5CPKA

Nucleosome containing methylated sat2l dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpkA00
4NE6A 3B0BA 5AVCC 5FUGA 2IO5C 4H9NB 5B0YD 1F66A 3NQJB 3W99D 5AVBA 4J8VD 3AZFD 3W96B 5B32A 3AV2D 1M18B 4H9PA 1M18C 3LELC 4XZQC 3LELB 3AZLA 1KX4D 3WKJA 5JRGD 3AFAB 3X1SB 3AZJA 2HIOD 1U35C 5E5AA 1U35B 5GXQD 5B24D 4J8XB 5B31D 5GT0A 2F8NA 4DRAA 5CPKA 1AOIB 2YFVB 4Z5TC 3LJAB 5B1MB 3MVDA 4JJNB 5B33A 1BH8B 3AN2A 3AZMD 4CSRB 5AV8A 1P3AB 5AVCA 4G92B 5B0ZB 3W98B 5AV6D 1KX3D 1KX5B 3MGSB 3B0DC 4XZQA 3KXBD 1EQZC 3KUYC 3KUYB 5B2JA 3AZEA 1P34D 4WU8D 4EO5C 4KGCC 5F99B 3VH6W 5AV9A 3AZKB 3AZKC 3X1TA 3WA9C 3AZHB 3KWQA 5CP6C 4E45A 5CP6B 4Z66D 3B0CW 1P3OD 3MGQD 4H9OB 4R8PD 2CWEA 4Z5TA 5BT1D 5B0YA 3A6NA 1P3PC 2AROB 3REHB 3B6FB 3VH6T 3V9RB 4QLCC 4QLCB 5JRGA 5BNXB 3REJC 3REKD 5DNMC 3LZ1B 3W97B 1TZYB 3X1VD 3RELC 2HIOA 3WAAC 3UTAD 3UT9C 3WAAB 3WTPC 5GXQA 1P3MD 1S32C 1S32B 5B24A 4WU9C 3AZGC 3AV1D 3VH5A 4DRBA 1EQZA 5CPIC 5CPIB 3O62B 1P3BD 4KGCA 5GT3B 1P3KA 4J8UC 3WA9A 3AZMA 3C1CD 3X1UB 4ZUXC 4M6BA 4ZUXB 5AVBD 1F66D 4H9RA 5B2IB 3NQUB 3UTBD 3MGPC 3AZLD 4XUJB 1P3PA 4J8WC 5E5AD 4X23B 3AZNB 3REJA 5DNMA 4WU8A 3RELA 2F8ND 5CPKD 2RVQC 4KHAA 1TAFB 4WU9A 4KUDD 3MGRD 5CPJC 5CPJB 3AZGA 4WNNA 2NZDC 5B33D 3MNNC 3AN2D 3LZ0C 4UUZA 3LZ0B 3MGQA 1P3OA 1M19B 4YM6B 4R8PA 3TU4B 5AVCD 4J8UA 2NQBB 5KDMB 2BYMA 1M1AB 1M1AC 4CAYB 5B1LC 3REKA 4NE5A 3AYWB 2LY8A 1H3OB 3UTAA 3LELD 4XZQD 4LD9C 4LD9B 1P3MA 4J8WA 2FJ7B 1P3IC 1P3IB 1U35D 1ULYA 2CV5C 2CV5B 1P3BA 3WKJB 3KWQD 2PYOB 1HQ3B 3A6ND 3C1CA 4Z5TD 3W96C 3UTBA 3AFAC 3X1SC 1Q9CA 1N1JA 3AZIB 5AY8B 3MVDB 4H9QA 1ZLAA 4WZSB 4J8XC 5AV8B 1AOIC 5DNNC 5DNNB 1EQZD 5B40B 1P3FA 3LJAC 4KUDA 3MGRA 5B1MC 4JJNC 4KGCD 1P3KD 5GSUB 3WA9D 1P3AC 4G92C 5B0ZC 3W98C 3NQJA 3W96A 5BNVA 1P3PD 1KX5C 5AV9B 3MGSC 1M18A 3LELA 4G91B 4QLCD 3REJD 3AFAA 5DNMD 3RELD 3UT9D 3WAAD 4J8VC 4J8VB 3AZFB 5F99C 1U35A 3W99B 3WTPD 3REIC 3REIB 1BH9B 1S32D 3AV2B 4J8XA 3AZHC 4WU9D 1KX4B 3AZGD 5JRGB 2YFVA 5BS7C 1BFMA 1P3LC 1P3LB 3LJAA 5B1MA 2AROC 4JJNA 5GXQB 3REHC 4J8UD 1BH8A 3B6FC 5B31C 4CSRA 4NE3A 5B31B 4ZUXD 1P3AA 3LZ1C 3W97C 1TZYC 5B0ZA 3MGPD 1KX5A 3MGSA 3R45B 4J8WD 5G49B 3O62C 3KUYA 2YFWB 5AV6B 5F99A 5GT3C 1KX3B 3AZKA 2RVQD 4H9SC 3AZHA 3X1UC 3KXBB 5CPJD 2HUEC 2HUEB 5B2IC 5CP6A 1P3GC 1P3GB 3MNND 2NZDD 3LZ0D 4YS3C 4H9OA 4YS3B 1P34B 4ZBJB 4WU8B 4XUJC 1WWSA 4KHAB 3B6FA 3V9RA 4QLCA 5B1LD 4WNNB 5BNXA 4X23C 4Z66C 4Z66B 3AZNC 1ZLAD 1A7WA 3W97A 4UUZB 1TZYA 3UT9A 3WAAA 4LD9D 3WTPA 2F8NK 1S32A 1P3FD 5JA4A 3REKB 5AV5C 5AV5B 5CPIA 1M19C 2BYKB 3X1VB 4YM6C 3TU4C 1P3MB 3C1BC 3C1BB 2NQBC 4H9SA 3X1UA 4ZUXA 1ID3C 3AV1B 1ID3B 3AYWC 5B2IA 3W96D 1HTAA 1M18D 5BO0B 3MGPA 3B6GC 3B6GB 3AFAD 3X1SD 5FUGB 1JFIA 2FJ7C 1F66C 3C1CB 1F66B 5AVBB 4X23A 3AZNA 5B32C 5B32B 1KU5A 4H9PB 4J8XD 3WKJC 3AZLB 2PYOC 2JSSA 1AOID 3AZJC 3AZJB 1HQ3C 1TAFA 3LJAD 3VH5W 5B1MD 5CPJA 5E5AB 4JJND 2NZDA 4H9QB 3MNNA 3VH6A 3LZ0A 1M19A 5GT0C 5GT0B 4YM6A 2F8NB 5CPKB 3TU4A 1P3AD 5B0ZD 2NQBA 1M1AA 4NFTA 3AZIC 3W98D 4CAYA 3MGRB 1R4VA 5B1LA 5AY8C 3MVDC 4WV4B 3VH5T 1KX5D 5B33B 3MGSD 3AN2B 1H3OA 4LD9A 5AV8C 3KUYD 5B40C 5AVCB 2IO5B 1WWIA 2FJ7A 1P3IA 5BNVB 5F99D 5GSUC 3AZKD 2CV5A 3REID 3AZHD 4XZQB 5CHLB 5CP6D 2PYOA 1HQ3A 5B2JC 5B2JB 3AZEC 3AZEB 1P3LD 4H9NA 2AROD 5AV9C 3REHD 3X1TC 3X1TB 5B31G 3B6FD 4G91C 3KWQC 3KWQB 3X1SA 3LZ1D 3W97D 1TZYD 3A6NC 5B0YC 5B0YB 4Z5TB 3W99C 3A6NB 3AZFC 3AZIA 5AY8A 3AV2C 1KX4C 5JRGC 1AOIA 5DNNA 5CPID 3O62D 5B40A 2HIOC 2HIOB 5GXQC 5GT3D 5GSUA 5B24C 5B24B 3B0DB 3X1UD 5B2ID 1EQZB 1P3GD 4YS3D 3W98A 4XUJD 4EO5B 4KGCB 3WTPE 1P3KC 1P3KB 3WA9B 3AZMC 3AZMB 4X23D 3AZND 4H9RB 5AV6C 4J8VA 3AZFA 1P3PB 1KX3C 3W99A 2L5AA 3REIA 1BH9A 3AV2A 3KSYA 4HGAC 4HGAB 3KXBC 1KX4A 5C3IC 5C3IB 3REJB 5AV5D 5DNMB 4E44A 5BS7A 1M19D 1P3LA 1P34C 4ZBJC 4WU8C 3B0CT 4YM6D 3RELB 3UT9B 2AROA 1B67A 3WTPB 3REHA 3TU4D 2NQBD 3C1BD 1B6WA 1M1AD 5B31A 4WU9B 5JA4B 3AZGB 1ID3D 3AYWD 1P3OC 3LZ1A 1P3OB 3MGQC 3MGQB 4R8PC 4R8PB 5BT1C 3B6GD 4J8UB 3R45A 2BYMB 2FJ7D 1P3ID 3REKC 2F8NH 5B32G 5G49A 3O62A 2CV5D 2YFWA 5B32D 3X1VC 3MGPB 3UTAC 3UTAB 1F1EA 3WKJD 2PYOD 5AV6A 1KX3A 5GT3A 3AZJD 1P3MC 1HQ3D 1JFIB 4J8WB 3KXBA 3AV1C 1P3GA 3NQUA 1P3BC 1P3BB 4YS3A 2F8NG 1P34A 4Z2MH 5GT0D 4XUJA 3C1CC 3AZID 5AVBC 5AY8D 3MVDD 4Z66A 2NZDB 3MNNB 3UTBC 3UTBB 3AZLC 5AV8D 4Z2MG 5DNND 5B40D 1N1JB 4AWLC 5E5AC 4AWLB 5B1LB 5AV5A 5GSUD 1ZLAC 1ZLAB 2BYKA 3X1VA 5CPKC 5B2JD 3C1BA 5KDMA 3AZED 1P3FB 1P3FC 4KUDB 3MGRC 4KUDC 3AV1A 1ID3A 3AYWA 5B33C 5AV9D 3AN2C 3X1TD 5BO0A 3B6GA
