5CPIC

Nucleosome containing unmethylated sat2r dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
b'RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpiC00
4WU9B 1BH9B 3AV1D 5B0ZD 5GT3C 1P3KC 3KSYA 4JJNC 3AZJC 1TZYA 5AY8D 1KX3D 5AVCC 4KGCA 3B0DC 5GSUB 4X23D 3LZ1C 3WKJB 1B67A 4Z2MG 3W97A 2FJ7D 1EQZB 5B40B 4YM6C 4KHAB 3WTPC 1M18A 3VH6A 5B2IA 3AZLB 4J8WA 3AV2D 5KDMB 2RVQD 5E5AB 5GXQD 3LZ0A 1JFIA 3AZGB 5B1LC 3KUYC 3AN2A 1P3FD 5B31A 5FUGA 1M1AB 3C1CB 2NZDA 2L5AA 3AV2C 2YFVB 1P34C 3RELB 1P3MA 4ZUXC 3W99C 1BFMA 3KWQD 1TAFB 1U35A 2NQBC 5F99D 3A6NC 3MGPD 3REIB 3B6GC 3W98C 3AZHD 5B0YA 5JRGA 3AYWC 4NE6A 3AZEC 3REHA 1P3PD 1EQZD 5B40D 3X1TC 3MGRD 4YS3D 2CV5C 2BYKA 3X1SB 4EO5B 5B24C 4NE3A 1S32C 3LELC 2HIOB 5DNMB 5E5AD 3MGQB 1F66B 4ZBJC 3AZGD 3MNNC 5CP6B 3B6FC 5B32C 2LY8A 4H9QA 1P3BA 3UT9B 1P3GC 1BH8B 1P3IB 3REJC 1M1AD 3C1CD 4CAYB 2F8NK 1ID3B 4H9SA 3RELD 3UTBB 3NQUB 1ZLAC 2F8NG 4J8UB 3AFAB 1HQ3A 5B0YB 3KXBA 3W97D 4DRBA 1TZYC 3UTAC 1P3OC 4H9PB 4KGCC 3X1VB 1HTAA 3AZKA 3TU4B 4WU8B 5B2ID 5AV9A 4J8WD 4R8PB 4G92C 4Z5TB 5B32G 3AV1A 3X1SD 1P3LA 3W96B 1M18C 3B0BA 5B31D 3X1UB 3AZIB 5BNVA 2HIOD 5DNMD 3MGQD 5AY8A 3LZ0C 5CP6D 5DNNA 4G91C 3UT9D 3AN2C 1P3ID 1U35D 4Z66B 5JA4A 4X23A 5AV5B 2PYOB 1ID3D 2NZDC 3UTBD 3MVDB 5CPKB 3O62B 4J8UD 3AFAD 1P3MC 5B0YD 3V9RA 5AV8B 3REHD 3X1VD 1U35C 1KX4B 5GXQA 4H9RA 4R8PD 5CPIA 5G49B 4WZSB 5JRGC 4WU9A 1BH9A 3W96D 3X1UD 5JA4B 5B31G 4WNNB 3WAAB 2IO5C 1P3KB 1P3BC 3KXBD 1KX5C 5GSUA 4Z66D 2PYOD 3WKJA 3B0DB 4QLCB 3MVDD 5CPKD 4H9SC 4E44A 4XZQA 3O62D 1EQZA 5B40A 5AV9D 1P3AC 4KHAA 5CPIB 5AV8D 1HQ3C 1N1JB 3AZLA 5KDMA 3WTPE 1P3LD 5E5AA 3AZKC 3WA9B 4H9NB 3AZGA 3AZFC 5BS7A 5BT1D 1M1AA 3KUYB 5DNND 3C1CA 3AV1C 2YFVA 5B0ZC 3RELA 2HUEB 3REKB 3WAAD 1TAFA 4CSRB 5AY8C 4XZQB 4Z2MH 1KX3C 1WWSA 3W99B 3REIA 3AZNB 4QLCD 4X23C 4J8VB 4UUZB 2FJ7C 1R4VA 5CPID 4HGAB 3W98B 3X1SA 5B2JA 4WU9D 2HIOA 2BYMB 1KU5A 5DNMA 3MGSB 3MGQA 1F66A 3WA9D 2RVQC 5GXQC 5CP6A 3UT9A 4ZBJB 1BH8A 5B33B 1P3FC 1P3IA 3B6FB 4CAYA 1ID3A 5GSUD 3UTBA 3NQUA 3WKJD 4J8UA 3REKD 4AWLB 2AROB 3AFAA 3KWQC 4XZQD 4H9PA 1ULYA 3X1VA 5F99C 3AZND 3MGPC 3UTAB 5B2JB 3TU4A 1P3OB 4WU8A 3LJAB 3AZLD 4R8PA 3AZHC 4Z5TA 4J8VD 1P3PC 1EQZC 5B40C 5B1MB 1H3OB 3W96A 3MGRC 3X1UA 4YS3C 3AZIA 3MGSD 5E5AC 3C1BB 3AZGC 5C3IB 5B33D 5CPJB 5BS7C 2F8NH 4KUDB 4Z66A 2PYOA 5AV5A 1M1AC 4G91B 3C1CC 3REID 3MVDA 5CPKA 3O62A 3RELC 2AROD 5AV8A 3W97C 1M19A 1KX4A 4XUJB 4LD9B 5B2JD 3LJAD 5G49A 5B2IC 4J8XB 4J8WC 1F66D 5GT0A 5B1MD 3X1SC 5AV6B 4EO5C 5B31C 4WNNA 2HIOC 5DNMC 3C1BD 3MGQC 3WAAA 1P3KA 5CP6C 4JJNA 1AOIB 3UT9C 5CPJD 4DRAA 3AZMB 4KUDD 1A7WA 1P3IC 1M19B 4QLCA 1KX5B 5AVBB 3TU4D 1ID3C 3UTBC 4WU8D 4J8UC 3AFAC 4Z5TD 5B0YC 3REHC 1N1JA 4YM6A 5GT0B 2CWEA 4XUJD 3X1VC 3B0CW 4LD9D 3AZID 3WA9A 4H9NA 4J8XD 4R8PC 5GT3B 5B1LA 3KUYA 4JJNB 3AZJB 3AZFB 3B0CT 3W96C 5AV6D 3X1UC 5AVCB 5AV5D 3REKA 4CSRA 5B0ZB 3LZ1B 1AOID 3W99A 3AZMD 3AZNA 3KXBC 1M19D 1KX3B 2NQBA 4Z66C 4YM6B 2PYOC 1KX4D 5AVBD 3WTPB 4J8VA 4UUZA 3MVDC 5CPKC 3O62C 3W98A 4WV4B 5AV9C 3VH5W 5AV8C 2FJ7B 5GT0D 2BYMA 5B1LB 3MGSA 2CV5A 1P3LC 3NQJB 1WWIA 3VH5T 3AV2B 5B33A 1P34B 5GT3D 1P3KD 3B6FA 3AZJD 4JJND 4ZUXB 5BT1C 5BO0B 5DNNC 1P3GA 5AVCD 2NQBB 4M6BA 3A6NB 2AROA 4H9OB 3B6GB 3WAAC 3LZ1D 1ZLAA 2F8NB 3AYWB 3KWQB 3AZEB 3UTAA 1P3OA 4YM6D 3LJAA 2YFWB 3X1TB 4QLCC 5F99B 5CHLB 3WTPD 2CV5B 3MGPB 4E45A 5B24B 1S32B 3LELB 2JSSA 5B1MA 5CPIC 1H3OA 3AZHB 1P3PB 3MNNB 3R45B 5B1LD 3KUYD 4WU9C 5B32B 5BNXB 3MGRB 3C1BA 4YS3B 1P3GB 3WA9C 3REJB 1P34D 5CPJA 4KUDA 1ZLAB 4ZUXD 3W99D 1TZYB 2NQBD 5GSUC 3A6ND 4KGCB 3WKJC 2HUEC 3REKC 3B6GD 2F8ND 4XZQC 3W98D 3AYWD 4G92B 4XUJA 3AZED 3W97B 4LD9A 3AZNC 4NE5A 3X1TD 4J8XA 3AZLC 2CV5D 1M18B 5B24D 4J8VC 1S32D 3LELD 3VH5A 5B2IB 4HGAC 4J8WB 5AV6A 3LZ0B 3MNND 3B6FD 1JFIB 5B32D 3MGSC 3AN2B 1P3GD 3REJD 5B31B 1AOIA 5FUGB 2NZDB 3AZMA 5B33C 1ZLAD 1P3MB 1KX5A 5AVBA 1TZYD 3UTAD 1P3OD 3REIC 4KGCD 1U35B 4AWLC 2AROC 1P3AA 5JRGB 3REHB 5B2JC 3LJAC 1M18D 1F66C 2BYKB 5GT3A 3AZJA 3AZFA 5B1MC 4NFTA 3LZ0D 5AVCA 2IO5B 1P3BB 3AN2D 4H9QB 5B0ZA 3C1BC 3LZ1A 2NZDD 5C3IC 5CPJC 1KX3A 4KUDC 1P3MD 1P3AB 3WTPA 1HQ3B 3KXBB 3TU4C 3VH6W 4WU8C 4Z5TC 2FJ7A 3AZKB 5JRGD 5AV9B 4XUJC 4LD9C 3AZIC 3NQJA 3VH6T 4J8XC 3AV1B 3AV2A 1P3LB 1P34A 5BNVB 4ZUXA 5BO0A 1P3FA 5AV6C 5AY8B 1B6WA 3A6NA 4H9OA 5AV5C 1F1EA 1P3BD 1KX5D 5DNNB 3B6GA 2F8NA 4X23B 1AOIC 3AYWA 3KWQA 3AZEA 1Q9CA 3AZMC 3X1TA 2YFWA 1P3AD 1M19C 5F99A 1HQ3D 1KX4C 3V9RB 5AVBC 3MGPA 5B24A 1S32A 3LELA 3AZHA 3AZKD 5GXQB 1P3PA 3MNNA 3R45A 4H9RB 5GT0C 5B32A 3AZFD 5BNXA 3MGRA 4YS3A 1P3FB 3REJA
