1S B;  3KWQ B;  5DNN C;  1M1A D;  1HQ3 A;  4R8P A;  3VH6 W;  4DRB A;  3AZF D;  1M1A C;  1S32 A;  1P3P B;  5CPK A;  5AY8 C;  4E45 A;  1M18 A;  3O62 D;  1TZY B;  3LZ1 B;  4ZUX C;  5CPJ D;  3LZ0 A;  5JRG B;  3MVD C;  1ZLA D;  3AYW A;  3B6G A;  3KUY A;  4YM6 B;  1AOI D;  3B6F A;  3REH D;  3LEL D;  4G91 C;  4NFT A;  1ZLA C;  4HGA B;  1HQ3 D;  1B67 A;  5GT3 A;  5DNN B;  3REH C;  3AV1 A;  4H9R B;  5B31 A;  3AZN A;  4QLC B;  4J8V A;  5B0Y A;  1M1A B;  3X1T D;  3AZL D;  1M18 D;  3W99 A;  4Z5T D;  3W97 D;  2BYK B;  3AZF B;  5FUG A;  4KGC C;  3AZL C;  3LZ0 D;  4Z5T C;  3KUY D;  2NQB C;  5F99 C;  3O62 B;  1BH8 A;  3W98 A;  3AZK A;  4X23 C;  3AV1 D;  3MGR D;  3X1V C;  1ZLA B;  5B1L D;  4UUZ A;  3REH B;  5GSU A;  1P3G A;  2PYO D;  3R45 B;  4J8U A;  5DNM D;  5B1L C;  5B0Y D;  3MGQ C;  5B24 A;  2PYO C;  4ZBJ C;  3VH6 T;  5JA4 B;  5AV8 A;  4XZQ A;  3AZL B;  3X1T B;  1M18 B;  4Z5T B;  1P34 A;  1M19 A;  3W97 B;  2FJ7 C;  5F99 B;  3VH6 A;  1R4V A;  5B2I D;  3AZK D;  3LZ0 B;  4XUJ C;  3KUY B;  3AFA A;  5AV6 C;  3X1V B;  5GSU D;  5B2I C;  2BYM A;  4J8U D;  5B2J D;  3MGS A;  1P3O A;  3MGR B;  3A6N C;  5B1L B;  5AVB A;  5B2J C;  2PYO B;  5AVC A;  3LJA A;  3UT9 D;  5DNM B;  4ZBJ B;  1P34 D;  1M19 D;  5BS7 C;  3MGP C;  5FUG B;  4Z66 A;  1ID3 D;  1Q9C A;  1P3B A;  5B32 D;  3AFA D;  3NQU A;  3REK C;  3UTB A;  1BH8 B;  3AZI D;  1KX5 C;  4WU8 C;  1N1J A;  3WTP D;  1ID3 C;  1P3O D;  3NQJ A;  3MGS D;  5B2I B;  3AZK B;  5B32 C;  3X1S A;  3KWQ A;  3AZI C;  3REI C;  3WTP C;  3W96 D;  3A6N B;  4H9N B;  5B2J B;  5B0Z D;  2F8N G;  5C3I C;  3AZH C;  4Z66 D;  3UT9 B;  1B6W A;  1TZY A;  2HUE C;  3LZ1 A;  3REL A;  1P3I D;  5JRG A;  1M19 B;  1EQZ A;  3WTP E;  1KU5 A;  4YM6 A;  2NZD D;  1P3I C;  4J8X D;  1ID3 B;  5B32 B;  3AFA B;  3AZI B;  4H9Q B;  5DNN A;  3REI B;  2F8N K;  2NZD C;  3WTP B;  1JFI A;  1TAF B;  3MGS B;  4J8W D;  1P3L D;  1M1A A;  2F8N D;  3W96 B;  1P3L C;  5AY8 A;  5C3I B;  3LZ1 D;  1HTA A;  2BYK A;  3REL D;  5B0Z B;  2HUE B;  3V9R B;  5JRG D;  1EQZ D;  5BNX B;  3O62 A;  3MVD A;  3B0C W;  4CAY A;  5BT1 D;  4YS3 C;  1P3I B;  1H3O B;  1ZLA A;  5BT1 C;  2NZD B;  3REH A;  4J8X B;  3R45 A;  1U35 D;  3C1B C;  1KX4 C;  5AY8 D;  1U35 C;  4J8W B;  3UTA D;  1P3L B;  5JA4 A;  2F8N B;  4ZUX D;  3UTA C;  3AZL A;  3X1T A;  3MVD D;  4Z5T A;  3WA9 C;  3W97 A;  5F99 A;  