chains in the Genus database with same CATH superfamily
4NE6A 3B0BA 5AVCC 5FUGA 2IO5C 4WJ3C 4H9NB 5B0YD 1F66A 3NQJB 3W99D 5AVBA 4J8VD 3AZFD 3W96B 5B32A 3AV2D 1M18B 4H9PA 1M18C 3LELC 4XZQC 3LELB 3AZLA 1KX4D 3WKJA 5JRGD 3AFAB 3X1SB 3AZJA 2HIOD 1U35C 5E5AA 2ZM5A 1U35B 5GXQD 5B24D 4J8XB 5B31D 5GT0A 2F8NA 4DRAA 5CPKA 1AOIB 2YFVB 4Z5TC 3LJAB 5B1MB 3MVDA 4JJNB 5B33A 1BH8B 3AN2A 3AZMD 4CSRB 5AV8A 1P3AB 5AVCA 4G92B 5B0ZB 3W98B 2Y2JA 5AV6D 1KX3D 2UWXA 3H0MC 2J8PA 3MGSB 1KX5B 3B0DC 4XZQA 3KXBD 1EQZC 3KUYC 3KUYB 5B2JA 3AZEA 1P34D 4WU8D 4EO5C 3IP4C 4KGCC 5F99B 3VH6W 5AV9A 3AZKB 3AZKC 3X1TA 3WA9C 3AZHB 3KWQA 5CP6C 4E45A 5CP6B 4Z66D 3B0CW 1P3OD 3MGQD 4H9OB 4UPKA 4R8PD 2CWEA 4Z5TA 5BT1D 5B0YA 3A6NA 1P3PC 2AROB 3REHB 3B6FB 3VH6T 3V9RB 4QLCC 4QLCB 5JRGA 5BNXB 3REJC 3REKD 5DNMC 3LZ1B 3W97B 1TZYB 3X1VD 3RELC 2HIOA 3WAAC 3UTAD 3UT9C 3WAAB 3WTPC 5GXQA 1P3MD 1S32C 1S32B 5B24A 4WU9C 3AZGC 3AV1D 3VH5A 4DRBA 1EQZA 5CPIC 5CPIB 3O62B 1P3BD 4KGCA 5GT3B 1P3KA 4J8UC 3WA9A 3AZMA 3C1CD 3X1UB 4ZUXC 5AVBD 4ZUXB 4M6BA 1F66D 4H9RA 5B2IB 3NQUB 3EPKA 3UTBD 3A1KA 3MGPC 4DQYB 3AZLD 4XUJB 1P3PA 1Z2CB 4J8WC 5E5AD 4X23B 3AZNB 3REJA 5DNMA 2Y2QA 3KFUG 4WU8A 3RELA 2F8ND 5CPKD 2RVQC 4KHAA 1TAFB 4WU9A 4KUDD 3MGRD 5CPJC 5CPJB 3AZGA 4WNNA 2NZDC 5B33D 3MNNC 3AN2D 3LZ0C 4UUZA 3LZ0B 3MGQA 1P3OA 1M19B 4YM6B 4R8PA 3TU4B 5AVCD 4J8UA 2NQBB 5KDMB 2BYMA 1M1AB 1M1AC 4CAYB 5B1LC 3REKA 4NE5A 3AYWB 2LY8A 1H3OB 3UTAA 3LELD 4XZQD 4LD9C 4LD9B 1P3MA 4J8WA 2FJ7B 1P3IC 1P3IB 1U35D 1ULYA 2CV5C 2CV5B 3EPLA 1P3BA 3WKJB 2W8SA 3KWQD 2PYOB 1HQ3B 3F6TA 3A6ND 3C1CA 4Z5TD 3W96C 3P5JB 3H0RC 3UTBA 3AFAC 3X1SC 3AL0C 1Q9CA 1N1JA 3AZIB 5AY8B 3MVDB 4H9QA 1ZLAA 4WZSB 4J8XC 2DF4C 5AV8B 1AOIC 5DNNC 5DNNB 2FFFB 2VQRA 1EQZD 5B40B 3EPJA 2ZY3A 1P3FA 3LJAC 4KUDA 3MGRA 5B1MC 4JJNC 4KGCD 1P3KD 5GSUB 3WA9D 2ZY5A 1P3AC 4G92C 5B0ZC 3W98C 3NQJA 3W96A 5BNVA 1P3PD 1KX5C 5AV9B 3MGSC 1M18A 3LELA 4G91B 4QLCD 3REJD 3AFAA 5DNMD 3RELD 3UT9D 3WAAD 2ZY4A 4J8VC 4J8VB 3AZFB 5F99C 1U35A 3W99B 3WTPD 3REIC 3REIB 1BH9B 1S32D 3AV2B 4J8XA 3AZHC 4WU9D 1KX4B 3AZGD 5JRGB 2YFVA 5BS7C 1BFMA 1P3LC 1P3LB 3LJAA 5B1MA 2BG1A 2AROC 4JJNA 5GXQB 3REHC 4J8UD 1BH8A 3B6FC 5B31C 4CSRA 4NE3A 5B31B 2Y2PA 4ZUXD 2Y2GA 1P3AA 3LZ1C 3W97C 1TZYC 5B0ZA 3MGPD 2Y2LA 1KX5A 3MGSA 3R45B 4J8WD 5G49B 3O62C 3KUYA 2YFWB 2XD5A 5AV6B 5F99A 5GT3C 1KX3B 3AZKA 2RVQD 4H9SC 3AZHA 3X1UC 3KXBB 5CPJD 2HUEC 2HUEB 5B2IC 5CP6A 1P3GC 1P3GB 3MNND 2NZDD 3LZ0D 4YS3C 4H9OA 4YS3B 1P34B 4ZBJB 4WU8B 4XUJC 1WWSA 4KHAB 3B6FA 3V9RA 4QLCA 5B1LD 4WNNB 5BNXA 4X23C 4Z66C 4Z66B 3AZNC 1ZLAD 1A7WA 1W2EA 4UUZB 3W97A 1TZYA 3UT9A 3WAAA 4LD9D 2G5IC 1T3UA 3WTPA 2F8NK 2Y2HA 1S32A 1P3FD 5JA4A 3REKB 5AV5C 5AV5B 5CPIA 1M19C 2BYKB 3X1VB 4YM6C 2G5HC 3TU4C 1P3MB 3C1BC 3C1BB 2NQBC 4H9SA 3X1UA 4ZUXA 1ID3C 3AV1B 1ID3B 3AYWC 5B2IA 3W96D 1HTAA 1M18D 5BO0B 3MGPA 3B6GC 3B6GB 3AFAD 3X1SD 5FUGB 1JFIA 2FJ7C 1F66C 3C1CB 1F66B 5AVBB 4X23A 3AZNA 5B32C 5B32B 1KU5A 4H9PB 4J8XD 3WKJC 3AZLB 2PYOC 2JSSA 1AOID 3AZJC 3AZJB 1HQ3C 2Y2IA 1TAFA 3LJAD 3EG5B 3VH5W 5B1MD 5CPJA 5E5AB 4JJND 2NZDA 4H9QB 3MNNA 3VH6A 3LZ0A 1M19A 5GT0C 5GT0B 4YM6A 2F8NB 5CPKB 3TU4A 1P3AD 5B0ZD 2NQBA 1M1AA 4NFTA 3AZIC 3W98D 4CAYA 3MGRB 1R4VA 5B1LA 5AY8C 3MVDC 4WV4B 3VH5T 1KX5D 5B33B 3MGSD 3AN2B 1H3OA 4LD9A 5AV8C 3KUYD 5B40C 5AVCB 2IO5B 1WWIA 2FJ7A 1P3IA 5BNVB 5F99D 5GSUC 3AZKD 2CV5A 3REID 3AZHD 4XZQB 5CHLB 2JCHA 5CP6D 2PYOA 1PZRA 1HQ3A 5B2JC 5B2JB 3AZEC 3AZEB 1P3LD 4H9NA 2AROD 5AV9C 3REHD 3X1TC 3X1TB 5B31G 3B6FD 4G91C 3KWQC 3KWQB 3X1SA 3FDDA 3LZ1D 3W97D 1TZYD 2Y2MA 5B0YC 5B0YB 4Z5TB 3W99C 3A6NC 3A6NB 3AZFC 3AZIA 5AY8A 2DQNC 3AV2C 1KX4C 5JRGC 1AOIA 5DNNA 5CPID 3O62D 5B40A 2F2AC 2HIOC 2HIOB 2RIQA 5GXQC 5GT3D 5GSUA 5B24C 5B24B 3B0DB 3X1UD 5B2ID 1EQZB 2ZY2A 1P3GD 4YS3D 3W98A 4XUJD 4EO5B 4KGCB 3WTPE 1P3KC 1P3KB 3WA9B 3AZMC 3AZMB 2Y2OA 3EPHA 4X23D 3AZND 4H9RB 2Y2NA 5AV6C 4J8VA 3AZFA 1P3PB 1KX3C 3W99A 2L5AA 3REIA 1BH9A 3AV2A 3KSYA 4HGAC 4HGAB 3KXBC 1KX4A 5C3IC 5C3IB 3REJB 5AV5D 5DNMB 4E44A 5BS7A 1M19D 3H0LC 1P34C 4ZBJC 4WU8C 3B0CT 1P3LA 4YM6D 3RELB 3UT9B 2AROA 1B67A 3WTPB 3REHA 3TU4D 2NQBD 3C1BD 1B6WA 1M1AD 5B31A 4WU9B 5JA4B 3AZGB 1ID3D 3AYWD 1P3OC 3LZ1A 1P3OB 3MGQC 3MGQB 4R8PC 4R8PB 5BT1C 3B6GD 2JE5A 2XD1A 4J8UB 3R45A 2BYMB 2FJ7D 1P3ID 3REKC 2F8NH 5B32G 5G49A 3O62A 2CV5D 2YFWA 5B32D 3X1VC 3MGPB 3UTAC 3UTAB 1F1EA 3WKJD 2PYOD 5AV6A 1KX3A 5GT3A 3AZJD 1P3MC 1HQ3D 1JFIB 4J8WB 3KXBA 3AV1C 1P3GA 3NQUA 1P3BC 1P3BB 4YS3A 2F8NG 1P34A 4Z2MH 5GT0D 4XUJA 3C1CC 3AZID 5AVBC 5AY8D 3MVDD 4Z66A 2NZDB 3MNNB 3UTBC 3UTBB 3AZLC 5AV8D 4Z2MG 5DNND 2Y2KA 5B40D 3A1IA 1N1JB 4AWLC 5E5AC 4AWLB 5B1LB 5AV5A 5GSUD 1ZLAC 1ZLAB 2BYKA 3X1VA 5CPKC 5B2JD 3C1BA 5KDMA 3AZED 1P3FB 1P3FC 4KUDB 3MGRC 4KUDC 3AV1A 1ID3A 3AYWA 5B33C 5AV9D 3AN2C 3X1TD 5BO0A 3B6GA
