5CPIC

Nucleosome containing unmethylated sat2r dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpiC00
2CWEA 4XZQB 3LELB 1TZYC 3LZ0A 1P3OB 3B0DB 3LJAA 3VH6T 4J8XD 1ULYA 5GXQD 3REKD 4Z2MH 4YM6B 4WNNA 5AV5B 5B0ZB 5CPIB 3AV2D 4LD9D 3NQUB 2PYOA 3KUYA 3AN2C 1KX3A 3AZKB 3UT9D 4J8UC 4G92B 5AY8A 3X1UC 3AZFB 1BFMA 3UTBA 5GSUB 1AOIC 1P3AC 1P3LA 5B1LC 3MGSB 4Z5TB 3X1VB 3LZ1C 3AZHA 1S32C 3W97D 5KDMB 3LELD 4KHAB 3B0CW 5AVBC 3C1BD 1ZLAB 3V9RB 5B1MB 5BO0A 3WKJB 5DNMA 4ZUXB 2NQBA 5B40B 3VH5T 4YM6D 1P3IC 5CPID 5B0ZD 2BYMB 3LZ0B 3AZKD 1P3BA 5BNXA 1TZYA 3AZFD 2AROA 2YFVA 3AZJA 5GXQC 5GSUD 3REKC 3KXBD 3MGSD 4R8PA 3AV2C 4LD9C 1HQ3A 2PYOB 4Z5TD 3X1VD 5B31B 5B2IC 1TAFA 5AY8B 5AV9C 4NE6A 3UTBB 3AZNA 4J8UA 3W99A 1P34B 3C1CB 3WKJD 5B1MD 2NZDD 2CV5A 4ZUXD 1KX4B 1AOIA 2YFWA 5AV8B 5B40D 2F8NG 3AZLA 5C3IC 3MGPC 1F66D 3W97C 4H9PA 4KUDC 2RVQC 1WWIA 3LELC 3REHA 5CPKB 1KX5B 3REIA 3W98D 1S32A 3WAAB 5F99B 3C1BC 4HGAB 1N1JB 3MNNB 5AVBA 4YM6C 3MGRA 3AZGB 5CPIC 4E45A 5B0ZC 3AZEB 3X1SA 4CSRB 1P3IA 5G49A 5B31D 4J8VB 5BNXB 3AZFC 1P3FA 2AROB 4X23D 4UUZA 2F8NH 1P34D 3KXBC 3MGSC 3RELC 3C1CD 3O62B 3MVDA 1H3OA 4R8PB 4WU8D 1HQ3B 4JJNA 5AV8D 1KX4D 4Z5TC 4WV4B 3TU4B 3WTPA 1TAFB 5CPKD 1KX5D 5JRGD 3B6FA 3A6NB 1U35A 5B2IA 3WAAD 5F99D 5BS7A 5AV9A 2F8NK 5CPJB 3WKJC 5B1MC 2NZDC 1ID3B 2YFWB 3MNND 3AZGD 3AZED 1F66C 5GT3A 3AZID 3W98C 3REHB 5CP6A 3MGPA 1BH8B 2HUEB 4J8VD 2JSSA 4XUJD 5B33B 4KUDA 5E5AB 3REJC 4H9QA 3C1BA 3AZMA 3AYWA 3O62D 5B2JC 5GT0D 4J8WA 1P3MB 1B67A 3AV1C 1P3KA 4Z66C 1M19B 5B31C 5B32B 3R45B 1P3PC 3B0BA 3MGQD 3NQJA 5B24A 4H9OA 4WU9A 4X23C 3A6ND 1Q9CA 1P34C 4YS3A 5CPJD 3MVDB 4WU8C 1ID3D 4JJNB 3KXBA 3RELA 2FJ7B 3WA9B 4E44A 1P3GB 3WTPB 1KX5C 5JRGC 1M1AC 4M6BA 3W96A 3WAAC 5B33D 5F99C 1U35B 5E5AD 5AVCA 5B0YD 4HGAC 4KGCB 3X1TC 1EQZB 3B6GA 1P3MD 4QLCB 3AZIC 1M19D 5CP6B 5B32D 5CHLB 4XUJC 5AV6A 4G91C 4H9RB 1M18D 3REJA 3VH6W 2HIOB 5GT0C 4XZQD 1P3OD 3AFAB 2FJ7D 5B2JA 5DNNB 4AWLB 3WA9D 4H9NB 3AV1A 4CAYA 4Z66A 3MGQC 1P3GD 5B24B 3KWQA 3UTAA 4NE3A 4WU9B 3A6NC 1P3PA 5AV5D 4YS3B 5CPJC 4H9SC 4KGCD 1ID3C 2F8NA 1EQZD 3LJAB 4J8XC 4QLCD 3KSYA 2HUEC 5B33C 5E5AC 4WNNB 5B0YC 5AVCB 1M1AA 1JFIA 3KUYB 1KX3B 3UT9C 2HIOD 3B6GB 1P3MC 5B31G 3AN2A 1M19C 3AFAD 3X1TA 3VH5W 5B32C 1P3LB 5DNND 3X1UA 5AV6B 3AZIA 1ZLAD 4WZSB 1P3AA 5B1LA 2IO5C 4XUJA 1M18C 4EO5B 3AZHB 4XZQC 3LZ1A 1P3OC 3LZ0D 2FJ7C 3B0DC 3WA9C 3LJAD 5BNVA 5BO0B 5DNMB 1R4VA 2NQBB 3UTAB 5AV5C 3MGQA 4KGCC 2PYOD 5FUGA 3KUYD 3AZKC 1KX3D 1WWSA 1P3BB 4H9SA 4G92C 5AY8D 4QLCC 1TZYB 2YFVB 3UTBD 5GSUC 3AZJB 1P3LD 4J8XA 5GXQA 3REKA 1JFIB 3X1VC 5B0YA 3AV2A 4LD9A 3AZHD 3AFAC 3UT9A 3AZNB 4J8UB 3W99B 4AWLC 1ZLAC 4ZUXC 5DNMD 2CV5B 1AOIB 5B40C 2NQBD 3AZLB 4H9PB 3WTPE 1M18A 3LZ0C 3LZ1B 3REIB 1S32B 3W97A 1A7WA 1P3BD 3LELA 1TZYD 2AROD 3AZJD 5AVBB 3MGRB 4R8PD 1HQ3D 3X1SB 4YM6A 2PYOC 1P3IB 5G49B 5AV5A 5CPIA 5B0ZA 1KX3C 3TU4D 3NQUA 5AY8C 5B32G 1P3FB 3AZKA 3UTBC 3AZND 3W99D 4UUZB 3AZFA 4NE5A 3C1CC 5GSUA 1KX4C 1H3OB 2CV5D 5AV8C 1AOID 3MGSA 3AZLD 3AZHC 4Z5TA 3X1VA 5CPKC 3REHD 3REID 3B6FB 1S32D 5B2IB 5KDMA 1HTAA 5AV9B 4KHAA 5DNMC 2NQBC 3MNNC 4ZBJC 3AZGC 3MGRD 3WKJA 5B1MA 2NZDA 3AZEC 4ZUXA 4DRAA 5B40A 5GT3B 3X1SD 1P3ID 5C3IB 3MGPB 1F66A 4J8VC 1P3BC 3W97B 4KUDB 2BYMA 3W98A 1P3FD 2AROC 4H9QB 3AZJC 3C1BB 3O62C 3AZMB 3AYWB 4R8PC 3MVDD 4J8WB 1HQ3C 4JJND 1P3KB 3B0CT 3TU4C 5BT1D 3WTPD 5B31A 3NQJB 4H9OB 3B6FD 3AZNC 3W99C 1U35D 5B2ID 5AV9D 4X23A 2CV5C 1P34A 3KXBB 3AZLC 3C1CA 3RELB 1KX4A 4WU8A 5AV8A 5GT3D 3REHC 3REIC 5CP6D 3MGPD 3W96B 4KUDD 5CPKA 2RVQD 5JRGA 1KX5A 3WAAA 5F99A 3MGRC 2NZDB 3AZMD 3AYWD 1N1JA 4J8WD 3MNNA 2LY8A 3X1SC 1P3KD 3AZGA 3AZEA 1F66B 1KU5A 4CSRA 3W98B 1P3FC 5B24D 4J8VA 4WU9D 3REJB 4YS3D 3VH6A 3MVDC 4JJNC 3RELD 3O62A 5GT0A 5B2JB 1B6WA 5BT1C 3AV1B 1P3GC 4CAYB 4Z66B 3WTPC 3KWQB 3TU4A 3B6FC 1U35C 3W96D 1P3PB 1BH9A 5BS7C 5AVCD 4ZBJB 4X23B 3A6NA 5CPJA 2F8NB 1EQZC 1ID3A 3B6GD 4WU8B 5GT3C 5CP6C 5AV6D 5JRGB 1M1AB 1BH8A 5B33A 5E5AA 3REJD 2HIOC 3AZMC 3AYWC 4J8WC 3AN2B 1P3KC 3X1TB 3VH5A 1P3MA 5DNNC 5B2JD 3X1UB 3AV1D 3AZIB 1M19A 4Z66D 5B32A 5B24C 1P3AB 3KWQD 3UTAD 4WU9C 5B1LB 4XUJB 2BYKA 3R45A 1P3PD 5JA4A 4G91B 4YS3C 1F1EA 2F8ND 4XZQA 5GT0B 3LJAC 1P3OA 5BNVB 2FJ7A 3WA9A 3W96C 1P3GA 5AVCC 1BH9B 3MGQB 1M1AD 3KUYC 5FUGB 4KGCA 3B6GC 3AN2D 3X1TD 1EQZA 4J8UD 2L5AA 1P3LC 4QLCA 5AV6C 3X1UD 4J8XB 5GXQB 3REKB 1P3AD 5B1LD 4EO5C 5B0YB 4H9RA 3AV2B 4LD9B 4NFTA 4Z2MG 3LZ1D 3UT9B 2HIOA 3AFAA 3KWQC 3UTAC 5DNNA 5AVBD 4H9NA 1ZLAA 2BYKB 3V9RA 5JA4B 4DRBA 2IO5B 1M18B
