5CPKA

Nucleosome containing methylated sat2l dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpkA00
3W96D 2HIOC 3AYWA 3WAAA 5B1LC 5B40C 1P3AB 5DNNA 4Z5TA 5AY8B 3B0DB 5FUGB 1P3GB 4J8UC 3AN2A 1TZYD 4UUZB 4DRAA 3VH6A 3KXBD 4J8XD 1P3AA 3AZID 5B31D 5AVBC 5B32G 1AOIC 4R8PC 5CPKB 1P3BD 4WNNA 5B33D 3AZLB 3WKJA 3UTAA 2BYMA 1N1JA 3AZLD 1TAFB 4J8VB 1P3LD 5AV8A 2PYOB 3REJB 3AZHA 2IO5C 5B2JC 1P3KD 5B2JA 5F99D 4Z66A 5CPID 3AZGB 2CV5D 4J8UB 3W97D 3C1CC 3B6GD 5B1MB 1AOIB 2IO5B 5DNMC 4WU9D 4H9QA 5B0YA 1HQ3D 3AZJA 3W98B 3C1BA 3W96C 3AZGA 4ZUXC 3UTBB 1EQZD 4KHAA 3X1TC 3B6GC 3X1SB 2NZDD 3LZ0D 4H9OB 2AROD 5AV5B 5JRGB 4H9PA 3MNNC 5CP6C 2PYOC 2BYMB 3MVDD 1WWIA 3LELD 4J8VC 2HIOD 5GT3B 5JRGA 1F66C 3WA9B 2HIOB 5BT1D 5GT3D 3MGSC 4QLCD 4WZSB 3REJC 5DNNB 3O62C 1P34A 2NQBC 4Z5TC 3AYWB 2LY8A 1M1AD 3UTBA 5CPJC 1A7WA 3X1UC 1P3LC 1KX3B 3NQJA 3AZFC 4XUJD 5BNVA 5BO0B 3RELA 3VH5A 1ZLAB 3WTPA 3KUYC 3AN2D 1P3KA 1S32B 3LZ1A 1HQ3A 3AZJD 2PYOA 3W97A 2CV5A 4YS3D 2NQBA 5BNXA 1F66A 3AZLA 1M1AC 3AV1A 1P3LB 1KX3C 3AV1C 1M19B 3UT9D 5B2IC 5B0YC 3TU4B 1JFIB 1P3FC 3VH5W 3AZFB 2L5AA 3X1TA 5B0ZC 2AROA 5AV8B 5B1MC 4NE3A 3LELA 5AV9A 1S32C 4WU8A 3W99A 4Z66D 3LZ0B 5AVCA 5CPKA 3X1SC 5B0ZD 4KGCB 3AZKD 3A6NB 5B40D 4YM6B 3MNND 5GSUB 3MNNB 5GXQD 5B0YD 3MGPB 1P3PC 1KX4C 5JRGC 1EQZA 4XUJA 5GT3A 4J8WB 3V9RB 3WTPD 3WA9C 3AZMB 3C1BC 4XZQD 5KDMB 5AV6C 4Z2MH 3A6NC 3REHB 4H9SC 3REKD 5JRGD 3AV2A 4QLCA 3MGSD 4G92C 1P3MB 5CPKC 3AYWC 3NQUA 3AZJB 1P3IB 3R45B 4HGAB 1M18B 3LZ1D 5CPJD 4Z66B 5B24B 4G92B 5B0ZA 1P3MC 4J8XB 4XUJC 2YFWB 1KX4B 1M19C 5AV6A 1BH8A 1N1JB 3W96A 3WAAD 4WNNB 3MGQC 4R8PA 5B2IB 4CAYA 1P3MD 5DNND 3R45A 3MGRD 3X1TD 1P3PD 3AFAD 1H3OB 1P3IA 1WWSA 4ZBJB 1M1AB 5E5AC 5CHLB 5AV9C 4J8WD 1Q9CA 2CWEA 5B32D 5DNMD 1ID3A 2FJ7B 3WKJD 3X1UB 1KX5D 5AV5D 2BYKB 1P3GA 4KUDA 3X1UA 3MGPD 4Z5TB 3AV2D 5GXQB 3MGQA 5C3IB 4Z2MG 1U35C 4LD9A 4J8XA 1P3AD 3MNNA 4E45A 5JA4A 3C1BB 3VH6T 5AV6D 5DNMB 1KX5B 1R4VA 3LZ1C 3REKC 3B0CT 5B2JD 3REJD 1P3KC 2FJ7D 4WU9A 2HUEB 3AV1B 1P3MA 4H9PB 2F8NG 1BH8B 3VH5T 4H9OA 5AV5C 3AFAB 3X1TB 3AZNA 4KUDC 5B33B 4ZUXD 5CPJA 3WTPB 4AWLC 1P3FA 3WTPE 2NZDA 5B32C 5B31C 5BO0A 5B1MA 1BFMA 2AROC 3KWQB 4H9NB 3NQJB 4H9SA 1KX4D 5CP6B 1S32D 3KXBB 4J8UD 3MGQD 2HUEC 2F8NA 5GSUC 3AZGD 3AV2B 5GSUA 1ZLAD 4WU9C 3LZ1B 1HQ3C 4X23D 3MGRA 3AZKC 1ULYA 1P3OC 2YFVA 4NFTA 4G91C 4H9RA 4J8WA 2BYKA 4KUDB 3MVDA 2YFVB 3B6FD 5B32A 4R8PD 1P3AC 1ID3D 3AZED 1ID3B 1P3GC 3WTPC 4AWLB 3UTBC 4ZBJC 3WA9D 1JFIA 2FJ7C 4JJNA 5BS7A 4H9QB 5B0YB 3TU4C 3A6NA 5B2ID 4M6BA 3TU4A 1P34B 2HIOA 4YS3A 3W98D 1P3IC 4DRBA 5GXQC 1AOID 5AV5A 1P3GD 5AY8C 3UTBD 3MVDC 3X1UD 4E44A 1KX4A 5B40B 4YM6D 3REJA 5B0ZB 4KGCD 5GT0D 3KUYD 3W98C 1TZYC 4J8VA 2NQBD 1M18D 4WV4B 1EQZC 1U35D 1M19A 4X23C 5B24C 1P3PB 3AZGC 2PYOD 3AZND 1ZLAC 4JJNC 3REIB 4ZUXA 3AZNB 3UT9C 5B40A 5DNNC 3O62B 3AV1D 4QLCC 3AZMC 3AZMA 5GXQA 5B31B 5E5AA 3MGQB 3MVDB 3AN2B 5AV9D 3V9RA 5BNVB 4J8WC 5E5AB 1KX3A 5AVCD 5B1LA 3O62A 4CSRA 3MGRC 3AZKA 1EQZB 4X23A 4KHAB 4ZUXB 1TZYB 4CSRB 3AZKB 4YM6A 1P3BA 3LJAB 1HTAA 3AZJC 3REHD 3B6GB 4J8XC 4WU8B 4CAYB 3W99B 4LD9C 3X1VA 3C1CD 3W96B 5B31A 5F99B 5AY8A 5CPIB 1U35B 3LELB 4KGCC 5AVBB 3B0BA 3X1SA 5GT0A 3AZFD 3C1BD 4J8VD 3KSYA 3W99C 4WU8C 3AZIA 3AZEA 3AZIC 3MGPC 1ID3C 3KWQA 2RVQD 1P3LA 5B2IA 3A6ND 2NZDB 5BNXB 5B33A 1P3OD 5B31G 3AZIB 3B0CW 5CP6D 4LD9B 1P34D 2CV5B 3W97B 1U35A 5E5AD 3LJAC 5AV8D 5AVBA 5B32B 5B24A 1TAFA 3UTAB 4H9RB 5F99A 1BH9B 3KUYA 5CPIA 5F99C 5CPIC 1M18A 3B6GA 1KX5A 4JJNB 3REIC 3NQUB 3X1VD 1M19D 3WAAB 1B6WA 3REKB 3MGPA 4Z66C 4X23B 3AN2C 4QLCB 3AZHC 4H9NA 5KDMA 3REHA 4LD9D 3AZNC 5C3IC 1P34C 5AVCB 3LZ0A 1P3FB 5G49B 3KWQD 5CPJB 5BS7C 2FJ7A 4XUJB 3UT9A 4HGAC 1M18C 2RVQC 3B6FC 2F8NB 1KX3D 2YFWA 3REIA 3WKJC 3MGSB 1P3OA 3O62D 3UTAC 5CP6A 3RELD 1M1AA 5AY8D 5AVBD 4EO5C 4J8UA 5B2JB 3C1CA 3LJAD 5AV6B 3REHC 3AZHB 1F66D 2AROB 3KWQC 3B6FB 5GT0B 3C1CB 3UT9B 3AV2C 3LELC 1S32A 1F1EA 3X1SD 3AZFA 2F8ND 3KXBC 5G49A 5GSUD 1ZLAA 2F8NH 2NZDC 3RELB 4WU9B 4Z5TD 5AV8C 4YS3B 5B1MD 5GT0C 4G91B 5B24D 1TZYA 3REKA 1P3FD 3AZLC 4UUZA 3AFAC 1H3OA 1P3KB 4EO5B 3WA9A 4R8PB 4JJND 3X1VB 2JSSA 3TU4D 4YM6C 3MGRB 5FUGA 3W99D 4WU8D 4NE5A 4YS3C 4NE6A 3B6FA 5CPKD 1P3BB 3AYWD 3UTAD 3RELC 3KXBA 5B33C 5B1LB 4XZQC 5AVCC 4KGCA 4XZQA 1BH9A 3KUYB 3AZEC 5AV9B 3MGSA 1P3OB 3AFAA 1P3ID 1KX5C 3B0DC 1P3BC 1HQ3B 1B67A 5BT1C 5GT3C 3W98A 3X1VC 3REID 1P3PA 3WKJB 5B1LD 1AOIA 4XZQB 3VH6W 3AZMD 3LJAA 4KUDD 5JA4B 3LZ0C 3AZHD 1F66B 2F8NK 5DNMA 3AZEB 1KU5A 2CV5C 3W97C 2NQBB 3WAAC