4CSR B;  3REL B;  4KHA B;  1EQZ B;  4X23 A;  3X1V A;  3MGR A;  3X1U D;  4JJN C;  3WAA C;  5B1L A;  3C1B B;  3AN2 D;  1JFI B;  2PYO A;  5CPI C;  1U35 B;  5DNM A;  3X1U C;  3AN2 C;  4KGC D;  2RVQ C;  5AY8 B;  3UTA B;  2NQB D;  5F99 D;  1BH9 B;  5GXQ D;  3WKJ C;  4EO5 C;  4ZUX B;  4X23 D;  3X1V D;  3MVD B;  4CAY B;  5AV6 A;  5GXQ C;  4WNN B;  5B2I A;  1F66 C;  3AZM C;  4G91 B;  4H9P B;  5CP6 C;  3B0C T;  3MGQ D;  4JJN B;  3A6N A;  4H9N A;  3MNN D;  5B2J A;  4E44 A;  2CWE A;  3X1U B;  3MNN C;  3AN2 B;  4H9O B;  4NE3 A;  3UT9 A;  1S32 C;  2FJ7 D;  4WU9 C;  5BS7 A;  4WV4 B;  3MGP A;  4KGC B;  4XUJ D;  4Z2M G;  2NQB B;  2IO5 C;  5AV6 D;  3REK A;  1ID3 A;  5GXQ B;  1F66 B;  5B32 G;  4X23 B;  3AYW C;  5B32 A;  3AZI A;  4H9Q A;  3A6N D;  3REI A;  3WTP A;  3KXB C;  1TAF A;  5GT3 C;  3C1C C;  3MGQ B;  3W96 A;  4NE6 A;  3MNN B;  2ARO C;  3TU4 D;  3MGP D;  4J8V C;  5B0Z A;  3W99 C;  3V9R A;  1P3M C;  3TU4 C;  5BNX A;  3REK D;  1KX5 D;  4WU8 D;  2FJ7 B;  1P3I A;  4XUJ B;  1H3O A;  3REI D;  5AV6 B;  2NZD A;  1P3K D;  4J8X A;  3AZG C;  1P3K C;  4J8W A;  3AZH D;  1P3L A;  5B40 C;  2ARO B;  5B24 C;  4G92 C;  3AV2 C;  4H9S C;  2F8N A;  2CV5 C;  1P3M B;  3TU4 B;  4M6B A;  3MGP B;  4CSR A;  1A7W A;  4XZQ C;  2HIO C;  4KHA A;  3REK B;  3AZJ C;  3AZE D;  1KX5 B;  4WU8 B;  4AWL C;  5AV9 C;  3AZE C;  3AZG B;  1P3F D;  3C1B A;  1KX4 A;  1P3K B;  1U35 A;  5GT0 C;  3B0B A;  5E5A C;  1P3F C;  5AVB C;  5B40 B;  3KSY A;  3AV2 B;  3UTA A;  3AZH B;  1BH9 A;  3WA9 A;  4YS3 D;  4ZUX A;  5BNV B;  3REJ C;  5B1M C;  4WNN A;  1P3B C;  4H9P A;  3C1B D;  5AV9 B;  1KX4 D;  4JJN A;  3AZE B;  3WAA A;  5CPI A;  5GT0 B;  5E5A B;  1P3A D;  3X1U A;  1P3F B;  3AN2 A;  5G49 B;  4H9O A;  4NE5 A;  2YFW B;  3WA9 D;  1P3P C;  1P3A C;  4KGC A;  3REJ B;  2NQB A;  4LD9 D;  4YS3 B;  5GXQ A;  1F66 A;  3AZM A;  4LD9 C;  4JJN D;  3WAA D;  5CPI D;  5B33 C;  5BO0 B;  3MGQ A;  1KX4 B;  2RVQ D;  5AV5 C;  4KUD D;  3MNN A;  4QLC C;  4WU9 A;  1P3A B;  4KUD C;  3WKJ D;  1KX3 D;  3AZF C;  3WA9 B;  2FJ7 A;  1F66 D;  3AZM D;  1KX3 C;  4XUJ A;  3O62 C;  5CP6 D;  4LD9 B;  3KXB A;  5CPJ C;  5B33 B;  4R8P D;  1AOI C;  3C1C A;  5B31 G;  3WAA B;  3LEL C;  5AV5 B;  5CPI B;  5KDM A;  1HQ3 C;  4R8P C;  2ARO A;  1S32 D;  4WU9 D;  5CPK D;  4DRA A;  4KUD B; 
#chains in the Genus database with same CATH topology