chains in the Genus database with same CATH superfamily
2CWEA 4XZQB 3LELB 1TZYC 3LZ0A 1P3OB 2BG1A 3B0DB 3LJAA 3VH6T 4J8XD 1ULYA 2DQNC 5GXQD 3REKD 4Z2MH 4YM6B 3A1KA 4WNNA 5AV5B 5B0ZB 5CPIB 2Y2OA 3AV2D 4LD9D 3NQUB 2PYOA 3KUYA 3AN2C 2XD1A 1KX3A 3AZKB 3UT9D 4J8UC 4G92B 5AY8A 3X1UC 3AZFB 1BFMA 3UTBA 5GSUB 1AOIC 1P3AC 1P3LA 5B1LC 3MGSB 4Z5TB 3X1VB 3LZ1C 3AZHA 1S32C 3W97D 5KDMB 3LELD 4KHAB 3B0CW 5AVBC 3C1BD 1ZLAB 3V9RB 5B1MB 5BO0A 3WKJB 5DNMA 4ZUXB 2NQBA 5B40B 3VH5T 3EPHA 4YM6D 1P3IC 5CPID 5B0ZD 2BYMB 3LZ0B 3AZKD 1P3BA 5BNXA 1TZYA 3AZFD 2AROA 2YFVA 3AZJA 5GXQC 5GSUD 3REKC 3KXBD 3MGSD 4R8PA 3AV2C 4LD9C 1HQ3A 2PYOB 4Z5TD 3X1VD 5B31B 5B2IC 1TAFA 5AY8B 5AV9C 4NE6A 3UTBB 3AZNA 4J8UA 3W99A 1P34B 3C1CB 3WKJD 5B1MD 2FFFB 2NZDD 2CV5A 4ZUXD 1KX4B 1AOIA 2YFWA 5AV8B 5B40D 2F8NG 3AZLA 5C3IC 3MGPC 1F66D 3W97C 2W8SA 2J8PA 4H9PA 4KUDC 2RVQC 1WWIA 3LELC 3REHA 5CPKB 1KX5B 3REIA 3W98D 1S32A 3WAAB 5F99B 3C1BC 4HGAB 1N1JB 3MNNB 5AVBA 4YM6C 3MGRA 3AZGB 5CPIC 4E45A 5B0ZC 3AZEB 3P5JB 3X1SA 4CSRB 3FDDA 1P3IA 5G49A 5B31D 4J8VB 5BNXB 3AZFC 1P3FA 2AROB 4X23D 4UUZA 2F8NH 1P34D 3KXBC 3MGSC 3RELC 3C1CD 3O62B 3MVDA 1H3OA 4R8PB 4WU8D 1HQ3B 4JJNA 5AV8D 1KX4D 4Z5TC 4WV4B 3TU4B 3WTPA 1TAFB 4WJ3C 5CPKD 1KX5D 5JRGD 3B6FA 3A6NB 1U35A 5B2IA 3WAAD 5F99D 5BS7A 5AV9A 2F8NK 5CPJB 3WKJC 5B1MC 2NZDC 1ID3B 2YFWB 3MNND 3AZGD 3AZED 1F66C 5GT3A 3AZID 3W98C 3REHB 5CP6A 3MGPA 1BH8B 2HUEB 4J8VD 2JSSA 4XUJD 5B33B 4KUDA 5E5AB 3REJC 4H9QA 3C1BA 3AZMA 3AYWA 3O62D 5B2JC 5GT0D 4J8WA 1P3MB 1B67A 3AV1C 1P3KA 4Z66C 1M19B 5B31C 5B32B 3R45B 1P3PC 3B0BA 3MGQD 3NQJA 5B24A 4H9OA 4WU9A 4X23C 3A6ND 1Q9CA 1P34C 4YS3A 5CPJD 3MVDB 4WU8C 1ID3D 4JJNB 3KXBA 2ZY2A 3RELA 2FJ7B 2Y2MA 3IP4C 3WA9B 4E44A 1P3GB 3WTPB 1KX5C 5JRGC 1M1AC 4M6BA 3W96A 3WAAC 5B33D 5F99C 1U35B 5E5AD 3H0MC 5B0YD 5AVCA 4HGAC 4KGCB 3X1TC 3H0RC 1EQZB 3B6GA 2XD5A 1P3MD 4QLCB 3AZIC 1M19D 5CP6B 2JE5A 5B32D 5CHLB 4XUJC 5AV6A 2ZM5A 4G91C 4H9RB 1M18D 3EPLA 3REJA 3VH6W 2HIOB 5GT0C 4XZQD 1P3OD 3AFAB 2FJ7D 2Y2GA 5B2JA 5DNNB 4AWLB 3WA9D 4H9NB 3AV1A 4CAYA 4Z66A 3MGQC 1P3GD 5B24B 3KWQA 3UTAA 4NE3A 4WU9B 3A6NC 1P3PA 5AV5D 4YS3B 5CPJC 4H9SC 4KGCD 2Y2JA 1ID3C 2F8NA 1EQZD 3LJAB 4J8XC 4QLCD 2Y2PA 3KSYA 2HUEC 5B33C 5E5AC 4WNNB 5B0YC 5AVCB 1M1AA 1JFIA 3KUYB 1KX3B 3UT9C 2HIOD 3B6GB 1P3MC 5B31G 3AN2A 1M19C 3AFAD 3X1TA 3VH5W 5B32C 1P3LB 5DNND 3X1UA 5AV6B 3AZIA 1ZLAD 4WZSB 1P3AA 5B1LA 2IO5C 4XUJA 1M18C 4EO5B 3AZHB 4XZQC 3LZ1A 1P3OC 3LZ0D 2FJ7C 3B0DC 3WA9C 3LJAD 5BNVA 5BO0B 5DNMB 1R4VA 2NQBB 3UTAB 5AV5C 3MGQA 4KGCC 2PYOD 5FUGA 3KUYD 3AZKC 1KX3D 1WWSA 1P3BB 4H9SA 4G92C 5AY8D 4QLCC 1TZYB 2YFVB 3UTBD 5GSUC 3AZJB 1P3LD 4J8XA 5GXQA 3REKA 1JFIB 3A1IA 3X1VC 5B0YA 3AV2A 4LD9A 3AZHD 2Y2LA 3AL0C 2JCHA 3AFAC 3UT9A 3AZNB 4J8UB 3W99B 4AWLC 1ZLAC 4ZUXC 2Y2HA 5DNMD 2CV5B 5B40C 1AOIB 2NQBD 1T3UA 3AZLB 4H9PB 3WTPE 1M18A 3LZ0C 3LZ1B 3REIB 1S32B 3W97A 1A7WA 1P3BD 3LELA 1TZYD 2Y2IA 2AROD 3AZJD 5AVBB 3MGRB 4R8PD 1HQ3D 3X1SB 4YM6A 2PYOC 1P3IB 5G49B 5AV5A 5CPIA 5B0ZA 1KX3C 3TU4D 2ZY3A 3NQUA 5AY8C 2VQRA 5B32G 1P3FB 3AZKA 3UTBC 3AZND 3W99D 4UUZB 3AZFA 4NE5A 3C1CC 5GSUA 1KX4C 1H3OB 2CV5D 5AV8C 1AOID 4UPKA 3MGSA 3AZLD 3AZHC 4Z5TA 3X1VA 5CPKC 3REHD 3REID 2F2AC 3B6FB 1S32D 5B2IB 5KDMA 1HTAA 5AV9B 2Y2QA 4KHAA 5DNMC 3H0LC 2NQBC 3MNNC 4ZBJC 3AZGC 3MGRD 3WKJA 5B1MA 2NZDA 3AZEC 4ZUXA 4DRAA 5B40A 5GT3B 3X1SD 3EPKA 2UWXA 1P3ID 5C3IB 2G5HC 3MGPB 1F66A 4J8VC 1P3BC 3W97B 4KUDB 2BYMA 3W98A 1P3FD 2AROC 4H9QB 3AZJC 2DF4C 3C1BB 3O62C 3AZMB 3AYWB 4R8PC 3MVDD 4J8WB 1HQ3C 4JJND 1P3KB 3B0CT 3TU4C 5BT1D 3WTPD 5B31A 2Y2KA 3NQJB 4H9OB 3B6FD 3AZNC 3W99C 1U35D 5B2ID 5AV9D 4X23A 2CV5C 1Z2CB 1P34A 3KXBB 3AZLC 3C1CA 3RELB 3EG5B 4WU8A 1KX4A 5AV8A 5GT3D 3REHC 3REIC 5CP6D 3MGPD 3W96B 4KUDD 5CPKA 2RVQD 5JRGA 1KX5A 3WAAA 5F99A 3MGRC 2NZDB 2Y2NA 3AZMD 3AYWD 1N1JA 4J8WD 3MNNA 3EPJA 2LY8A 3X1SC 1P3KD 3AZGA 3AZEA 1F66B 1KU5A 4CSRA 3W98B 1P3FC 5B24D 4J8VA 4WU9D 1W2EA 3REJB 4DQYB 2G5IC 4YS3D 3VH6A 3MVDC 4JJNC 3RELD 3O62A 5GT0A 5B2JB 1B6WA 5BT1C 3AV1B 1P3GC 2ZY4A 4CAYB 4Z66B 3WTPC 3KFUG 3KWQB 3TU4A 3B6FC 1U35C 3W96D 1P3PB 1BH9A 5BS7C 5AVCD 4ZBJB 4X23B 3A6NA 5CPJA 2F8NB 1EQZC 1ID3A 3B6GD 4WU8B 5GT3C 5CP6C 5AV6D 5JRGB 1M1AB 1BH8A 5B33A 5E5AA 3REJD 2HIOC 3AZMC 3AYWC 4J8WC 3AN2B 1P3KC 3F6TA 3X1TB 3VH5A 1P3MA 5DNNC 5B2JD 3X1UB 3AV1D 3AZIB 1M19A 4Z66D 5B32A 5B24C 1P3AB 3KWQD 3UTAD 4WU9C 5B1LB 4XUJB 2BYKA 3R45A 1P3PD 5JA4A 4G91B 4YS3C 1F1EA 2F8ND 4XZQA 5GT0B 3LJAC 1P3OA 5BNVB 2FJ7A 3WA9A 3W96C 1P3GA 5AVCC 1BH9B 3MGQB 1M1AD 1PZRA 3KUYC 5FUGB 4KGCA 3B6GC 3AN2D 3X1TD 1EQZA 4J8UD 2L5AA 1P3LC 4QLCA 2ZY5A 5AV6C 3X1UD 4J8XB 5GXQB 3REKB 1P3AD 5B1LD 4EO5C 5B0YB 4H9RA 3AV2B 4LD9B 4NFTA 4Z2MG 3LZ1D 3UT9B 2HIOA 3AFAA 3KWQC 3UTAC 5DNNA 5AVBD 4H9NA 2RIQA 1ZLAA 2BYKB 3V9RA 5JA4B 4DRBA 2IO5B 1M18B