chains in the Genus database with same CATH superfamily
3W96D 2HIOC 3AYWA 3WAAA 5B1LC 5B40C 1P3AB 5DNNA 4Z5TA 5AY8B 3B0DB 5FUGB 1P3GB 1PZRA 4J8UC 3AN2A 2RIQA 1TZYD 4UUZB 4DRAA 3VH6A 3KXBD 4J8XD 1P3AA 3AZID 5B31D 5AVBC 1Z2CB 5B32G 2Y2MA 1AOIC 4R8PC 3A1KA 5CPKB 1P3BD 4WNNA 3EG5B 5B33D 3AZLB 3WKJA 3UTAA 2BYMA 1N1JA 3AZLD 1TAFB 4J8VB 1P3LD 5AV8A 2PYOB 3REJB 3AZHA 2IO5C 5B2JC 1P3KD 5B2JA 5F99D 4Z66A 5CPID 3AZGB 3H0LC 2JCHA 2CV5D 4J8UB 3W97D 3C1CC 3B6GD 5B1MB 1AOIB 2IO5B 5DNMC 4WU9D 4H9QA 5B0YA 1HQ3D 3AZJA 3W98B 3C1BA 3W96C 3AZGA 4ZUXC 3UTBB 1EQZD 4KHAA 3X1TC 3B6GC 3X1SB 2G5IC 2NZDD 1T3UA 3LZ0D 4H9OB 2AROD 5AV5B 2VQRA 5JRGB 4H9PA 3MNNC 5CP6C 2PYOC 2BYMB 3MVDD 1WWIA 3LELD 4J8VC 2HIOD 5GT3B 5JRGA 1F66C 3WA9B 2HIOB 2XD5A 5BT1D 5GT3D 4QLCD 4WZSB 3MGSC 5DNNB 3O62C 3REJC 1P34A 2NQBC 4Z5TC 3AYWB 2LY8A 3H0MC 1M1AD 3UTBA 5CPJC 1A7WA 3X1UC 1P3LC 1KX3B 3NQJA 3AZFC 4XUJD 5BNVA 5BO0B 3RELA 3A1IA 3VH5A 1ZLAB 3WTPA 3KUYC 3EPHA 3AN2D 1P3KA 1S32B 3LZ1A 1HQ3A 3AZJD 2PYOA 3W97A 2CV5A 4YS3D 2NQBA 5BNXA 1F66A 3AZLA 1M1AC 3AV1A 1P3LB 1KX3C 3AV1C 2DF4C 1M19B 3UT9D 5B2IC 5B0YC 3TU4B 1JFIB 1P3FC 3VH5W 3AZFB 2ZY4A 2L5AA 3X1TA 5B0ZC 2AROA 5AV8B 5B1MC 4NE3A 3LELA 5AV9A 1S32C 4WU8A 3W99A 4Z66D 5AVCA 3LZ0B 5CPKA 3X1SC 5B0ZD 4KGCB 3AZKD 3A6NB 5B40D 4YM6B 3MNND 5GSUB 3MNNB 5GXQD 5B0YD 3MGPB 1P3PC 2ZY2A 2BG1A 1KX4C 5JRGC 1EQZA 4XUJA 5GT3A 4J8WB 3V9RB 3WTPD 3WA9C 3AZMB 3C1BC 4XZQD 5KDMB 5AV6C 4Z2MH 3A6NC 3REHB 4H9SC 3REKD 5JRGD 3AV2A 2XD1A 4QLCA 3MGSD 4G92C 1P3MB 5CPKC 3AYWC 3NQUA 3AZJB 1P3IB 3R45B 4HGAB 1M18B 3LZ1D 5CPJD 4UPKA 4Z66B 5B24B 4G92B 5B0ZA 1P3MC 4J8XB 4XUJC 2YFWB 1KX4B 1W2EA 1M19C 5AV6A 1BH8A 2ZY3A 1N1JB 3W96A 3WAAD 4WNNB 3MGQC 4R8PA 5B2IB 4CAYA 3EPLA 5DNND 3R45A 3MGRD 3X1TD 1P3MD 1P3PD 3AFAD 1H3OB 1P3IA 1WWSA 4ZBJB 1M1AB 5E5AC 5CHLB 2Y2OA 5AV9C 4J8WD 1Q9CA 2CWEA 5B32D 5DNMD 1ID3A 2FJ7B 3WKJD 3X1UB 1KX5D 5AV5D 2BYKB 1P3GA 4KUDA 3X1UA 3MGPD 4Z5TB 3AV2D 5GXQB 3MGQA 5C3IB 4Z2MG 1U35C 4LD9A 4J8XA 1P3AD 3MNNA 4E45A 5JA4A 3C1BB 3VH6T 5AV6D 5DNMB 1KX5B 1R4VA 3P5JB 3LZ1C 3REKC 3B0CT 5B2JD 3REJD 1P3KC 2FJ7D 4WU9A 2HUEB 3AV1B 1P3MA 4H9PB 2F8NG 1BH8B 3VH5T 4H9OA 5AV5C 3AFAB 3X1TB 3AZNA 2J8PA 3FDDA 4KUDC 5B33B 4ZUXD 5CPJA 3WTPB 4AWLC 1P3FA 3WTPE 2NZDA 5B32C 5B31C 5BO0A 5B1MA 1BFMA 2AROC 3KWQB 4H9NB 3NQJB 4H9SA 2G5HC 1KX4D 5CP6B 1S32D 3KXBB 4J8UD 3MGQD 2HUEC 2F8NA 5GSUC 3AZGD 3AV2B 5GSUA 1ZLAD 4WU9C 3LZ1B 1HQ3C 4X23D 3MGRA 3AZKC 1ULYA 1P3OC 2YFVA 4NFTA 4G91C 2JE5A 4H9RA 4J8WA 2BYKA 4KUDB 3MVDA 2YFVB 3B6FD 5B32A 4R8PD 1P3AC 2F2AC 1ID3D 3AZED 1ID3B 2Y2LA 1P3GC 3WTPC 4AWLB 3UTBC 4ZBJC 3WA9D 1JFIA 2FJ7C 4JJNA 5BS7A 4H9QB 5B0YB 3TU4C 5B2ID 4M6BA 3A6NA 3TU4A 1P34B 2HIOA 4YS3A 3W98D 1P3IC 4DRBA 5GXQC 1AOID 5AV5A 1P3GD 5AY8C 3UTBD 3MVDC 3X1UD 4E44A 1KX4A 5B40B 4YM6D 3REJA 5B0ZB 4KGCD 5GT0D 3H0RC 3KUYD 3W98C 1TZYC 4J8VA 2NQBD 1M18D 4WV4B 1EQZC 1U35D 1M19A 4X23C 5B24C 1P3PB 3AZGC 2PYOD 3AZND 1ZLAC 4JJNC 3REIB 4ZUXA 3AZNB 3UT9C 5B40A 5DNNC 3O62B 3AV1D 4QLCC 3AZMC 3AZMA 5GXQA 5B31B 5E5AA 3MGQB 3MVDB 3AN2B 5AV9D 3V9RA 5BNVB 4J8WC 2Y2GA 5E5AB 1KX3A 5AVCD 5B1LA 3O62A 4CSRA 3MGRC 3AZKA 1EQZB 4X23A 4KHAB 4ZUXB 1TZYB 4CSRB 3AZKB 4YM6A 1P3BA 3LJAB 1HTAA 2UWXA 3AZJC 3REHD 3B6GB 4J8XC 4WU8B 4CAYB 3W99B 4LD9C 3X1VA 3C1CD 3W96B 5B31A 5F99B 5AY8A 5CPIB 4WJ3C 1U35B 3LELB 4KGCC 5AVBB 3B0BA 3X1SA 5GT0A 3AZFD 3C1BD 4J8VD 3KSYA 3W99C 4WU8C 3AZIA 3AZEA 3AZIC 3MGPC 1ID3C 3KWQA 2RVQD 1P3LA 5B2IA 3A6ND 2NZDB 2Y2NA 3F6TA 5BNXB 5B33A 1P3OD 5B31G 3AZIB 3B0CW 5CP6D 4LD9B 1P34D 2CV5B 3W97B 2ZY5A 1U35A 5E5AD 3LJAC 5AV8D 5AVBA 5B32B 5B24A 1TAFA 3UTAB 4H9RB 5F99A 1BH9B 3KUYA 5CPIA 5F99C 5CPIC 3IP4C 1M18A 3B6GA 1KX5A 4JJNB 3REIC 3NQUB 3X1VD 1M19D 2W8SA 3WAAB 1B6WA 3REKB 3MGPA 4Z66C 4X23B 3AN2C 4QLCB 3AZHC 4H9NA 5KDMA 3REHA 4LD9D 3AZNC 5C3IC 1P34C 5AVCB 3LZ0A 1P3FB 5G49B 3KWQD 2Y2IA 5BS7C 5CPJB 2FJ7A 3EPKA 4XUJB 3UT9A 4HGAC 2DQNC 1M18C 2RVQC 3B6FC 2F8NB 3EPJA 1KX3D 2YFWA 3REIA 3WKJC 3MGSB 1P3OA 3O62D 3UTAC 2FFFB 5CP6A 3RELD 1M1AA 3AL0C 5AY8D 5AVBD 2Y2JA 4EO5C 2Y2PA 4J8UA 5B2JB 3C1CA 3LJAD 5AV6B 3REHC 3AZHB 1F66D 2AROB 3KWQC 3B6FB 5GT0B 3C1CB 3UT9B 3AV2C 3LELC 1S32A 1F1EA 3X1SD 3AZFA 2F8ND 3KXBC 5G49A 5GSUD 1ZLAA 2F8NH 2NZDC 3RELB 4WU9B 4Z5TD 5AV8C 4YS3B 5B1MD 5GT0C 4G91B 3KFUG 5B24D 1TZYA 3REKA 1P3FD 3AZLC 4UUZA 3AFAC 1H3OA 1P3KB 4EO5B 3WA9A 4R8PB 4JJND 3X1VB 2JSSA 3TU4D 4YM6C 2Y2KA 5FUGA 3W99D 3MGRB 4WU8D 4NE5A 4YS3C 4NE6A 3B6FA 5CPKD 1P3BB 3AYWD 3UTAD 2Y2HA 3RELC 3KXBA 5B33C 5B1LB 4XZQC 5AVCC 4KGCA 4XZQA 1BH9A 3KUYB 2Y2QA 3AZEC 5AV9B 3MGSA 4DQYB 1P3OB 3AFAA 1P3ID 1KX5C 3B0DC 1P3BC 1HQ3B 1B67A 5BT1C 5GT3C 3W98A 3X1VC 3REID 1P3PA 3WKJB 5B1LD 1AOIA 4XZQB 3VH6W 3AZMD 3LJAA 4KUDD 5JA4B 3LZ0C 3AZHD 1F66B 2F8NK 5DNMA 3AZEB 1KU5A 2CV5C 3W97C 2ZM5A 2NQBB 3WAAC