chains in the Genus database with same CATH superfamily
4WU9B 1BH9B 3AV1D 5B0ZD 5GT3C 1P3KC 3KSYA 4JJNC 3AZJC 1TZYA 5AY8D 1KX3D 5AVCC 4KGCA 3B0DC 5GSUB 4X23D 3LZ1C 3WKJB 1B67A 4Z2MG 3W97A 2FJ7D 1EQZB 5B40B 4YM6C 4KHAB 2ZY4A 3WTPC 1M18A 3VH6A 5B2IA 3AZLB 4J8WA 3AV2D 5KDMB 2RVQD 5E5AB 5GXQD 3LZ0A 1JFIA 4UPKA 3AZGB 5B1LC 3KUYC 3AN2A 1P3FD 5B31A 5FUGA 1M1AB 3C1CB 2NZDA 2G5HC 2L5AA 2YFVB 3AV2C 1P34C 3RELB 1P3MA 4ZUXC 3W99C 1BFMA 3KWQD 1TAFB 1U35A 2NQBC 5F99D 3A6NC 3MGPD 3REIB 3B6GC 3W98C 3AZHD 5B0YA 5JRGA 3AYWC 4NE6A 3AZEC 3REHA 1P3PD 1EQZD 5B40D 3X1TC 3MGRD 4YS3D 2CV5C 2BYKA 3X1SB 4EO5B 5B24C 2JCHA 4NE3A 3LELC 1S32C 2HIOB 5DNMB 5E5AD 3MGQB 1F66B 4ZBJC 3AZGD 3MNNC 5CP6B 3B6FC 5B32C 2LY8A 4H9QA 1P3BA 3UT9B 1P3GC 1BH8B 1P3IB 3REJC 1M1AD 3C1CD 4CAYB 2F8NK 1ID3B 4H9SA 3RELD 3UTBB 2ZY3A 3NQUB 1ZLAC 2F8NG 4J8UB 3AFAB 1HQ3A 5B0YB 3KXBA 2Y2MA 4DRBA 3W97D 1TZYC 3UTAC 1P3OC 4H9PB 4KGCC 3X1VB 1HTAA 3AZKA 3TU4B 4WU8B 2ZM5A 5B2ID 5AV9A 2VQRA 2Y2NA 4R8PB 4J8WD 4G92C 4Z5TB 5B32G 3AV1A 3X1SD 1P3LA 3W96B 1M18C 3B0BA 5B31D 3X1UB 3AZIB 5BNVA 2HIOD 5DNMD 3MGQD 5AY8A 3LZ0C 5CP6D 5DNNA 4G91C 3UT9D 3AN2C 1P3ID 1U35D 4Z66B 5JA4A 4X23A 5AV5B 2PYOB 1ID3D 2NZDC 3UTBD 3MVDB 5CPKB 3O62B 4J8UD 3AFAD 1P3MC 5B0YD 3V9RA 5AV8B 3REHD 3X1VD 1U35C 1KX4B 5GXQA 4H9RA 4R8PD 5CPIA 5G49B 2Y2HA 5JRGC 4WZSB 4WU9A 2Y2IA 1BH9A 3W96D 3X1UD 5JA4B 5B31G 4WNNB 3P5JB 3WAAB 2IO5C 1P3KB 2Y2QA 1Z2CB 3KXBD 1P3BC 1KX5C 5GSUA 4Z66D 2PYOD 3WKJA 3B0DB 4QLCB 2BG1A 3MVDD 5CPKD 4H9SC 2F2AC 4E44A 4XZQA 3O62D 1EQZA 5B40A 5AV9D 1P3AC 4KHAA 5CPIB 5AV8D 1HQ3C 4DQYB 1N1JB 3AZLA 2XD5A 5KDMA 3WTPE 1P3LD 5E5AA 3AZKC 3WA9B 4H9NB 3AZGA 3KFUG 3AZFC 5BS7A 5BT1D 1M1AA 3KUYB 5DNND 3C1CA 3AV1C 2YFVA 5B0ZC 3EPKA 3RELA 2HUEB 3REKB 3WAAD 1TAFA 4CSRB 5AY8C 4XZQB 4Z2MH 1KX3C 1WWSA 3W99B 2ZY2A 3REIA 3AZNB 4QLCD 4X23C 4J8VB 4UUZB 2FJ7C 1R4VA 5CPID 4HGAB 3W98B 3X1SA 5B2JA 4WU9D 2HIOA 2BYMB 1KU5A 5DNMA 3MGSB 3MGQA 1F66A 3WA9D 2RVQC 5GXQC 5CP6A 3UT9A 4ZBJB 1BH8A 5B33B 1P3FC 1P3IA 3B6FB 4CAYA 1ID3A 5GSUD 3UTBA 3NQUA 3WKJD 4J8UA 3REKD 4AWLB 2AROB 3AFAA 3KWQC 4XZQD 4H9PA 1ULYA 3X1VA 5F99C 3AZND 3MGPC 3UTAB 5B2JB 3TU4A 1P3OB 4WU8A 3LJAB 3AZLD 4R8PA 3AZHC 4Z5TA 4J8VD 3FDDA 1P3PC 1EQZC 5B40C 3EG5B 5B1MB 1H3OB 2DQNC 3W96A 3MGRC 3X1UA 4YS3C 3AZIA 2DF4C 3MGSD 5E5AC 3C1BB 3AZGC 5C3IB 5B33D 5CPJB 5BS7C 2F8NH 4KUDB 4Z66A 2PYOA 5AV5A 1M1AC 4G91B 3C1CC 3REID 3MVDA 5CPKA 3O62A 3RELC 2AROD 5AV8A 3W97C 2Y2OA 1M19A 1KX4A 4XUJB 4LD9B 5B2JD 3LJAD 5G49A 5B2IC 4J8XB 4J8WC 1F66D 5GT0A 5B1MD 3X1SC 5AV6B 4EO5C 5B31C 4WNNA 2HIOC 5DNMC 3C1BD 3MGQC 3WAAA 1P3KA 5CP6C 4JJNA 1AOIB 3H0LC 3UT9C 5CPJD 4DRAA 3AZMB 4KUDD 1A7WA 1P3IC 1M19B 4QLCA 2W8SA 1KX5B 5AVBB 3TU4D 1ID3C 3UTBC 4WU8D 4J8UC 3AFAC 4Z5TD 5B0YC 3REHC 1N1JA 4YM6A 5GT0B 2CWEA 4XUJD 3X1VC 3B0CW 4LD9D 3AZID 3WA9A 4H9NA 3EPHA 4J8XD 2XD1A 4R8PC 5GT3B 5B1LA 3KUYA 4JJNB 3AZJB 3AZFB 3B0CT 3W96C 5AV6D 3X1UC 5AVCB 5AV5D 3REKA 2FFFB 4CSRA 5B0ZB 3LZ1B 1AOID 3W99A 3AL0C 3AZMD 3AZNA 3KXBC 1M19D 1KX3B 2NQBA 4Z66C 4YM6B 2PYOC 1KX4D 5AVBD 3WTPB 3IP4C 4J8VA 4UUZA 3MVDC 5CPKC 3O62C 3W98A 4WV4B 5AV9C 3VH5W 2G5IC 5AV8C 2FJ7B 5GT0D 3F6TA 2BYMA 5B1LB 3MGSA 2CV5A 3EPJA 1P3LC 1W2EA 3NQJB 1WWIA 3VH5T 3AV2B 2J8PA 5B33A 1P34B 5GT3D 1P3KD 3B6FA 3AZJD 4JJND 4ZUXB 5BT1C 5BO0B 5DNNC 1P3GA 5AVCD 2NQBB 4M6BA 3A6NB 2AROA 4H9OB 3B6GB 3WAAC 3EPLA 3LZ1D 1ZLAA 2F8NB 2Y2PA 3AYWB 3KWQB 3AZEB 3UTAA 1P3OA 4YM6D 3LJAA 2YFWB 3X1TB 4QLCC 5F99B 5CHLB 3WTPD 2CV5B 3MGPB 4E45A 2RIQA 5B24B 1S32B 3LELB 2JSSA 5B1MA 5CPIC 1H3OA 3AZHB 1P3PB 3MNNB 3R45B 5B1LD 3KUYD 4WU9C 5B32B 5BNXB 3MGRB 3C1BA 4YS3B 1P3GB 3WA9C 3REJB 1P34D 5CPJA 4KUDA 1ZLAB 4ZUXD 3W99D 2ZY5A 1TZYB 2NQBD 5GSUC 3A6ND 4KGCB 3WKJC 2HUEC 3REKC 3B6GD 2F8ND 4XZQC 3W98D 3AYWD 4G92B 4XUJA 3AZED 2Y2KA 3W97B 4LD9A 3AZNC 4NE5A 3X1TD 4J8XA 3AZLC 2CV5D 1M18B 5B24D 4J8VC 1S32D 3LELD 3VH5A 5B2IB 4HGAC 4J8WB 5AV6A 3LZ0B 3MNND 3B6FD 1JFIB 5B32D 3MGSC 3AN2B 1P3GD 3REJD 5B31B 1AOIA 5FUGB 2NZDB 3AZMA 5B33C 1ZLAD 1P3MB 1KX5A 5AVBA 1TZYD 3UTAD 2Y2JA 3REIC 1P3OD 3A1IA 4KGCD 1U35B 4AWLC 2AROC 2Y2LA 1P3AA 3A1KA 5JRGB 3REHB 5B2JC 3LJAC 1M18D 1F66C 2BYKB 5GT3A 3AZJA 3AZFA 5B1MC 4NFTA 3LZ0D 5AVCA 2IO5B 1T3UA 1P3BB 3AN2D 4H9QB 5B0ZA 3C1BC 3LZ1A 2JE5A 2NZDD 5C3IC 5CPJC 1KX3A 4KUDC 1P3MD 1P3AB 3WTPA 1HQ3B 3KXBB 3TU4C 3VH6W 4WU8C 4Z5TC 2FJ7A 3AZKB 5JRGD 5AV9B 4XUJC 4LD9C 3AZIC 3NQJA 3VH6T 4J8XC 3AV1B 3AV2A 1P3LB 1PZRA 1P34A 5BNVB 4ZUXA 5BO0A 1P3FA 4WJ3C 5AV6C 5AY8B 1B6WA 2Y2GA 3H0RC 3A6NA 4H9OA 5AV5C 1F1EA 1P3BD 1KX5D 5DNNB 3B6GA 2F8NA 4X23B 3H0MC 1AOIC 3AYWA 3KWQA 3AZEA 1Q9CA 3AZMC 2UWXA 3X1TA 2YFWA 1P3AD 1M19C 5F99A 1HQ3D 1KX4C 3V9RB 5AVBC 3MGPA 5B24A 1S32A 3LELA 3AZHA 3AZKD 5GXQB 1P3PA 3MNNA 3R45A 4H9RB 5GT0C 5B32A 3AZFD 5BNXA 3MGRA 4YS3A 1P3FB 3REJA