chains in the Genus database with same CATH topology
2CWEA 4XZQB 3LELB 1TZYC 3LZ0A 1P3OB 2BG1A 3B0DB 3LJAA 3VH6T 4J8XD 1ULYA 2DQNC 5GXQD 3REKD 4Z2MH 4YM6B 3A1KA 4WNNA 5AV5B 5B0ZB 5CPIB 2Y2OA 3AV2D 4LD9D 3NQUB 2PYOA 3KUYA 3AN2C 2XD1A 1KX3A 3AZKB 3UT9D 4J8UC 4G92B 5AY8A 3X1UC 3AZFB 1BFMA 3UTBA 5GSUB 1AOIC 1P3AC 1P3LA 5B1LC 3MGSB 4Z5TB 3X1VB 3LZ1C 3AZHA 1S32C 3W97D 5KDMB 3LELD 4KHAB 3B0CW 5AVBC 3C1BD 1ZLAB 3V9RB 5B1MB 5BO0A 3WKJB 5DNMA 4ZUXB 2NQBA 5B40B 3VH5T 3EPHA 4YM6D 1P3IC 5CPID 5B0ZD 2BYMB 3LZ0B 3AZKD 1P3BA 5BNXA 1TZYA 3AZFD 2AROA 2YFVA 3AZJA 5GXQC 5GSUD 3REKC 3KXBD 3MGSD 4R8PA 3AV2C 4LD9C 1HQ3A 2PYOB 4Z5TD 3X1VD 5B31B 5B2IC 1TAFA 5AY8B 5AV9C 4NE6A 3UTBB 3AZNA 4J8UA 3W99A 1P34B 3C1CB 3WKJD 5B1MD 2FFFB 2NZDD 2CV5A 4ZUXD 1KX4B 1AOIA 2YFWA 5AV8B 5B40D 2F8NG 3AZLA 5C3IC 3MGPC 1F66D 3W97C 2W8SA 2J8PA 4H9PA 4KUDC 2RVQC 1WWIA 3LELC 3REHA 5CPKB 1KX5B 3REIA 3W98D 1S32A 3WAAB 5F99B 3C1BC 4HGAB 1N1JB 3MNNB 5AVBA 4YM6C 3MGRA 3AZGB 5CPIC 4E45A 5B0ZC 3AZEB 3P5JB 3X1SA 4CSRB 3FDDA 1P3IA 5G49A 5B31D 4J8VB 5BNXB 3AZFC 1P3FA 2AROB 4X23D 4UUZA 2F8NH 1P34D 3KXBC 3MGSC 3RELC 3C1CD 3O62B 3MVDA 1H3OA 4R8PB 4WU8D 1HQ3B 4JJNA 5AV8D 1KX4D 4Z5TC 4WV4B 3TU4B 3WTPA 1TAFB 4WJ3C 5CPKD 1KX5D 5JRGD 3B6FA 3A6NB 1U35A 5B2IA 3WAAD 5F99D 5BS7A 5AV9A 2F8NK 5CPJB 3WKJC 5B1MC 2NZDC 1ID3B 2YFWB 3MNND 3AZGD 3AZED 1F66C 5GT3A 3AZID 3W98C 3REHB 5CP6A 3MGPA 1BH8B 2HUEB 4J8VD 2JSSA 4XUJD 5B33B 4KUDA 5E5AB 3REJC 4H9QA 3C1BA 3AZMA 3AYWA 3O62D 5B2JC 5GT0D 4J8WA 1P3MB 1B67A 3AV1C 1P3KA 4Z66C 1M19B 5B31C 5B32B 3R45B 1P3PC 3B0BA 3MGQD 3NQJA 5B24A 4H9OA 4WU9A 4X23C 3A6ND 1Q9CA 1P34C 4YS3A 5CPJD 3MVDB 4WU8C 1ID3D 4JJNB 3KXBA 2ZY2A 3RELA 2FJ7B 2Y2MA 3IP4C 3WA9B 4E44A 1P3GB 3WTPB 1KX5C 5JRGC 1M1AC 4M6BA 3W96A 3WAAC 5B33D 5F99C 1U35B 5E5AD 3H0MC 5B0YD 5AVCA 4HGAC 4KGCB 3X1TC 3H0RC 1EQZB 3B6GA 2XD5A 1P3MD 4QLCB 3AZIC 1M19D 5CP6B 2JE5A 5B32D 5CHLB 4XUJC 5AV6A 2ZM5A 4G91C 4H9RB 1M18D 3EPLA 3REJA 3VH6W 2HIOB 5GT0C 4XZQD 1P3OD 3AFAB 2FJ7D 2Y2GA 5B2JA 5DNNB 4AWLB 3WA9D 4H9NB 3AV1A 4CAYA 4Z66A 3MGQC 1P3GD 5B24B 3KWQA 3UTAA 4NE3A 4WU9B 3A6NC 1P3PA 5AV5D 4YS3B 5CPJC 4H9SC 4KGCD 2Y2JA 1ID3C 2F8NA 1EQZD 3LJAB 4J8XC 4QLCD 2Y2PA 3KSYA 2HUEC 5B33C 5E5AC 4WNNB 5B0YC 5AVCB 1M1AA 1JFIA 3KUYB 1KX3B 3UT9C 2HIOD 3B6GB 1P3MC 5B31G 3AN2A 1M19C 3AFAD 3X1TA 3VH5W 5B32C 1P3LB 5DNND 3X1UA 5AV6B 3AZIA 1ZLAD 4WZSB 1P3AA 5B1LA 2IO5C 4XUJA 1M18C 4EO5B 3AZHB 4XZQC 3LZ1A 1P3OC 3LZ0D 2FJ7C 3B0DC 3WA9C 3LJAD 5BNVA 5BO0B 5DNMB 1R4VA 2NQBB 3UTAB 5AV5C 3MGQA 4KGCC 2PYOD 5FUGA 3KUYD 3AZKC 1KX3D 1WWSA 1P3BB 4H9SA 4G92C 5AY8D 4QLCC 1TZYB 2YFVB 3UTBD 5GSUC 3AZJB 1P3LD 4J8XA 5GXQA 3REKA 1JFIB 3A1IA 3X1VC 5B0YA 3AV2A 4LD9A 3AZHD 2Y2LA 3AL0C 2JCHA 3AFAC 3UT9A 3AZNB 4J8UB 3W99B 4AWLC 1ZLAC 4ZUXC 2Y2HA 5DNMD 2CV5B 5B40C 1AOIB 2NQBD 1T3UA 3AZLB 4H9PB 3WTPE 1M18A 3LZ0C 3LZ1B 3REIB 1S32B 3W97A 1A7WA 1P3BD 3LELA 1TZYD 2Y2IA 2AROD 3AZJD 5AVBB 3MGRB 4R8PD 1HQ3D 3X1SB 4YM6A 2PYOC 1P3IB 5G49B 5AV5A 5CPIA 5B0ZA 1KX3C 3TU4D 2ZY3A 3NQUA 5AY8C 2VQRA 5B32G 1P3FB 3AZKA 3UTBC 3AZND 3W99D 4UUZB 3AZFA 4NE5A 3C1CC 5GSUA 1KX4C 1H3OB 2CV5D 5AV8C 1AOID 4UPKA 3MGSA 3AZLD 3AZHC 4Z5TA 3X1VA 5CPKC 3REHD 3REID 2F2AC 3B6FB 1S32D 5B2IB 5KDMA 1HTAA 5AV9B 2Y2QA 4KHAA 5DNMC 3H0LC 2NQBC 3MNNC 4ZBJC 3AZGC 3MGRD 3WKJA 5B1MA 2NZDA 3AZEC 4ZUXA 4DRAA 5B40A 5GT3B 3X1SD 3EPKA 2UWXA 1P3ID 5C3IB 2G5HC 3MGPB 1F66A 4J8VC 1P3BC 3W97B 4KUDB 2BYMA 3W98A 1P3FD 2AROC 4H9QB 3AZJC 2DF4C 3C1BB 3O62C 3AZMB 3AYWB 4R8PC 3MVDD 4J8WB 1HQ3C 4JJND 1P3KB 3B0CT 3TU4C 5BT1D 3WTPD 5B31A 2Y2KA 3NQJB 4H9OB 3B6FD 3AZNC 3W99C 1U35D 5B2ID 5AV9D 4X23A 2CV5C 1Z2CB 1P34A 3KXBB 3AZLC 3C1CA 3RELB 3EG5B 4WU8A 1KX4A 5AV8A 5GT3D 3REHC 3REIC 5CP6D 3MGPD 3W96B 4KUDD 5CPKA 2RVQD 5JRGA 1KX5A 3WAAA 5F99A 3MGRC 2NZDB 2Y2NA 3AZMD 3AYWD 1N1JA 4J8WD 3MNNA 3EPJA 2LY8A 3X1SC 1P3KD 3AZGA 