5CPOA

Crystal structure of xena from pseudomonas putida in complex with an nadh mimic (mbu)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
359
structure length
359
Chain Sequence
b'SALFEPYTLKDVTLRNRIAIPPMCQYMAEDGLINDWHQVHYASMARGGAGLLVVEATAVAPEGRITPGCAGIWSDAHAQAFVPVVQAIKAAGSVPGIQIAHAGRKASANRPWEGDDHIGADDARGWETIAPSAIAFGAHLPNVPRAMTLDDIARVKQDFVDAARRARDAGFEWIELHFAHGYLGQSFFSEHSNKRTDAYGGSFDNRSRFLLETLAAVREVWPENLPLTARFGVLEYDGRDEQTLEESIELARRFKAGGLDLLSVSVGFTIPETNIPWGPAFMGPIAERVRREAKLPVTSAWGFGTPQLAEAALQANQLDLVSVGRAHLADPHWAYFAAKELGVEKASWTLPAPYAHWLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xenobiotic reductase
publication title Better than Nature: Nicotinamide Biomimetics That Outperform Natural Coenzymes.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 130
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cpoA00
1W5PA 3GNNA 4IMDA 2VFEA 4N2YA 2QCEA 4UFLA 3W2UA 4ZL1A 1AL7A 1VYPX 2Q8LA 4K37A 5SWUA 1MSSA 4QNWA 1W54A 1A50A 3A23A 4KKXA 1HFBA 3W7KA 2XN1A 1QNVA 2QUTA 1XUZA 1HTIA 4QQ3A 3LI0A 1ZAIA 1UUOA 2J27A 3RNDA 5D04C 3DHFA 3LXCA 3PBVA 4Z0SA 2A7PA 5DXXA 4YCPA 1L9WA 1RV8A 3S5YA 1GTEA 1XC4A 2JGQA 3LX9A 2Y62A 3KRZA 4MVAA 3S6DA 4UR7A 3HJZA 4ORIA 1GWJA 4DF2A 4O1CA 2QJGA 4MLJA 1PL9A 3EKLA 1KTBA 4HNVA 1GZGA 2F84A 3H55A 1W1ZA 2J6XA 3UWUA 2EHHA 3P82A 1KLZA 1WBJA 4WZHA 3Q58A 3W7IA 1H1ZA 4NQ1A 3G3MA 4NU7A 1F73A 3TA6A 5C2XA 3ZFHA 4FNUA 5HQEA 1C29A 3W86A 3TH6A 4K7VA 4R34A 3W2LA 2V2HA 1K7FA 1YDVA 4AMAA 1KFKA 5DCEA 3VNDA 2DZXA 3EX2A 4X9SA 3IGXA 4CQAA 4GJ1A 4N4QA 1Q45A 2AGKA 2YGYA 3IIPA 3N9SA 5D02A 3TAOA 3NQDA 3O6YX 2R14A 2CFFA 1K8YA 1I2NA 1SFLA 2JKEA 5AYYA 1TSIA 1L6WA 2QCNA 3GVGA 1F74A 2ZFAA 4JR5A 1MEWA 1YPIA 3DFQA 4JEQA 1WYIA 2V5LA 3I7SA 3UWWA 2FPTA 4GUJA 1YDOA 5LKYA 3S42A 5FF0A 1VH7A 5I3FA 4BK9A 3NQ6A 1I2OA 3S5ZA 3BLEA 2QEZA 3P5ZA 2Q3OA 2ZRWA 3QH2A 1OABA 2WPBA 1RQBA 3GAYA 4M5PA 