chains in the Genus database with same CATH topology
4NE6A 3B0BA 5AVCC 5FUGA 2IO5C 4WJ3C 4H9NB 5B0YD 1F66A 3NQJB 3W99D 5AVBA 4J8VD 3AZFD 3W96B 5B32A 3AV2D 1M18B 4H9PA 1M18C 3LELC 4XZQC 3LELB 3AZLA 1KX4D 3WKJA 5JRGD 3AFAB 3X1SB 3AZJA 2HIOD 1U35C 5E5AA 2ZM5A 1U35B 5GXQD 5B24D 4J8XB 5B31D 5GT0A 2F8NA 4DRAA 5CPKA 1AOIB 2YFVB 4Z5TC 3LJAB 5B1MB 3MVDA 4JJNB 5B33A 1BH8B 3AN2A 3AZMD 4CSRB 5AV8A 1P3AB 5AVCA 4G92B 5B0ZB 3W98B 2Y2JA 5AV6D 1KX3D 2UWXA 3H0MC 2J8PA 3MGSB 1KX5B 3B0DC 4XZQA 3KXBD 1EQZC 3KUYC 3KUYB 5B2JA 3AZEA 1P34D 4WU8D 4EO5C 3IP4C 4KGCC 5F99B 3VH6W 5AV9A 3AZKB 3AZKC 3X1TA 3WA9C 3AZHB 3KWQA 5CP6C 4E45A 5CP6B 4Z66D 3B0CW 1P3OD 3MGQD 4H9OB 4UPKA 4R8PD 2CWEA 4Z5TA 5BT1D 5B0YA 3A6NA 1P3PC 2AROB 3REHB 3B6FB 3VH6T 3V9RB 4QLCC 4QLCB 5JRGA 5BNXB 3REJC 3REKD 5DNMC 3LZ1B 3W97B 1TZYB 3X1VD 3RELC 2HIOA 3WAAC 3UTAD 3UT9C 3WAAB 3WTPC 5GXQA 1P3MD 1S32C 1S32B 5B24A 4WU9C 3AZGC 3AV1D 3VH5A 4DRBA 1EQZA 5CPIC 5CPIB 3O62B 1P3BD 4KGCA 5GT3B 1P3KA 4J8UC 3WA9A 3AZMA 3C1CD 3X1UB 4ZUXC 5AVBD 4ZUXB 4M6BA 1F66D 4H9RA 5B2IB 3NQUB 3EPKA 3UTBD 3A1KA 3MGPC 4DQYB 3AZLD 4XUJB 1P3PA 1Z2CB 4J8WC 5E5AD 4X23B 3AZNB 3REJA 5DNMA 2Y2QA 3KFUG 4WU8A 3RELA 2F8ND 5CPKD 2RVQC 4KHAA 1TAFB 4WU9A 4KUDD 3MGRD 5CPJC 5CPJB 3AZGA 4WNNA 2NZDC 5B33D 3MNNC 3AN2D 3LZ0C 4UUZA 3LZ0B 3MGQA 1P3OA 1M19B 4YM6B 4R8PA 3TU4B 5AVCD 4J8UA 2NQBB 5KDMB 2BYMA 1M1AB 1M1AC 4CAYB 5B1LC 3REKA 4NE5A 3AYWB 2LY8A 1H3OB 3UTAA 3LELD 4XZQD 4LD9C 4LD9B 1P3MA 4J8WA 2FJ7B 1P3IC 1P3IB 1U35D 1ULYA 2CV5C 2CV5B 3EPLA 1P3BA 3WKJB 2W8SA 3KWQD 2PYOB 1HQ3B 3F6TA 3A6ND 3C1CA 4Z5TD 3W96C 3P5JB 3H0RC 3UTBA 3AFAC 3X1SC 3AL0C 1Q9CA 1N1JA 3AZIB 5AY8B 3MVDB 4H9QA 1ZLAA 4WZSB 4J8XC 2DF4C 5AV8B 1AOIC 5DNNC 5DNNB 2FFFB 2VQRA 1EQZD 5B40B 3EPJA 2ZY3A 1P3FA 3LJAC 4KUDA 3MGRA 5B1MC 4JJNC 4KGCD 1P3KD 5GSUB 3WA9D 2ZY5A 1P3AC 4G92C 5B0ZC 3W98C 3NQJA 3W96A 5BNVA 1P3PD 1KX5C 5AV9B 3MGSC 1M18A 3LELA 4G91B 4QLCD 3REJD 3AFAA 5DNMD 3RELD 3UT9D 3WAAD 2ZY4A 4J8VC 4J8VB 3AZFB 5F99C 1U35A 3W99B 3WTPD 3REIC 3REIB 1BH9B 1S32D 3AV2B 4J8XA 3AZHC 4WU9D 1KX4B 3AZGD 5JRGB 2YFVA 5BS7C 1BFMA 1P3LC 1P3LB 3LJAA 5B1MA 2BG1A 2AROC 4JJNA 5GXQB 3REHC 4J8UD 1BH8A 3B6FC 5B31C 4CSRA 4NE3A 5B31B 2Y2PA 4ZUXD 2Y2GA 1P3AA 3LZ1C 3W97C 1TZYC 5B0ZA 3MGPD 2Y2LA 1KX5A 3MGSA 3R45B 4J8WD 5G49B 3O62C 3KUYA 2YFWB 2XD5A 5AV6B 5F99A 5GT3C 1KX3B 3AZKA 2RVQD 4H9SC 3AZHA 3X1UC 3KXBB 5CPJD 2HUEC 2HUEB 5B2IC 5CP6A 1P3GC 1P3GB 3MNND 2NZDD 3LZ0D 4YS3C 4H9OA 4YS3B 1P34B 4ZBJB 4WU8B 4XUJC 1WWSA 4KHAB 3B6FA 3V9RA 4QLCA 5B1LD 4WNNB 5BNXA 4X23C 4Z66C 4Z66B 3AZNC 1ZLAD 1A7WA 1W2EA 4UUZB 3W97A 1TZYA 3UT9A 3WAAA 4LD9D 2G5IC 1T3UA 3WTPA 2F8NK 2Y2HA 1S32A 1P3FD 5JA4A 3REKB 5AV5C 5AV5B 5CPIA 1M19C 2BYKB 3X1VB 4YM6C 2G5HC 3TU4C 1P3MB 3C1BC 3C1BB 2NQBC 4H9SA 3X1UA 4ZUXA 1ID3C 3AV1B 1ID3B 3AYWC 5B2IA 3W96D 1HTAA 1M18D 5BO0B 3MGPA 3B6GC 3B6GB 3AFAD 3X1SD 5FUGB 1JFIA 2FJ7C 1F66C 3C1CB 1F66B 5AVBB 4X23A 3AZNA 5B32C 5B32B 1KU5A 4H9PB 4J8XD 3WKJC 3AZLB 2PYOC 2JSSA 1AOID 3AZJC 3AZJB 1HQ3C 2Y2IA 1TAFA 3LJAD 3EG5B 3VH5W 5B1MD 5CPJA 5E5AB 4JJND 2NZDA 4H9QB 3MNNA 3VH6A 3LZ0A 1M19A 5GT0C 5GT0B 4YM6A 2F8NB 5CPKB 3TU4A 1P3AD 5B0ZD 2NQBA 1M1AA 4NFTA 3AZIC 3W98D 4CAYA 3MGRB 1R4VA 5B1LA 5AY8C 3MVDC 4WV4B 3VH5T 1KX5D 5B33B 3MGSD 3AN2B 1H3OA 4LD9A 5AV8C 3KUYD 5B40C 5AVCB 2IO5B 1WWIA 2FJ7A 1P3IA 5BNVB 5F99D 5GSUC 3AZKD 2CV5A 3REID 3AZHD 4XZQB 5CHLB 2JCHA 5CP6D 2PYOA 1PZRA 1HQ3A 5B2JC 5B2JB 3AZEC 3AZEB 1P3LD 4H9NA 2AROD 5AV9C 3REHD 3X1TC 3X1TB 5B31G 3B6FD 4G91C 3KWQC 3KWQB 3X1SA 3FDDA 3LZ1D 3W97D 1TZYD 2Y2MA 5B0YC 5B0YB 4Z5TB 3W99C 3A6NC 3A6NB 3AZFC 3AZIA 5AY8A 2DQNC 3AV2C 1KX4C 5JRGC 1AOIA 5DNNA 5CPID 3O62D 5B40A 2F2AC 2HIOC 2HIOB 2RIQA 5GXQC 5GT3D 5GSUA 5B24C 5B24B 3B0DB 3X1UD 5B2ID 1EQZB 2ZY2A 1P3GD 4YS3D 3W98A 4XUJD 4EO5B 4KGCB 3WTPE 1P3KC 1P3KB 3WA9B 3AZMC 3AZMB 2Y2OA 3EPHA 4X23D 3AZND 