chains in the Genus database with same CATH topology
3W96D 2HIOC 3AYWA 3WAAA 5B1LC 5B40C 1P3AB 5DNNA 4Z5TA 5AY8B 3B0DB 5FUGB 1P3GB 1PZRA 4J8UC 3AN2A 2RIQA 1TZYD 4UUZB 4DRAA 3VH6A 3KXBD 4J8XD 1P3AA 3AZID 5B31D 5AVBC 1Z2CB 5B32G 2Y2MA 1AOIC 4R8PC 3A1KA 5CPKB 1P3BD 4WNNA 3EG5B 5B33D 3AZLB 3WKJA 3UTAA 2BYMA 1N1JA 3AZLD 1TAFB 4J8VB 1P3LD 5AV8A 2PYOB 3REJB 3AZHA 2IO5C 5B2JC 1P3KD 5B2JA 5F99D 4Z66A 5CPID 3AZGB 3H0LC 2JCHA 2CV5D 4J8UB 3W97D 3C1CC 3B6GD 5B1MB 1AOIB 2IO5B 5DNMC 4WU9D 4H9QA 5B0YA 1HQ3D 3AZJA 3W98B 3C1BA 3W96C 3AZGA 4ZUXC 3UTBB 1EQZD 4KHAA 3X1TC 3B6GC 3X1SB 2G5IC 2NZDD 1T3UA 3LZ0D 4H9OB 2AROD 5AV5B 2VQRA 5JRGB 4H9PA 3MNNC 5CP6C 2PYOC 2BYMB 3MVDD 1WWIA 3LELD 4J8VC 2HIOD 5GT3B 5JRGA 1F66C 3WA9B 2HIOB 2XD5A 5BT1D 5GT3D 4QLCD 4WZSB 3MGSC 5DNNB 3O62C 3REJC 1P34A 2NQBC 4Z5TC 3AYWB 2LY8A 3H0MC 1M1AD 3UTBA 5CPJC 1A7WA 3X1UC 1P3LC 1KX3B 3NQJA 3AZFC 4XUJD 5BNVA 5BO0B 3RELA 3A1IA 3VH5A 1ZLAB 3WTPA 3KUYC 3EPHA 3AN2D 1P3KA 1S32B 3LZ1A 1HQ3A 3AZJD 2PYOA 3W97A 2CV5A 4YS3D 2NQBA 5BNXA 1F66A 3AZLA 1M1AC 3AV1A 1P3LB 1KX3C 3AV1C 2DF4C 1M19B 3UT9D 5B2IC 5B0YC 3TU4B 1JFIB 1P3FC 3VH5W 3AZFB 2ZY4A 2L5AA 3X1TA 5B0ZC 2AROA 5AV8B 5B1MC 4NE3A 3LELA 5AV9A 1S32C 4WU8A 3W99A 4Z66D 5AVCA 3LZ0B 5CPKA 3X1SC 5B0ZD 4KGCB 3AZKD 3A6NB 5B40D 4YM6B 3MNND 5GSUB 3MNNB 5GXQD 5B0YD 3MGPB 1P3PC 2ZY2A 2BG1A 1KX4C 5JRGC 1EQZA 4XUJA 5GT3A 4J8WB 3V9RB 3WTPD 3WA9C 3AZMB 3C1BC 4XZQD 5KDMB 5AV6C 4Z2MH 3A6NC 3REHB 4H9SC 3REKD 5JRGD 3AV2A 2XD1A 4QLCA 3MGSD 4G92C 1P3MB 5CPKC 3AYWC 3NQUA 3AZJB 1P3IB 3R45B 4HGAB 1M18B 3LZ1D 5CPJD 4UPKA 4Z66B 5B24B 4G92B 5B0ZA 1P3MC 4J8XB 4XUJC 2YFWB 1KX4B 1W2EA 1M19C 5AV6A 1BH8A 2ZY3A 1N1JB 3W96A 3WAAD 4WNNB 3MGQC 4R8PA 5B2IB 4CAYA 3EPLA 5DNND 3R45A 3MGRD 3X1TD 1P3MD 1P3PD 3AFAD 1H3OB 1P3IA 1WWSA 4ZBJB 1M1AB 5E5AC 5CHLB 2Y2OA 5AV9C 4J8WD 1Q9CA 2CWEA 5B32D 5DNMD 1ID3A 2FJ7B 3WKJD 3X1UB 1KX5D 5AV5D 2BYKB 1P3GA 4KUDA 3X1UA 3MGPD 4Z5TB 3AV2D 5GXQB 3MGQA 5C3IB 4Z2MG 1U35C 4LD9A 4J8XA 1P3AD 3MNNA 4E45A 5JA4A 3C1BB 3VH6T 5AV6D 5DNMB 1KX5B 1R4VA 3P5JB 3LZ1C 3REKC 3B0CT 5B2JD 3REJD 1P3KC 2FJ7D 4WU9A 2HUEB 3AV1B 1P3MA 4H9PB 2F8NG 1BH8B 3VH5T 4H9OA 5AV5C 3AFAB 3X1TB 3AZNA 2J8PA 3FDDA 4KUDC 5B33B 4ZUXD 5CPJA 3WTPB 4AWLC 1P3FA 3WTPE 2NZDA 5B32C 5B31C 5BO0A 5B1MA 1BFMA 2AROC 3KWQB 4H9NB 3NQJB 4H9SA 2G5HC 1KX4D 5CP6B 1S32D 3KXBB 4J8UD 3MGQD 2HUEC 2F8NA 5GSUC 3AZGD 3AV2B 5GSUA 1ZLAD 4WU9C 3LZ1B 1HQ3C 4X23D 3MGRA 3AZKC 1ULYA 1P3OC 2YFVA 4NFTA 4G91C 2JE5A 4H9RA 4J8WA 2BYKA 4KUDB 3MVDA 2YFVB 3B6FD 5B32A 4R8PD 1P3AC 2F2AC 1ID3D 3AZED 1ID3B 2Y2LA 1P3GC 3WTPC 4AWLB 3UTBC 4ZBJC 3WA9D 1JFIA 2FJ7C 4JJNA 5BS7A 4H9QB 5B0YB 3TU4C 5B2ID 4M6BA 3A6NA 3TU4A 1P34B 2HIOA 4YS3A 3W98D 1P3IC 4DRBA 5GXQC 1AOID 5AV5A 1P3GD 5AY8C 3UTBD 3MVDC 3X1UD 4E44A 1KX4A 5B40B 4YM6D 3REJA 5B0ZB 4KGCD 5GT0D 3H0RC 3KUYD 3W98C 1TZYC 4J8VA 2NQBD 1M18D 4WV4B 1EQZC 1U35D 1M19A 4X23C 5B24C 1P3PB 3AZGC 2PYOD 3AZND 1ZLAC 4JJNC 3REIB 4ZUXA 3AZNB 3UT9C 5B40A 5DNNC 3O62B 3AV1D 4QLCC 3AZMC 3AZMA 5GXQA 5B31B 5E5AA 3MGQB 3MVDB 3AN2B 5AV9D 3V9RA 5BNVB 4J8WC 2Y2GA 5E5AB 1KX3A 5AVCD 5B1LA 3O62A 4CSRA 3MGRC 3AZKA 1EQZB 4X23A 4KHAB 4ZUXB 1TZYB 4CSRB 3AZKB 4YM6A 1P3BA 3LJAB 1HTAA 2UWXA 3AZJC 3REHD 3B6GB 4J8XC 4WU8B 4CAYB 3W99B 4LD9C 3X1VA 3C1CD 3W96B 5B31A 5F99B 5AY8A 5CPIB 4WJ3C 1U35B 3LELB 4KGCC 5AVBB 3B0BA 3X1SA 5GT0A 3AZFD 3C1BD 4J8VD 3KSYA 3W99C 4WU8C 3AZIA 3AZEA 3AZIC 3MGPC 1ID3C 3KWQA 2RVQD 1P3LA 5B2IA 3A6ND 2NZDB 2Y2NA 3F6TA 5BNXB 5B33A 1P3OD 5B31G 3AZIB 3B0CW 5CP6D 4LD9B 1P34D 2CV5B 3W97B 2ZY5A 1U35A 5E5AD 3LJAC 5AV8D 5AVBA 5B32B 5B24A 1TAFA 3UTAB 4H9RB 5F99A 1BH9B 3KUYA 5CPIA 5F99C 5CPIC 3IP4C 1M18A 3B6GA 1KX5A 4JJNB 3REIC 3NQUB 3X1VD 1M19D 2W8SA 3WAAB 1B6WA 3REKB 3MGPA 4Z66C 4X23B 3AN2C 4QLCB 3AZHC 4H9NA 5KDMA 3REHA 4LD9D 3AZNC 5C3IC 1P34C 5AVCB 3LZ0A 1P3FB 5G49B 3KWQD 2Y2IA 5BS7C 