4GXMA 1H63A 3VKJA 3W1RA 3ELFA 2DZSA 5K9CA 3M43A 3TSMA 2VFHA 3GDTA 5KZEA 1LP6A 1TQJA 3LHTA 3TXZA 4H4IA 4UFMA 4IOTA 2VFGA 2ABBA 3FKRA 2B7PA 2H3BA 2TRSA 4UR8A 4UTTA 5C54A 2DZTA 1KFJA 3KVJA 4M19A 1QOPA 3HPZA 3P62A 2LLEA 1DL3A 1DHPA 3P5YA 2C16A 4CQ9A 3Q2DA 4O52A 5CPMA 5ABTA 1LOQA 2GVLA 1GT8A 1Q6QA 1N7KA 2X1TA 1E51A 3MI6A 1VR6A 2X30A 3AO0A 3W1XA 2V8ZA 5LNWA 3NPVA 3PF3A 4JIQA 1K8ZA 5HULA 3LTSA 4JD4A 5F4SA 1A5CA 2HMCA 4MYXA 2QCHA 1DVJA 5FF2A 4NJIA 3G1AA 4IMGA 5T26A 3RMJA 4GBUA 4XWUA 1LROA 1FBAA 1XBXA 3TC7A 4K7YA 5EBUA 2A6LA 3DXIA 4DXVA 3HGOA 4CCEA 4MZYA 1SO4A 3QC3A 4JTJA 4LRTA 1M5WA 1KFLA 4OV9A 1SPQA 3W7NA 1OK4A 4QJ1A 4WQ6A 4UTWC 3MHUA 4IQLA 1W8SA 4I7WA 3L67A 1NSJA 3I7QA 2BXVA 2CLEA 1DQXA 1JUBA 4AH7A 1X7FA 2OJPA 2CZ5A 1OYCA 3LCLA 4LUJA 2C15A 1TQXA 3C2EA 5D2TA 2A0NA 4LY8A 4WUIA 4PODA 4JGDA 1SSGA 3W1LA 4ZQOA 3FLUA 4JYFA 3INPA 5KITA 2V2CA 2RKXA 3R89A 3NM1A 4WJEA 5HJLA 3TU9A 2W6RA 4IX0A 4BF9A 3W1AA 2DZVA 2QCDB 3EXRA 4MYAA 1EA0A 4AEOA 1ME7A 3QYQA 3QW4B 5I3KA 3WK3A 1J2WA 1FCQA 4UMCA 4LC6A 5CZTA 1ADOA 2E6DA 5E1QA 4IPIA 5EYWA 2QCLA 4HNUA 2C3ZA 4GWEA 4NVTA 4LT9A 3W1NA 3DFNA 3MHFA 3EKZA 1KBJA 4HNTA 3A24A 5IM51 1TPEA 1AK5A 4KWWA 3LRLA 4RR4A 2JKAA 2AAMA 1PCWA 3PBYA 5AYXA 3O63A 1O5XA 3DBPA 1GVRA 3HG4A 4M6PA 2CZDA 3DHDA 3HOJA 1LRNA 3JS3A 2ZZ6A 1O60A 4DO5A 2E77A 1WA3A 4NJKA 5LZLA 2NV2A 2V81A 4FB7A 3G1YA 3ATYA 1SW7A 2ZZ4A 1TV7A 5FEZA 2ISSA 1TRDA 3IEBA 5G2WA 1SU5A 1ZJIA 3E96A 2ZCGA 1KM4A 4FF7A 4MOZA 5I3GA 3DH7A 1QPOA 4EOUA 3TW7A 3TFCA 3GX9A 2JBMA 2Y7GA 4UTKA 3W71A 4FNSA 3L5AA 1FDJA 1X8FA 1H7WA 6ALDA 3W1QA 1H62A 2QKFA 2Z1BA 1PHWA 4NNBA 1SZFA 5CPNA 4WOZA 4PL2A 2WNQA 2Y7DA 3NYZA 1XDLA 3NAVA 3STEA 5AC8A 2QDHA 2QUUA 5K4ZA 1TPUA 1K03A 1OFOA 5C55A 1JQVA 3UWYA 1XM3A 1OYBA 2YSWA 3UY8A 4YCOA 2Q8ZA 2NXIA 4NJGA 2YFNA 1FUYA 1OVDA 2H6RA 2NWSA 5LHEA 1HL2A 1BWKA 3BG9A 3N14A 2FLIA 2RDTA 3BW2A 5DBUA 3OA3A 3S9YA 4LRSA 