4H9RB 2Y2NA 5AV6C 4J8VA 3AZFA 1P3PB 1KX3C 3W99A 2L5AA 3REIA 1BH9A 3AV2A 3KSYA 4HGAC 4HGAB 3KXBC 1KX4A 5C3IC 5C3IB 3REJB 5AV5D 5DNMB 4E44A 5BS7A 1M19D 3H0LC 1P34C 4ZBJC 4WU8C 3B0CT 1P3LA 4YM6D 3RELB 3UT9B 2AROA 1B67A 3WTPB 3REHA 3TU4D 2NQBD 3C1BD 1B6WA 1M1AD 5B31A 4WU9B 5JA4B 3AZGB 1ID3D 3AYWD 1P3OC 3LZ1A 1P3OB 3MGQC 3MGQB 4R8PC 4R8PB 5BT1C 3B6GD 2JE5A 2XD1A 4J8UB 3R45A 2BYMB 2FJ7D 1P3ID 3REKC 2F8NH 5B32G 5G49A 3O62A 2CV5D 2YFWA 5B32D 3X1VC 3MGPB 3UTAC 3UTAB 1F1EA 3WKJD 2PYOD 5AV6A 1KX3A 5GT3A 3AZJD 1P3MC 1HQ3D 1JFIB 4J8WB 3KXBA 3AV1C 1P3GA 3NQUA 1P3BC 1P3BB 4YS3A 2F8NG 1P34A 4Z2MH 5GT0D 4XUJA 3C1CC 3AZID 5AVBC 5AY8D 3MVDD 4Z66A 2NZDB 3MNNB 3UTBC 3UTBB 3AZLC 5AV8D 4Z2MG 5DNND 2Y2KA 5B40D 3A1IA 1N1JB 4AWLC 5E5AC 4AWLB 5B1LB 5AV5A 5GSUD 1ZLAC 1ZLAB 2BYKA 3X1VA 5CPKC 5B2JD 3C1BA 5KDMA 3AZED 1P3FB 1P3FC 4KUDB 3MGRC 4KUDC 3AV1A 1ID3A 3AYWA 5B33C 5AV9D 3AN2C 3X1TD 5BO0A 3B6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NE6 A;  3B0B A;  5AVC C;  5FUG A;  2IO5 C;  4H9N B;  5B0Y D;  1F66 A;  3NQJ B;  3W99 D;  5AVB A;  4J8V D;  3AZF D;  3W96 B;  5B32 A;  3AV2 D;  1M18 B;  4H9P A;  1M18 C;  3LEL C;  4XZQ C;  3LEL B;  3AZL A;  1KX4 D;  3WKJ A;  5JRG D;  3AFA B;  3X1S B;  3AZJ A;  2HIO D;  1U35 C;  5E5A A;  1U35 B;  5GXQ D;  5B24 D;  4J8X B;  5B31 D;  5GT0 A;  2F8N A;  4DRA A;  5CPK A;  1AOI B;  2YFV B;  4Z5T C;  3LJA B;  5B1M B;  3MVD A;  4JJN B;  5B33 A;  1BH8 B;  3AN2 A;  3AZM D;  4CSR B;  5AV8 A;  1P3A B;  5AVC A;  4G92 B;  5B0Z B;  3W98 B;  5AV6 D;  1KX3 D;  1KX5 B;  3MGS B;  3B0D C;  4XZQ A;  3KXB D;  1EQZ C;  3KUY C;  3KUY B;  5B2J A;  3AZE A;  1P34 D;  4WU8 D;  4EO5 C;  4KGC C;  5F99 B;  3VH6 W;  5AV9 A;  3AZK B;  3AZK C;  3X1T A;  3WA9 C;  3AZH B;  3KWQ A;  5CP6 C;  4E45 A;  5CP6 B;  4Z66 D;  3B0C W;  1P3O D;  3MGQ D;  4H9O B;  4R8P D;  2CWE A;  4Z5T A;  5BT1 D;  5B0Y A;  3A6N A;  1P3P C;  2ARO B;  3REH B;  3B6F B;  3VH6 T;  3V9R B;  4QLC C;  4QLC B;  5JRG A;  5BNX B;  3REJ C;  3REK D;  5DNM C;  3LZ1 B;  3W97 B;  1TZY B;  3X1V D;  3REL C;  2HIO A;  3WAA C;  3UTA D;  3UT9 C;  3WAA B;  3WTP C;  5GXQ A;  1P3M D;  1S32 C;  1S32 B;  5B24 A;  4WU9 C;  3AZG C;  3AV1 D;  3VH5 A;  4DRB A;  1EQZ A;  5CPI C;  5CPI B;  3O62 B;  1P3B D;  4KGC A;  5GT3 B;  1P3K A;  4J8U C;  3WA9 A;  3AZM A;  3C1C D;  3X1U B;  4ZUX C;  4M6B A;  4ZUX B;  5AVB D;  1F66 D;  4H9R A;  5B2I B;  3NQU B;  3UTB D;  3MGP C;  3AZL D;  4XUJ B;  1P3P A;  4J8W C;  5E5A D;  4X23 B;  3AZN B;  3REJ A;  5DNM A;  4WU8 A;  3REL A;  2F8N D;  5CPK D;  2RVQ C;  4KHA A;  1TAF B;  4WU9 A;  4KUD D;  3MGR D;  5CPJ C;  5CPJ B;  3AZG A;  4WNN A;  2NZD C;  5B33 D;  3MNN C;  3AN2 D;  3LZ0 C;  4UUZ A;  3LZ0 B;  3MGQ A;  1P3O A;  1M19 B;  4YM6 B;  4R8P A;  3TU4 B;  5AVC D;  4J8U A;  2NQB B;  5KDM B;  2BYM A;  1M1A B;  1M1A C;  4CAY B;  5B1L C;  3REK A;  4NE5 A;  3AYW B;  2LY8 A;  1H3O B;  3UTA A;  3LEL D;  4XZQ D;  4LD9 C;  4LD9 B;  1P3M A;  4J8W A;  2FJ7 B;  1P3I C;  1P3I B;  1U35 D;  1ULY A;  2CV5 C;  2CV5 B;  1P3B A;  3WKJ B;  3KWQ D;  2PYO B;  1HQ3 B;  3A6N D;  3C1C A;  4Z5T D;  3W96 C;  3UTB A;  3AFA C;  3X1S C;  1Q9C A;  1N1J A;  3AZI B;  5AY8 B;  3MVD B;  4H9Q A;  1ZLA A;  4WZS B;  4J8X C;  5AV8 B;  1AOI C;  5DNN C;  5DNN B;  1EQZ D;  5B40 B;  1P3F A;  3LJA C;  4KUD A;  3MGR A;  5B1M C;  4JJN C;  4KGC D;  1P3K D;  5GSU B;  3WA9 D;  1P3A C;  4G92 C;  5B0Z C;  3W98 C;  3NQJ A;  3W96 A;  5BNV A;  1P3P D;  1KX5 C;  5AV9 B;  3MGS C;  1M18 A;  3LEL A;  4G91 B;  4QLC D;  3REJ D;  3AFA A;  5DNM D;  3REL D;  3UT9 D;  3WAA D;  4J8V C;  4J8V B;  3AZF B;  5F99 C;  1U35 A;  3W99 B;  3WTP D;  3REI C;  3REI B;  1BH9 B;  1S32 D;  3AV2 B;  4J8X A;  3AZH C;  4WU9 D;  1KX4 B;  3AZG D;  5JRG B;  2YFV A;  5BS7 C;  1BFM A;  1P3L C;  1P3L B;  3LJA A;  5B1M A;  2ARO C;  4JJN A;  5GXQ B;  3REH C;  4J8U D;  1BH8 A;  3B6F C;  5B31 C;  4CSR A;  4NE3 A;  5B31 B;  4ZUX D;  1P3A A;  3LZ1 C;  3W97 C;  1TZY C;  5B0Z A;  3MGP D;  1KX5 A;  3MGS A;  3R45 B;  4J8W D;  5G49 B;  3O62 C;  3KUY A;  2YFW B;  5AV6 B;  5F99 A;  5GT3 C;  1KX3 B;  3AZK A;  2RVQ D;  4H9S C;  3AZH A;  3X1U C;  3KXB B;  5CPJ D;  2HUE C;  2HUE B;  5B2I C;  5CP6 A;  1P3G C;  1P3G B;  3MNN D;  2NZD D;  3LZ0 D;  4YS3 C;  4H9O A;  4YS3 B;  1P34 B;  4ZBJ B;  4WU8 B;  4XUJ C;  1WWS A;  4KHA B;  3B6F A;  3V9R A;  4QLC A;  5B1L D;  4WNN B;  5BNX A;  4X23 C;  4Z66 C;  4Z66 B;  3AZN C;  1ZLA D;  1A7W A;  3W97 A;  4UUZ B;  1TZY A;  3UT9 A;  3WAA A;  4LD9 D;  3WTP A;  2F8N K;  1S32 A;  1P3F D;  5JA4 A;  3REK B;  5AV5 C;  5AV5 B;  5CPI A;  1M19 C;  2BYK B;  3X1V B;  4YM6 C;  3TU4 C;  1P3M B;  3C1B C;  3C1B B;  2NQB C;  4H9S A;  3X1U A;  4ZUX A;  1ID3 C;  3AV1 B;  1ID3 B;  3AYW C;  5B2I A;  3W96 D;  1HTA A;  1M18 D;  5BO0 B;  3MGP A;  3B6G C;  3B6G B;  3AFA D;  3X1S D;  5FUG B;  1JFI A;  2FJ7 C;  1F66 C;  3C1C B;  1F66 B;  5AVB B;  4X23 A;  3AZN A;  5B32 C;  5B32 B;  1KU5 A;  4H9P B;  4J8X D;  3WKJ C;  3AZL B;  2PYO C;  2JSS A;  1AOI D;  3AZJ C;  3AZJ B;  1HQ3 C;  1TAF A;  3LJA D;  3VH5 W;  5B1M D;  5CPJ A;  5E5A B;  4JJN D;  2NZD A;  4H9Q B;  3MNN A;  3VH6 A;  3LZ0 A;  1M19 A;  5GT0 C;  5GT0 B;  4YM6 A;  2F8N B;  5CPK B;  3TU4 A;  1P3A D;  5B0Z D;  2NQB A;  1M1A A;  4NFT A;  3AZI C;  3W98 D;  4CAY A;  3MGR B;  1R4V A;  5B1L A;  5AY8 C;  3MVD C;  4WV4 B;  3VH5 T;  1KX5 D;  5B33 B;  3MGS D;  3AN2 B;  1H3O A;  4LD9 A;  5AV8 C;  3KUY D;  5B40 C;  5AVC B;  2IO5 B;  1WWI A;  2FJ7 A;  1P3I A;  5BNV B;  5F99 D;  5GSU C;  3AZK D;  2CV5 A;  3REI D;  3AZH D;  4XZQ B;  5CHL B;  5CP6 D;  2PYO A;  1HQ3 A;  5B2J C;  5B2J B;  3AZE C;  3AZE B;  1P3L D;  4H9N A;  2ARO D;  5AV9 C;  3REH D;  3X1T C;  3X1T B;  5B31 G;  3B6F D;  4G91 C;  3KWQ C;  3KWQ B;  3X1S A;  3LZ1 D;  3W97 D;  1TZY D;  3A6N C;  5B0Y C;  5B0Y B;  4Z5T B;  3W99 C;  3A6N B;  3AZF C;  3AZI A;  5AY8 A;  3AV2 C;  1KX4 C;  5JRG C;  1AOI A;  5DNN A;  5CPI D;  3O62 D;  5B40 A;  2HIO C;  2HIO B;  5GXQ C;  5GT3 D;  5GSU A;  5B24 C;  5B24 B;  3B0D B;  3X1U D;  5B2I D;  1EQZ B;  1P3G D;  4YS3 D;  3W98 A;  4XUJ D;  4EO5 B;  4KGC B;  3WTP E;  1P3K C;  1P3K B;  3WA9 B;  3AZM C;  3AZM B;  4X23 D;  3AZN D;  4H9R B;  5AV6 C;  4J8V A;  3AZF A;  1P3P B;  1KX3 C;  3W99 A;  2L5A A;  3REI A;  1BH9 A;  3AV2 A;  3KSY A;  4HGA C;  4HGA B;  3KXB C;  1KX4 A;  5C3I C;  5C3I B;  3REJ B;  5AV5 D;  5DNM B;  4E44 A;  5BS7 A;  1M19 D;  1P3L A;  1P34 C;  4ZBJ C;  4WU8 C;  3B0C T;  4YM6 D;  3REL B;  3UT9 B;  2ARO A;  1B67 A;  3WTP B;  3REH A;  3TU4 D;  2NQB D;  3C1B D;  1B6W A;  1M1A D;  5B31 A;  4WU9 B;  5JA4 B;  3AZG B;  1ID3 D;  3AYW D;  1P3O C;  3LZ1 A;  1P3O B;  3MGQ C;  3MGQ B;  4R8P C;  4R8P B;  5BT1 C;  3B6G D;  4J8U B;  3R45 A;  2BYM B;  2FJ7 D;  1P3I D;  3REK C;  2F8N H;  5B32 G;  5G49 A;  3O62 A;  2CV5 D;  2YFW A;  5B32 D;  3X1V C;  3MGP B;  3UTA C;  3UTA B;  1F1E A;  3WKJ D;  2PYO D;  5AV6 A;  1KX3 A;  5GT3 A;  3AZJ D;  1P3M C;  1HQ3 D;  1JFI B;  4J8W B;  3KXB A;  3AV1 C;  1P3G A;  3NQU A;  1P3B C;  1P3B B;  4YS3 A;  2F8N G;  1P34 A;  4Z2M H;  5GT0 D;  4XUJ A;  3C1C C;  3AZI D;  5AVB C;  5AY8 D;  3MVD D;  4Z66 A;  2NZD B;  3MNN B;  3UTB C;  3UTB B;  3AZL C;  5AV8 D;  4Z2M G;  5DNN D;  5B40 D;  1N1J B;  4AWL C;  5E5A C;  4AWL B;  5B1L B;  5AV5 A;  5GSU D;  1ZLA C;  1ZLA B;  2BYK A;  3X1V A;  5CPK C;  5B2J D;  3C1B A;  5KDM A;  3AZE D;  1P3F B;  1P3F C;  4KUD B;  3MGR C;  4KUD C;  3AV1 A;  1ID3 A;  3AYW A;  5B33 C;  5AV9 D;  3AN2 C;  3X1T D;  5BO0 A;  3B6G A; 
#chains in the Genus database with same CATH topology
 4NE6 A;  3B0B A;  5AVC C;  5FUG A;  2IO5 C;  4WJ3 C;  4H9N B;  5B0Y D;  1F66 A;  3NQJ B;  3W99 D;  5AVB A;  4J8V D;  3AZF D;  3W96 B;  5B32 A;  3AV2 D;  1M18 B;  4H9P A;  1M18 C;  3LEL C;  4XZQ C;  3LEL B;  3AZL A;  1KX4 D;  3WKJ A;  5JRG D;  3AFA B;  3X1S B;  3AZJ A;  2HIO D;  1U35 C;  5E5A A;  2ZM5 A;  1U35 B;  5GXQ D;  5B24 D;  4J8X B;  5B31 D;  5GT0 A;  2F8N A;  4DRA A;  5CPK A;  1AOI B;  2YFV B;  4Z5T C;  3LJA B;  5B1M B;  3MVD A;  4JJN B;  5B33 A;  1BH8 B;  3AN2 A;  3AZM D;  4CSR B;  5AV8 A;  1P3A B;  5AVC A;  4G92 B;  5B0Z B;  3W98 B;  2Y2J A;  5AV6 D;  1KX3 D;  2UWX A;  3H0M C;  2J8P A;  3MGS B;  1KX5 B;  3B0D C;  4XZQ A;  3KXB D;  1EQZ C;  3KUY C;  3KUY B;  5B2J A;  3AZE A;  1P34 D;  4WU8 D;  4EO5 C;  3IP4 C;  4KGC C;  5F99 B;  3VH6 W;  5AV9 A;  3AZK B;  3AZK C;  3X1T A;  3WA9 C;  3AZH B;  3KWQ A;  5CP6 C;  4E45 A;  5CP6 B;  4Z66 D;  3B0C W;  1P3O D;  3MGQ D;  4H9O B;  4UPK A;  4R8P D;  2CWE A;  4Z5T A;  5BT1 D;  5B0Y A;  3A6N A;  1P3P C;  2ARO B;  3REH B;  3B6F B;  3VH6 T;  3V9R B;  4QLC C;  4QLC B;  5JRG A;  5BNX B;  3REJ C;  3REK D;  5DNM C;  3LZ1 B;  3W97 B;  1TZY B;  