 3VH5 W;  1P3M A;  3TU4 A;  5CPK C;  3X1T C;  1M18 C;  3WKJ B;  4EO5 B;  3AYW D;  1KX3 B;  3B6G D;  3B6F D;  3W97 C;  2YFV B;  1KX5 A;  4WU8 A;  3KXB D;  2W8S A;  3LZ0 C;  3AZM B;  3B6F C;  3KUY C;  3B6G C;  5GT3 D;  3C1C D;  5CPJ B;  5CP6 B;  3AZG A;  5B31 D;  1AOI B;  3AZN D;  1P3K A;  3LEL B;  2ARO D;  3AV1 C;  3MGR C;  2Y2P A;  4J8V D;  1HQ3 B;  5B31 C;  5B40 A;  4R8P B;  3AZN C;  3W99 D;  3AV2 A;  4H9S A;  1P3M D;  3AZH A;  5DNM C;  2CV5 A;  5B0Y C;  1S32 B;  4WU9 B;  5CPK B;  2HIO A;  5BNV A;  2JCH A;  2IO5 B;  3AZJ A;  3W98 D;  2XD1 A;  3AZG D;  3AYW B;  1WWI A;  3B6F B;  3B6G B;  5AV9 A;  4WZS B;  3AZE A;  1P3G D;  2Y2I A;  3KXB B;  3AZK C;  3W98 C;  1WWS A;  5B40 D;  5GT0 A;  5GT3 B;  5B24 D;  3C1C B;  5E5A A;  5GSU C;  3AV1 B;  1P3G C;  5B31 B;  1P3F A;  3AV2 D;  3AZN B;  4J8U C;  2CV5 D;  5G49 A;  5KDM B;  2YFW A;  4J8V B;  5AV8 D;  5B0Y B;  4XZQ D;  2HIO D;  3W99 B;  3UT9 C;  3REJ A;  3AZJ D;  5AV8 C;  5B1M A;  4YS3 A;  3VH5 T;  1P34 C;  4DQY B;  1M19 C;  5AV9 D;  2DF4 C;  3B0D C;  4Z2M H;  3W98 B;  5GT0 D;  3AFA C;  3VH5 A;  5E5A D;  5AVB D;  4UUZ B;  5BO0 A;  1P3O C;  5GSU B;  3MGS C;  1P3G B;  5AVC D;  3LJA D;  4J8U B;  5B24 B;  3W96 C;  1P3P A;  1P3A A;  2LY8 A;  2FFF B;  5AVC C;  3LJA C;  4G92 B;  3REJ D;  2CV5 B;  5B1M D;  5B0Z C;  5AV8 B;  4XZQ B;  2HIO B;  5CHL B;  1P3B D;  3UTB D;  4Z66 C;  1P34 B;  4LD9 A;  3AZJ B;  3B0D B;  3X1S D;  3KWQ D;  4AWL B;  3UTB C;  5B33 A;  4H9R A;  2BYM B;  4J8X C;  3X1S C;  3KWQ C;  3EPK A;  5AV5 A;  1P3O B;  4QLC A;  2L5A A;  1P3P D;  5AVB B;  1BFM A;  4J8W C;  4KUD A;  5AVC B;  3LJA B;  1F1E A;  1ULY A;  1TZY D;  3AZF A;  3H0M C;  3WKJ A;  1TZY C;  3LZ1 C;  4YM6 D;  1KX3 A;  2F8N H;  2YFV A;  2JSS A;  5B1M B;  4Z66 B;  3REL C;  5JRG C;  5B33 D;  1P3B B;  1EQZ C;  4YM6 C;  3NQU B;  5DNN D;  3UTB B;  5CP6 A;  5CPJ A;  1N1J B;  1AOI A;  3NQJ B;  5AV5 D;  3EPH A;  4HGA C;  3LEL A;  4QLC D;  3X1S B;  3KWQ B;  5DNN C;  1M1A D;  1HQ3 A;  4R8P A;  3VH6 W;  2UWX A;  4DRB A;  3AZF D;  1M1A C;  1S32 A;  1P3P B;  5CPK A;  5AY8 C;  4E45 A;  1M18 A;  3O62 D;  4WJ3 C;  2VQR A;  1TZY B;  3LZ1 B;  2ZY3 A;  4ZUX C;  5CPJ D;  3LZ0 A;  5JRG B;  3MVD C;  1ZLA D;  3AYW A;  3B6G A;  3KUY A;  4YM6 B;  1AOI D;  3B6F A;  3REH D;  3LEL D;  4G91 C;  4NFT A;  1ZLA C;  4HGA B;  1HQ3 D;  1B67 A;  2Y2O A;  