4UTWA 5LNUA 3C2VA 5CZSA 3EEGA 4O17A 4ALDA 2CLOA 3L5LA 2ZA2A 1TCDA 3TMLA 3TV8A 3T55A 1XI3A 1DBTA 3S1VA 4JTSA 3QFEA 3C2OA 3W72A 6TIMA 1UUMA 2HS8A 4NX5A 1EIXA 2A1YA 2DORA 2EPHA 3TCEA 5LNSA 3M5YA 3Q94A 3QW3A 3LV6A 3W2JA 1ICSA 4JDBA 3M7WA 2ATMA 3C4UA 4UFIA 3CU2A 3G22A 4O28A 3LCIA 1RPXA 2CWNA 3W7QA 3C3NA 5F2GA 4LVFA 3D0CA 3BW3A 2CLIA 4PTNA 2H3DA 5TIMA 1OFRA 3MBDA 3FS2A 2QAPA 3B05A 1I4NA 3QM3A 3TQVA 4FNTA 4FXSA 4UCGA 1TV8A 5HWNA 2VC6A 3ZWSA 3N3MA 2QAFA 1OFQA 2O7QA 3TR2A 4JTFA 3CC1A 1S5TA 1FXQA 3TJLA 3BG3A 5A8GA 1EEPA 5HR7A 2WNZA 4P2VA 3MO7A 1XUUA 3C56A 1JCMP 1Z42A 2FTPA 4UTIA 1PS9A 5CPOA 2ZA1A 2DJXA 2ZRYA 5AHLA 3DI0A 5IBXA 4E2BA 4S2CA 1ZAHA 1FWNA 3W74A 4MUZA 3GR8A 3OHIA 1GYLA 1NEYA 1KA9F 3W7HA 3W7RA 4GE8A 3FOKA 8TIMA 1JVNA 1F6KA 4U4MA 1LBFA 4PCFA 3GB6A 4G1KA 3M44A 4A2RA 4N6EA 1IIGA 2E6AA 2VOMA 5KZDA 1SQ7A 1RVGA 4GFSA 1DQWA 3DKLA 4MJMA 4X2RA 5J5DA 1M7OA 3BGGA 2NLIA 5CZJA 4O50A 3UXDA 2XN2A 2NV1A 5EY5A 3ANYA 2YW4A 5BRBA 2FQIA 4HHPA 2JGYA 2P10A 3NVTA 5CZ0A 1ICQA 2IQTA 2VENA 3QPYA 3A5VA 1M6JA 2VFIA 1KLYA 2FB3A 3STGA 2CLKA 4GUHA 5HUOA 3C2FA 4JS3A 3TKFA 4R7JA 3P8IA 2KZHA 5H91A 5EPDA 4N02A 3DAQA 1QOQA 5TQLA 3PBWA 1KW1A 4TX9A 5AB3A 1F05A 5HINA 3I7RA 4JNMA 2ZZ7A 2VKZG 3FYPA 4MY9A 1FWSA 1YTDA 3TC6A 3NZ1A 2OT1A 3S1UA 1QPQA 2OX1A 2PRLA 4BI7A 3M6YA 1Z41A 3B04A 1LDCA 3O6DA 3UD6A 3S1XA 2TPSA 1VQTA 1YXDA 3O06A 1GQNA 2B4GA 1N55A 1LZOA 3NQVA 3EXTA 1O95A 4GRSA 3FIGA 1ML1A 3TE9A 2PRMA 4Y8FA 1YTEA 3B0UX 4RV8A 3TX9A 3NA8A 4O54A 3L9CA 5K3VA 2D73A 3EWZA 3N73A 4UMAA 1IXPA 1TPFA 4DPQA 4ML9A 1JQXA 3F4WA 1FWRA 2V30A 3ZS4A 4WXZA 1OJXA 3I68A 2ZRXA 4KFPA 2Z6IA 3LTYA 5EMUA 1PIIA 4O4WA 4L4LA 3BO9A 4U28A 3RLVA 3LRKA 3LHZA 5LNRA 3MP3A 1H7PA 3WJSA 1HO1A 3T40A 1KFBA 1AW5A 5LHFA 3NQFA 3R12A 3W2KA 4PH6A 4OGZA 3B8DA 4LOCA 3EX4A 3ABRA 3EWXA 3KRSA 4M7TA 4MFDA 3LDVA 4XTIA 4HPJA 1O5KA 1QWGA 3CM4A 4NUWA 4PL1A 1R2TA 2DP3A 