3AZEA 1F66B 1KU5A 4CSRA 3W98B 1P3FC 5B24D 4J8VA 4WU9D 1W2EA 3REJB 4DQYB 2G5IC 4YS3D 3VH6A 3MVDC 4JJNC 3RELD 3O62A 5GT0A 5B2JB 1B6WA 5BT1C 3AV1B 1P3GC 2ZY4A 4CAYB 4Z66B 3WTPC 3KFUG 3KWQB 3TU4A 3B6FC 1U35C 3W96D 1P3PB 1BH9A 5BS7C 5AVCD 4ZBJB 4X23B 3A6NA 5CPJA 2F8NB 1EQZC 1ID3A 3B6GD 4WU8B 5GT3C 5CP6C 5AV6D 5JRGB 1M1AB 1BH8A 5B33A 5E5AA 3REJD 2HIOC 3AZMC 3AYWC 4J8WC 3AN2B 1P3KC 3F6TA 3X1TB 3VH5A 1P3MA 5DNNC 5B2JD 3X1UB 3AV1D 3AZIB 1M19A 4Z66D 5B32A 5B24C 1P3AB 3KWQD 3UTAD 4WU9C 5B1LB 4XUJB 2BYKA 3R45A 1P3PD 5JA4A 4G91B 4YS3C 1F1EA 2F8ND 4XZQA 5GT0B 3LJAC 1P3OA 5BNVB 2FJ7A 3WA9A 3W96C 1P3GA 5AVCC 1BH9B 3MGQB 1M1AD 1PZRA 3KUYC 5FUGB 4KGCA 3B6GC 3AN2D 3X1TD 1EQZA 4J8UD 2L5AA 1P3LC 4QLCA 2ZY5A 5AV6C 3X1UD 4J8XB 5GXQB 3REKB 1P3AD 5B1LD 4EO5C 5B0YB 4H9RA 3AV2B 4LD9B 4NFTA 4Z2MG 3LZ1D 3UT9B 2HIOA 3AFAA 3KWQC 3UTAC 5DNNA 5AVBD 4H9NA 2RIQA 1ZLAA 2BYKB 3V9RA 5JA4B 4DRBA 2IO5B 1M18B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWE A;  4XZQ B;  3LEL B;  1TZY C;  3LZ0 A;  1P3O B;  3B0D B;  3LJA A;  3VH6 T;  4J8X D;  1ULY A;  5GXQ D;  3REK D;  4Z2M H;  4YM6 B;  4WNN A;  5AV5 B;  5B0Z B;  5CPI B;  3AV2 D;  4LD9 D;  3NQU B;  2PYO A;  3KUY A;  3AN2 C;  1KX3 A;  3AZK B;  3UT9 D;  4J8U C;  4G92 B;  5AY8 A;  3X1U C;  3AZF B;  1BFM A;  3UTB A;  5GSU B;  1AOI C;  1P3A C;  1P3L A;  5B1L C;  3MGS B;  4Z5T B;  3X1V B;  3LZ1 C;  3AZH A;  1S32 C;  3W97 D;  5KDM B;  3LEL D;  4KHA B;  3B0C W;  5AVB C;  3C1B D;  1ZLA B;  3V9R B;  5B1M B;  5BO0 A;  3WKJ B;  5DNM A;  4ZUX B;  2NQB A;  5B40 B;  3VH5 T;  4YM6 D;  1P3I C;  5CPI D;  5B0Z D;  2BYM B;  3LZ0 B;  3AZK D;  1P3B A;  5BNX A;  1TZY A;  3AZF D;  2ARO A;  2YFV A;  3AZJ A;  5GXQ C;  5GSU D;  3REK C;  3KXB D;  3MGS D;  4R8P A;  3AV2 C;  4LD9 C;  1HQ3 A;  2PYO B;  4Z5T D;  3X1V D;  5B31 B;  5B2I C;  1TAF A;  5AY8 B;  5AV9 C;  4NE6 A;  3UTB B;  3AZN A;  4J8U A;  3W99 A;  1P34 B;  3C1C B;  3WKJ D;  5B1M D;  2NZD D;  2CV5 A;  4ZUX D;  1KX4 B;  1AOI A;  2YFW A;  5AV8 B;  5B40 D;  2F8N G;  3AZL A;  5C3I C;  3MGP C;  1F66 D;  3W97 C;  4H9P A;  4KUD C;  2RVQ C;  1WWI A;  3LEL C;  3REH A;  5CPK B;  1KX5 B;  3REI A;  3W98 D;  1S32 A;  3WAA B;  5F99 B;  3C1B C;  4HGA B;  1N1J B;  3MNN B;  5AVB A;  4YM6 C;  3MGR A;  3AZG B;  5CPI C;  4E45 A;  5B0Z C;  3AZE B;  3X1S A;  4CSR B;  1P3I A;  5G49 A;  5B31 D;  4J8V B;  5BNX B;  3AZF C;  1P3F A;  2ARO B;  4X23 D;  4UUZ A;  2F8N H;  1P34 D;  3KXB C;  3MGS C;  3REL C;  3C1C D;  3O62 B;  3MVD A;  1H3O A;  4R8P B;  4WU8 D;  1HQ3 B;  4JJN A;  5AV8 D;  1KX4 D;  4Z5T C;  4WV4 B;  3TU4 B;  3WTP A;  1TAF B;  5CPK D;  1KX5 D;  5JRG D;  3B6F A;  3A6N B;  1U35 A;  5B2I A;  3WAA D;  5F99 D;  5BS7 A;  5AV9 A;  2F8N K;  5CPJ B;  3WKJ C;  5B1M C;  2NZD C;  1ID3 B;  2YFW B;  3MNN D;  3AZG D;  3AZE D;  1F66 C;  5GT3 A;  3AZI D;  3W98 C;  3REH B;  5CP6 A;  3MGP A;  1BH8 B;  2HUE B;  4J8V D;  2JSS A;  4XUJ D;  5B33 B;  4KUD A;  5E5A B;  3REJ C;  4H9Q A;  3C1B A;  3AZM A;  3AYW A;  3O62 D;  5B2J C;  5GT0 D;  4J8W A;  1P3M B;  1B67 A;  3AV1 C;  1P3K A;  4Z66 C;  1M19 B;  5B31 C;  5B32 B;  3R45 B;  1P3P C;  3B0B A;  3MGQ D;  3NQJ A;  5B24 A;  4H9O A;  4WU9 A;  4X23 C;  3A6N D;  1Q9C A;  1P34 C;  4YS3 A;  5CPJ D;  3MVD B;  4WU8 C;  1ID3 D;  4JJN B;  3KXB A;  3REL A;  2FJ7 B;  3WA9 B;  4E44 A;  1P3G B;  3WTP B;  1KX5 C;  5JRG C;  1M1A C;  4M6B A;  3W96 A;  3WAA C;  5B33 D;  5F99 C;  1U35 B;  5E5A D;  5AVC A;  5B0Y D;  4HGA C;  4KGC B;  3X1T C;  1EQZ B;  3B6G A;  1P3M D;  4QLC B;  3AZI C;  1M19 D;  5CP6 B;  5B32 D;  5CHL B;  4XUJ C;  5AV6 A;  4G91 C;  4H9R B;  1M18 D;  3REJ A;  3VH6 W;  2HIO B;  5GT0 C;  4XZQ D;  1P3O D;  3AFA B;  2FJ7 D;  5B2J A;  5DNN B;  4AWL B;  3WA9 D;  4H9N B;  3AV1 A;  4CAY A;  4Z66 A;  3MGQ C;  1P3G D;  5B24 B;  3KWQ A;  3UTA A;  4NE3 A;  4WU9 B;  3A6N C;  1P3P A;  5AV5 D;  4YS3 B;  5CPJ C;  4H9S C;  4KGC D;  1ID3 C;  2F8N A;  1EQZ D;  3LJA B;  4J8X C;  4QLC D;  3KSY A;  2HUE C;  5B33 C;  5E5A C;  4WNN B;  5B0Y C;  5AVC B;  1M1A A;  1JFI A;  3KUY B;  1KX3 B;  3UT9 C;  2HIO D;  3B6G B;  1P3M C;  5B31 G;  3AN2 A;  1M19 C;  3AFA D;  3X1T A;  3VH5 W;  5B32 C;  1P3L B;  5DNN D;  3X1U A;  5AV6 B;  3AZI A;  1ZLA D;  4WZS B;  1P3A A;  5B1L A;  2IO5 C;  4XUJ A;  1M18 C;  4EO5 B;  3AZH B;  4XZQ C;  3LZ1 A;  1P3O C;  3LZ0 D;  2FJ7 C;  3B0D C;  3WA9 C;  