5CPJB 2FJ7A 3EPKA 4XUJB 3UT9A 4HGAC 2DQNC 1M18C 2RVQC 3B6FC 2F8NB 3EPJA 1KX3D 2YFWA 3REIA 3WKJC 3MGSB 1P3OA 3O62D 3UTAC 2FFFB 5CP6A 3RELD 1M1AA 3AL0C 5AY8D 5AVBD 2Y2JA 4EO5C 2Y2PA 4J8UA 5B2JB 3C1CA 3LJAD 5AV6B 3REHC 3AZHB 1F66D 2AROB 3KWQC 3B6FB 5GT0B 3C1CB 3UT9B 3AV2C 3LELC 1S32A 1F1EA 3X1SD 3AZFA 2F8ND 3KXBC 5G49A 5GSUD 1ZLAA 2F8NH 2NZDC 3RELB 4WU9B 4Z5TD 5AV8C 4YS3B 5B1MD 5GT0C 4G91B 3KFUG 5B24D 1TZYA 3REKA 1P3FD 3AZLC 4UUZA 3AFAC 1H3OA 1P3KB 4EO5B 3WA9A 4R8PB 4JJND 3X1VB 2JSSA 3TU4D 4YM6C 2Y2KA 5FUGA 3W99D 3MGRB 4WU8D 4NE5A 4YS3C 4NE6A 3B6FA 5CPKD 1P3BB 3AYWD 3UTAD 2Y2HA 3RELC 3KXBA 5B33C 5B1LB 4XZQC 5AVCC 4KGCA 4XZQA 1BH9A 3KUYB 2Y2QA 3AZEC 5AV9B 3MGSA 4DQYB 1P3OB 3AFAA 1P3ID 1KX5C 3B0DC 1P3BC 1HQ3B 1B67A 5BT1C 5GT3C 3W98A 3X1VC 3REID 1P3PA 3WKJB 5B1LD 1AOIA 4XZQB 3VH6W 3AZMD 3LJAA 4KUDD 5JA4B 3LZ0C 3AZHD 1F66B 2F8NK 5DNMA 3AZEB 1KU5A 2CV5C 3W97C 2ZM5A 2NQBB 3WAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W96 D;  2HIO C;  3AYW A;  3WAA A;  5B1L C;  5B40 C;  1P3A B;  5DNN A;  4Z5T A;  5AY8 B;  3B0D B;  5FUG B;  1P3G B;  4J8U C;  3AN2 A;  1TZY D;  4UUZ B;  4DRA A;  3VH6 A;  3KXB D;  4J8X D;  1P3A A;  3AZI D;  5B31 D;  5AVB C;  5B32 G;  1AOI C;  4R8P C;  5CPK B;  1P3B D;  4WNN A;  5B33 D;  3AZL B;  3WKJ A;  3UTA A;  2BYM A;  1N1J A;  3AZL D;  1TAF B;  4J8V B;  1P3L D;  5AV8 A;  2PYO B;  3REJ B;  3AZH A;  2IO5 C;  5B2J C;  1P3K D;  5B2J A;  5F99 D;  4Z66 A;  5CPI D;  3AZG B;  2CV5 D;  4J8U B;  3W97 D;  3C1C C;  3B6G D;  5B1M B;  1AOI B;  2IO5 B;  5DNM C;  4WU9 D;  4H9Q A;  5B0Y A;  1HQ3 D;  3AZJ A;  3W98 B;  3C1B A;  3W96 C;  3AZG A;  4ZUX C;  3UTB B;  1EQZ D;  4KHA A;  3X1T C;  3B6G C;  3X1S B;  2NZD D;  3LZ0 D;  4H9O B;  2ARO D;  5AV5 B;  5JRG B;  4H9P A;  3MNN C;  5CP6 C;  2PYO C;  2BYM B;  3MVD D;  1WWI A;  3LEL D;  4J8V C;  2HIO D;  5GT3 B;  5JRG A;  1F66 C;  3WA9 B;  2HIO B;  5BT1 D;  5GT3 D;  3MGS C;  4QLC D;  4WZS B;  3REJ C;  5DNN B;  3O62 C;  1P34 A;  2NQB C;  4Z5T C;  3AYW B;  2LY8 A;  1M1A D;  3UTB A;  5CPJ C;  1A7W A;  3X1U C;  1P3L C;  1KX3 B;  3NQJ A;  3AZF C;  4XUJ D;  5BNV A;  5BO0 B;  3REL A;  3VH5 A;  1ZLA B;  3WTP A;  3KUY C;  3AN2 D;  1P3K A;  1S32 B;  3LZ1 A;  1HQ3 A;  3AZJ D;  2PYO A;  3W97 A;  2CV5 A;  4YS3 D;  2NQB A;  5BNX A;  1F66 A;  3AZL A;  1M1A C;  3AV1 A;  1P3L B;  1KX3 C;  3AV1 C;  1M19 B;  3UT9 D;  5B2I C;  5B0Y C;  3TU4 B;  1JFI B;  1P3F C;  3VH5 W;  3AZF B;  2L5A A;  3X1T A;  5B0Z C;  2ARO A;  5AV8 B;  5B1M C;  4NE3 A;  3LEL A;  5AV9 A;  1S32 C;  4WU8 A;  3W99 A;  4Z66 D;  3LZ0 B;  5AVC A;  5CPK A;  3X1S C;  5B0Z D;  4KGC B;  3AZK D;  3A6N B;  5B40 D;  4YM6 B;  3MNN D;  5GSU B;  3MNN B;  5GXQ D;  5B0Y D;  3MGP B;  1P3P C;  1KX4 C;  5JRG C;  1EQZ A;  4XUJ A;  5GT3 A;  4J8W B;  3V9R B;  3WTP D;  3WA9 C;  3AZM B;  3C1B C;  4XZQ D;  5KDM B;  5AV6 C;  4Z2M H;  3A6N C;  3REH B;  4H9S C;  3REK D;  5JRG D;  3AV2 A;  4QLC A;  3MGS D;  4G92 C;  1P3M B;  5CPK C;  3AYW C;  3NQU A;  3AZJ B;  1P3I B;  3R45 B;  4HGA B;  1M18 B;  3LZ1 D;  5CPJ D;  4Z66 B;  5B24 B;  4G92 B;  5B0Z A;  1P3M C;  4J8X B;  4XUJ C;  2YFW B;  1KX4 B;  1M19 C;  5AV6 A;  1BH8 A;  1N1J B;  3W96 A;  3WAA D;  4WNN B;  3MGQ C;  4R8P A;  5B2I B;  4CAY A;  1P3M D;  5DNN D;  3R45 A;  3MGR D;  3X1T D;  1P3P D;  3AFA D;  1H3O B;  1P3I A;  1WWS A;  4ZBJ B;  1M1A B;  5E5A C;  5CHL B;  5AV9 C;  4J8W D;  1Q9C A;  2CWE A;  5B32 D;  5DNM D;  1ID3 A;  2FJ7 B;  3WKJ D;  3X1U B;  1KX5 D;  5AV5 D;  2BYK B;  1P3G A;  4KUD A;  3X1U A;  3MGP D;  4Z5T B;  3AV2 D;  5GXQ B;  3MGQ A;  5C3I B;  4Z2M G;  1U35 C;  4LD9 A;  4J8X A;  1P3A D;  3MNN A;  4E45 A;  5JA4 A;  3C1B B;  3VH6 T;  5AV6 D;  5DNM B;  1KX5 B;  1R4V A;  3LZ1 C;  3REK C;  3B0C T;  5B2J D;  3REJ D;  1P3K C;  2FJ7 D;  4WU9 A;  2HUE B;  3AV1 B;  1P3M A;  4H9P B;  2F8N G;  1BH8 B;  3VH5 T;  4H9O A;  5AV5 C;  3AFA B;  3X1T B;  3AZN A;  4KUD C;  5B33 B;  4ZUX D;  5CPJ A;  3WTP B;  4AWL C;  1P3F A;  3WTP E;  2NZD A;  5B32 C;  5B31 C;  5BO0 A;  5B1M A;  1BFM A;  2ARO C;  3KWQ B;  4H9N B;  3NQJ B;  4H9S A;  1KX4 D;  5CP6 B;  1S32 D;  3KXB B;  4J8U D;  3MGQ D;  2HUE C;  2F8N A;  5GSU C;  3AZG D;  3AV2 B;  5GSU A;  1ZLA D;  4WU9 C;  3LZ1 B;  1HQ3 C;  4X23 D;  3MGR A;  3AZK C;  1ULY A;  1P3O C;  2YFV A;  4NFT A;  4G91 C;  4H9R A;  4J8W A;  2BYK A;  4KUD B;  3MVD A;  