2YXGA 4RXFA 3NL3A 4NZFA 3M9YA 3NR0A 4BFAA 3MI2A 4LC8A 4IXXA 2GPTA 3BV4A 5C6MA 4N6FA 1DV7A 1UASA 4XZ9A 2E5DA 1WBHA 2ISWA 5D09A 1FCUA 2YZRA 3IRDA 3W23A 2TSYA 1LTDA 3B4UA 3IIZA 4RK8A 3NQ8A 3T78A 2B7NA 1JJKA 1LBMA 3THQA 5TBOA 3PB0A 4DEFA 5G1TA 1UBSA 1AL8A 1YXCA 3UQNA 5K7JA 3NM3A 2VEKA 1VYSX 1R30A 5DCBA 4FNPA 1M7PA 4RXGA 2NXHA 1BEUA 1D9EA 3SGZA 1B4KA 3BGJA 3PG8A 3M41A 1X1ZA 3GR7A 3I65A 3GK0A 4N9DA 2WKJA 4BI5A 3TAKA 1ZY9A 1S3HA 3CHVA 4O0ZA 1FCVA 3G0SA 5D03A 3LXBA 1TTQA 1GG1A 1R46A 3QRHA 2C13A 4PC8A 2I9EA 2QCMA 3MI3A 3P8JA 2V82A 2PCQA 3LHWA 1ICPA 5D32A 3O6CA 2QCGA 3LV5A 5I3HA 1P0NA 3F1QA 1TPVA 1TYGA 4IPJA 3TFXA 4Y9AA 2QCDA 4DBDA 3CIXA 2YW3A 2V5BA 5LSMA 2C18A 3S5OA 3NQCA 4IXHA 4Z08A 3W83A 1G4EA 1XDMA 1JRBA 1SO3A 4XTDA 4EWND 1RQEA 1U5JA 1RZMA 4UUIA 1JRCA 3QMRA 3USBA 2R91A 2ATSA 2F7FA 2NWRA 4BR1A 2GUUA 3KX6A 4X22A 1DOSA 3P67A 3U8GA 1GVQA 5AFDA 3PULA 4ADUA 4UFJA 4AAJA 3STCA 1LOLA 1T99A 3B0VC 3W7CA 4QM1A 3B06A 3VFLA 2O7SA 5I3IA 1OX5A 4UIOA 4XUGA 2ZYFA 3BLIA 5KZMA 3KVKA 5HWJA 3EWUA 4HNNA 3IGUA 3NPUA 3W1MA 4UFHA 4UTUA 4CLMA 3CPRA 3CIWA 1OX4B 2DU2A 1SZEA 3UYCA 3P60A 4LV4A 4HPXA 2YX0A 2FPYA 3FKKA 3BG5A 3GLCA 4LNYA 2G96A 3FYOA 2VEPA 1EPXA 1PCKA 2E6FA 3QSRA 1MZHA 2CLHA 4UMBA 1HG3A 3PB2A 1OG0A 3OVQA 3T7VA 3O1NA 1FY6A 3QMTA 5BOOA 3NOEA 3VE7A 4LS1A 2WQPA 3W85A 4CCCA 3N2MA 4X3ZA 3S8HA 3FA5A 2YYTA 3NGJA 3VE9A 4NXSA 3YPIA 4KFOA 5F2MA 4RZ6A 4QIUA 4I7VA 2J88A 3FFSA 3QF0A 2HSAA 3L2IA 4FO4A 1FXPA 3EB2A 4NX0A 3W1UA 3UWVA 3HBLA 4C1KA 3GXTA 3L21A 3HGSA 1UJPA 3G1SA 3NQ2A 1GG0A 3A5FA 1ZNNA 1Q3NA 1D3HA 2EAWA 4D2JA 1SFJA 2QCCA 1TREA 3SI9A 1EWEA 1K7EA 1F2JA 2A7NA 2J9ZA 3LBCA 1KTCA 4LVGA 3P84A 4Y6GA 5AHMA 3QEZA 1MEHA 1OF8A 2BX7A 3EWBX 1VLIA 4JX5A 5EL1A 5F2IA 3W88A 4WY0F 5KINA 3H54A 4AHPA 4JICA 3LCGA 3EXSA 5HWMA 1MO0A 3CLMA 1A53A 4OE7A 2NUWA 3LI1A 3LXAA 2Z0IA 5AHEA 3WJYA 1ZCOA 4AF0B 1LLWA 1F7BA 3QQ0A 5G4WA 5D05A 