3LJA D;  5BNV A;  5BO0 B;  5DNM B;  1R4V A;  2NQB B;  3UTA B;  5AV5 C;  3MGQ A;  4KGC C;  2PYO D;  5FUG A;  3KUY D;  3AZK C;  1KX3 D;  1WWS A;  1P3B B;  4H9S A;  4G92 C;  5AY8 D;  4QLC C;  1TZY B;  2YFV B;  3UTB D;  5GSU C;  3AZJ B;  1P3L D;  4J8X A;  5GXQ A;  3REK A;  1JFI B;  3X1V C;  5B0Y A;  3AV2 A;  4LD9 A;  3AZH D;  3AFA C;  3UT9 A;  3AZN B;  4J8U B;  3W99 B;  4AWL C;  1ZLA C;  4ZUX C;  5DNM D;  2CV5 B;  1AOI B;  5B40 C;  2NQB D;  3AZL B;  4H9P B;  3WTP E;  1M18 A;  3LZ0 C;  3LZ1 B;  3REI B;  1S32 B;  3W97 A;  1A7W A;  1P3B D;  3LEL A;  1TZY D;  2ARO D;  3AZJ D;  5AVB B;  3MGR B;  4R8P D;  1HQ3 D;  3X1S B;  4YM6 A;  2PYO C;  1P3I B;  5G49 B;  5AV5 A;  5CPI A;  5B0Z A;  1KX3 C;  3TU4 D;  3NQU A;  5AY8 C;  5B32 G;  1P3F B;  3AZK A;  3UTB C;  3AZN D;  3W99 D;  4UUZ B;  3AZF A;  4NE5 A;  3C1C C;  5GSU A;  1KX4 C;  1H3O B;  2CV5 D;  5AV8 C;  1AOI D;  3MGS A;  3AZL D;  3AZH C;  4Z5T A;  3X1V A;  5CPK C;  3REH D;  3REI D;  3B6F B;  1S32 D;  5B2I B;  5KDM A;  1HTA A;  5AV9 B;  4KHA A;  5DNM C;  2NQB C;  3MNN C;  4ZBJ C;  3AZG C;  3MGR D;  3WKJ A;  5B1M A;  2NZD A;  3AZE C;  4ZUX A;  4DRA A;  5B40 A;  5GT3 B;  3X1S D;  1P3I D;  5C3I B;  3MGP B;  1F66 A;  4J8V C;  1P3B C;  3W97 B;  4KUD B;  2BYM A;  3W98 A;  1P3F D;  2ARO C;  4H9Q B;  3AZJ C;  3C1B B;  3O62 C;  3AZM B;  3AYW B;  4R8P C;  3MVD D;  4J8W B;  1HQ3 C;  4JJN D;  1P3K B;  3B0C T;  3TU4 C;  5BT1 D;  3WTP D;  5B31 A;  3NQJ B;  4H9O B;  3B6F D;  3AZN C;  3W99 C;  1U35 D;  5B2I D;  5AV9 D;  4X23 A;  2CV5 C;  1P34 A;  3KXB B;  3AZL C;  3C1C A;  3REL B;  1KX4 A;  4WU8 A;  5AV8 A;  5GT3 D;  3REH C;  3REI C;  5CP6 D;  3MGP D;  3W96 B;  4KUD D;  5CPK A;  2RVQ D;  5JRG A;  1KX5 A;  3WAA A;  5F99 A;  3MGR C;  2NZD B;  3AZM D;  3AYW D;  1N1J A;  4J8W D;  3MNN A;  2LY8 A;  3X1S C;  1P3K D;  3AZG A;  3AZE A;  1F66 B;  1KU5 A;  4CSR A;  3W98 B;  1P3F C;  5B24 D;  4J8V A;  4WU9 D;  3REJ B;  4YS3 D;  3VH6 A;  3MVD C;  4JJN C;  3REL D;  3O62 A;  5GT0 A;  5B2J B;  1B6W A;  5BT1 C;  3AV1 B;  1P3G C;  4CAY B;  4Z66 B;  3WTP C;  3KWQ B;  3TU4 A;  3B6F C;  1U35 C;  3W96 D;  1P3P B;  1BH9 A;  5BS7 C;  5AVC D;  4ZBJ B;  4X23 B;  3A6N A;  5CPJ A;  2F8N B;  1EQZ C;  1ID3 A;  3B6G D;  4WU8 B;  5GT3 C;  5CP6 C;  5AV6 D;  5JRG B;  1M1A B;  1BH8 A;  5B33 A;  5E5A A;  3REJ D;  2HIO C;  3AZM C;  3AYW C;  4J8W C;  3AN2 B;  1P3K C;  3X1T B;  3VH5 A;  1P3M A;  5DNN C;  5B2J D;  3X1U B;  3AV1 D;  3AZI B;  1M19 A;  4Z66 D;  5B32 A;  5B24 C;  1P3A B;  3KWQ D;  3UTA D;  4WU9 C;  5B1L B;  4XUJ B;  2BYK A;  3R45 A;  1P3P D;  5JA4 A;  4G91 B;  4YS3 C;  1F1E A;  2F8N D;  4XZQ A;  5GT0 B;  3LJA C;  1P3O A;  5BNV B;  2FJ7 A;  3WA9 A;  3W96 C;  1P3G A;  5AVC C;  1BH9 B;  3MGQ B;  1M1A D;  3KUY C;  5FUG B;  4KGC A;  3B6G C;  3AN2 D;  3X1T D;  1EQZ A;  4J8U D;  2L5A A;  1P3L C;  4QLC A;  5AV6 C;  3X1U D;  4J8X B;  5GXQ B;  3REK B;  1P3A D;  5B1L D;  4EO5 C;  5B0Y B;  4H9R A;  3AV2 B;  4LD9 B;  4NFT A;  4Z2M G;  3LZ1 D;  3UT9 B;  2HIO A;  3AFA A;  3KWQ C;  3UTA C;  5DNN A;  5AVB D;  4H9N A;  1ZLA A;  2BYK B;  3V9R A;  5JA4 B;  4DRB A;  2IO5 B;  1M18 B; 
#chains in the Genus database with same CATH topology
 2CWE A;  4XZQ B;  3LEL B;  1TZY C;  3LZ0 A;  1P3O B;  2BG1 A;  3B0D B;  3LJA A;  3VH6 T;  4J8X D;  1ULY A;  2DQN C;  5GXQ D;  3REK D;  4Z2M H;  4YM6 B;  3A1K A;  4WNN A;  5AV5 B;  5B0Z B;  5CPI B;  2Y2O A;  3AV2 D;  4LD9 D;  3NQU B;  2PYO A;  3KUY A;  3AN2 C;  2XD1 A;  1KX3 A;  3AZK B;  3UT9 D;  4J8U C;  4G92 B;  5AY8 A;  3X1U C;  3AZF B;  1BFM A;  3UTB A;  5GSU B;  1AOI C;  1P3A C;  1P3L A;  5B1L C;  3MGS B;  4Z5T B;  3X1V B;  3LZ1 C;  3AZH A;  1S32 C;  3W97 D;  5KDM B;  3LEL D;  4KHA B;  3B0C W;  5AVB C;  3C1B D;  1ZLA B;  3V9R B;  5B1M B;  5BO0 A;  3WKJ B;  5DNM A;  4ZUX B;  2NQB A;  5B40 B;  3VH5 T;  3EPH A;  4YM6 D;  1P3I C;  5CPI D;  5B0Z D;  2BYM B;  3LZ0 B;  3AZK D;  1P3B A;  5BNX A;  1TZY A;  3AZF D;  2ARO A;  2YFV A;  3AZJ A;  5GXQ C;  5GSU D;  3REK C;  3KXB D;  3MGS D;  4R8P A;  3AV2 C;  4LD9 C;  1HQ3 A;  2PYO B;  4Z5T D;  3X1V D;  5B31 B;  5B2I C;  1TAF A;  5AY8 B;  5AV9 C;  4NE6 A;  3UTB B;  3AZN A;  4J8U A;  3W99 A;  1P34 B;  3C1C B;  3WKJ D;  5B1M D;  2FFF B;  2NZD D;  2CV5 A;  4ZUX D;  1KX4 B;  1AOI A;  2YFW A;  5AV8 B;  5B40 D;  2F8N G;  3AZL A;  5C3I C;  3MGP C;  