3IP4 C;  5GT3 A;  5DNN B;  3REH C;  4H9R B;  3AV1 A;  5B31 A;  3AZN A;  4QLC B;  4J8V A;  5B0Y A;  1M1A B;  3X1T D;  3AZL D;  1M18 D;  3W99 A;  4Z5T D;  3W97 D;  2BYK B;  3AZF B;  5FUG A;  4KGC C;  3AZL C;  3LZ0 D;  4Z5T C;  3KUY D;  2NQB C;  5F99 C;  3O62 B;  1BH8 A;  3W98 A;  3AZK A;  4X23 C;  3AV1 D;  3MGR D;  3X1V C;  1ZLA B;  5B1L D;  4UUZ A;  2ZY2 A;  3REH B;  3H0L C;  5GSU A;  1P3G A;  3R45 B;  2PYO D;  4J8U A;  5DNM D;  5B1L C;  5B0Y D;  3MGQ C;  5B24 A;  2PYO C;  4ZBJ C;  3VH6 T;  5JA4 B;  5AV8 A;  4XZQ A;  3AZL B;  3X1T B;  1M18 B;  4Z5T B;  1P34 A;  2Y2M A;  1M19 A;  3W97 B;  2FJ7 C;  5F99 B;  3VH6 A;  1R4V A;  5B2I D;  3AZK D;  3LZ0 B;  4XUJ C;  3KUY B;  3AFA A;  5AV6 C;  3X1V B;  5GSU D;  5B2I C;  2BYM A;  4J8U D;  5B2J D;  3MGS A;  1P3O A;  3MGR B;  3A6N C;  5B1L B;  5AVB A;  5B2J C;  2PYO B;  5AVC A;  3LJA A;  3UT9 D;  3EPL A;  5DNM B;  4ZBJ B;  3FDD A;  1P34 D;  1M19 D;  5BS7 C;  3MGP C;  5FUG B;  4Z66 A;  1ID3 D;  1Q9C A;  1P3B A;  5B32 D;  3AFA D;  3NQU A;  3REK C;  3UTB A;  1BH8 B;  3AZI D;  1KX5 C;  4WU8 C;  1N1J A;  3WTP D;  1ID3 C;  1P3O D;  3NQJ A;  3MGS D;  5B2I B;  3AZK B;  5B32 C;  3X1S A;  3KWQ A;  3AZI C;  3REI C;  3WTP C;  3W96 D;  3A6N B;  4H9N B;  3AL0 C;  5B2J B;  2Y2Q A;  5B0Z D;  2F8N G;  5C3I C;  3AZH C;  4Z66 D;  3UT9 B;  1B6W A;  1TZY A;  2HUE C;  3LZ1 A;  3REL A;  1P3I D;  5JRG A;  1M19 B;  1EQZ A;  4YM6 A;  1KU5 A;  3WTP E;  2NZD D;  1P3I C;  4J8X D;  1ID3 B;  1W2E A;  1T3U A;  5B32 B;  3AFA B;  3AZI B;  4H9Q B;  5DNN A;  3REI B;  2F8N K;  2NZD C;  3WTP B;  1JFI A;  1TAF B;  3MGS B;  4J8W D;  1P3L D;  1M1A A;  2F8N D;  3W96 B;  1P3L C;  2ZM5 A;  5AY8 A;  5C3I B;  3LZ1 D;  2BG1 A;  1HTA A;  2BYK A;  3REL D;  5B0Z B;  2HUE B;  3V9R B;  5JRG D;  1EQZ D;  5BNX B;  3O62 A;  3MVD A;  3B0C W;  4CAY A;  5BT1 D;  4YS3 C;  1P3I B;  1H3O B;  1ZLA A;  5BT1 C;  2NZD B;  3REH A;  4J8X B;  3R45 A;  1U35 D;  3C1B C;  1KX4 C;  5AY8 D;  1U35 C;  4J8W B;  3UTA D;  1P3L B;  2G5H C;  2Y2L A;  5JA4 A;  2F8N B;  4ZUX D;  3UTA C;  3AZL A;  3X1T A;  3MVD D;  4Z5T A;  3WA9 C;  3W97 A;  5F99 A;  4CSR B;  3REL B;  4KHA B;  1EQZ B;  4X23 A;  2ZY4 A;  3X1V A;  3A1I A;  3MGR A;  3X1U D;  4JJN C;  3WAA C;  5B1L A;  3C1B B;  3AN2 D;  1JFI B;  2PYO A;  5CPI C;  1U35 B;  5DNM A;  3X1U C;  1Z2C B;  3AN2 C;  4KGC D;  2RVQ C;  