4XBKA 1I2PA 3O07A 1LCOA 1H7NA 1K3UA 4EF8A 2ZQ0A 4JTIA 3U6WA 2I1OA 1AW1A 3NL2A 3NL5A 5D2XA 5D30A 4P61A 2GVGA 1JCJA 1P1XA 5K9DA 3A22A 2BWGA 2X1RA 5BMWA 1MXSA 3E0IA 3NQEA 4Q32A 2FFCA 3TQ0A 3E12A 3MYOA 2Y85A 4BWLC 2BZNA 4ADTA 3R2GA 3UNDA 1BTMA 5L9FA 4AHOA 1H7OA 1S5VA 3OVPA 1FDZA 1Q6LA 4O16A 4A21A 3GKFA 2GQ8A 5DBTA 5D2YA 4JTUA 3MP4A 2FIQA 4AXKA 1R2RA 1SUXA 1XBZA 3UWQA 3UZJA 4JTKA 3G24A 3LERA 3M5XA 3UXAA 3TW6A 5BMXA 3RU6A 4MIMA 3PS7A 1TPWA 3W3OA 4TR9A 3TXVA 1AG1O 3THAA 4Q4KA 1DKWA 3NO5A 1F5ZA 1AMKA 2Q3RA 2ZZ2A 1EP1A 4J9JA 1TO3A 1LBLA 4ORMA 2YCEA 5DELA 3MMTA 3S5NA 5AHFA 3W73A 5FF3A 1FDYA 4WY0B 3SR7A 3LOTA 1VC4A 4NT0A 4MZ1A 2WSYA 4M6VA 4I9AA 1TTPA 1O4UA 4DQWA 1ZALA 1TJRA 1PE1A 2WSQA 1X1OA 5C5YA 1KM0A 1VRDA 5G1YA 3W2MA 4MZ8A 3T4CA 1TIMA 4EVZA 1VYRA 4JY9A 5G4EA 3GZ3A 3W7JA 3CT7A 2WOQA 3RFAA 1B57A 2Y7EA 3W76A 4WOQA 4XQ6A 1A5BA 2R8WA 4JX4A 1C9DA 2HS6A 3IVUA 4CCDA 4O53A 3PVFA 3C52A 5DCDA 3PR2A 3WK0A 1KM5A 3LB0A 4MY1A 4O4VA 4ONVA 5FF4A 3OBKA 4BI6A 4LVDA 1X6UA 1SO6A 3G1HA 4JY8A 2ZRVA 3L0GA 4H6KA 3N19B 4Z0JA 1LORA 3W7MA 1ME9A 4LTSA 1TPB1 3W1PA 4LVAA 2NXGA 3CWNA 2ZZ1A 4YMZA 5I3JA 2XFWA 1OYAA 1BWLA 1SR9A 4FEZA 4RX0A 4R33A 3TJXA 3GKAA 2TYSA 1W0MA 4JX6A 3W07A 2QF7A 3WK1A 1V7YA 4UTMA 2ZRZA 5DY3A 3UPBA 3CEPA 4WX2A 2X2GA 3L68A 4ZMGA 2OMAA 4IMEA 1GJPA 1EB3A 3P61A 1WOAA 5D37A 3SSJA 3CB8A 3KVLA 4ZVJA 3P74A 4RCXA 2Y70A 4IUOA 5D2VA 4GC4A 3OIXA 3C8FA 2PE4A 2ZRUA 1L6SA 3HPXA 5E0KA 1EWDA 2EKCA 3HG3A 2FB2A 2E6YA 3GDRA 2Y63A 3ABSA 3NQGA 4K39A 3WFAA 4HT3A 3SJ3A 3FEMA 3GIYA 5KTLA 3IIOA 4W9TA 4WD0A 1CI1A 1JCNA 1W5MA 1VHCA 3KFTA 4N9EA 2EGZA 4H3DA 2W0UA 4BWLA 5EKYA 2OCZA 1IXQA 1W31A 3T44A 5LGZA 3EWYA 4DF0A 1BKSA 3WJXA 4O57A 1Z44A 3SZ8A 2VFFA 1OK6A 4Y96A 2BLEA 3TMQA 1JCLA 1T96A 4FX7A 4YLWA 3VI2A 4JYDA 3TNOA 4IMCA 1J5TA 1WX0A 3DI1A 2CLFA 1JUEA 5BW6A 2J9YA 3KXQA 3UWZA 3LHVA 4RLIA 2QR6A 1T8XA 4E38A 2QUVA 1W37A 