1F66 D;  3W97 C;  2W8S A;  2J8P A;  4H9P A;  4KUD C;  2RVQ C;  1WWI A;  3LEL C;  3REH A;  5CPK B;  1KX5 B;  3REI A;  3W98 D;  1S32 A;  3WAA B;  5F99 B;  3C1B C;  4HGA B;  1N1J B;  3MNN B;  5AVB A;  4YM6 C;  3MGR A;  3AZG B;  5CPI C;  4E45 A;  5B0Z C;  3AZE B;  3P5J B;  3X1S A;  4CSR B;  3FDD A;  1P3I A;  5G49 A;  5B31 D;  4J8V B;  5BNX B;  3AZF C;  1P3F A;  2ARO B;  4X23 D;  4UUZ A;  2F8N H;  1P34 D;  3KXB C;  3MGS C;  3REL C;  3C1C D;  3O62 B;  3MVD A;  1H3O A;  4R8P B;  4WU8 D;  1HQ3 B;  4JJN A;  5AV8 D;  1KX4 D;  4Z5T C;  4WV4 B;  3TU4 B;  3WTP A;  1TAF B;  4WJ3 C;  5CPK D;  1KX5 D;  5JRG D;  3B6F A;  3A6N B;  1U35 A;  5B2I A;  3WAA D;  5F99 D;  5BS7 A;  5AV9 A;  2F8N K;  5CPJ B;  3WKJ C;  5B1M C;  2NZD C;  1ID3 B;  2YFW B;  3MNN D;  3AZG D;  3AZE D;  1F66 C;  5GT3 A;  3AZI D;  3W98 C;  3REH B;  5CP6 A;  3MGP A;  1BH8 B;  2HUE B;  4J8V D;  2JSS A;  4XUJ D;  5B33 B;  4KUD A;  5E5A B;  3REJ C;  4H9Q A;  3C1B A;  3AZM A;  3AYW A;  3O62 D;  5B2J C;  5GT0 D;  4J8W A;  1P3M B;  1B67 A;  3AV1 C;  1P3K A;  4Z66 C;  1M19 B;  5B31 C;  5B32 B;  3R45 B;  1P3P C;  3B0B A;  3MGQ D;  3NQJ A;  5B24 A;  4H9O A;  4WU9 A;  4X23 C;  3A6N D;  1Q9C A;  1P34 C;  4YS3 A;  5CPJ D;  3MVD B;  4WU8 C;  1ID3 D;  4JJN B;  3KXB A;  2ZY2 A;  3REL A;  2FJ7 B;  2Y2M A;  3IP4 C;  3WA9 B;  4E44 A;  1P3G B;  3WTP B;  1KX5 C;  5JRG C;  1M1A C;  4M6B A;  3W96 A;  3WAA C;  5B33 D;  5F99 C;  1U35 B;  5E5A D;  3H0M C;  5B0Y D;  5AVC A;  4HGA C;  4KGC B;  3X1T C;  3H0R C;  1EQZ B;  3B6G A;  2XD5 A;  1P3M D;  4QLC B;  3AZI C;  1M19 D;  5CP6 B;  2JE5 A;  5B32 D;  5CHL B;  4XUJ C;  5AV6 A;  2ZM5 A;  4G91 C;  4H9R B;  1M18 D;  3EPL A;  3REJ A;  3VH6 W;  2HIO B;  5GT0 C;  4XZQ D;  1P3O D;  3AFA B;  2FJ7 D;  2Y2G A;  5B2J A;  5DNN B;  4AWL B;  3WA9 D;  4H9N B;  3AV1 A;  4CAY A;  4Z66 A;  3MGQ C;  1P3G D;  5B24 B;  3KWQ A;  3UTA A;  4NE3 A;  4WU9 B;  3A6N C;  1P3P A;  5AV5 D;  4YS3 B;  5CPJ C;  4H9S C;  4KGC D;  2Y2J A;  1ID3 C;  2F8N A;  1EQZ D;  3LJA B;  4J8X C;  4QLC D;  2Y2P A;  3KSY A;  2HUE C;  5B33 C;  5E5A C;  4WNN B;  5B0Y C;  5AVC B;  1M1A A;  1JFI A;  3KUY B;  1KX3 B;  3UT9 C;  2HIO D;  3B6G B;  1P3M C;  5B31 G;  3AN2 A;  1M19 C;  3AFA D;  3X1T A;  3VH5 W;  5B32 C;  1P3L B;  5DNN D;  3X1U A;  5AV6 B;  3AZI A;  1ZLA D;  4WZS B;  1P3A A;  5B1L A;  2IO5 C;  4XUJ A;  1M18 C;  4EO5 B;  3AZH B;  4XZQ C;  3LZ1 A;  1P3O C;  3LZ0 D;  2FJ7 C;  3B0D C;  3WA9 C;  3LJA D;  5BNV A;  5BO0 B;  5DNM B;  1R4V A;  2NQB B;  3UTA B;  5AV5 C;  3MGQ A;  4KGC C;  2PYO D;  5FUG A;  3KUY D;  3AZK C;  1KX3 D;  1WWS A;  1P3B B;  4H9S A;  4G92 C;  5AY8 D;  4QLC C;  1TZY B;  2YFV B;  3UTB D;  5GSU C;  3AZJ B;  1P3L D;  4J8X A;  5GXQ A;  3REK A;  1JFI B;  3A1I A;  3X1V C;  5B0Y A;  3AV2 A;  4LD9 A;  3AZH D;  2Y2L A;  3AL0 C;  2JCH A;  3AFA C;  3UT9 A;  3AZN B;  4J8U B;  3W99 B;  4AWL C;  1ZLA C;  4ZUX C;  2Y2H A;  5DNM D;  2CV5 B;  5B40 C;  1AOI B;  2NQB D;  1T3U A;  3AZL B;  4H9P B;  3WTP E;  1M18 A;  3LZ0 C;  3LZ1 B;  3REI B;  1S32 B;  3W97 A;  1A7W A;  1P3B D;  3LEL A;  1TZY D;  2Y2I A;  2ARO D;  3AZJ D;  5AVB B;  3MGR B;  4R8P D;  1HQ3 D;  3X1S B;  4YM6 A;  2PYO C;  1P3I B;  5G49 B;  5AV5 A;  5CPI A;  5B0Z A;  1KX3 C;  3TU4 D;  2ZY3 A;  3NQU A;  5AY8 C;  2VQR A;  5B32 G;  1P3F B;  3AZK A;  3UTB C;  3AZN D;  3W99 D;  4UUZ B;  3AZF A;  4NE5 A;  3C1C C;  5GSU A;  1KX4 C;  1H3O B;  2CV5 D;  5AV8 C;  1AOI D;  4UPK A;  3MGS A;  3AZL D;  3AZH C;  4Z5T A;  3X1V A;  5CPK C;  3REH D;  3REI D;  2F2A C;  3B6F B;  1S32 D;  5B2I B;  5KDM A;  1HTA A;  5AV9 B;  2Y2Q A;  4KHA A;  5DNM C;  3H0L C;  2NQB C;  3MNN C;  4ZBJ C;  3AZG C;  3MGR D;  3WKJ A;  5B1M A;  2NZD A;  3AZE C;  4ZUX A;  4DRA A;  5B40 A;  5GT3 B;  3X1S D;  3EPK A;  2UWX A;  1P3I D;  5C3I B;  2G5H C;  3MGP B;  1F66 A;  4J8V C;  1P3B C;  3W97 B;  4KUD B;  2BYM A;  3W98 A;  1P3F D;  2ARO C;  4H9Q B;  3AZJ C;  2DF4 C;  3C1B B;  3O62 C;  3AZM B;  3AYW B;  4R8P C;  3MVD D;  4J8W B;  1HQ3 C;  4JJN D;  1P3K B;  3B0C T;  3TU4 C;  5BT1 D;  3WTP D;  5B31 A;  2Y2K A;  3NQJ B;  4H9O B;  3B6F D;  3AZN C;  3W99 C;  1U35 D;  5B2I D;  5AV9 D;  4X23 A;  2CV5 C;  1Z2C B;  1P34 A;  3KXB B;  3AZL C;  3C1C A;  3REL B;  3EG5 B;  4WU8 A;  1KX4 A;  5AV8 A;  5GT3 D;  3REH C;  3REI C;  5CP6 D;  3MGP D;  3W96 B;  4KUD D;  5CPK A;  2RVQ D;  5JRG A;  1KX5 A;  3WAA A;  5F99 A;  3MGR C;  2NZD B;  2Y2N A;  3AZM D;  3AYW D;  1N1J A;  4J8W D;  3MNN A;  3EPJ A;  2LY8 A;  3X1S C;  1P3K D;  3AZG A;  3AZE A;  1F66 B;  1KU5 A;  4CSR A;  3W98 B;  1P3F C;  5B24 D;  4J8V A;  4WU9 D;  1W2E A;  3REJ B;  4DQY B;  2G5I C;  4YS3 D;  3VH6 A;  3MVD C;  4JJN C;  3REL D;  3O62 A;  5GT0 A;  5B2J B;  1B6W A;  5BT1 C;  3AV1 B;  1P3G C;  2ZY4 A;  4CAY B;  4Z66 B;  3WTP C;  3KFU G;  3KWQ B;  3TU4 A;  3B6F C;  1U35 C;  3W96 D;  1P3P B;  1BH9 A;  5BS7 C;  5AVC D;  4ZBJ B;  4X23 B;  3A6N A;  5CPJ A;  2F8N B;  1EQZ C;  1ID3 A;  3B6G D;  4WU8 B;  5GT3 C;  5CP6 C;  5AV6 D;  5JRG B;  1M1A B;  1BH8 A;  5B33 A;  5E5A A;  3REJ D;  2HIO C;  3AZM C;  3AYW C;  4J8W C;  3AN2 B;  1P3K C;  3F6T A;  3X1T B;  3VH5 A;  1P3M A;  5DNN C;  5B2J D;  3X1U B;  3AV1 D;  3AZI B;  1M19 A;  4Z66 D;  5B32 A;  5B24 C;  1P3A B;  3KWQ D;  3UTA D;  4WU9 C;  5B1L B;  4XUJ B;  2BYK A;  3R45 A;  1P3P D;  5JA4 A;  4G91 B;  4YS3 C;  1F1E A;  2F8N D;  4XZQ A;  5GT0 B;  3LJA C;  1P3O A;  5BNV B;  2FJ7 A;  3WA9 A;  3W96 C;  1P3G A;  5AVC C;  1BH9 B;  3MGQ B;  1M1A D;  1PZR A;  3KUY C;  5FUG B;  4KGC A;  3B6G C;  3AN2 D;  3X1T D;  1EQZ A;  4J8U D;  2L5A A;  1P3L C;  4QLC A;  2ZY5 A;  5AV6 C;  3X1U D;  4J8X B;  5GXQ B;  3REK B;  1P3A D;  5B1L D;  4EO5 C;  5B0Y B;  4H9R A;  3AV2 B;  4LD9 B;  4NFT A;  4Z2M G;  3LZ1 D;  3UT9 B;  2HIO A;  3AFA A;  3KWQ C;  3UTA C;  5DNN A;  5AVB D;  4H9N A;  2RIQ A;  1ZLA A;  2BYK B;  3V9R A;  5JA4 B;  4DRB A;  2IO5 B;  1M18 B; 
#chains in the Genus database with same CATH homology
 2CWE A;  4XZQ B;  3LEL B;  1TZY C;  3LZ0 A;  1P3O B;  2BG1 A;  3B0D B;  3LJA A;  3VH6 T;  4J8X D;  1ULY A;  2DQN C;  5GXQ D;  3REK D;  4Z2M H;  4YM6 B;  3A1K A;  4WNN A;  5AV5 B;  5B0Z B;  5CPI B;  2Y2O A;  3AV2 D;  4LD9 D;  3NQU B;  2PYO A;  3KUY A;  3AN2 C;  2XD1 A;  1KX3 A;  3AZK B;  3UT9 D;  4J8U C;  4G92 B;  5AY8 A;  3X1U C;  3AZF B;  1BFM A;  3UTB A;  5GSU B;  1AOI C;  1P3A C;  1P3L A;  5B1L C;  3MGS B;  4Z5T B;  3X1V B;  3LZ1 C;  3AZH A;  1S32 C;  3W97 D;  5KDM B;  3LEL D;  4KHA B;  3B0C W;  5AVB C;  3C1B D;  1ZLA B;  3V9R B;  5B1M B;  5BO0 A;  3WKJ B;  5DNM A;  4ZUX B;  2NQB A;  5B40 B;  3VH5 T;  3EPH A;  4YM6 D;  1P3I C;  5CPI D;  5B0Z D;  2BYM B;  3LZ0 B;  3AZK D;  1P3B A;  5BNX A;  1TZY A;  3AZF D;  2ARO A;  2YFV A;  3AZJ A;  5GXQ C;  5GSU D;  3REK C;  3KXB D;  3MGS D;  4R8P A;  3AV2 C;  4LD9 C;  1HQ3 A;  2PYO B;  4Z5T D;  3X1V D;  5B31 B;  5B2I C;  1TAF A;  5AY8 B;  5AV9 C;  4NE6 A;  3UTB B;  3AZN A;  4J8U A;  3W99 A;  1P34 B;  3C1C B;  3WKJ D;  5B1M D;  2FFF B;  2NZD D;  2CV5 A;  4ZUX D;  1KX4 B;  1AOI A;  2YFW A;  5AV8 B;  5B40 D;  2F8N G;  3AZL A;  5C3I C;  3MGP C;  1F66 D;  3W97 C;  2W8S A;  2J8P A;  4H9P A;  4KUD C;  2RVQ C;  1WWI A;  3LEL C;  3REH A;  5CPK B;  1KX5 B;  3REI A;  3W98 D;  1S32 A;  3WAA B;  5F99 B;  3C1B C;  4HGA B;  1N1J B;  3MNN B;  5AVB A;  4YM6 C;  3MGR A;  3AZG B;  5CPI C;  4E45 A;  5B0Z C;  3AZE B;  3P5J B;  3X1S A;  4CSR B;  3FDD A;  1P3I A;  5G49 A;  5B31 D;  4J8V B;  5BNX B;  3AZF C;  1P3F A;  2ARO B;  4X23 D;  4UUZ A;  2F8N H;  1P34 D;  3KXB C;  3MGS C;  3REL C;  3C1C D;  3O62 B;  3MVD A;  1H3O A;  4R8P B;  4WU8 D;  1HQ3 B;  4JJN A;  5AV8 D;  1KX4 D;  4Z5T C;  4WV4 B;  3TU4 B;  3WTP A;  1TAF B;  4WJ3 C;  5CPK D;  1KX5 D;  5JRG D;  3B6F A;  3A6N B;  1U35 A;  5B2I A;  3WAA D;  5F99 D;  5BS7 A;  5AV9 A;  2F8N K;  5CPJ B;  3WKJ C;  5B1M C;  2NZD C;  1ID3 B;  2YFW B;  3MNN D;  3AZG D;  3AZE D;  1F66 C;  5GT3 A;  3AZI D;  3W98 C;  3REH B;  5CP6 A;  3MGP A;  1BH8 B;  2HUE B;  4J8V D;  2JSS A;  4XUJ D;  5B33 B;  4KUD A;  5E5A B;  3REJ C;  4H9Q A;  3C1B A;  3AZM A;  3AYW A;  3O62 D;  5B2J C;  5GT0 D;  4J8W A;  1P3M B;  1B67 A;  3AV1 C;  1P3K A;  4Z66 C;  1M19 B;  5B31 C;  5B32 B;  3R45 B;  1P3P C;  3B0B A;  3MGQ D;  3NQJ A;  5B24 A;  4H9O A;  4WU9 A;  4X23 C;  3A6N D;  1Q9C A;  1P34 C;  4YS3 A;  5CPJ D;  3MVD B;  4WU8 C;  1ID3 D;  4JJN B;  3KXB A;  2ZY2 A;  3REL A;  2FJ7 B;  2Y2M A;  3IP4 C;  3WA9 B;  4E44 A;  1P3G B;  3WTP B;  1KX5 C;  5JRG C;  1M1A C;  4M6B A;  3W96 A;  3WAA C;  5B33 D;  5F99 C;  1U35 B;  5E5A D;  3H0M C;  5B0Y D;  5AVC A;  4HGA C;  4KGC B;  3X1T C;  3H0R C;  1EQZ B;  3B6G A;  2XD5 A;  1P3M D;  4QLC B;  3AZI C;  1M19 D;  5CP6 B;  2JE5 