chains in the Genus database with same CATH topology
4WU9B 1BH9B 3AV1D 5B0ZD 5GT3C 1P3KC 3KSYA 4JJNC 3AZJC 1TZYA 5AY8D 1KX3D 5AVCC 4KGCA 3B0DC 5GSUB 4X23D 3LZ1C 3WKJB 1B67A 4Z2MG 3W97A 2FJ7D 1EQZB 5B40B 4YM6C 4KHAB 2ZY4A 3WTPC 1M18A 3VH6A 5B2IA 3AZLB 4J8WA 3AV2D 5KDMB 2RVQD 5E5AB 5GXQD 3LZ0A 1JFIA 4UPKA 3AZGB 5B1LC 3KUYC 3AN2A 1P3FD 5B31A 5FUGA 1M1AB 3C1CB 2NZDA 2G5HC 2L5AA 2YFVB 3AV2C 1P34C 3RELB 1P3MA 4ZUXC 3W99C 1BFMA 3KWQD 1TAFB 1U35A 2NQBC 5F99D 3A6NC 3MGPD 3REIB 3B6GC 3W98C 3AZHD 5B0YA 5JRGA 3AYWC 4NE6A 3AZEC 3REHA 1P3PD 1EQZD 5B40D 3X1TC 3MGRD 4YS3D 2CV5C 2BYKA 3X1SB 4EO5B 5B24C 2JCHA 4NE3A 3LELC 1S32C 2HIOB 5DNMB 5E5AD 3MGQB 1F66B 4ZBJC 3AZGD 3MNNC 5CP6B 3B6FC 5B32C 2LY8A 4H9QA 1P3BA 3UT9B 1P3GC 1BH8B 1P3IB 3REJC 1M1AD 3C1CD 4CAYB 2F8NK 1ID3B 4H9SA 3RELD 3UTBB 2ZY3A 3NQUB 1ZLAC 2F8NG 4J8UB 3AFAB 1HQ3A 5B0YB 3KXBA 2Y2MA 4DRBA 3W97D 1TZYC 3UTAC 1P3OC 4H9PB 4KGCC 3X1VB 1HTAA 3AZKA 3TU4B 4WU8B 2ZM5A 5B2ID 5AV9A 2VQRA 2Y2NA 4R8PB 4J8WD 4G92C 4Z5TB 5B32G 3AV1A 3X1SD 1P3LA 3W96B 1M18C 3B0BA 5B31D 3X1UB 3AZIB 5BNVA 2HIOD 5DNMD 3MGQD 5AY8A 3LZ0C 5CP6D 5DNNA 4G91C 3UT9D 3AN2C 1P3ID 1U35D 4Z66B 5JA4A 4X23A 5AV5B 2PYOB 1ID3D 2NZDC 3UTBD 3MVDB 5CPKB 3O62B 4J8UD 3AFAD 1P3MC 5B0YD 3V9RA 5AV8B 3REHD 3X1VD 1U35C 1KX4B 5GXQA 4H9RA 4R8PD 5CPIA 5G49B 2Y2HA 5JRGC 4WZSB 4WU9A 2Y2IA 1BH9A 3W96D 3X1UD 5JA4B 5B31G 4WNNB 3P5JB 3WAAB 2IO5C 1P3KB 2Y2QA 1Z2CB 3KXBD 1P3BC 1KX5C 5GSUA 4Z66D 2PYOD 3WKJA 3B0DB 4QLCB 2BG1A 3MVDD 5CPKD 4H9SC 2F2AC 4E44A 4XZQA 3O62D 1EQZA 5B40A 5AV9D 1P3AC 4KHAA 5CPIB 5AV8D 1HQ3C 4DQYB 1N1JB 3AZLA 2XD5A 5KDMA 3WTPE 1P3LD 5E5AA 3AZKC 3WA9B 4H9NB 3AZGA 3KFUG 3AZFC 5BS7A 5BT1D 1M1AA 3KUYB 5DNND 3C1CA 3AV1C 2YFVA 5B0ZC 3EPKA 3RELA 2HUEB 3REKB 3WAAD 1TAFA 4CSRB 5AY8C 4XZQB 4Z2MH 1KX3C 1WWSA 3W99B 2ZY2A 3REIA 3AZNB 4QLCD 4X23C 4J8VB 4UUZB 2FJ7C 1R4VA 5CPID 4HGAB 3W98B 3X1SA 5B2JA 4WU9D 2HIOA 2BYMB 1KU5A 5DNMA 3MGSB 3MGQA 1F66A 3WA9D 2RVQC 5GXQC 5CP6A 3UT9A 4ZBJB 1BH8A 5B33B 1P3FC 1P3IA 3B6FB 4CAYA 1ID3A 5GSUD 3UTBA 3NQUA 3WKJD 4J8UA 3REKD 4AWLB 2AROB 3AFAA 3KWQC 4XZQD 4H9PA 1ULYA 3X1VA 5F99C 3AZND 3MGPC 3UTAB 5B2JB 3TU4A 1P3OB 4WU8A 3LJAB 3AZLD 4R8PA 3AZHC 4Z5TA 4J8VD 3FDDA 1P3PC 1EQZC 5B40C 3EG5B 5B1MB 1H3OB 2DQNC 3W96A 3MGRC 3X1UA 4YS3C 3AZIA 2DF4C 3MGSD 5E5AC 3C1BB 3AZGC 5C3IB 5B33D 5CPJB 5BS7C 2F8NH 4KUDB 4Z66A 2PYOA 5AV5A 1M1AC 4G91B 3C1CC 3REID 3MVDA 5CPKA 3O62A 3RELC 2AROD 5AV8A 3W97C 2Y2OA 1M19A 1KX4A 4XUJB 4LD9B 5B2JD 3LJAD 5G49A 5B2IC 4J8XB 4J8WC 1F66D 5GT0A 5B1MD 3X1SC 5AV6B 4EO5C 5B31C 4WNNA 2HIOC 5DNMC 3C1BD 3MGQC 3WAAA 1P3KA 5CP6C 4JJNA 1AOIB 3H0LC 3UT9C 5CPJD 4DRAA 3AZMB 4KUDD 1A7WA 1P3IC 1M19B 4QLCA 2W8SA 1KX5B 5AVBB 3TU4D 1ID3C 3UTBC 4WU8D 4J8UC 3AFAC 4Z5TD 5B0YC 3REHC 1N1JA 4YM6A 5GT0B 2CWEA 4XUJD 3X1VC 3B0CW 4LD9D 3AZID 3WA9A 4H9NA 3EPHA 4J8XD 2XD1A 4R8PC 5GT3B 5B1LA 3KUYA 4JJNB 3AZJB 3AZFB 3B0CT 3W96C 5AV6D 3X1UC 5AVCB 5AV5D 3REKA 2FFFB 4CSRA 5B0ZB 3LZ1B 1AOID 3W99A 3AL0C 3AZMD 3AZNA 3KXBC 1M19D 1KX3B 2NQBA 4Z66C 4YM6B 2PYOC 1KX4D 5AVBD 3WTPB 3IP4C 4J8VA 4UUZA 3MVDC 5CPKC 3O62C 3W98A 4WV4B 5AV9C 3VH5W 2G5IC 5AV8C 2FJ7B 5GT0D 3F6TA 2BYMA 5B1LB 3MGSA 2CV5A 3EPJA 1P3LC 1W2EA 3NQJB 1WWIA 3VH5T 3AV2B 2J8PA 5B33A 1P34B 5GT3D 1P3KD 3B6FA 3AZJD 4JJND 4ZUXB 5BT1C 5BO0B 5DNNC 1P3GA 5AVCD 2NQBB 4M6BA 3A6NB 2AROA 4H9OB 3B6GB 3WAAC 3EPLA 3LZ1D 1ZLAA 2F8NB 2Y2PA 3AYWB 3KWQB 3AZEB 3UTAA 1P3OA 4YM6D 3LJAA 2YFWB 3X1TB 4QLCC 5F99B 5CHLB 3WTPD 2CV5B 3MGPB 4E45A 2RIQA 5B24B 1S32B 3LELB 2JSSA 5B1MA 5CPIC 1H3OA 3AZHB 1P3PB 3MNNB 3R45B 5B1LD 3KUYD 4WU9C 5B32B 5BNXB 3MGRB 3C1BA 4YS3B 1P3GB 3WA9C 3REJB 1P34D 5CPJA 4KUDA 1ZLAB 4ZUXD 3W99D 2ZY5A 1TZYB 2NQBD 5GSUC 3A6ND 4KGCB 3WKJC 2HUEC 3REKC 3B6GD 2F8ND 4XZQC 3W98D 3AYWD 4G92B 4XUJA 3AZED 2Y2KA 3W97B 4LD9A 3AZNC 4NE5A 3X1TD 