3LLFA 1B3OA 1ZFJA 1Y0EA 2R94A 5F4XA 1P5BA 1W5OA 5BNKA 2RDWA 1KV5A 5K4XA 2GJNA 3KVMA 2WJZA 4NNCA 3DFOA 4JTEA 3QSTA 2ZA3A 4TMBA 3BLFA 4O0KA 5K9XA 3BVJA 1IGSA 1OX6A 3HGJA 5D38A 1K02A 5MHBA 1SZNA 3MYPA 4Z1BA 4IJBA 2ZZ5A 3S1WA 3SFKA 3TQKA 1Q6RA 3M1ZA 2BSLA 1RR2A 2DZWA 1A5SA 3EX1A 3JRKA 3Q37A 3MHGA 1QFEA 1NF7A 5AOUA 4UXDA 4O13A 1TPH1 3RF9A 3BK0A 1F76A 4JTGA 5FEPA 5D2WA 3VCRA 1G7UA 5D33A 3PBUA 2WSRA 1KBIA 3G0UA 3GDMA 3OEXA 1C8VA 5G2HA 4Z1AA 3TUUA 1YPFA 4C1LA 4TO8A 1KFCA 3HIJA 3MBFA 4UTTC 1NVMA 3E9AA 1B4EA 4RZ4A 3LHYA 5AHIA 1ZAJA 3P7YA 3PY2A 3M47A 3SY5A 1DJQA 1G67A 3DENA 2J9XA 4NZJA 3N34A 1OF6A 4UFKA 1XBYA 1GTHA 1TB3A 1FX6A 3DZ1A 4JIPA 1H7RA 4AWTA 1VCFA 1G4SA 3PSVA 1QCWA 3TSDA 3FJLA 2A2IA 2X16A 3TIMA 4PFMA 4ZQPA 4N9CA 4JDYA 1OX4A 1XL9A 2H8XA 5DXYA 3NNTA 1TTIA 1VGAA 1TRIA 3W70A 1RD5A 4UNKA 2C19A 5DN1A 2GOUA 3NEVA 2YDAA 4O8RA 3E02A 3K30A 4LW7A 2ZTJA 3MW7A 3GXNA 1P4CA 2DJLA 3KOFA 1XBVA 3MWAA 1KTNA 4K8EA 3ABOA 3SECA 3OG3A 3I6RA 1FWTA 1NAL1 3GAKA 5U7SA 4TMCA 2RH9A 3G18A 4N4PA 1ONRA 3W84A 3HG5A 3IGSA 1ZENA 5FEXA 4XBSA 4S2BA 3W22A 1U83A 1W3NA 2Y6ZA 1K7XA 4JN6A 3DFSA 1IXNA 3V1PA 1UB3A 3UPWA 2NX9A 2J24A 5F1UA 1TJPA 2E09A 3O16A 3LLDA 3C2RA 2RFGA 4RZ5A 3G1VA 1PV8A 5F1VA 3NG3A 3CQ0A 3QZEA 1N8FA 3W75A 1WDWA 2DZUA 1QDSA 4LU0A 1LYXA 2PRHA 3CTLA 4O19A 1VHNA 4POCA 1OFEA 4JXCA 4DF1A 3A21A 1J4EA 1LOSA 4M6QA 1W5NA 3HGRA 5AHNA 3CWOX 4HIBA 5LGXA 2Y61A 2V9DA 4ZQCA 1JCXA 1KM3A 1XXXA 1R2SA 3LM7A 2C14A 4UTJA 4UNLA 4OHQA 2CZEA 3M16A 4FIRA 2YYUA 2P1FA 4MJZA 2VEMA 3DFTA 3NQMA 4AF0A 3NPWA 1GYNA 5EA9A 4GUGA 1QPRA 3B0PA 3HO8A 2YFOA 1LM1A 1YTKA 1F6PA 1ALDA 2P0OA 3W87A 1MEIA 3B03A 3WK2A 2CU0A 3ZR4A 4YXGA 3HG2A 2ZBTA 2CLMA 4ZQNA 2NZLA 1H1YA 1VJIA 1T0OA 4JYEA 5KMYA 3IVSA 4KFNA 4CNPA 1P0KA 2VFDA 4FXRA 1L2UA 2OZ0A 4ADSA 3NL6A 4NXKA 4ZQMA 5HMSA 1OHLA 1YDNA 4HN4A 5AC6A 2EF9A 2FPVA 4MKNA 3NQAA 4A3UA 1IXOA 5FEWA 2RDUA 3IV3A 