3X1V D;  3REL C;  2HIO A;  3WAA C;  3UTA D;  3UT9 C;  3WAA B;  3WTP C;  5GXQ A;  1P3M D;  1S32 C;  1S32 B;  5B24 A;  4WU9 C;  3AZG C;  3AV1 D;  3VH5 A;  4DRB A;  1EQZ A;  5CPI C;  5CPI B;  3O62 B;  1P3B D;  4KGC A;  5GT3 B;  1P3K A;  4J8U C;  3WA9 A;  3AZM A;  3C1C D;  3X1U B;  4ZUX C;  5AVB D;  4ZUX B;  4M6B A;  1F66 D;  4H9R A;  5B2I B;  3NQU B;  3EPK A;  3UTB D;  3A1K A;  3MGP C;  4DQY B;  3AZL D;  4XUJ B;  1P3P A;  1Z2C B;  4J8W C;  5E5A D;  4X23 B;  3AZN B;  3REJ A;  5DNM A;  2Y2Q A;  3KFU G;  4WU8 A;  3REL A;  2F8N D;  5CPK D;  2RVQ C;  4KHA A;  1TAF B;  4WU9 A;  4KUD D;  3MGR D;  5CPJ C;  5CPJ B;  3AZG A;  4WNN A;  2NZD C;  5B33 D;  3MNN C;  3AN2 D;  3LZ0 C;  4UUZ A;  3LZ0 B;  3MGQ A;  1P3O A;  1M19 B;  4YM6 B;  4R8P A;  3TU4 B;  5AVC D;  4J8U A;  2NQB B;  5KDM B;  2BYM A;  1M1A B;  1M1A C;  4CAY B;  5B1L C;  3REK A;  4NE5 A;  3AYW B;  2LY8 A;  1H3O B;  3UTA A;  3LEL D;  4XZQ D;  4LD9 C;  4LD9 B;  1P3M A;  4J8W A;  2FJ7 B;  1P3I C;  1P3I B;  1U35 D;  1ULY A;  2CV5 C;  2CV5 B;  3EPL A;  1P3B A;  3WKJ B;  2W8S A;  3KWQ D;  2PYO B;  1HQ3 B;  3F6T A;  3A6N D;  3C1C A;  4Z5T D;  3W96 C;  3P5J B;  3H0R C;  3UTB A;  3AFA C;  3X1S C;  3AL0 C;  1Q9C A;  1N1J A;  3AZI B;  5AY8 B;  3MVD B;  4H9Q A;  1ZLA A;  4WZS B;  4J8X C;  2DF4 C;  5AV8 B;  1AOI C;  5DNN C;  5DNN B;  2FFF B;  2VQR A;  1EQZ D;  5B40 B;  3EPJ A;  2ZY3 A;  1P3F A;  3LJA C;  4KUD A;  3MGR A;  5B1M C;  4JJN C;  4KGC D;  1P3K D;  5GSU B;  3WA9 D;  2ZY5 A;  1P3A C;  4G92 C;  5B0Z C;  3W98 C;  3NQJ A;  3W96 A;  5BNV A;  1P3P D;  1KX5 C;  5AV9 B;  3MGS C;  1M18 A;  3LEL A;  4G91 B;  4QLC D;  3REJ D;  3AFA A;  5DNM D;  3REL D;  3UT9 D;  3WAA D;  2ZY4 A;  4J8V C;  4J8V B;  3AZF B;  5F99 C;  1U35 A;  3W99 B;  3WTP D;  3REI C;  3REI B;  1BH9 B;  1S32 D;  3AV2 B;  4J8X A;  3AZH C;  4WU9 D;  1KX4 B;  3AZG D;  5JRG B;  2YFV A;  5BS7 C;  1BFM A;  1P3L C;  1P3L B;  3LJA A;  5B1M A;  2BG1 A;  2ARO C;  4JJN A;  5GXQ B;  3REH C;  4J8U D;  1BH8 A;  3B6F C;  5B31 C;  4CSR A;  4NE3 A;  5B31 B;  2Y2P A;  4ZUX D;  2Y2G A;  1P3A A;  3LZ1 C;  3W97 C;  1TZY C;  5B0Z A;  3MGP D;  2Y2L A;  1KX5 A;  3MGS A;  3R45 B;  4J8W D;  5G49 B;  3O62 C;  3KUY A;  2YFW B;  2XD5 A;  5AV6 B;  5F99 A;  5GT3 C;  1KX3 B;  3AZK A;  2RVQ D;  4H9S C;  3AZH A;  3X1U C;  3KXB B;  5CPJ D;  2HUE C;  2HUE B;  5B2I C;  5CP6 A;  1P3G C;  1P3G B;  3MNN D;  2NZD D;  3LZ0 D;  4YS3 C;  4H9O A;  4YS3 B;  1P34 B;  4ZBJ B;  4WU8 B;  4XUJ C;  1WWS A;  4KHA B;  3B6F A;  3V9R A;  4QLC A;  5B1L D;  4WNN B;  5BNX A;  4X23 C;  4Z66 C;  4Z66 B;  3AZN C;  1ZLA D;  1A7W A;  1W2E A;  4UUZ B;  3W97 A;  1TZY A;  3UT9 A;  3WAA A;  4LD9 D;  2G5I C;  1T3U A;  3WTP A;  2F8N K;  2Y2H A;  1S32 A;  1P3F D;  5JA4 A;  3REK B;  5AV5 C;  5AV5 B;  5CPI A;  1M19 C;  2BYK B;  3X1V B;  4YM6 C;  2G5H C;  3TU4 C;  1P3M B;  3C1B C;  3C1B B;  2NQB C;  4H9S A;  3X1U A;  4ZUX A;  1ID3 C;  3AV1 B;  1ID3 B;  3AYW C;  5B2I A;  3W96 D;  1HTA A;  1M18 D;  5BO0 B;  3MGP A;  3B6G C;  3B6G B;  3AFA D;  3X1S D;  5FUG B;  1JFI A;  2FJ7 C;  1F66 C;  3C1C B;  1F66 B;  5AVB B;  4X23 A;  3AZN A;  5B32 C;  5B32 B;  1KU5 A;  4H9P B;  4J8X D;  3WKJ C;  3AZL B;  2PYO C;  2JSS A;  1AOI D;  3AZJ C;  3AZJ B;  1HQ3 C;  2Y2I A;  1TAF A;  3LJA D;  3EG5 B;  3VH5 W;  5B1M D;  5CPJ A;  5E5A B;  4JJN D;  2NZD A;  4H9Q B;  3MNN A;  3VH6 A;  3LZ0 A;  1M19 A;  5GT0 C;  5GT0 B;  4YM6 A;  2F8N B;  5CPK B;  3TU4 A;  1P3A D;  5B0Z D;  2NQB A;  1M1A A;  4NFT A;  3AZI C;  3W98 D;  4CAY A;  3MGR B;  1R4V A;  5B1L A;  5AY8 C;  3MVD C;  4WV4 B;  3VH5 T;  1KX5 D;  5B33 B;  3MGS D;  3AN2 B;  1H3O A;  4LD9 A;  5AV8 C;  3KUY D;  5B40 C;  5AVC B;  2IO5 B;  1WWI A;  2FJ7 A;  1P3I A;  5BNV B;  5F99 D;  5GSU C;  3AZK D;  2CV5 A;  3REI D;  3AZH D;  4XZQ B;  5CHL B;  2JCH A;  5CP6 D;  2PYO A;  1PZR A;  1HQ3 A;  5B2J C;  5B2J B;  3AZE C;  3AZE B;  1P3L D;  4H9N A;  2ARO D;  5AV9 C;  3REH D;  3X1T C;  3X1T B;  5B31 G;  3B6F D;  4G91 C;  3KWQ C;  3KWQ B;  3X1S A;  3FDD A;  3LZ1 D;  3W97 D;  1TZY D;  2Y2M A;  5B0Y C;  5B0Y B;  4Z5T B;  3W99 C;  3A6N C;  3A6N B;  3AZF C;  3AZI A;  5AY8 A;  2DQN C;  3AV2 C;  1KX4 C;  5JRG C;  1AOI A;  5DNN A;  5CPI D;  3O62 D;  5B40 A;  2F2A C;  2HIO C;  2HIO B;  2RIQ A;  5GXQ C;  5GT3 D;  5GSU A;  5B24 C;  5B24 B;  3B0D B;  3X1U D;  5B2I D;  1EQZ B;  2ZY2 A;  1P3G D;  4YS3 D;  3W98 A;  4XUJ D;  4EO5 B;  4KGC B;  3WTP E;  1P3K C;  1P3K B;  3WA9 B;  3AZM C;  3AZM B;  2Y2O A;  3EPH A;  4X23 D;  3AZN D;  4H9R B;  2Y2N A;  5AV6 C;  4J8V A;  3AZF A;  1P3P B;  1KX3 C;  3W99 A;  2L5A A;  3REI A;  1BH9 A;  3AV2 A;  3KSY A;  4HGA C;  4HGA B;  3KXB C;  1KX4 A;  5C3I C;  5C3I B;  3REJ B;  5AV5 D;  5DNM B;  4E44 A;  5BS7 A;  1M19 D;  3H0L C;  1P34 C;  4ZBJ C;  4WU8 C;  3B0C T;  1P3L A;  4YM6 D;  3REL B;  3UT9 B;  2ARO A;  1B67 A;  3WTP B;  3REH A;  3TU4 D;  2NQB D;  3C1B D;  1B6W A;  1M1A D;  5B31 A;  4WU9 B;  5JA4 B;  3AZG B;  1ID3 D;  3AYW D;  1P3O C;  3LZ1 A;  1P3O B;  3MGQ C;  3MGQ B;  4R8P C;  4R8P B;  5BT1 C;  3B6G D;  2JE5 A;  2XD1 A;  4J8U B;  3R45 A;  2BYM B;  2FJ7 D;  1P3I D;  3REK C;  2F8N H;  5B32 G;  5G49 A;  3O62 A;  2CV5 D;  2YFW A;  5B32 D;  3X1V C;  3MGP B;  3UTA C;  3UTA B;  1F1E A;  3WKJ D;  2PYO D;  5AV6 A;  1KX3 A;  5GT3 A;  3AZJ D;  1P3M C;  1HQ3 D;  1JFI B;  4J8W B;  3KXB A;  3AV1 C;  1P3G A;  3NQU A;  1P3B C;  1P3B B;  4YS3 A;  2F8N G;  1P34 A;  4Z2M H;  5GT0 D;  4XUJ A;  3C1C C;  3AZI D;  5AVB C;  5AY8 D;  3MVD D;  4Z66 A;  2NZD B;  3MNN B;  3UTB C;  3UTB B;  3AZL C;  5AV8 D;  4Z2M G;  5DNN D;  2Y2K A;  5B40 D;  3A1I A;  1N1J B;  4AWL C;  5E5A C;  4AWL B;  5B1L B;  5AV5 A;  5GSU D;  1ZLA C;  1ZLA B;  2BYK A;  3X1V A;  5CPK C;  5B2J D;  3C1B A;  5KDM A;  3AZE D;  1P3F B;  1P3F C;  4KUD B;  3MGR C;  4KUD C;  3AV1 A;  1ID3 A;  3AYW A;  5B33 C;  5AV9 D;  3AN2 C;  3X1T D;  5BO0 A;  3B6G A; 
#chains in the Genus database with same CATH homology
 4NE6 A;  3B0B A;  5AVC C;  5FUG A;  2IO5 C;  4WJ3 C;  4H9N B;  5B0Y D;  1F66 A;  3NQJ B;  3W99 D;  5AVB A;  4J8V D;  3AZF D;  3W96 B;  5B32 A;  3AV2 D;  1M18 B;  4H9P A;  1M18 C;  3LEL C;  4XZQ C;  3LEL B;  3AZL A;  1KX4 D;  3WKJ A;  5JRG D;  3AFA B;  3X1S B;  3AZJ A;  2HIO D;  1U35 C;  5E5A A;  2ZM5 A;  1U35 B;  5GXQ D;  5B24 D;  4J8X B;  5B31 D;  5GT0 A;  2F8N A;  4DRA A;  5CPK A;  1AOI B;  2YFV B;  4Z5T C;  3LJA B;  5B1M B;  3MVD A;  4JJN B;  5B33 A;  1BH8 B;  3AN2 A;  3AZM D;  4CSR B;  5AV8 A;  1P3A B;  5AVC A;  4G92 B;  5B0Z B;  3W98 B;  2Y2J A;  5AV6 D;  1KX3 D;  2UWX A;  3H0M C;  2J8P A;  3MGS B;  1KX5 B;  3B0D C;  4XZQ A;  3KXB D;  1EQZ C;  3KUY C;  3KUY B;  5B2J A;  3AZE A;  1P34 D;  4WU8 D;  4EO5 C;  3IP4 C;  4KGC C;  5F99 B;  3VH6 W;  5AV9 A;  3AZK B;  3AZK C;  3X1T A;  3WA9 C;  3AZH B;  3KWQ A;  5CP6 C;  4E45 A;  5CP6 B;  4Z66 D;  3B0C W;  1P3O D;  3MGQ D;  4H9O B;  4UPK A;  4R8P D;  2CWE A;  4Z5T A;  5BT1 D;  5B0Y A;  3A6N A;  1P3P C;  2ARO B;  3REH B;  3B6F B;  3VH6 T;  3V9R B;  4QLC C;  4QLC B;  5JRG A;  5BNX B;  3REJ C;  3REK D;  5DNM C;  3LZ1 B;  3W97 B;  1TZY B;  3X1V D;  3REL C;  2HIO A;  3WAA C;  3UTA D;  3UT9 C;  3WAA B;  3WTP C;  5GXQ A;  1P3M D;  1S32 C;  1S32 B;  5B24 A;  4WU9 C;  3AZG C;  3AV1 D;  3VH5 A;  4DRB A;  1EQZ A;  5CPI C;  5CPI B;  3O62 B;  1P3B D;  4KGC A;  5GT3 B;  1P3K A;  4J8U C;  3WA9 A;  3AZM A;  3C1C D;  3X1U B;  4ZUX C;  5AVB D;  4ZUX B;  4M6B A;  1F66 D;  4H9R A;  5B2I B;  3NQU B;  3EPK A;  3UTB D;  3A1K A;  3MGP C;  4DQY B;  3AZL D;  4XUJ B;  1P3P A;  1Z2C B;  4J8W C;  5E5A D;  4X23 B;  3AZN B;  3REJ A;  5DNM A;  2Y2Q A;  3KFU G;  4WU8 A;  3REL A;  2F8N D;  5CPK D;  2RVQ C;  4KHA A;  1TAF B;  4WU9 A;  4KUD D;  3MGR D;  5CPJ C;  5CPJ B;  3AZG A;  4WNN A;  2NZD C;  5B33 D;  3MNN C;  3AN2 D;  3LZ0 C;  4UUZ A;  3LZ0 B;  3MGQ A;  1P3O A;  1M19 B;  4YM6 B;  4R8P A;  3TU4 B;  5AVC D;  4J8U A;  2NQB B;  5KDM B;  2BYM A;  1M1A B;  1M1A C;  4CAY B;  5B1L C;  3REK A;  4NE5 A;  3AYW B;  2LY8 A;  1H3O B;  3UTA A;  3LEL D;  4XZQ D;  4LD9 C;  4LD9 B;  1P3M A;  4J8W A;  2FJ7 B;  1P3I C;  1P3I B;  1U35 D;  1ULY A;  2CV5 C;  2CV5 B;  3EPL A;  1P3B A;  3WKJ B;  2W8S A;  3KWQ D;  2PYO B;  1HQ3 B;  3F6T A;  3A6N D;  3C1C A;  4Z5T D;  3W96 C;  3P5J B;  3H0R C;  3UTB A;  3AFA C;  3X1S C;  3AL0 C;  1Q9C A;  1N1J A;  3AZI B;  5AY8 B;  3MVD B;  4H9Q A;  1ZLA A;  4WZS B;  4J8X C;  2DF4 C;  5AV8 B;  1AOI C;  5DNN C;  5DNN B;  2FFF B;  2VQR A;  1EQZ D;  5B40 B;  3EPJ A;  2ZY3 A;  1P3F A;  3LJA C;  4KUD A;  3MGR A;  5B1M C;  4JJN C;  4KGC D;  1P3K D;  5GSU B;  3WA9 D;  2ZY5 A;  1P3A C;  4G92 C;  5B0Z C;  3W98 C;  3NQJ A;  3W96 A;  5BNV A;  1P3P D;  1KX5 C;  5AV9 B;  3MGS