2YFV B;  3B6F D;  5B32 A;  4R8P D;  1P3A C;  1ID3 D;  3AZE D;  1ID3 B;  1P3G C;  3WTP C;  4AWL B;  3UTB C;  4ZBJ C;  3WA9 D;  1JFI A;  2FJ7 C;  4JJN A;  5BS7 A;  4H9Q B;  5B0Y B;  3TU4 C;  3A6N A;  5B2I D;  4M6B A;  3TU4 A;  1P34 B;  2HIO A;  4YS3 A;  3W98 D;  1P3I C;  4DRB A;  5GXQ C;  1AOI D;  5AV5 A;  1P3G D;  5AY8 C;  3UTB D;  3MVD C;  3X1U D;  4E44 A;  1KX4 A;  5B40 B;  4YM6 D;  3REJ A;  5B0Z B;  4KGC D;  5GT0 D;  3KUY D;  3W98 C;  1TZY C;  4J8V A;  2NQB D;  1M18 D;  4WV4 B;  1EQZ C;  1U35 D;  1M19 A;  4X23 C;  5B24 C;  1P3P B;  3AZG C;  2PYO D;  3AZN D;  1ZLA C;  4JJN C;  3REI B;  4ZUX A;  3AZN B;  3UT9 C;  5B40 A;  5DNN C;  3O62 B;  3AV1 D;  4QLC C;  3AZM C;  3AZM A;  5GXQ A;  5B31 B;  5E5A A;  3MGQ B;  3MVD B;  3AN2 B;  5AV9 D;  3V9R A;  5BNV B;  4J8W C;  5E5A B;  1KX3 A;  5AVC D;  5B1L A;  3O62 A;  4CSR A;  3MGR C;  3AZK A;  1EQZ B;  4X23 A;  4KHA B;  4ZUX B;  1TZY B;  4CSR B;  3AZK B;  4YM6 A;  1P3B A;  3LJA B;  1HTA A;  3AZJ C;  3REH D;  3B6G B;  4J8X C;  4WU8 B;  4CAY B;  3W99 B;  4LD9 C;  3X1V A;  3C1C D;  3W96 B;  5B31 A;  5F99 B;  5AY8 A;  5CPI B;  1U35 B;  3LEL B;  4KGC C;  5AVB B;  3B0B A;  3X1S A;  5GT0 A;  3AZF D;  3C1B D;  4J8V D;  3KSY A;  3W99 C;  4WU8 C;  3AZI A;  3AZE A;  3AZI C;  3MGP C;  1ID3 C;  3KWQ A;  2RVQ D;  1P3L A;  5B2I A;  3A6N D;  2NZD B;  5BNX B;  5B33 A;  1P3O D;  5B31 G;  3AZI B;  3B0C W;  5CP6 D;  4LD9 B;  1P34 D;  2CV5 B;  3W97 B;  1U35 A;  5E5A D;  3LJA C;  5AV8 D;  5AVB A;  5B32 B;  5B24 A;  1TAF A;  3UTA B;  4H9R B;  5F99 A;  1BH9 B;  3KUY A;  5CPI A;  5F99 C;  5CPI C;  1M18 A;  3B6G A;  1KX5 A;  4JJN B;  3REI C;  3NQU B;  3X1V D;  1M19 D;  3WAA B;  1B6W A;  3REK B;  3MGP A;  4Z66 C;  4X23 B;  3AN2 C;  4QLC B;  3AZH C;  4H9N A;  5KDM A;  3REH A;  4LD9 D;  3AZN C;  5C3I C;  1P34 C;  5AVC B;  3LZ0 A;  1P3F B;  5G49 B;  3KWQ D;  5CPJ B;  5BS7 C;  2FJ7 A;  4XUJ B;  3UT9 A;  4HGA C;  1M18 C;  2RVQ C;  3B6F C;  2F8N B;  1KX3 D;  2YFW A;  3REI A;  3WKJ C;  3MGS B;  1P3O A;  3O62 D;  3UTA C;  5CP6 A;  3REL D;  1M1A A;  5AY8 D;  5AVB D;  4EO5 C;  4J8U A;  5B2J B;  3C1C A;  3LJA D;  5AV6 B;  3REH C;  3AZH B;  1F66 D;  2ARO B;  3KWQ C;  3B6F B;  5GT0 B;  3C1C B;  3UT9 B;  3AV2 C;  3LEL C;  1S32 A;  1F1E A;  3X1S D;  3AZF A;  2F8N D;  3KXB C;  5G49 A;  5GSU D;  1ZLA A;  2F8N H;  2NZD C;  3REL B;  4WU9 B;  4Z5T D;  5AV8 C;  4YS3 B;  5B1M D;  5GT0 C;  4G91 B;  5B24 D;  1TZY A;  3REK A;  1P3F D;  3AZL C;  4UUZ A;  3AFA C;  1H3O A;  1P3K B;  4EO5 B;  3WA9 A;  4R8P B;  4JJN D;  3X1V B;  2JSS A;  3TU4 D;  4YM6 C;  3MGR B;  5FUG A;  3W99 D;  4WU8 D;  4NE5 A;  4YS3 C;  4NE6 A;  3B6F A;  5CPK D;  1P3B B;  3AYW D;  3UTA D;  3REL C;  3KXB A;  5B33 C;  5B1L B;  4XZQ C;  5AVC C;  4KGC A;  4XZQ A;  1BH9 A;  3KUY B;  3AZE C;  5AV9 B;  3MGS A;  1P3O B;  3AFA A;  1P3I D;  1KX5 C;  3B0D C;  1P3B C;  1HQ3 B;  1B67 A;  5BT1 C;  5GT3 C;  3W98 A;  3X1V C;  3REI D;  1P3P A;  3WKJ B;  5B1L D;  1AOI A;  4XZQ B;  3VH6 W;  3AZM D;  3LJA A;  4KUD D;  5JA4 B;  3LZ0 C;  3AZH D;  1F66 B;  2F8N K;  5DNM A;  3AZE B;  1KU5 A;  2CV5 C;  3W97 C;  2NQB B;  3WAA C; 
#chains in the Genus database with same CATH topology
 3W96 D;  2HIO C;  3AYW A;  3WAA A;  5B1L C;  5B40 C;  1P3A B;  5DNN A;  4Z5T A;  5AY8 B;  3B0D B;  5FUG B;  1P3G B;  1PZR A;  4J8U C;  3AN2 A;  2RIQ A;  1TZY D;  4UUZ B;  4DRA A;  3VH6 A;  3KXB D;  4J8X D;  1P3A A;  3AZI D;  5B31 D;  5AVB C;  1Z2C B;  5B32 G;  2Y2M A;  1AOI C;  4R8P C;  3A1K A;  5CPK B;  1P3B D;  4WNN A;  3EG5 B;  5B33 D;  3AZL B;  3WKJ A;  3UTA A;  2BYM A;  1N1J A;  3AZL D;  1TAF B;  4J8V B;  1P3L D;  5AV8 A;  2PYO B;  3REJ B;  3AZH A;  2IO5 C;  5B2J C;  1P3K D;  5B2J A;  5F99 D;  4Z66 A;  5CPI D;  3AZG B;  3H0L C;  2JCH A;  2CV5 D;  4J8U B;  3W97 D;  3C1C C;  3B6G D;  5B1M B;  1AOI B;  2IO5 B;  5DNM C;  4WU9 D;  4H9Q A;  5B0Y A;  1HQ3 D;  3AZJ A;  3W98 B;  3C1B A;  3W96 C;  3AZG A;  4ZUX C;  3UTB B;  1EQZ D;  4KHA A;  3X1T C;  3B6G C;  3X1S B;  2G5I C;  2NZD D;  1T3U A;  3LZ0 D;  4H9O B;  2ARO D;  5AV5 B;  2VQR A;  5JRG B;  4H9P A;  3MNN C;  5CP6 C;  2PYO C;  2BYM B;  3MVD D;  1WWI A;  3LEL D;  4J8V C;  2HIO D;  5GT3 B;  5JRG A;  1F66 C;  3WA9 B;  2HIO B;  2XD5 A;  5BT1 D;  5GT3 D;  4QLC D;  4WZS B;  3MGS C;  5DNN B;  3O62 C;  3REJ C;  1P34 A;  2NQB C;  4Z5T C;  