2PURA 2HTMA 3M5ZA 3ZWTA 3LBMA 3NPXA 3HQ1A 3EWWA 2WNNA 1S5WA 3LCHA 4LV9A 1TPC1 1ME8A 4ZQRA 1H61A 3DGRA 4LUIA 3R5EA 1YADA 4ICNA 1FQ0A 3M5VA 2NUYA 2BTMA 1L6YA 3MUXA 1VZWA 1I8JA 1LLZA 3TDFA 2ABAA 2GQ9A 3C0JA 3IIXA 4WY0A 4KWVA 3DKJA 4ZZ9A 3EX3A 3P80A 5CSRA 4JTLA 1QO5A 1SO5A 4Y90A 4AVFA 1PHQA 1AW2A 4YL2A 1TTJA 3ABQA 5CKSA 3E49A 1KFEA 5CGQA 1XFBA 4K38A 4Z1CA 4MFEA 2Z2UA 1HO4A 1RQHA 3KAOA 3A9IA 1GPWA 5FESA 4M7SA 3W7LA 2ISVA 4NJHA 2B7OA 2I14A 2WV8A 4OWGA 4K36A 1OFPA 2VEIA 4YWIA 1EUAA 5A5WA 4WXYA 5G2IA 1VPXA 1Q6OA 3L66A 4JTTA 2B0MA 1GOXA 1LRQA 1G6CA 3W9ZA 4O12A 4FX8A 2FDSA 3KHJA 3PUEA 1OFAA 1CW2A 2YPIA 7TIMA 5KSWA 2C0AA 4LS0A 3TROA 4O1AA 1QR7A 2WO5A 5F2LA 3RLUA 2E1DA 3G3DA 2ZDRA 4TIMA 3N9RA 4K8HA 2X1UA 4FX6M 1KV8A 1JULA 3DU0A 4UTHA 4PA8A 4QNEA 1PVNA 3WJWA 4UC5A 2NX1A 2ZZ3A 3F03K 4A22A 4E2DA 1H7XA 2E5BA 4O15A 4QITA 1W56A 4O14A 4IGHA 4B5NA 2GJLA 3GYEA 4DPPA 1B9BA 1IIHA 1TMHA 3QQ1A 3ATZA 1H50A 1H51A 3G0XA 5AC7A 1CX9A 4QAIA 2QDGA 1JCYA 1TPDA 3PC0A 1DJNA 3HF3A 2JKPA 3HPSA 3PUOA 1KM6A 3GDKA 5CSSA 1YXYA 3C6CA 2V2DA 3TSBA 2CLLA 5G5IA 3PUDA 1QMLA 5IBXC 4HSNA 4MLRA 3KRUA 4Q33A 3QMSA 3SW6A 1QPNA 4A2SA 1G7VA 3LRMA 2H8ZA 2B7QA 1O94A 5FI8A 3PM6A 4IMFA 3MJYA 4O11A 1K8XA 1GVFA 2G97A 2AQWA 4R53A 4XKYA 4E0CA 1EUNA 2Y7FA 3O15A 2TMDA 3O8AA 3L0KA 3W6YA 2A5HA 1THFD 1UCWA 4OQVA 3R13A 1YLVA 1KM2A 4NNAA 3GNDA 1NFBA 1GVSA 2V0TA 4IWWA 2A21A 4EF9A 3G8EA 4CNOA 3UZ5A 4GNJA 3IVTA 4OT7A 2RHGA 3L65A 1I2QA 5DY2A 3LCFA 1SSDA 1Z48A 1SZGA 3FJ6A 2A85A 4AWUA 3N2XA 1YYAA 4A29A 3G1FA 1R47A 3O05A 3AJXA 1FWWA 2OT0A 3GXPA 1GVOA 2ALDA 5L6UA 3BW4A 4MPQA 3DFPA 5HR6A 5K2ZA 2Y88A 4JTHA 2DZPA 2GVJA 2ZTKA 4IX2A 2Z6JA 2YR1A 4OBTA 4CQ8A 3GDLA 4OV4A 1FCBA 2A4AA 1DORA 1JR1A 4HSOA 3JR2A 3BPWA 2GQAA 1ZHAA 3SIZA 3HB9A 3PG9A 4AB4A 2G5WA 2A7RA 1WXJA 3HMJG 1H5YA 4AHQA 4CNNA 5HUPA 3L0NA 1NF0A 3W2NA 3G1XA 4HKPA 1WV2A 4GUFA 2XN0A 3H53A 4I7UA 