4J8XA 3AZLC 2CV5D 1M18B 5B24D 4J8VC 1S32D 3LELD 3VH5A 5B2IB 4HGAC 4J8WB 5AV6A 3LZ0B 3MNND 3B6FD 1JFIB 5B32D 3MGSC 3AN2B 1P3GD 3REJD 5B31B 1AOIA 5FUGB 2NZDB 3AZMA 5B33C 1ZLAD 1P3MB 1KX5A 5AVBA 1TZYD 3UTAD 2Y2JA 3REIC 1P3OD 3A1IA 4KGCD 1U35B 4AWLC 2AROC 2Y2LA 1P3AA 3A1KA 5JRGB 3REHB 5B2JC 3LJAC 1M18D 1F66C 2BYKB 5GT3A 3AZJA 3AZFA 5B1MC 4NFTA 3LZ0D 5AVCA 2IO5B 1T3UA 1P3BB 3AN2D 4H9QB 5B0ZA 3C1BC 3LZ1A 2JE5A 2NZDD 5C3IC 5CPJC 1KX3A 4KUDC 1P3MD 1P3AB 3WTPA 1HQ3B 3KXBB 3TU4C 3VH6W 4WU8C 4Z5TC 2FJ7A 3AZKB 5JRGD 5AV9B 4XUJC 4LD9C 3AZIC 3NQJA 3VH6T 4J8XC 3AV1B 3AV2A 1P3LB 1PZRA 1P34A 5BNVB 4ZUXA 5BO0A 1P3FA 4WJ3C 5AV6C 5AY8B 1B6WA 2Y2GA 3H0RC 3A6NA 4H9OA 5AV5C 1F1EA 1P3BD 1KX5D 5DNNB 3B6GA 2F8NA 4X23B 3H0MC 1AOIC 3AYWA 3KWQA 3AZEA 1Q9CA 3AZMC 2UWXA 3X1TA 2YFWA 1P3AD 1M19C 5F99A 1HQ3D 1KX4C 3V9RB 5AVBC 3MGPA 5B24A 1S32A 3LELA 3AZHA 3AZKD 5GXQB 1P3PA 3MNNA 3R45A 4H9RB 5GT0C 5B32A 3AZFD 5BNXA 3MGRA 4YS3A 1P3FB 3REJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU9 B;  1BH9 B;  3AV1 D;  5B0Z D;  5GT3 C;  1P3K C;  3KSY A;  4JJN C;  3AZJ C;  1TZY A;  5AY8 D;  1KX3 D;  5AVC C;  4KGC A;  3B0D C;  5GSU B;  4X23 D;  3LZ1 C;  3WKJ B;  1B67 A;  4Z2M G;  3W97 A;  2FJ7 D;  1EQZ B;  5B40 B;  4YM6 C;  4KHA B;  3WTP C;  1M18 A;  3VH6 A;  5B2I A;  3AZL B;  4J8W A;  3AV2 D;  5KDM B;  2RVQ D;  5E5A B;  5GXQ D;  3LZ0 A;  1JFI A;  3AZG B;  5B1L C;  3KUY C;  3AN2 A;  1P3F D;  5B31 A;  5FUG A;  1M1A B;  3C1C B;  2NZD A;  2L5A A;  3AV2 C;  2YFV B;  1P34 C;  3REL B;  1P3M A;  4ZUX C;  3W99 C;  1BFM A;  3KWQ D;  1TAF B;  1U35 A;  2NQB C;  5F99 D;  3A6N C;  3MGP D;  3REI B;  3B6G C;  3W98 C;  3AZH D;  5B0Y A;  5JRG A;  3AYW C;  4NE6 A;  3AZE C;  3REH A;  1P3P D;  1EQZ D;  5B40 D;  3X1T C;  3MGR D;  4YS3 D;  2CV5 C;  2BYK A;  3X1S B;  4EO5 B;  5B24 C;  4NE3 A;  1S32 C;  3LEL C;  2HIO B;  5DNM B;  5E5A D;  3MGQ B;  1F66 B;  4ZBJ C;  3AZG D;  3MNN C;  5CP6 B;  3B6F C;  5B32 C;  2LY8 A;  4H9Q A;  1P3B A;  3UT9 B;  1P3G C;  1BH8 B;  1P3I B;  3REJ C;  1M1A D;  3C1C D;  4CAY B;  2F8N K;  1ID3 B;  4H9S A;  3REL D;  3UTB B;  3NQU B;  1ZLA C;  2F8N G;  4J8U B;  3AFA B;  1HQ3 A;  5B0Y B;  3KXB A;  3W97 D;  4DRB A;  1TZY C;  3UTA C;  1P3O C;  4H9P B;  4KGC C;  3X1V B;  1HTA A;  3AZK A;  3TU4 B;  4WU8 B;  5B2I D;  5AV9 A;  4J8W D;  4R8P B;  4G92 C;  4Z5T B;  5B32 G;  3AV1 A;  3X1S D;  1P3L A;  3W96 B;  1M18 C;  3B0B A;  5B31 D;  3X1U B;  3AZI B;  5BNV A;  2HIO D;  5DNM D;  3MGQ D;  5AY8 A;  3LZ0 C;  5CP6 D;  5DNN A;  4G91 C;  3UT9 D;  3AN2 C;  1P3I D;  1U35 D;  4Z66 B;  5JA4 A;  4X23 A;  5AV5 B;  2PYO B;  1ID3 D;  2NZD C;  3UTB D;  3MVD B;  5CPK B;  3O62 B;  4J8U D;  3AFA D;  1P3M C;  5B0Y D;  3V9R A;  5AV8 B;  3REH D;  3X1V D;  1U35 C;  1KX4 B;  5GXQ A;  4H9R A;  4R8P D;  5CPI A;  5G49 B;  4WZS B;  5JRG C;  4WU9 A;  1BH9 A;  3W96 D;  3X1U D;  5JA4 B;  5B31 G;  4WNN B;  3WAA B;  2IO5 C;  1P3K B;  1P3B C;  3KXB D;  1KX5 C;  5GSU A;  4Z66 D;  2PYO D;  3WKJ A;  3B0D B;  4QLC B;  3MVD D;  5CPK D;  4H9S C;  4E44 A;  4XZQ A;  3O62 D;  1EQZ A;  5B40 A;  5AV9 D;  1P3A C;  4KHA A;  5CPI B;  5AV8 D;  1HQ3 C;  1N1J B;  3AZL A;  5KDM A;  3WTP E;  1P3L D;  5E5A A;  3AZK C;  3WA9 B;  4H9N B;  3AZG A;  3AZF C;  5BS7 A;  5BT1 D;  1M1A A;  3KUY B;  5DNN D;  3C1C A;  3AV1 C;  2YFV A;  5B0Z C;  3REL A;  2HUE B;  3REK B;  3WAA D;  1TAF A;  4CSR B;  5AY8 C;  4XZQ B;  4Z2M H;  1KX3 C;  1WWS A;  3W99 B;  3REI A;  3AZN B;  4QLC D;  4X23 C;  4J8V B;  4UUZ B;  2FJ7 C;  1R4V A;  5CPI D;  4HGA B;  3W98 B;  3X1S A;  5B2J A;  4WU9 D;  2HIO A;  2BYM B;  1KU5 A;  5DNM A;  3MGS B;  3MGQ A;  1F66 A;  3WA9 D;  2RVQ C;  5GXQ C;  5CP6 A;  3UT9 A;  4ZBJ B;  1BH8 A;  5B33 B;  1P3F C;  1P3I A;  3B6F B;  4CAY A;  1ID3 A;  5GSU D;  3UTB A;  3NQU A;  3WKJ D;  4J8U A;  3REK D;  4AWL B;  2ARO B;  3AFA A;  3KWQ C;  4XZQ D;  4H9P A;  1ULY A;  3X1V A;  5F99 C;  3AZN D;  3MGP C;  3UTA B;  5B2J B;  3TU4 A;  1P3O B;  4WU8 A;  3LJA B;  3AZL D;  4R8P A;  3AZH C;  4Z5T A;  4J8V D;  1P3P C;  1EQZ C;  5B40 C;  5B1M B;  1H3O B;  3W96 A;  3MGR C;  3X1U A;  4YS3 C;  3AZI A;  3MGS D;  5E5A C;  3C1B B;  3AZG C;  5C3I B;  5B33 D;  5CPJ B;  5BS7 C;  2F8N H;  4KUD B;  4Z66 A;  2PYO A;  5AV5 A;  1M1A C;  4G91 B;  3C1C C;  3REI D;  3MVD A;  5CPK A;  3O62 A;  3REL C;  2ARO D;  5AV8 A;  3W97 C;  1M19 A;  1KX4 A;  