3AYW B;  2LY8 A;  3H0M C;  1M1A D;  3UTB A;  5CPJ C;  1A7W A;  3X1U C;  1P3L C;  1KX3 B;  3NQJ A;  3AZF C;  4XUJ D;  5BNV A;  5BO0 B;  3REL A;  3A1I A;  3VH5 A;  1ZLA B;  3WTP A;  3KUY C;  3EPH A;  3AN2 D;  1P3K A;  1S32 B;  3LZ1 A;  1HQ3 A;  3AZJ D;  2PYO A;  3W97 A;  2CV5 A;  4YS3 D;  2NQB A;  5BNX A;  1F66 A;  3AZL A;  1M1A C;  3AV1 A;  1P3L B;  1KX3 C;  3AV1 C;  2DF4 C;  1M19 B;  3UT9 D;  5B2I C;  5B0Y C;  3TU4 B;  1JFI B;  1P3F C;  3VH5 W;  3AZF B;  2ZY4 A;  2L5A A;  3X1T A;  5B0Z C;  2ARO A;  5AV8 B;  5B1M C;  4NE3 A;  3LEL A;  5AV9 A;  1S32 C;  4WU8 A;  3W99 A;  4Z66 D;  5AVC A;  3LZ0 B;  5CPK A;  3X1S C;  5B0Z D;  4KGC B;  3AZK D;  3A6N B;  5B40 D;  4YM6 B;  3MNN D;  5GSU B;  3MNN B;  5GXQ D;  5B0Y D;  3MGP B;  1P3P C;  2ZY2 A;  2BG1 A;  1KX4 C;  5JRG C;  1EQZ A;  4XUJ A;  5GT3 A;  4J8W B;  3V9R B;  3WTP D;  3WA9 C;  3AZM B;  3C1B C;  4XZQ D;  5KDM B;  5AV6 C;  4Z2M H;  3A6N C;  3REH B;  4H9S C;  3REK D;  5JRG D;  3AV2 A;  2XD1 A;  4QLC A;  3MGS D;  4G92 C;  1P3M B;  5CPK C;  3AYW C;  3NQU A;  3AZJ B;  1P3I B;  3R45 B;  4HGA B;  1M18 B;  3LZ1 D;  5CPJ D;  4UPK A;  4Z66 B;  5B24 B;  4G92 B;  5B0Z A;  1P3M C;  4J8X B;  4XUJ C;  2YFW B;  1KX4 B;  1W2E A;  1M19 C;  5AV6 A;  1BH8 A;  2ZY3 A;  1N1J B;  3W96 A;  3WAA D;  4WNN B;  3MGQ C;  4R8P A;  5B2I B;  4CAY A;  3EPL A;  5DNN D;  3R45 A;  3MGR D;  3X1T D;  1P3M D;  1P3P D;  3AFA D;  1H3O B;  1P3I A;  1WWS A;  4ZBJ B;  1M1A B;  5E5A C;  5CHL B;  2Y2O A;  5AV9 C;  4J8W D;  1Q9C A;  2CWE A;  5B32 D;  5DNM D;  1ID3 A;  2FJ7 B;  3WKJ D;  3X1U B;  1KX5 D;  5AV5 D;  2BYK B;  1P3G A;  4KUD A;  3X1U A;  3MGP D;  4Z5T B;  3AV2 D;  5GXQ B;  3MGQ A;  5C3I B;  4Z2M G;  1U35 C;  4LD9 A;  4J8X A;  1P3A D;  3MNN A;  4E45 A;  5JA4 A;  3C1B B;  3VH6 T;  5AV6 D;  5DNM B;  1KX5 B;  1R4V A;  3P5J B;  3LZ1 C;  3REK C;  3B0C T;  5B2J D;  3REJ D;  1P3K C;  2FJ7 D;  4WU9 A;  2HUE B;  3AV1 B;  1P3M A;  4H9P B;  2F8N G;  1BH8 B;  3VH5 T;  4H9O A;  5AV5 C;  3AFA B;  3X1T B;  3AZN A;  2J8P A;  3FDD A;  4KUD C;  5B33 B;  4ZUX D;  5CPJ A;  3WTP B;  4AWL C;  1P3F A;  3WTP E;  2NZD A;  5B32 C;  5B31 C;  5BO0 A;  5B1M A;  1BFM A;  2ARO C;  3KWQ B;  4H9N B;  3NQJ B;  4H9S A;  2G5H C;  1KX4 D;  5CP6 B;  1S32 D;  3KXB B;  4J8U D;  3MGQ D;  2HUE C;  2F8N A;  5GSU C;  3AZG D;  3AV2 B;  5GSU A;  1ZLA D;  4WU9 C;  3LZ1 B;  1HQ3 C;  4X23 D;  3MGR A;  3AZK C;  1ULY A;  1P3O C;  2YFV A;  4NFT A;  4G91 C;  2JE5 A;  4H9R A;  4J8W A;  2BYK A;  4KUD B;  3MVD A;  2YFV B;  3B6F D;  5B32 A;  4R8P D;  1P3A C;  2F2A C;  1ID3 D;  3AZE D;  1ID3 B;  2Y2L A;  1P3G C;  3WTP C;  4AWL B;  3UTB C;  4ZBJ C;  3WA9 D;  1JFI A;  2FJ7 C;  4JJN A;  5BS7 A;  4H9Q B;  5B0Y B;  3TU4 C;  5B2I D;  4M6B A;  3A6N A;  3TU4 A;  1P34 B;  2HIO A;  4YS3 A;  3W98 D;  1P3I C;  4DRB A;  5GXQ C;  1AOI D;  5AV5 A;  1P3G D;  5AY8 C;  3UTB D;  3MVD C;  3X1U D;  4E44 A;  1KX4 A;  5B40 B;  4YM6 D;  3REJ A;  5B0Z B;  4KGC D;  5GT0 D;  3H0R C;  3KUY D;  3W98 C;  1TZY C;  4J8V A;  2NQB D;  1M18 D;  4WV4 B;  1EQZ C;  1U35 D;  1M19 A;  4X23 C;  5B24 C;  1P3P B;  3AZG C;  2PYO D;  3AZN D;  1ZLA C;  4JJN C;  3REI B;  4ZUX A;  3AZN B;  3UT9 C;  5B40 A;  5DNN C;  3O62 B;  3AV1 D;  4QLC C;  3AZM C;  3AZM A;  5GXQ A;  5B31 B;  5E5A A;  3MGQ B;  3MVD B;  3AN2 B;  5AV9 D;  3V9R A;  5BNV B;  4J8W C;  2Y2G A;  5E5A B;  1KX3 A;  5AVC D;  5B1L A;  3O62 A;  4CSR A;  3MGR C;  3AZK A;  1EQZ B;  4X23 A;  4KHA B;  4ZUX B;  1TZY B;  4CSR B;  3AZK B;  4YM6 A;  1P3B A;  3LJA B;  1HTA A;  2UWX A;  3AZJ C;  3REH D;  3B6G B;  4J8X C;  4WU8 B;  4CAY B;  3W99 B;  4LD9 C;  3X1V A;  3C1C D;  3W96 B;  5B31 A;  5F99 B;  5AY8 A;  5CPI B;  4WJ3 C;  1U35 B;  3LEL B;  4KGC C;  5AVB B;  3B0B A;  3X1S A;  5GT0 A;  3AZF D;  3C1B D;  4J8V D;  3KSY A;  3W99 C;  4WU8 C;  3AZI A;  3AZE A;  3AZI C;  3MGP C;  1ID3 C;  3KWQ A;  2RVQ D;  1P3L A;  5B2I A;  3A6N D;  2NZD B;  2Y2N A;  3F6T A;  5BNX B;  5B33 A;  1P3O D;  5B31 G;  3AZI B;  3B0C W;  5CP6 D;  4LD9 B;  1P34 D;  2CV5 B;  3W97 B;  2ZY5 A;  1U35 A;  5E5A D;  3LJA C;  5AV8 D;  5AVB A;  5B32 B;  5B24 A;  1TAF A;  3UTA B;  4H9R B;  5F99 A;  1BH9 B;  3KUY A;  5CPI A;  5F99 C;  5CPI C;  3IP4 C;  1M18 A;  3B6G A;  1KX5 A;  4JJN B;  3REI C;  3NQU B;  3X1V D;  1M19 D;  2W8S A;  3WAA B;  1B6W A;  3REK B;  3MGP A;  4Z66 C;  4X23 