2Y2N A;  5AY8 B;  3UTA B;  2NQB D;  5F99 D;  1BH9 B;  5GXQ D;  3WKJ C;  4EO5 C;  4ZUX B;  4X23 D;  3X1V D;  3MVD B;  4CAY B;  5AV6 A;  5GXQ C;  4WNN B;  5B2I A;  1F66 C;  3AZM C;  4G91 B;  3P5J B;  4H9P B;  2ZY5 A;  5CP6 C;  3B0C T;  3MGQ D;  4JJN B;  3A6N A;  4H9N A;  3MNN D;  5B2J A;  4E44 A;  2CWE A;  3X1U B;  3MNN C;  3AN2 B;  4H9O B;  4NE3 A;  3UT9 A;  1S32 C;  2FJ7 D;  4WU9 C;  5BS7 A;  4WV4 B;  3MGP A;  4KGC B;  4XUJ D;  4Z2M G;  4UPK A;  2NQB B;  2IO5 C;  5AV6 D;  3REK A;  1ID3 A;  5GXQ B;  1F66 B;  5B32 G;  4X23 B;  3AYW C;  5B32 A;  3AZI A;  4H9Q A;  3A6N D;  3REI A;  3WTP A;  3KXB C;  1TAF A;  5GT3 C;  3C1C C;  3MGQ B;  3W96 A;  4NE6 A;  3EPJ A;  3MNN B;  2ARO C;  3TU4 D;  3MGP D;  4J8V C;  5B0Z A;  3W99 C;  3V9R A;  1P3M C;  3TU4 C;  3EG5 B;  5BNX A;  3REK D;  1KX5 D;  4WU8 D;  2FJ7 B;  1P3I A;  4XUJ B;  1H3O A;  3REI D;  5AV6 B;  2NZD A;  1P3K D;  4J8X A;  3F6T A;  3AZG C;  1P3K C;  2F2A C;  4J8W A;  3AZH D;  1P3L A;  5B40 C;  2ARO B;  5B24 C;  4G92 C;  3AV2 C;  4H9S C;  2F8N A;  2CV5 C;  1P3M B;  3TU4 B;  4M6B A;  3MGP B;  4CSR A;  1A7W A;  4XZQ C;  2HIO C;  4KHA A;  3H0R C;  3REK B;  3AZJ C;  3AZE D;  1KX5 B;  4WU8 B;  4AWL C;  5AV9 C;  3AZE C;  3AZG B;  1P3F D;  3C1B A;  1KX4 A;  1P3K B;  2RIQ A;  1U35 A;  5GT0 C;  2DQN C;  3B0B A;  5E5A C;  2Y2J A;  5AVB C;  1P3F C;  5B40 B;  2Y2G A;  3KSY A;  2G5I C;  3AV2 B;  3UTA A;  3AZH B;  1BH9 A;  3WA9 A;  4YS3 D;  2Y2K A;  4ZUX A;  5BNV B;  3REJ C;  5B1M C;  4WNN A;  1P3B C;  4H9P A;  3C1B D;  5AV9 B;  1KX4 D;  4JJN A;  3AZE B;  3WAA A;  5CPI A;  5GT0 B;  5E5A B;  1P3A D;  3X1U A;  1P3F B;  3AN2 A;  5G49 B;  4H9O A;  4NE5 A;  2YFW B;  3WA9 D;  1P3P C;  1P3A C;  3A1K A;  4KGC A;  1PZR A;  3REJ B;  2NQB A;  4LD9 D;  4YS3 B;  5GXQ A;  1F66 A;  3AZM A;  4LD9 C;  4JJN D;  2XD5 A;  3WAA D;  2JE5 A;  3KFU G;  5CPI D;  5B33 C;  5BO0 B;  3MGQ A;  1KX4 B;  2RVQ D;  5AV5 C;  4KUD D;  3MNN A;  4QLC C;  4WU9 A;  1P3A B;  4KUD C;  3WKJ D;  1KX3 D;  2J8P A;  3AZF C;  3WA9 B;  2FJ7 A;  1F66 D;  3AZM D;  1KX3 C;  4XUJ A;  3O62 C;  5CP6 D;  4LD9 B;  3KXB A;  5CPJ C;  5B33 B;  4R8P D;  1AOI C;  3C1C A;  5B31 G;  3WAA B;  3LEL C;  5AV5 B;  2Y2H A;  5CPI B;  5KDM A;  1HQ3 C;  4R8P C;  2ARO A;  1S32 D;  4WU9 D;  5CPK D;  4DRA A;  4KUD B; 
#chains in the Genus database with same CATH homology