4XUJ B;  4LD9 B;  5B2J D;  3LJA D;  5G49 A;  5B2I C;  4J8X B;  4J8W C;  1F66 D;  5GT0 A;  5B1M D;  3X1S C;  5AV6 B;  4EO5 C;  5B31 C;  4WNN A;  2HIO C;  5DNM C;  3C1B D;  3MGQ C;  3WAA A;  1P3K A;  5CP6 C;  4JJN A;  1AOI B;  3UT9 C;  5CPJ D;  4DRA A;  3AZM B;  4KUD D;  1A7W A;  1P3I C;  1M19 B;  4QLC A;  1KX5 B;  5AVB B;  3TU4 D;  1ID3 C;  3UTB C;  4WU8 D;  4J8U C;  3AFA C;  4Z5T D;  5B0Y C;  3REH C;  1N1J A;  4YM6 A;  5GT0 B;  2CWE A;  4XUJ D;  3X1V C;  3B0C W;  4LD9 D;  3AZI D;  3WA9 A;  4H9N A;  4J8X D;  4R8P C;  5GT3 B;  5B1L A;  3KUY A;  4JJN B;  3AZJ B;  3AZF B;  3B0C T;  3W96 C;  5AV6 D;  3X1U C;  5AVC B;  5AV5 D;  3REK A;  4CSR A;  5B0Z B;  3LZ1 B;  1AOI D;  3W99 A;  3AZM D;  3AZN A;  3KXB C;  1M19 D;  1KX3 B;  2NQB A;  4Z66 C;  4YM6 B;  2PYO C;  1KX4 D;  5AVB D;  3WTP B;  4J8V A;  4UUZ A;  3MVD C;  5CPK C;  3O62 C;  3W98 A;  4WV4 B;  5AV9 C;  3VH5 W;  5AV8 C;  2FJ7 B;  5GT0 D;  2BYM A;  5B1L B;  3MGS A;  2CV5 A;  1P3L C;  3NQJ B;  1WWI A;  3VH5 T;  3AV2 B;  5B33 A;  1P34 B;  5GT3 D;  1P3K D;  3B6F A;  3AZJ D;  4JJN D;  4ZUX B;  5BT1 C;  5BO0 B;  5DNN C;  1P3G A;  5AVC D;  2NQB B;  4M6B A;  3A6N B;  2ARO A;  4H9O B;  3B6G B;  3WAA C;  3LZ1 D;  1ZLA A;  2F8N B;  3AYW B;  3KWQ B;  3AZE B;  3UTA A;  1P3O A;  4YM6 D;  3LJA A;  2YFW B;  3X1T B;  4QLC C;  5F99 B;  5CHL B;  3WTP D;  2CV5 B;  3MGP B;  4E45 A;  5B24 B;  1S32 B;  3LEL B;  2JSS A;  5B1M A;  5CPI C;  1H3O A;  3AZH B;  1P3P B;  3MNN B;  3R45 B;  5B1L D;  3KUY D;  4WU9 C;  5B32 B;  5BNX B;  3MGR B;  3C1B A;  4YS3 B;  1P3G B;  3WA9 C;  3REJ B;  1P34 D;  5CPJ A;  4KUD A;  1ZLA B;  4ZUX D;  3W99 D;  1TZY B;  2NQB D;  5GSU C;  3A6N D;  4KGC B;  3WKJ C;  2HUE C;  3REK C;  3B6G D;  2F8N D;  4XZQ C;  3W98 D;  3AYW D;  4G92 B;  4XUJ A;  3AZE D;  3W97 B;  4LD9 A;  3AZN C;  4NE5 A;  3X1T D;  4J8X A;  3AZL C;  2CV5 D;  1M18 B;  5B24 D;  4J8V C;  1S32 D;  3LEL D;  3VH5 A;  5B2I B;  4HGA C;  4J8W B;  5AV6 A;  3LZ0 B;  3MNN D;  3B6F D;  1JFI B;  5B32 D;  3MGS C;  3AN2 B;  1P3G D;  3REJ D;  5B31 B;  1AOI A;  5FUG B;  2NZD B;  3AZM A;  5B33 C;  1ZLA D;  1P3M B;  1KX5 A;  5AVB A;  1TZY D;  3UTA D;  1P3O D;  3REI C;  4KGC D;  1U35 B;  4AWL C;  2ARO C;  1P3A A;  5JRG B;  3REH B;  5B2J C;  3LJA C;  1M18 D;  1F66 C;  2BYK B;  5GT3 A;  3AZJ A;  3AZF A;  5B1M C;  4NFT A;  3LZ0 D;  5AVC A;  2IO5 B;  1P3B B;  3AN2 D;  4H9Q B;  5B0Z A;  3C1B C;  3LZ1 A;  2NZD D;  5C3I C;  5CPJ C;  1KX3 A;  4KUD C;  1P3M D;  1P3A B;  3WTP A;  1HQ3 B;  3KXB B;  3TU4 C;  3VH6 W;  4WU8 C;  4Z5T C;  2FJ7 A;  3AZK B;  5JRG D;  5AV9 B;  4XUJ C;  4LD9 C;  3AZI C;  3NQJ A;  3VH6 T;  4J8X C;  3AV1 B;  3AV2 A;  1P3L B;  1P34 A;  5BNV B;  4ZUX A;  5BO0 A;  1P3F A;  5AV6 C;  5AY8 B;  1B6W A;  3A6N A;  4H9O A;  5AV5 C;  1F1E A;  1P3B D;  1KX5 D;  5DNN B;  3B6G A;  2F8N A;  4X23 B;  1AOI C;  3AYW A;  3KWQ A;  3AZE A;  1Q9C A;  3AZM C;  3X1T A;  2YFW A;  1P3A D;  1M19 C;  5F99 A;  1HQ3 D;  1KX4 C;  3V9R B;  5AVB C;  3MGP A;  5B24 A;  1S32 A;  3LEL A;  3AZH A;  3AZK D;  5GXQ B;  1P3P A;  3MNN A;  3R45 A;  4H9R B;  5GT0 C;  5B32 A;  3AZF D;  5BNX A;  3MGR A;  4YS3 A;  1P3F B;  3REJ A; 
#chains in the Genus database with same CATH topology
 4WU9 B;  1BH9 B;  3AV1 D;  5B0Z D;  5GT3 C;  1P3K C;  3KSY A;  4JJN C;  3AZJ C;  1TZY A;  5AY8 D;  1KX3 D;  5AVC C;  4KGC A;  3B0D C;  5GSU B;  4X23 D;  3LZ1 C;  3WKJ B;  1B67 A;  4Z2M G;  3W97 A;  2FJ7 D;  1EQZ B;  5B40 B;  4YM6 C;  4KHA B;  2ZY4 A;  3WTP C;  1M18 A;  3VH6 A;  5B2I A;  3AZL B;  4J8W A;  3AV2 D;  5KDM B;  2RVQ D;  5E5A B;  5GXQ D;  3LZ0 A;  1JFI A;  4UPK A;  3AZG B;  5B1L C;  3KUY C;  3AN2 A;  1P3F D;  5B31 A;  5FUG A;  1M1A B;  3C1C B;  2NZD A;  2G5H C;  2L5A A;  2YFV B;  3AV2 C;  1P34 C;  3REL B;  1P3M A;  4ZUX C;  3W99 C;  1BFM A;  3KWQ D;  1TAF B;  1U35 A;  2NQB C;  5F99 D;  3A6N C;  3MGP D;  3REI B;  3B6G C;  3W98 C;  3AZH D;  5B0Y A;  5JRG A;  3AYW C;  4NE6 A;  3AZE C;  3REH A;  1P3P D;  1EQZ D;  5B40 D;  3X1T C;  3MGR D;  4YS3 D;  2CV5 C;  2BYK A;  3X1S B;  4EO5 B;  5B24 C;  2JCH A;  4NE3 A;  3LEL C;  1S32 C;  2HIO B;  5DNM B;  5E5A D;  3MGQ B;  1F66 B;  4ZBJ C;  3AZG D;  3MNN C;  5CP6 B;  3B6F C;  5B32 C;  2LY8 A;  4H9Q A;  1P3B A;  3UT9 B;  1P3G C;  1BH8 B;  1P3I B;  3REJ C;  1M1A D;  3C1C D;  4CAY B;  2F8N K;  1ID3 B;  4H9S A;  3REL