A;  5B32 D;  5CHL B;  4XUJ C;  5AV6 A;  2ZM5 A;  4G91 C;  4H9R B;  1M18 D;  3EPL A;  3REJ A;  3VH6 W;  2HIO B;  5GT0 C;  4XZQ D;  1P3O D;  3AFA B;  2FJ7 D;  2Y2G A;  5B2J A;  5DNN B;  4AWL B;  3WA9 D;  4H9N B;  3AV1 A;  4CAY A;  4Z66 A;  3MGQ C;  1P3G D;  5B24 B;  3KWQ A;  3UTA A;  4NE3 A;  4WU9 B;  3A6N C;  1P3P A;  5AV5 D;  4YS3 B;  5CPJ C;  4H9S C;  4KGC D;  2Y2J A;  1ID3 C;  2F8N A;  1EQZ D;  3LJA B;  4J8X C;  4QLC D;  2Y2P A;  3KSY A;  2HUE C;  5B33 C;  5E5A C;  4WNN B;  5B0Y C;  5AVC B;  1M1A A;  1JFI A;  3KUY B;  1KX3 B;  3UT9 C;  2HIO D;  3B6G B;  1P3M C;  5B31 G;  3AN2 A;  1M19 C;  3AFA D;  3X1T A;  3VH5 W;  5B32 C;  1P3L B;  5DNN D;  3X1U A;  5AV6 B;  3AZI A;  1ZLA D;  4WZS B;  1P3A A;  5B1L A;  2IO5 C;  4XUJ A;  1M18 C;  4EO5 B;  3AZH B;  4XZQ C;  3LZ1 A;  1P3O C;  3LZ0 D;  2FJ7 C;  3B0D C;  3WA9 C;  3LJA D;  5BNV A;  5BO0 B;  5DNM B;  1R4V A;  2NQB B;  3UTA B;  5AV5 C;  3MGQ A;  4KGC C;  2PYO D;  5FUG A;  3KUY D;  3AZK C;  1KX3 D;  1WWS A;  1P3B B;  4H9S A;  4G92 C;  5AY8 D;  4QLC C;  1TZY B;  2YFV B;  3UTB D;  5GSU C;  3AZJ B;  1P3L D;  4J8X A;  5GXQ A;  3REK A;  1JFI B;  3A1I A;  3X1V C;  5B0Y A;  3AV2 A;  4LD9 A;  3AZH D;  2Y2L A;  3AL0 C;  2JCH A;  3AFA C;  3UT9 A;  3AZN B;  4J8U B;  3W99 B;  4AWL C;  1ZLA C;  4ZUX C;  2Y2H A;  5DNM D;  2CV5 B;  5B40 C;  1AOI B;  2NQB D;  1T3U A;  3AZL B;  4H9P B;  3WTP E;  1M18 A;  3LZ0 C;  3LZ1 B;  3REI B;  1S32 B;  3W97 A;  1A7W A;  1P3B D;  3LEL A;  1TZY D;  2Y2I A;  2ARO D;  3AZJ D;  5AVB B;  3MGR B;  4R8P D;  1HQ3 D;  3X1S B;  4YM6 A;  2PYO C;  1P3I B;  5G49 B;  5AV5 A;  5CPI A;  5B0Z A;  1KX3 C;  3TU4 D;  2ZY3 A;  3NQU A;  5AY8 C;  2VQR A;  5B32 G;  1P3F B;  3AZK A;  3UTB C;  3AZN D;  3W99 D;  4UUZ B;  3AZF A;  4NE5 A;  3C1C C;  5GSU A;  1KX4 C;  1H3O B;  2CV5 D;  5AV8 C;  1AOI D;  4UPK A;  3MGS A;  3AZL D;  3AZH C;  4Z5T A;  3X1V A;  5CPK C;  3REH D;  3REI D;  2F2A C;  3B6F B;  1S32 D;  5B2I B;  5KDM A;  1HTA A;  5AV9 B;  2Y2Q A;  4KHA A;  5DNM C;  3H0L C;  2NQB C;  3MNN C;  4ZBJ C;  3AZG C;  3MGR D;  3WKJ A;  5B1M A;  2NZD A;  3AZE C;  4ZUX A;  4DRA A;  5B40 A;  5GT3 B;  3X1S D;  3EPK A;  2UWX A;  1P3I D;  5C3I B;  2G5H C;  3MGP B;  1F66 A;  4J8V C;  1P3B C;  3W97 B;  4KUD B;  2BYM A;  3W98 A;  1P3F D;  2ARO C;  4H9Q B;  3AZJ C;  2DF4 C;  3C1B B;  3O62 C;  3AZM B;  3AYW B;  4R8P C;  3MVD D;  4J8W B;  1HQ3 C;  4JJN D;  1P3K B;  3B0C T;  3TU4 C;  5BT1 D;  3WTP D;  5B31 A;  2Y2K A;  3NQJ B;  4H9O B;  3B6F D;  3AZN C;  3W99 C;  1U35 D;  5B2I D;  5AV9 D;  4X23 A;  2CV5 C;  1Z2C B;  1P34 A;  3KXB B;  3AZL C;  3C1C A;  3REL B;  3EG5 B;  4WU8 A;  1KX4 A;  5AV8 A;  5GT3 D;  3REH C;  3REI C;  5CP6 D;  3MGP D;  3W96 B;  4KUD D;  5CPK A;  2RVQ D;  5JRG A;  1KX5 A;  3WAA A;  5F99 A;  3MGR C;  2NZD B;  2Y2N A;  3AZM D;  3AYW D;  1N1J A;  4J8W D;  3MNN A;  3EPJ A;  2LY8 A;  3X1S C;  1P3K D;  3AZG A;  3AZE A;  1F66 B;  1KU5 A;  4CSR A;  3W98 B;  1P3F C;  5B24 D;  4J8V A;  4WU9 D;  1W2E A;  3REJ B;  4DQY B;  2G5I C;  4YS3 D;  3VH6 A;  3MVD C;  4JJN C;  3REL D;  3O62 A;  5GT0 A;  5B2J B;  1B6W A;  5BT1 C;  3AV1 B;  1P3G C;  2ZY4 A;  4CAY B;  4Z66 B;  3WTP C;  3KFU G;  3KWQ B;  3TU4 A;  3B6F C;  1U35 C;  3W96 D;  1P3P B;  1BH9 A;  5BS7 C;  5AVC D;  4ZBJ B;  4X23 B;  3A6N A;  5CPJ A;  2F8N B;  1EQZ C;  1ID3 A;  3B6G D;  4WU8 B;  5GT3 C;  5CP6 C;  5AV6 D;  5JRG B;  1M1A B;  1BH8 A;  5B33 A;  5E5A A;  3REJ D;  2HIO C;  3AZM C;  3AYW C;  4J8W C;  3AN2 B;  1P3K C;  3F6T A;  3X1T B;  3VH5 A;  1P3M A;  5DNN C;  5B2J D;  3X1U B;  3AV1 D;  3AZI B;  1M19 A;  4Z66 D;  5B32 A;  5B24 C;  1P3A B;  3KWQ D;  3UTA D;  4WU9 C;  5B1L B;  4XUJ B;  2BYK A;  3R45 A;  1P3P D;  5JA4 A;  4G91 B;  4YS3 C;  1F1E A;  2F8N D;  4XZQ A;  5GT0 B;  3LJA C;  1P3O A;  5BNV B;  2FJ7 A;  3WA9 A;  3W96 C;  1P3G A;  5AVC C;  1BH9 B;  3MGQ B;  1M1A D;  1PZR A;  3KUY C;  5FUG B;  4KGC A;  3B6G C;  3AN2 D;  3X1T D;  1EQZ A;  4J8U D;  2L5A A;  1P3L C;  4QLC A;  2ZY5 A;  5AV6 C;  3X1U D;  4J8X B;  5GXQ B;  3REK B;  1P3A D;  5B1L D;  4EO5 C;  5B0Y B;  4H9R A;  3AV2 B;  4LD9 B;  4NFT A;  4Z2M G;  3LZ1 D;  3UT9 B;  2HIO A;  3AFA A;  3KWQ C;  3UTA C;  5DNN A;  5AVB D;  4H9N A;  2RIQ A;  1ZLA A;  2BYK B;  3V9R A;  5JA4 B;  4DRB A;  2IO5 B;  1M18 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...