 3VH5 W;  1P3M A;  3TU4 A;  5CPK C;  3X1T C;  1M18 C;  3WKJ B;  4EO5 B;  3AYW D;  1KX3 B;  3B6G D;  3B6F D;  3W97 C;  2YFV B;  1KX5 A;  4WU8 A;  3KXB D;  2W8S A;  3LZ0 C;  3AZM B;  3B6F C;  3KUY C;  3B6G C;  5GT3 D;  3C1C D;  5CPJ B;  5CP6 B;  3AZG A;  5B31 D;  1AOI B;  3AZN D;  1P3K A;  3LEL B;  2ARO D;  3AV1 C;  3MGR C;  2Y2P A;  4J8V D;  1HQ3 B;  5B31 C;  5B40 A;  4R8P B;  3AZN C;  3W99 D;  3AV2 A;  4H9S A;  1P3M D;  3AZH A;  5DNM C;  2CV5 A;  5B0Y C;  1S32 B;  4WU9 B;  5CPK B;  2HIO A;  5BNV A;  2JCH A;  2IO5 B;  3AZJ A;  3W98 D;  2XD1 A;  3AZG D;  3AYW B;  1WWI A;  3B6F B;  3B6G B;  5AV9 A;  4WZS B;  3AZE A;  1P3G D;  2Y2I A;  3KXB B;  3AZK C;  3W98 C;  1WWS A;  5B40 D;  5GT0 A;  5GT3 B;  5B24 D;  3C1C B;  5E5A A;  5GSU C;  3AV1 B;  1P3G C;  5B31 B;  1P3F A;  3AV2 D;  3AZN B;  4J8U C;  2CV5 D;  5G49 A;  5KDM B;  2YFW A;  4J8V B;  5AV8 D;  5B0Y B;  4XZQ D;  2HIO D;  3W99 B;  3UT9 C;  3REJ A;  3AZJ D;  5AV8 C;  5B1M A;  4YS3 A;  3VH5 T;  1P34 C;  4DQY B;  1M19 C;  5AV9 D;  2DF4 C;  3B0D C;  4Z2M H;  3W98 B;  5GT0 D;  3AFA C;  3VH5 A;  5E5A D;  5AVB D;  4UUZ B;  5BO0 A;  1P3O C;  5GSU B;  3MGS C;  1P3G B;  5AVC D;  3LJA D;  4J8U B;  5B24 B;  3W96 C;  1P3P A;  1P3A A;  2LY8 A;  2FFF B;  5AVC C;  3LJA C;  4G92 B;  3REJ D;  2CV5 B;  5B1M D;  5B0Z C;  5AV8 B;  4XZQ B;  2HIO B;  5CHL B;  1P3B D;  3UTB D;  4Z66 C;  1P34 B;  4LD9 A;  3AZJ B;  3B0D B;  3X1S D;  3KWQ D;  4AWL B;  3UTB C;  5B33 A;  4H9R A;  2BYM B;  4J8X C;  3X1S C;  3KWQ C;  3EPK A;  5AV5 A;  1P3O B;  4QLC A;  2L5A A;  1P3P D;  5AVB B;  1BFM A;  4J8W C;  4KUD A;  5AVC B;  3LJA B;  1F1E A;  1ULY A;  1TZY D;  3AZF A;  3H0M C;  3WKJ A;  1TZY C;  3LZ1 C;  4YM6 D;  1KX3 A;  2F8N H;  2YFV A;  2JSS A;  5B1M B;  4Z66 B;  3REL C;  5JRG C;  5B33 D;  1P3B B;  1EQZ C;  4YM6 C;  3NQU B;  5DNN D;  3UTB B;  5CP6 A;  5CPJ A;  1N1J B;  1AOI A;  3NQJ B;  5AV5 D;  3EPH A;  4HGA C;  3LEL A;  4QLC D;  3X1S B;  3KWQ B;  5DNN C;  1M1A D;  1HQ3 A;  4R8P A;  3VH6 W;  2UWX A;  4DRB A;  3AZF D;  1M1A C;  1S32 A;  1P3P B;  5CPK A;  5AY8 C;  4E45 A;  1M18 A;  3O62 D;  4WJ3 C;  2VQR A;  1TZY B;  3LZ1 B;  2ZY3 A;  4ZUX C;  5CPJ D;  3LZ0 A;  5JRG B;  3MVD C;  1ZLA D;  3AYW A;  3B6G A;  3KUY A;  4YM6 B;  1AOI D;  3B6F A;  3REH D;  3LEL D;  4G91 C;  4NFT A;  1ZLA C;  4HGA B;  1HQ3 D;  1B67 A;  2Y2O A;  3IP4 C;  5GT3 A;  5DNN B;  3REH C;  4H9R B;  3AV1 A;  5B31 A;  3AZN A;  4QLC B;  4J8V A;  5B0Y A;  1M1A B;  3X1T D;  3AZL D;  1M18 D;  3W99 A;  4Z5T D;  3W97 D;  2BYK B;  3AZF B;  5FUG A;  4KGC C;  3AZL C;  3LZ0 D;  4Z5T C;  3KUY D;  2NQB C;  5F99 C;  3O62 B;  1BH8 A;  3W98 A;  3AZK A;  4X23 C;  3AV1 D;  3MGR D;  3X1V C;  1ZLA B;  5B1L D;  4UUZ A;  2ZY2 A;  3REH B;  3H0L C;  5GSU A;  1P3G A;  3R45 B;  2PYO D;  4J8U A;  5DNM D;  5B1L C;  5B0Y D;  3MGQ C;  5B24 A;  2PYO C;  4ZBJ C;  3VH6 T;  5JA4 B;  5AV8 A;  4XZQ A;  3AZL B;  3X1T B;  1M18 B;  4Z5T B;  1P34 A;  2Y2M A;  1M19 A;  3W97 B;  2FJ7 C;  5F99 B;  3VH6 A;  1R4V A;  5B2I D;  3AZK D;  3LZ0 B;  4XUJ C;  3KUY B;  3AFA A;  5AV6 C;  3X1V B;  5GSU D;  5B2I C;  2BYM A;  4J8U D;  5B2J D;  3MGS A;  1P3O A;  3MGR B;  3A6N C;  5B1L B;  5AVB A;  5B2J C;  2PYO B;  5AVC A;  3LJA A;  3UT9 D;  3EPL A;  5DNM B;  4ZBJ B;  3FDD A;  1P34 D;  1M19 D;  5BS7 C;  3MGP C;  5FUG B;  4Z66 A;  1ID3 D;  1Q9C A;  1P3B A;  5B32 D;  3AFA D;  3NQU A;  3REK C;  3UTB A;  1BH8 B;  3AZI D;  1KX5 C;  4WU8 C;  1N1J A;  3WTP D;  1ID3 C;  1P3O D;  3NQJ A;  3MGS D;  5B2I B;  3AZK B;  5B32 C;  3X1S A;  3KWQ A;  3AZI C;  3REI C;  3WTP C;  3W96 D;  3A6N B;  4H9N B;  3AL0 C;  5B2J B;  2Y2Q A;  5B0Z D;  2F8N G;  5C3I C;  3AZH C;  4Z66 D;  3UT9 B;  1B6W A;  1TZY A;  2HUE C;  3LZ1 A;  3REL A;  1P3I D;  5JRG A;  1M19 B;  1EQZ A;  4YM6 A;  1KU5 A;  3WTP E;  2NZD D;  1P3I C;  4J8X D;  1ID3 B;  1W2E A;  1T3U A;  5B32 B;  3AFA B;  3AZI B;  4H9Q B;  5DNN A;  3REI B;  2F8N K;  2NZD C;  3WTP B;  1JFI A;  1TAF B;  3MGS B;  4J8W D;  1P3L D;  1M1A A;  2F8N D;  3W96 B;  1P3L C;  2ZM5 A;  5AY8 A;  5C3I B;  3LZ1 D;  2BG1 A;  1HTA A;  2BYK A;  3REL D;  5B0Z B;  2HUE B;  3V9R B;  5JRG D;  1EQZ D;  5BNX B;  3O62 A;  3MVD A;  3B0C W;  4CAY A;  5BT1 D;  4YS3 C;  1P3I B;  1H3O B;  1ZLA A;  5BT1 C;  2NZD B;  3REH A;  4J8X B;  3R45 A;  1U35 D;  3C1B C;  1KX4 C;  5AY8 D;  1U35 C;  4J8W B;  3UTA D;  1P3L B;  2G5H C;  2Y2L A;  5JA4 A;  2F8N B;  4ZUX D;  3UTA C;  3AZL A;  3X1T A;  3MVD D;  4Z5T A;  3WA9 C;  3W97 A;  5F99 A;  4CSR B;  3REL B;  4KHA B;  1EQZ B;  4X23 A;  2ZY4 A;  3X1V A;  3A1I A;  3MGR A;  3X1U D;  4JJN C;  3WAA C;  5B1L A;  3C1B B;  3AN2 D;  1JFI B;  2PYO A;  5CPI C;  1U35 B;  5DNM A;  3X1U C;  1Z2C B;  3AN2 C;  4KGC D;  2RVQ C;  2Y2N A;  5AY8 B;  3UTA B;  2NQB D;  5F99 D;  1BH9 B;  5GXQ D;  3WKJ C;  4EO5 C;  4ZUX B;  4X23 D;  3X1V D;  3MVD B;  4CAY B;  5AV6 A;  5GXQ C;  4WNN B;  5B2I A;  1F66 C;  3AZM C;  4G91 B;  3P5J B;  4H9P B;  2ZY5 A;  5CP6 C;  3B0C T;  3MGQ D;  4JJN B;  3A6N A;  4H9N A;  3MNN D;  5B2J A;  4E44 A;  2CWE A;  3X1U B;  3MNN C;  3AN2 B;  4H9O B;  4NE3 A;  3UT9 A;  1S32 C;  2FJ7 D;  4WU9 C;  5BS7 A;  4WV4 B;  3MGP A;  4KGC B;  4XUJ D;  4Z2M G;  4UPK A;  2NQB B;  2IO5 C;  5AV6 D;  3REK A;  1ID3 A;  5GXQ B;  1F66 B;  5B32 G;  4X23 B;  3AYW C;  5B32 A;  3AZI A;  4H9Q A;  3A6N D;  3REI A;  3WTP A;  3KXB C;  1TAF A;  5GT3 C;  3C1C C;  3MGQ B;  3W96 A;  4NE6 A;  3EPJ A;  3MNN B;  2ARO C;  3TU4 D;  3MGP D;  4J8V C;  5B0Z A;  3W99 C;  3V9R A;  1P3M C;  3TU4 C;  3EG5 B;  5BNX A;  3REK D;  1KX5 D;  4WU8 D;  2FJ7 B;  1P3I A;  4XUJ B;  1H3O A;  3REI D;  5AV6 B;  2NZD A;  1P3K D;  4J8X A;  3F6T A;  3AZG C;  1P3K C;  2F2A C;  4J8W A;  3AZH D;  1P3L A;  5B40 C;  2ARO B;  5B24 C;  4G92 C;  3AV2 C;  4H9S C;  2F8N A;  2CV5 C;  1P3M B;  3TU4 B;  4M6B A;  3MGP B;  4CSR A;  1A7W A;  4XZQ C;  2HIO C;  4KHA A;  3H0R C;  3REK B;  3AZJ C;  3AZE D;  1KX5 B;  4WU8 B;  4AWL C;  5AV9 C;  3AZE C;  3AZG B;  1P3F D;  3C1B A;  1KX4 A;  1P3K B;  2RIQ A;  1U35 A;  5GT0 C;  2DQN C;  3B0B A;  5E5A C;  2Y2J A;  5AVB C;  1P3F C;  5B40 B;  2Y2G A;  3KSY A;  2G5I C;  3AV2 B;  3UTA A;  3AZH B;  1BH9 A;  3WA9 A;  4YS3 D;  2Y2K A;  4ZUX A;  5BNV B;  3REJ C;  5B1M C;  4WNN A;  1P3B C;  4H9P A;  3C1B D;  5AV9 B;  1KX4 D;  4JJN A;  3AZE B;  3WAA A;  5CPI A;  5GT0 B;  5E5A B;  1P3A D;  3X1U A;  1P3F B;  3AN2 A;  5G49 B;  4H9O A;  4NE5 A;  2YFW B;  3WA9 D;  1P3P C;  1P3A C;  3A1K A;  4KGC A;  1PZR A;  3REJ B;  2NQB A;  4LD9 D;  4YS3 B;  5GXQ A;  1F66 A;  3AZM A;  4LD9 C;  4JJN D;  2XD5 A;  3WAA D;  2JE5 A;  3KFU G;  5CPI D;  5B33 C;  5BO0 B;  3MGQ A;  1KX4 B;  2RVQ D;  5AV5 C;  4KUD D;  3MNN A;  4QLC C;  4WU9 A;  1P3A B;  4KUD C;  3WKJ D;  1KX3 D;  2J8P A;  3AZF C;  3WA9 B;  2FJ7 A;  1F66 D;  3AZM D;  1KX3 C;  4XUJ A;  3O62 C;  5CP6 D;  4LD9 B;  3KXB A;  5CPJ C;  5B33 B;  4R8P D;  1AOI C;  3C1C A;  5B31 G;  3WAA B;  3LEL C;  5AV5 B;  2Y2H A;  5CPI B;  5KDM A;  1HQ3 C;  4R8P C;  2ARO A;  1S32 D;  4WU9 D;  5CPK D;  4DRA A;  4KUD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...