C;  1M18 A;  3LEL A;  4G91 B;  4QLC D;  3REJ D;  3AFA A;  5DNM D;  3REL D;  3UT9 D;  3WAA D;  2ZY4 A;  4J8V C;  4J8V B;  3AZF B;  5F99 C;  1U35 A;  3W99 B;  3WTP D;  3REI C;  3REI B;  1BH9 B;  1S32 D;  3AV2 B;  4J8X A;  3AZH C;  4WU9 D;  1KX4 B;  3AZG D;  5JRG B;  2YFV A;  5BS7 C;  1BFM A;  1P3L C;  1P3L B;  3LJA A;  5B1M A;  2BG1 A;  2ARO C;  4JJN A;  5GXQ B;  3REH C;  4J8U D;  1BH8 A;  3B6F C;  5B31 C;  4CSR A;  4NE3 A;  5B31 B;  2Y2P A;  4ZUX D;  2Y2G A;  1P3A A;  3LZ1 C;  3W97 C;  1TZY C;  5B0Z A;  3MGP D;  2Y2L A;  1KX5 A;  3MGS A;  3R45 B;  4J8W D;  5G49 B;  3O62 C;  3KUY A;  2YFW B;  2XD5 A;  5AV6 B;  5F99 A;  5GT3 C;  1KX3 B;  3AZK A;  2RVQ D;  4H9S C;  3AZH A;  3X1U C;  3KXB B;  5CPJ D;  2HUE C;  2HUE B;  5B2I C;  5CP6 A;  1P3G C;  1P3G B;  3MNN D;  2NZD D;  3LZ0 D;  4YS3 C;  4H9O A;  4YS3 B;  1P34 B;  4ZBJ B;  4WU8 B;  4XUJ C;  1WWS A;  4KHA B;  3B6F A;  3V9R A;  4QLC A;  5B1L D;  4WNN B;  5BNX A;  4X23 C;  4Z66 C;  4Z66 B;  3AZN C;  1ZLA D;  1A7W A;  1W2E A;  4UUZ B;  3W97 A;  1TZY A;  3UT9 A;  3WAA A;  4LD9 D;  2G5I C;  1T3U A;  3WTP A;  2F8N K;  2Y2H A;  1S32 A;  1P3F D;  5JA4 A;  3REK B;  5AV5 C;  5AV5 B;  5CPI A;  1M19 C;  2BYK B;  3X1V B;  4YM6 C;  2G5H C;  3TU4 C;  1P3M B;  3C1B C;  3C1B B;  2NQB C;  4H9S A;  3X1U A;  4ZUX A;  1ID3 C;  3AV1 B;  1ID3 B;  3AYW C;  5B2I A;  3W96 D;  1HTA A;  1M18 D;  5BO0 B;  3MGP A;  3B6G C;  3B6G B;  3AFA D;  3X1S D;  5FUG B;  1JFI A;  2FJ7 C;  1F66 C;  3C1C B;  1F66 B;  5AVB B;  4X23 A;  3AZN A;  5B32 C;  5B32 B;  1KU5 A;  4H9P B;  4J8X D;  3WKJ C;  3AZL B;  2PYO C;  2JSS A;  1AOI D;  3AZJ C;  3AZJ B;  1HQ3 C;  2Y2I A;  1TAF A;  3LJA D;  3EG5 B;  3VH5 W;  5B1M D;  5CPJ A;  5E5A B;  4JJN D;  2NZD A;  4H9Q B;  3MNN A;  3VH6 A;  3LZ0 A;  1M19 A;  5GT0 C;  5GT0 B;  4YM6 A;  2F8N B;  5CPK B;  3TU4 A;  1P3A D;  5B0Z D;  2NQB A;  1M1A A;  4NFT A;  3AZI C;  3W98 D;  4CAY A;  3MGR B;  1R4V A;  5B1L A;  5AY8 C;  3MVD C;  4WV4 B;  3VH5 T;  1KX5 D;  5B33 B;  3MGS D;  3AN2 B;  1H3O A;  4LD9 A;  5AV8 C;  3KUY D;  5B40 C;  5AVC B;  2IO5 B;  1WWI A;  2FJ7 A;  1P3I A;  5BNV B;  5F99 D;  5GSU C;  3AZK D;  2CV5 A;  3REI D;  3AZH D;  4XZQ B;  5CHL B;  2JCH A;  5CP6 D;  2PYO A;  1PZR A;  1HQ3 A;  5B2J C;  5B2J B;  3AZE C;  3AZE B;  1P3L D;  4H9N A;  2ARO D;  5AV9 C;  3REH D;  3X1T C;  3X1T B;  5B31 G;  3B6F D;  4G91 C;  3KWQ C;  3KWQ B;  3X1S A;  3FDD A;  3LZ1 D;  3W97 D;  1TZY D;  2Y2M A;  5B0Y C;  5B0Y B;  4Z5T B;  3W99 C;  3A6N C;  3A6N B;  3AZF C;  3AZI A;  5AY8 A;  2DQN C;  3AV2 C;  1KX4 C;  5JRG C;  1AOI A;  5DNN A;  5CPI D;  3O62 D;  5B40 A;  2F2A C;  2HIO C;  2HIO B;  2RIQ A;  5GXQ C;  5GT3 D;  5GSU A;  5B24 C;  5B24 B;  3B0D B;  3X1U D;  5B2I D;  1EQZ B;  2ZY2 A;  1P3G D;  4YS3 D;  3W98 A;  4XUJ D;  4EO5 B;  4KGC B;  3WTP E;  1P3K C;  1P3K B;  3WA9 B;  3AZM C;  3AZM B;  2Y2O A;  3EPH A;  4X23 D;  3AZN D;  4H9R B;  2Y2N A;  5AV6 C;  4J8V A;  3AZF A;  1P3P B;  1KX3 C;  3W99 A;  2L5A A;  3REI A;  1BH9 A;  3AV2 A;  3KSY A;  4HGA C;  4HGA B;  3KXB C;  1KX4 A;  5C3I C;  5C3I B;  3REJ B;  5AV5 D;  5DNM B;  4E44 A;  5BS7 A;  1M19 D;  3H0L C;  1P34 C;  4ZBJ C;  4WU8 C;  3B0C T;  1P3L A;  4YM6 D;  3REL B;  3UT9 B;  2ARO A;  1B67 A;  3WTP B;  3REH A;  3TU4 D;  2NQB D;  3C1B D;  1B6W A;  1M1A D;  5B31 A;  4WU9 B;  5JA4 B;  3AZG B;  1ID3 D;  3AYW D;  1P3O C;  3LZ1 A;  1P3O B;  3MGQ C;  3MGQ B;  4R8P C;  4R8P B;  5BT1 C;  3B6G D;  2JE5 A;  2XD1 A;  4J8U B;  3R45 A;  2BYM B;  2FJ7 D;  1P3I D;  3REK C;  2F8N H;  5B32 G;  5G49 A;  3O62 A;  2CV5 D;  2YFW A;  5B32 D;  3X1V C;  3MGP B;  3UTA C;  3UTA B;  1F1E A;  3WKJ D;  2PYO D;  5AV6 A;  1KX3 A;  5GT3 A;  3AZJ D;  1P3M C;  1HQ3 D;  1JFI B;  4J8W B;  3KXB A;  3AV1 C;  1P3G A;  3NQU A;  1P3B C;  1P3B B;  4YS3 A;  2F8N G;  1P34 A;  4Z2M H;  5GT0 D;  4XUJ A;  3C1C C;  3AZI D;  5AVB C;  5AY8 D;  3MVD D;  4Z66 A;  2NZD B;  3MNN B;  3UTB C;  3UTB B;  3AZL C;  5AV8 D;  4Z2M G;  5DNN D;  2Y2K A;  5B40 D;  3A1I A;  1N1J B;  4AWL C;  5E5A C;  4AWL B;  5B1L B;  5AV5 A;  5GSU D;  1ZLA C;  1ZLA B;  2BYK A;  3X1V A;  5CPK C;  5B2J D;  3C1B A;  5KDM A;  3AZE D;  1P3F B;  1P3F C;  4KUD B;  3MGR C;  4KUD C;  3AV1 A;  1ID3 A;  3AYW A;  5B33 C;  5AV9 D;  3AN2 C;  3X1T D;  5BO0 A;  3B6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...