D;  3UTB B;  2ZY3 A;  3NQU B;  1ZLA C;  2F8N G;  4J8U B;  3AFA B;  1HQ3 A;  5B0Y B;  3KXB A;  2Y2M A;  4DRB A;  3W97 D;  1TZY C;  3UTA C;  1P3O C;  4H9P B;  4KGC C;  3X1V B;  1HTA A;  3AZK A;  3TU4 B;  4WU8 B;  2ZM5 A;  5B2I D;  5AV9 A;  2VQR A;  2Y2N A;  4R8P B;  4J8W D;  4G92 C;  4Z5T B;  5B32 G;  3AV1 A;  3X1S D;  1P3L A;  3W96 B;  1M18 C;  3B0B A;  5B31 D;  3X1U B;  3AZI B;  5BNV A;  2HIO D;  5DNM D;  3MGQ D;  5AY8 A;  3LZ0 C;  5CP6 D;  5DNN A;  4G91 C;  3UT9 D;  3AN2 C;  1P3I D;  1U35 D;  4Z66 B;  5JA4 A;  4X23 A;  5AV5 B;  2PYO B;  1ID3 D;  2NZD C;  3UTB D;  3MVD B;  5CPK B;  3O62 B;  4J8U D;  3AFA D;  1P3M C;  5B0Y D;  3V9R A;  5AV8 B;  3REH D;  3X1V D;  1U35 C;  1KX4 B;  5GXQ A;  4H9R A;  4R8P D;  5CPI A;  5G49 B;  2Y2H A;  5JRG C;  4WZS B;  4WU9 A;  2Y2I A;  1BH9 A;  3W96 D;  3X1U D;  5JA4 B;  5B31 G;  4WNN B;  3P5J B;  3WAA B;  2IO5 C;  1P3K B;  2Y2Q A;  1Z2C B;  3KXB D;  1P3B C;  1KX5 C;  5GSU A;  4Z66 D;  2PYO D;  3WKJ A;  3B0D B;  4QLC B;  2BG1 A;  3MVD D;  5CPK D;  4H9S C;  2F2A C;  4E44 A;  4XZQ A;  3O62 D;  1EQZ A;  5B40 A;  5AV9 D;  1P3A C;  4KHA A;  5CPI B;  5AV8 D;  1HQ3 C;  4DQY B;  1N1J B;  3AZL A;  2XD5 A;  5KDM A;  3WTP E;  1P3L D;  5E5A A;  3AZK C;  3WA9 B;  4H9N B;  3AZG A;  3KFU G;  3AZF C;  5BS7 A;  5BT1 D;  1M1A A;  3KUY B;  5DNN D;  3C1C A;  3AV1 C;  2YFV A;  5B0Z C;  3EPK A;  3REL A;  2HUE B;  3REK B;  3WAA D;  1TAF A;  4CSR B;  5AY8 C;  4XZQ B;  4Z2M H;  1KX3 C;  1WWS A;  3W99 B;  2ZY2 A;  3REI A;  3AZN B;  4QLC D;  4X23 C;  4J8V B;  4UUZ B;  2FJ7 C;  1R4V A;  5CPI D;  4HGA B;  3W98 B;  3X1S A;  5B2J A;  4WU9 D;  2HIO A;  2BYM B;  1KU5 A;  5DNM A;  3MGS B;  3MGQ A;  1F66 A;  3WA9 D;  2RVQ C;  5GXQ C;  5CP6 A;  3UT9 A;  4ZBJ B;  1BH8 A;  5B33 B;  1P3F C;  1P3I A;  3B6F B;  4CAY A;  1ID3 A;  5GSU D;  3UTB A;  3NQU A;  3WKJ D;  4J8U A;  3REK D;  4AWL B;  2ARO B;  3AFA A;  3KWQ C;  4XZQ D;  4H9P A;  1ULY A;  3X1V A;  5F99 C;  3AZN D;  3MGP C;  3UTA B;  5B2J B;  3TU4 A;  1P3O B;  4WU8 A;  3LJA B;  3AZL D;  4R8P A;  3AZH C;  4Z5T A;  4J8V D;  3FDD A;  1P3P C;  1EQZ C;  5B40 C;  3EG5 B;  5B1M B;  1H3O B;  2DQN C;  3W96 A;  3MGR C;  3X1U A;  4YS3 C;  3AZI A;  2DF4 C;  3MGS D;  5E5A C;  3C1B B;  3AZG C;  5C3I B;  5B33 D;  5CPJ B;  5BS7 C;  2F8N H;  4KUD B;  4Z66 A;  2PYO A;  5AV5 A;  1M1A C;  4G91 B;  3C1C C;  3REI D;  3MVD A;  5CPK A;  3O62 A;  3REL C;  2ARO D;  5AV8 A;  3W97 C;  2Y2O A;  1M19 A;  1KX4 A;  4XUJ B;  4LD9 B;  5B2J D;  3LJA D;  5G49 A;  5B2I C;  4J8X B;  4J8W C;  1F66 D;  5GT0 A;  5B1M D;  3X1S C;  5AV6 B;  4EO5 C;  5B31 C;  4WNN A;  2HIO C;  5DNM C;  3C1B D;  3MGQ C;  3WAA A;  1P3K A;  5CP6 C;  4JJN A;  1AOI B;  3H0L C;  3UT9 C;  5CPJ D;  4DRA A;  3AZM B;  4KUD D;  1A7W A;  1P3I C;  1M19 B;  4QLC A;  2W8S A;  1KX5 B;  5AVB B;  3TU4 D;  1ID3 C;  3UTB C;  4WU8 D;  4J8U C;  3AFA C;  4Z5T D;  5B0Y C;  3REH C;  1N1J A;  4YM6 A;  5GT0 B;  2CWE A;  4XUJ D;  3X1V C;  3B0C W;  4LD9 D;  3AZI D;  3WA9 A;  4H9N A;  3EPH A;  4J8X D;  2XD1 A;  4R8P C;  5GT3 B;  5B1L A;  3KUY A;  4JJN B;  3AZJ B;  3AZF B;  3B0C T;  3W96 C;  5AV6 D;  3X1U C;  5AVC B;  5AV5 D;  3REK A;  2FFF B;  4CSR A;  5B0Z B;  3LZ1 B;  1AOI D;  3W99 A;  3AL0 C;  3AZM D;  3AZN A;  3KXB C;  1M19 D;  1KX3 B;  2NQB A;  4Z66 C;  4YM6 B;  2PYO C;  1KX4 D;  5AVB D;  3WTP B;  3IP4 C;  4J8V A;  4UUZ A;  3MVD C;  5CPK C;  3O62 C;  3W98 A;  4WV4 B;  5AV9 C;  3VH5 W;  2G5I C;  5AV8 C;  2FJ7 B;  5GT0 D;  3F6T A;  2BYM A;  5B1L B;  3MGS A;  2CV5 A;  3EPJ A;  1P3L C;  1W2E A;  3NQJ B;  1WWI A;  3VH5 T;  3AV2 B;  2J8P A;  5B33 A;  1P34 B;  5GT3 D;  1P3K D;  3B6F A;  3AZJ D;  4JJN D;  4ZUX B;  5BT1 C;  5BO0 B;  5DNN C;  1P3G A;  5AVC D;  2NQB B;  4M6B A;  3A6N B;  2ARO A;  4H9O B;  3B6G B;  3WAA C;  3EPL A;  3LZ1 D;  1ZLA A;  2F8N B;  2Y2P A;  3AYW B;  3KWQ B;  3AZE B;  3UTA A;  1P3O A;  4YM6 D;  3LJA A;  2YFW B;  3X1T B;  4QLC C;  5F99 B;  5CHL B;  3WTP D;  2CV5 B;  3MGP B;  4E45 A;  2RIQ A;  5B24 B;  1S32 B;  3LEL B;  2JSS A;  5B1M A;  5CPI C;  1H3O A;  3AZH B;  1P3P B;  3MNN B;  3R45 B;  5B1L D;  3KUY D;  4WU9 C;  5B32 B;  5BNX B;  3MGR B;  3C1B A;  4YS3 B;  1P3G B;  3WA9 C;  3REJ B;  1P34 D;  5CPJ A;  4KUD A;  1ZLA B;  4ZUX D;  3W99 D;  2ZY5 A;  1TZY B;  2NQB D;  5GSU C;  3A6N D;  4KGC B;  3WKJ C;  2HUE C;  3REK C;  3B6G D;  2F8N D;  4XZQ C;  3W98 D;  3AYW D;  4G92 B;  4XUJ A;  3AZE D;  2Y2K A;  3W97 B;  4LD9 A;  3AZN C;  4NE5 A;  3X1T D;  4J8X A;  3AZL C;  2CV5 D;  1M18 B;  5B24 D;  4J8V C;  1S32 D;  3LEL D;  3VH5 A;  5B2I B;  4HGA C;  4J8W B;  5AV6 A;  3LZ0 B;  3MNN D;  3B6F D;  1JFI B;  5B32 D;  3MGS C;  3AN2 B;  1P3G D;  3REJ D;  5B31 B;  1AOI A;  5FUG B;  2NZD B;  3AZM A;  5B33 C;  1ZLA D;  1P3M B;  1KX5 A;  5AVB A;  1TZY D;  3UTA D;  2Y2J A;  3REI C;  1P3O D;  3A1I A;  4KGC D;  1U35 B;  4AWL C;  2ARO C;  2Y2L A;  1P3A A;  3A1K A;  5JRG B;  3REH B;  5B2J C;  3LJA C;  1M18 D;  1F66 C;  2BYK B;  5GT3 A;  3AZJ A;  3AZF A;  5B1M C;  4NFT A;  3LZ0 D;  5AVC A;  2IO5 B;  1T3U A;  1P3B B;  3AN2 D;  4H9Q B;  5B0Z A;  3C1B C;  3LZ1 A;  2JE5 A;  2NZD D;  5C3I C;  5CPJ C;  1KX3 A;  4KUD C;  1P3M D;  1P3A B;  3WTP A;  1HQ3 B;  3KXB B;  3TU4 C;  3VH6 W;  4WU8 C;  4Z5T C;  2FJ7 A;  3AZK B;  5JRG D;  5AV9 B;  4XUJ C;  4LD9 C;  3AZI C;  3NQJ A;  3VH6 T;  4J8X C;  3AV1 B;  3AV2 A;  1P3L B;  1PZR A;  1P34 A;  5BNV B;  4ZUX A;  5BO0 A;  1P3F A;  4WJ3 C;  5AV6 C;  5AY8 B;  1B6W A;  2Y2G A;  3H0R C;  3A6N A;  4H9O A;  5AV5 C;  1F1E A;  1P3B D;  1KX5 D;  5DNN B;  3B6G A;  2F8N A;  4X23 B;  3H0M C;  1AOI C;  3AYW A;  3KWQ A;  3AZE A;  1Q9C A;  3AZM C;  2UWX A;  3X1T A;  2YFW A;  1P3A D;  1M19 C;  5F99 A;  1HQ3 D;  1KX4 C;  3V9R B;  5AVB C;  3MGP A;  5B24 A;  1S32 A;  3LEL A;  3AZH A;  3AZK D;  5GXQ B;  1P3P A;  3MNN A;  3R45 A;  4H9R B;  5GT0 C;  5B32 A;  3AZF D;  5BNX A;  3MGR A;  4YS3 A;  1P3F B;  3REJ A; 
#chains in the Genus database with same CATH homology
 4WU9 B;  1BH9 B;  3AV1 D;  5B0Z D;  5GT3 C;  1P3K C;  3KSY A;  4JJN C;  3AZJ C;  1TZY A;  5AY8 D;  1KX3 D;  5AVC C;  4KGC A;  3B0D C;  5GSU B;  4X23 D;  3LZ1 C;  3WKJ B;  1B67 A;  4Z2M G;  3W97 A;  2FJ7 D;  1EQZ B;  5B40 B;  4YM6 C;  4KHA B;  2ZY4 A;  3WTP C;  1M18 A;  3VH6 A;  5B2I A;  3AZL B;  4J8W A;  3AV2 D;  5KDM B;  2RVQ D;  5E5A B;  5GXQ D;  3LZ0 A;  1JFI A;  4UPK A;  3AZG B;  5B1L C;  3KUY C;  3AN2 A;  1P3F D;  5B31 A;  5FUG A;  1M1A B;  3C1C B;  2NZD A;  2G5H C;  2L5A A;  2YFV B;  3AV2 C;  1P34 C;  3REL B;  1P3M A;  4ZUX C;  3W99 C;  1BFM A;  3KWQ D;  1TAF B;  1U35 A;  2NQB C;  5F99 D;  3A6N C;  3MGP D;  3REI B;  3B6G C;  3W98 C;  3AZH D;  5B0Y A;  5JRG A;  3AYW C;  4NE6 A;  3AZE C;  3REH A;  1P3P D;  1EQZ D;  5B40 D;  3X1T C;  3MGR D;  4YS3 D;  2CV5 C;  2BYK A;  3X1S B;  4EO5 B;  5B24 C;  2JCH A;  4NE3 A;  3LEL C;  1S32 C;  2HIO B;  5DNM B;  5E5A D;  3MGQ B;  1F66 B;  4ZBJ C;  3AZG D;  3MNN C;  5CP6 B;  3B6F C;  5B32 C;  2LY8 A;  4H9Q A;  1P3B A;  3UT9 B;  1P3G C;  1BH8 B;  1P3I B;  3REJ C;  1M1A D;  3C1C D;  4CAY B;  2F8N K;  1ID3 B;  4H9S A;  3REL D;  3UTB B;  2ZY3 A;  3NQU B;  1ZLA C;  2F8N G;  4J8U B;  3AFA B;  1HQ3 A;  5B0Y B;  3KXB A;  2Y2M A;  4DRB A;  3W97 D;  1TZY C;  3UTA C;  1P3O C;  4H9P B;  4KGC C;  3X1V B;  1HTA A;  3AZK A;  3TU4 B;  4WU8 B;  2ZM5 A;  5B2I D;  5AV9 A;  2VQR A;  2Y2N A;  4R8P B;  4J8W D;  4G92 C;  4Z5T B;  5B32 G;  3AV1 A;  3X1S D;  1P3L A;  3W96 B;  1M18 C;  3B0B A;  5B31 D;  3X1U B;  3AZI B;  5BNV A;  2HIO D;  5DNM D;  3MGQ D;  5AY8 A;  3LZ0 C;  5CP6 D;  5DNN A;  4G91 C;  3UT9 D;  3AN2 C;  1P3I D;  1U35 D;  4Z66 B;  5JA4 A;  4X23 A;  5AV5 B;  2PYO B;  1ID3 D;  2NZD C;  3UTB D;  3MVD B;  5CPK B;  3O62 B;  4J8U D;  3AFA D;  1P3M C;  5B0Y D;  3V9R A;  5AV8 B;  3REH D;  3X1V D;  1U35 C;  1KX4 B;  5GXQ A;  4H9R A;  4R8P D;  5CPI A;  5G49 B;  2Y2H A;  5JRG C;  4WZS B;  4WU9 A;  2Y2I A;  1BH9 A;  3W96 D;  3X1U D;  5JA4 B;  5B31 G;  4WNN B;  3P5J B;  3WAA B;  2IO5 C;  1P3K B;  2Y2Q A;  1Z2C B;  3KXB D;  1P3B C;  1KX5 C;  5GSU A;  4Z66 D;  2PYO D;  3WKJ A;  3B0D B;  4QLC B;  2BG1 A;  3MVD D;  5CPK D;  4H9S C;  2F2A C;  4E44 A;  4XZQ A;  3O62 D;  1EQZ A;  5B40 A;  5AV9 D;  1P3A C;  4KHA A;  5CPI B;  5AV8 D;  1HQ3 C;  4DQY B;  1N1J B;  3AZL A;  2XD5 A;  5KDM A;  3WTP E;  1P3L D;  5E5A A;  3AZK C;  3WA9 B;  4H9N B;  3AZG A;  3KFU G;  3AZF C;  5BS7 A;  5BT1 D;  1M1A A;  3KUY B;  5DNN D;  3C1C A;  3AV1 C;  2YFV A;  5B0Z C;  3EPK A;  3REL A;  2HUE B;  3REK B;  3WAA D;  1TAF A;  4CSR B;  5AY8 C;  4XZQ B;  4Z2M H;  1KX3 C;  1WWS A;  3W99 B;  2ZY2 A;  3REI A;  3AZN B;  4QLC D;  4X23 C;  4J8V B;  4UUZ B;  2FJ7 C;  1R4V A;  5CPI D;  4HGA B;  3W98 B;  3X1S