B;  3AN2 C;  4QLC B;  3AZH C;  4H9N A;  5KDM A;  3REH A;  4LD9 D;  3AZN C;  5C3I C;  1P34 C;  5AVC B;  3LZ0 A;  1P3F B;  5G49 B;  3KWQ D;  2Y2I A;  5BS7 C;  5CPJ B;  2FJ7 A;  3EPK A;  4XUJ B;  3UT9 A;  4HGA C;  2DQN C;  1M18 C;  2RVQ C;  3B6F C;  2F8N B;  3EPJ A;  1KX3 D;  2YFW A;  3REI A;  3WKJ C;  3MGS B;  1P3O A;  3O62 D;  3UTA C;  2FFF B;  5CP6 A;  3REL D;  1M1A A;  3AL0 C;  5AY8 D;  5AVB D;  2Y2J A;  4EO5 C;  2Y2P A;  4J8U A;  5B2J B;  3C1C A;  3LJA D;  5AV6 B;  3REH C;  3AZH B;  1F66 D;  2ARO B;  3KWQ C;  3B6F B;  5GT0 B;  3C1C B;  3UT9 B;  3AV2 C;  3LEL C;  1S32 A;  1F1E A;  3X1S D;  3AZF A;  2F8N D;  3KXB C;  5G49 A;  5GSU D;  1ZLA A;  2F8N H;  2NZD C;  3REL B;  4WU9 B;  4Z5T D;  5AV8 C;  4YS3 B;  5B1M D;  5GT0 C;  4G91 B;  3KFU G;  5B24 D;  1TZY A;  3REK A;  1P3F D;  3AZL C;  4UUZ A;  3AFA C;  1H3O A;  1P3K B;  4EO5 B;  3WA9 A;  4R8P B;  4JJN D;  3X1V B;  2JSS A;  3TU4 D;  4YM6 C;  2Y2K A;  5FUG A;  3W99 D;  3MGR B;  4WU8 D;  4NE5 A;  4YS3 C;  4NE6 A;  3B6F A;  5CPK D;  1P3B B;  3AYW D;  3UTA D;  2Y2H A;  3REL C;  3KXB A;  5B33 C;  5B1L B;  4XZQ C;  5AVC C;  4KGC A;  4XZQ A;  1BH9 A;  3KUY B;  2Y2Q A;  3AZE C;  5AV9 B;  3MGS A;  4DQY B;  1P3O B;  3AFA A;  1P3I D;  1KX5 C;  3B0D C;  1P3B C;  1HQ3 B;  1B67 A;  5BT1 C;  5GT3 C;  3W98 A;  3X1V C;  3REI D;  1P3P A;  3WKJ B;  5B1L D;  1AOI A;  4XZQ B;  3VH6 W;  3AZM D;  3LJA A;  4KUD D;  5JA4 B;  3LZ0 C;  3AZH D;  1F66 B;  2F8N K;  5DNM A;  3AZE B;  1KU5 A;  2CV5 C;  3W97 C;  2ZM5 A;  2NQB B;  3WAA C; 
#chains in the Genus database with same CATH homology
 3W96 D;  2HIO C;  3AYW A;  3WAA A;  5B1L C;  5B40 C;  1P3A B;  5DNN A;  4Z5T A;  5AY8 B;  3B0D B;  5FUG B;  1P3G B;  1PZR A;  4J8U C;  3AN2 A;  2RIQ A;  1TZY D;  4UUZ B;  4DRA A;  3VH6 A;  3KXB D;  4J8X D;  1P3A A;  3AZI D;  5B31 D;  5AVB C;  1Z2C B;  5B32 G;  2Y2M A;  1AOI C;  4R8P C;  3A1K A;  5CPK B;  1P3B D;  4WNN A;  3EG5 B;  5B33 D;  3AZL B;  3WKJ A;  3UTA A;  2BYM A;  1N1J A;  3AZL D;  1TAF B;  4J8V B;  1P3L D;  5AV8 A;  2PYO B;  3REJ B;  3AZH A;  2IO5 C;  5B2J C;  1P3K D;  5B2J A;  5F99 D;  4Z66 A;  5CPI D;  3AZG B;  3H0L C;  2JCH A;  2CV5 D;  4J8U B;  3W97 D;  3C1C C;  3B6G D;  5B1M B;  1AOI B;  2IO5 B;  5DNM C;  4WU9 D;  4H9Q A;  5B0Y A;  1HQ3 D;  3AZJ A;  3W98 B;  3C1B A;  3W96 C;  3AZG A;  4ZUX C;  3UTB B;  1EQZ D;  4KHA A;  3X1T C;  3B6G C;  3X1S B;  2G5I C;  2NZD D;  1T3U A;  3LZ0 D;  4H9O B;  2ARO D;  5AV5 B;  2VQR A;  5JRG B;  4H9P A;  3MNN C;  5CP6 C;  2PYO C;  2BYM B;  3MVD D;  1WWI A;  3LEL D;  4J8V C;  2HIO D;  5GT3 B;  5JRG A;  1F66 C;  3WA9 B;  2HIO B;  2XD5 A;  5BT1 D;  5GT3 D;  4QLC D;  4WZS B;  3MGS C;  5DNN B;  3O62 C;  3REJ C;  1P34 A;  2NQB C;  4Z5T C;  3AYW B;  2LY8 A;  3H0M C;  1M1A D;  3UTB A;  5CPJ C;  1A7W A;  3X1U C;  1P3L C;  1KX3 B;  3NQJ A;  3AZF C;  4XUJ D;  5BNV A;  5BO0 B;  3REL A;  3A1I A;  3VH5 A;  1ZLA B;  3WTP A;  3KUY C;  3EPH A;  3AN2 D;  1P3K A;  1S32 B;  3LZ1 A;  1HQ3 A;  3AZJ D;  2PYO A;  3W97 A;  2CV5 A;  4YS3 D;  2NQB A;  5BNX A;  1F66 A;  3AZL A;  1M1A C;  3AV1 A;  1P3L B;  1KX3 C;  3AV1 C;  2DF4 C;  1M19 B;  3UT9 D;  5B2I C;  5B0Y C;  3TU4 B;  1JFI B;  1P3F C;  3VH5 W;  3AZF B;  2ZY4 A;  2L5A A;  3X1T A;  5B0Z C;  2ARO A;  5AV8 B;  5B1M C;  4NE3 A;  3LEL A;  5AV9 A;  1S32 C;  4WU8 A;  3W99 A;  4Z66 D;  5AVC A;  3LZ0 B;  5CPK A;  3X1S C;  5B0Z D;  4KGC B;  3AZK D;  3A6N B;  5B40 D;  4YM6 B;  3MNN D;  5GSU B;  3MNN B;  5GXQ D;  5B0Y D;  3MGP B;  1P3P C;  2ZY2 A;  2BG1 A;  1KX4 C;  5JRG C;  1EQZ A;  4XUJ A;  5GT3 A;  4J8W B;  3V9R B;  3WTP D;  3WA9 C;  3AZM B;  3C1B C;  4XZQ D;  5KDM B;  5AV6 C;  4Z2M H;  3A6N C;  3REH B;  4H9S C;  3REK D;  5JRG D;  3AV2 A;  2XD1 A;  4QLC A;  3MGS D;  4G92 C;  1P3M B;  5CPK C;  3AYW C;  3NQU A;  3AZJ B;  1P3I B;  3R45 B;  4HGA B;  1M18 B;  3LZ1 D;  5CPJ D;  4UPK A;  4Z66 B;  5B24 B;  4G92 B;  5B0Z A;  1P3M C;  4J8X B;  4XUJ C;  2YFW B;  1KX4 B;  1W2E A;  1M19 C;  5AV6 A;  1BH8 A;  2ZY3 A;  1N1J B;  3W96 A;  3WAA D;  4WNN B;  3MGQ C;  4R8P A;  5B2I B;  4CAY A;  3EPL A;  5DNN D;  3R45 A;  3MGR D;  3X1T D;  1P3M D;  1P3P D;  3AFA D;  1H3O B;  1P3I A;  1WWS A;  4ZBJ B;  1M1A B;  5E5A C;  5CHL B;  2Y2O A;  5AV9 C;  4J8W D;  1Q9C A;  2CWE A;  5B32 D;  5DNM D;  1ID3 A;  2FJ7 B;  3WKJ D;  3X1U B;  1KX5 D;  5AV5 