A;  5B2J A;  4WU9 D;  2HIO A;  2BYM B;  1KU5 A;  5DNM A;  3MGS B;  3MGQ A;  1F66 A;  3WA9 D;  2RVQ C;  5GXQ C;  5CP6 A;  3UT9 A;  4ZBJ B;  1BH8 A;  5B33 B;  1P3F C;  1P3I A;  3B6F B;  4CAY A;  1ID3 A;  5GSU D;  3UTB A;  3NQU A;  3WKJ D;  4J8U A;  3REK D;  4AWL B;  2ARO B;  3AFA A;  3KWQ C;  4XZQ D;  4H9P A;  1ULY A;  3X1V A;  5F99 C;  3AZN D;  3MGP C;  3UTA B;  5B2J B;  3TU4 A;  1P3O B;  4WU8 A;  3LJA B;  3AZL D;  4R8P A;  3AZH C;  4Z5T A;  4J8V D;  3FDD A;  1P3P C;  1EQZ C;  5B40 C;  3EG5 B;  5B1M B;  1H3O B;  2DQN C;  3W96 A;  3MGR C;  3X1U A;  4YS3 C;  3AZI A;  2DF4 C;  3MGS D;  5E5A C;  3C1B B;  3AZG C;  5C3I B;  5B33 D;  5CPJ B;  5BS7 C;  2F8N H;  4KUD B;  4Z66 A;  2PYO A;  5AV5 A;  1M1A C;  4G91 B;  3C1C C;  3REI D;  3MVD A;  5CPK A;  3O62 A;  3REL C;  2ARO D;  5AV8 A;  3W97 C;  2Y2O A;  1M19 A;  1KX4 A;  4XUJ B;  4LD9 B;  5B2J D;  3LJA D;  5G49 A;  5B2I C;  4J8X B;  4J8W C;  1F66 D;  5GT0 A;  5B1M D;  3X1S C;  5AV6 B;  4EO5 C;  5B31 C;  4WNN A;  2HIO C;  5DNM C;  3C1B D;  3MGQ C;  3WAA A;  1P3K A;  5CP6 C;  4JJN A;  1AOI B;  3H0L C;  3UT9 C;  5CPJ D;  4DRA A;  3AZM B;  4KUD D;  1A7W A;  1P3I C;  1M19 B;  4QLC A;  2W8S A;  1KX5 B;  5AVB B;  3TU4 D;  1ID3 C;  3UTB C;  4WU8 D;  4J8U C;  3AFA C;  4Z5T D;  5B0Y C;  3REH C;  1N1J A;  4YM6 A;  5GT0 B;  2CWE A;  4XUJ D;  3X1V C;  3B0C W;  4LD9 D;  3AZI D;  3WA9 A;  4H9N A;  3EPH A;  4J8X D;  2XD1 A;  4R8P C;  5GT3 B;  5B1L A;  3KUY A;  4JJN B;  3AZJ B;  3AZF B;  3B0C T;  3W96 C;  5AV6 D;  3X1U C;  5AVC B;  5AV5 D;  3REK A;  2FFF B;  4CSR A;  5B0Z B;  3LZ1 B;  1AOI D;  3W99 A;  3AL0 C;  3AZM D;  3AZN A;  3KXB C;  1M19 D;  1KX3 B;  2NQB A;  4Z66 C;  4YM6 B;  2PYO C;  1KX4 D;  5AVB D;  3WTP B;  3IP4 C;  4J8V A;  4UUZ A;  3MVD C;  5CPK C;  3O62 C;  3W98 A;  4WV4 B;  5AV9 C;  3VH5 W;  2G5I C;  5AV8 C;  2FJ7 B;  5GT0 D;  3F6T A;  2BYM A;  5B1L B;  3MGS A;  2CV5 A;  3EPJ A;  1P3L C;  1W2E A;  3NQJ B;  1WWI A;  3VH5 T;  3AV2 B;  2J8P A;  5B33 A;  1P34 B;  5GT3 D;  1P3K D;  3B6F A;  3AZJ D;  4JJN D;  4ZUX B;  5BT1 C;  5BO0 B;  5DNN C;  1P3G A;  5AVC D;  2NQB B;  4M6B A;  3A6N B;  2ARO A;  4H9O B;  3B6G B;  3WAA C;  3EPL A;  3LZ1 D;  1ZLA A;  2F8N B;  2Y2P A;  3AYW B;  3KWQ B;  3AZE B;  3UTA A;  1P3O A;  4YM6 D;  3LJA A;  2YFW B;  3X1T B;  4QLC C;  5F99 B;  5CHL B;  3WTP D;  2CV5 B;  3MGP B;  4E45 A;  2RIQ A;  5B24 B;  1S32 B;  3LEL B;  2JSS A;  5B1M A;  5CPI C;  1H3O A;  3AZH B;  1P3P B;  3MNN B;  3R45 B;  5B1L D;  3KUY D;  4WU9 C;  5B32 B;  5BNX B;  3MGR B;  3C1B A;  4YS3 B;  1P3G B;  3WA9 C;  3REJ B;  1P34 D;  5CPJ A;  4KUD A;  1ZLA B;  4ZUX D;  3W99 D;  2ZY5 A;  1TZY B;  2NQB D;  5GSU C;  3A6N D;  4KGC B;  3WKJ C;  2HUE C;  3REK C;  3B6G D;  2F8N D;  4XZQ C;  3W98 D;  3AYW D;  4G92 B;  4XUJ A;  3AZE D;  2Y2K A;  3W97 B;  4LD9 A;  3AZN C;  4NE5 A;  3X1T D;  4J8X A;  3AZL C;  2CV5 D;  1M18 B;  5B24 D;  4J8V C;  1S32 D;  3LEL D;  3VH5 A;  5B2I B;  4HGA C;  4J8W B;  5AV6 A;  3LZ0 B;  3MNN D;  3B6F D;  1JFI B;  5B32 D;  3MGS C;  3AN2 B;  1P3G D;  3REJ D;  5B31 B;  1AOI A;  5FUG B;  2NZD B;  3AZM A;  5B33 C;  1ZLA D;  1P3M B;  1KX5 A;  5AVB A;  1TZY D;  3UTA D;  2Y2J A;  3REI C;  1P3O D;  3A1I A;  4KGC D;  1U35 B;  4AWL C;  2ARO C;  2Y2L A;  1P3A A;  3A1K A;  5JRG B;  3REH B;  5B2J C;  3LJA C;  1M18 D;  1F66 C;  2BYK B;  5GT3 A;  3AZJ A;  3AZF A;  5B1M C;  4NFT A;  3LZ0 D;  5AVC A;  2IO5 B;  1T3U A;  1P3B B;  3AN2 D;  4H9Q B;  5B0Z A;  3C1B C;  3LZ1 A;  2JE5 A;  2NZD D;  5C3I C;  5CPJ C;  1KX3 A;  4KUD C;  1P3M D;  1P3A B;  3WTP A;  1HQ3 B;  3KXB B;  3TU4 C;  3VH6 W;  4WU8 C;  4Z5T C;  2FJ7 A;  3AZK B;  5JRG D;  5AV9 B;  4XUJ C;  4LD9 C;  3AZI C;  3NQJ A;  3VH6 T;  4J8X C;  3AV1 B;  3AV2 A;  1P3L B;  1PZR A;  1P34 A;  5BNV B;  4ZUX A;  5BO0 A;  1P3F A;  4WJ3 C;  5AV6 C;  5AY8 B;  1B6W A;  2Y2G A;  3H0R C;  3A6N A;  4H9O A;  5AV5 C;  1F1E A;  1P3B D;  1KX5 D;  5DNN B;  3B6G A;  2F8N A;  4X23 B;  3H0M C;  1AOI C;  3AYW A;  3KWQ A;  3AZE A;  1Q9C A;  3AZM C;  2UWX A;  3X1T A;  2YFW A;  1P3A D;  1M19 C;  5F99 A;  1HQ3 D;  1KX4 C;  3V9R B;  5AVB C;  3MGP A;  5B24 A;  1S32 A;  3LEL A;  3AZH A;  3AZK D;  5GXQ B;  1P3P A;  3MNN A;  3R45 A;  4H9R B;  5GT0 C;  5B32 A;  3AZF D;  5BNX A;  3MGR A;  4YS3 A;  1P3F B;  3REJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...