D;  2BYK B;  1P3G A;  4KUD A;  3X1U A;  3MGP D;  4Z5T B;  3AV2 D;  5GXQ B;  3MGQ A;  5C3I B;  4Z2M G;  1U35 C;  4LD9 A;  4J8X A;  1P3A D;  3MNN A;  4E45 A;  5JA4 A;  3C1B B;  3VH6 T;  5AV6 D;  5DNM B;  1KX5 B;  1R4V A;  3P5J B;  3LZ1 C;  3REK C;  3B0C T;  5B2J D;  3REJ D;  1P3K C;  2FJ7 D;  4WU9 A;  2HUE B;  3AV1 B;  1P3M A;  4H9P B;  2F8N G;  1BH8 B;  3VH5 T;  4H9O A;  5AV5 C;  3AFA B;  3X1T B;  3AZN A;  2J8P A;  3FDD A;  4KUD C;  5B33 B;  4ZUX D;  5CPJ A;  3WTP B;  4AWL C;  1P3F A;  3WTP E;  2NZD A;  5B32 C;  5B31 C;  5BO0 A;  5B1M A;  1BFM A;  2ARO C;  3KWQ B;  4H9N B;  3NQJ B;  4H9S A;  2G5H C;  1KX4 D;  5CP6 B;  1S32 D;  3KXB B;  4J8U D;  3MGQ D;  2HUE C;  2F8N A;  5GSU C;  3AZG D;  3AV2 B;  5GSU A;  1ZLA D;  4WU9 C;  3LZ1 B;  1HQ3 C;  4X23 D;  3MGR A;  3AZK C;  1ULY A;  1P3O C;  2YFV A;  4NFT A;  4G91 C;  2JE5 A;  4H9R A;  4J8W A;  2BYK A;  4KUD B;  3MVD A;  2YFV B;  3B6F D;  5B32 A;  4R8P D;  1P3A C;  2F2A C;  1ID3 D;  3AZE D;  1ID3 B;  2Y2L A;  1P3G C;  3WTP C;  4AWL B;  3UTB C;  4ZBJ C;  3WA9 D;  1JFI A;  2FJ7 C;  4JJN A;  5BS7 A;  4H9Q B;  5B0Y B;  3TU4 C;  5B2I D;  4M6B A;  3A6N A;  3TU4 A;  1P34 B;  2HIO A;  4YS3 A;  3W98 D;  1P3I C;  4DRB A;  5GXQ C;  1AOI D;  5AV5 A;  1P3G D;  5AY8 C;  3UTB D;  3MVD C;  3X1U D;  4E44 A;  1KX4 A;  5B40 B;  4YM6 D;  3REJ A;  5B0Z B;  4KGC D;  5GT0 D;  3H0R C;  3KUY D;  3W98 C;  1TZY C;  4J8V A;  2NQB D;  1M18 D;  4WV4 B;  1EQZ C;  1U35 D;  1M19 A;  4X23 C;  5B24 C;  1P3P B;  3AZG C;  2PYO D;  3AZN D;  1ZLA C;  4JJN C;  3REI B;  4ZUX A;  3AZN B;  3UT9 C;  5B40 A;  5DNN C;  3O62 B;  3AV1 D;  4QLC C;  3AZM C;  3AZM A;  5GXQ A;  5B31 B;  5E5A A;  3MGQ B;  3MVD B;  3AN2 B;  5AV9 D;  3V9R A;  5BNV B;  4J8W C;  2Y2G A;  5E5A B;  1KX3 A;  5AVC D;  5B1L A;  3O62 A;  4CSR A;  3MGR C;  3AZK A;  1EQZ B;  4X23 A;  4KHA B;  4ZUX B;  1TZY B;  4CSR B;  3AZK B;  4YM6 A;  1P3B A;  3LJA B;  1HTA A;  2UWX A;  3AZJ C;  3REH D;  3B6G B;  4J8X C;  4WU8 B;  4CAY B;  3W99 B;  4LD9 C;  3X1V A;  3C1C D;  3W96 B;  5B31 A;  5F99 B;  5AY8 A;  5CPI B;  4WJ3 C;  1U35 B;  3LEL B;  4KGC C;  5AVB B;  3B0B A;  3X1S A;  5GT0 A;  3AZF D;  3C1B D;  4J8V D;  3KSY A;  3W99 C;  4WU8 C;  3AZI A;  3AZE A;  3AZI C;  3MGP C;  1ID3 C;  3KWQ A;  2RVQ D;  1P3L A;  5B2I A;  3A6N D;  2NZD B;  2Y2N A;  3F6T A;  5BNX B;  5B33 A;  1P3O D;  5B31 G;  3AZI B;  3B0C W;  5CP6 D;  4LD9 B;  1P34 D;  2CV5 B;  3W97 B;  2ZY5 A;  1U35 A;  5E5A D;  3LJA C;  5AV8 D;  5AVB A;  5B32 B;  5B24 A;  1TAF A;  3UTA B;  4H9R B;  5F99 A;  1BH9 B;  3KUY A;  5CPI A;  5F99 C;  5CPI C;  3IP4 C;  1M18 A;  3B6G A;  1KX5 A;  4JJN B;  3REI C;  3NQU B;  3X1V D;  1M19 D;  2W8S A;  3WAA B;  1B6W A;  3REK B;  3MGP A;  4Z66 C;  4X23 B;  3AN2 C;  4QLC B;  3AZH C;  4H9N A;  5KDM A;  3REH A;  4LD9 D;  3AZN C;  5C3I C;  1P34 C;  5AVC B;  3LZ0 A;  1P3F B;  5G49 B;  3KWQ D;  2Y2I A;  5BS7 C;  5CPJ B;  2FJ7 A;  3EPK A;  4XUJ B;  3UT9 A;  4HGA C;  2DQN C;  1M18 C;  2RVQ C;  3B6F C;  2F8N B;  3EPJ A;  1KX3 D;  2YFW A;  3REI A;  3WKJ C;  3MGS B;  1P3O A;  3O62 D;  3UTA C;  2FFF B;  5CP6 A;  3REL D;  1M1A A;  3AL0 C;  5AY8 D;  5AVB D;  2Y2J A;  4EO5 C;  2Y2P A;  4J8U A;  5B2J B;  3C1C A;  3LJA D;  5AV6 B;  3REH C;  3AZH B;  1F66 D;  2ARO B;  3KWQ C;  3B6F B;  5GT0 B;  3C1C B;  3UT9 B;  3AV2 C;  3LEL C;  1S32 A;  1F1E A;  3X1S D;  3AZF A;  2F8N D;  3KXB C;  5G49 A;  5GSU D;  1ZLA A;  2F8N H;  2NZD C;  3REL B;  4WU9 B;  4Z5T D;  5AV8 C;  4YS3 B;  5B1M D;  5GT0 C;  4G91 B;  3KFU G;  5B24 D;  1TZY A;  3REK A;  1P3F D;  3AZL C;  4UUZ A;  3AFA C;  1H3O A;  1P3K B;  4EO5 B;  3WA9 A;  4R8P B;  4JJN D;  3X1V B;  2JSS A;  3TU4 D;  4YM6 C;  2Y2K A;  5FUG A;  3W99 D;  3MGR B;  4WU8 D;  4NE5 A;  4YS3 C;  4NE6 A;  3B6F A;  5CPK D;  1P3B B;  3AYW D;  3UTA D;  2Y2H A;  3REL C;  3KXB A;  5B33 C;  5B1L B;  4XZQ C;  5AVC C;  4KGC A;  4XZQ A;  1BH9 A;  3KUY B;  2Y2Q A;  3AZE C;  5AV9 B;  3MGS A;  4DQY B;  1P3O B;  3AFA A;  1P3I D;  1KX5 C;  3B0D C;  1P3B C;  1HQ3 B;  1B67 A;  5BT1 C;  5GT3 C;  3W98 A;  3X1V C;  3REI D;  1P3P A;  3WKJ B;  5B1L D;  1AOI A;  4XZQ B;  3VH6 W;  3AZM D;  3LJA A;  4KUD D;  5JA4 B;  3LZ0 C;  3AZH D;  1F66 B;  2F8N K;  5DNM A;  3AZE B;  1KU5 A;  2CV5 C;  3W97 C;  2ZM5 A;  2NQB B;  3WAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...