5H2ZA 2JK2A 2A6NA 2E68A 3RK8A 1JUKA 4FIQA 3G8RA 2FJKA 1G69A 5AYZA 1OFDA 4O1DA 4O10A 2W79A 1VCGA 1VCVA 3W7GA 1EP3A 3M0ZA 3SGUA 4UTLA 1G4PA 1XKYA 3MP5A 4MY8A 5J5RA 1KM1A 3NXFA 2PC4A 4S1FA 4GUIA 1G4TA 1XCFA 5LNVA 1WQ5A 3R8RA 1W5QA 2QCFA 5CPLA 2QJIA 1LRTA 4TU1A 3NDOA 3PAJA 1W3TA 2QJHA 3NQ7A 3V75A 3PWAA 3STFA 1I45A 1QAPA 4O18A 4OU1A 3L5MA 4EIVA 1SW0A 3LCWA 4XKYB 3U2OA 4FNQA 1H60A 4LWWA 3OVRA 3CEUA 1I2RA 3W1TA 3S0CA 1EX5A 1HUVA 2NX3A 3W7OA 2VXNA 4FNRA 3P81A 1VLWA 2NUXA 5GVJA 5CG7A 1WOBA 5DLCA 4AWSA 4FHAA 5AN7A 3PSWA 3QJAA 5FF7A 1IF2A 4PEKA 2VELA 4NJJA 3W7PA 3F4NA 2G95A 3LCXA 3QPZA 3UY7A 2H90A 4N9BA 3LTPA 1VS1A 4RKAA 3EX6A 4QISA 5F4WA 3LGEA 3W7DA 3NZRA 4Z1DA 1V5XA 2E5CA 4O1BA 4DBEA 2X1SA 4DO4A 1QO2A 5HNRA 1GEQA 3IIVA 3BARA 1SW3A 4K6AA 4RJEA 5E93A 1EP2A 2UV8G 2Y89A 3WJZA 4QSHA 2CW6A 2C6QA 4DO6A 3G1DA 1A5AA 3W7EA 4DELA 3LHUA 4L4MA 1OFBA 2C1HA 1D3GA 3C61A 4LS2A 1TV5A 1WAUA 1W3IA 5U4NA 3TK7A 4LVBA 2CZFA
chains in the Genus database with same CATH superfamily
2W27A 2GFTA 2HBXA 1KC7A 1T41A 4LAUA 1H41A 4U3AA 4ZL1A 1VYPX 2FJUB 2XGBA 4K37A 1JD9A 1RCXB 2PTDA 5GJNA 4G2DA 1Z89A 3W7KA 1HFBA 3VTRA 2XN1A 1GJUA 2GVYA 2W61A 4LNCA 2J27A 3DHFA 3V3WA 4PSRA 4MF4A 4Z0SA 5DXXA 4YCPA 2GVEA 2G3NA 3EOSA 3U5UA 6ENLA 1XRVA 3VOIA 4BKNA 3LX9A 3KRZA 4MVAA 1DQUA 1GWJA 1UWUA 1HJVA 3AMLA 4XAGA 3B8TA 3COTA 3WH6A 3ZVHA 4B9ZA 1PL9A 2RUSA 2DUAA 4OKDA 2AL1A 3WQ4A 1G1YA 1W1ZA 2J6XA 2D0FA 4WZHA 1H1ZA 3G3MA 3PJXA 2PZNA 4FNUA 5JH2A 1Q6FA 3W86A 1E6RA 1EGMA 4CVUA 3U48A 2PUZA 3W2LA 1GW9A 1W8GA 1K7FA 1DWAM 1KFKA 3DC0A 2HCVA 3BAIA 3VNDA 2A3BA 3OZOA 5EFDA 3B97A 4MMWA 3NQDA 4MB1A 3WLSA 1BSLA 1SFLA 2JKEA 3GM8A 4HNOA 1V6XA 3KBNA 2ZFAA 1A0DA 3DFQA 3CHCA 1KB3A 3B9OA 3XISA 3ERPA 2WZIA 3NQ6A 5DQPA 5DMNA 1GVEA 2XVKA 2DW7A 3MPGA 4HOZA 4MB5A 2DZSA 3UG5A 2AL2B 3SRHA 4FPSA 3LHTA 3HQPA 2OGYA 6A3HA 1FWFC 4GI6A 3WFLA 3WNOA 2ABBA 4F0HA 1E6PA 2GWGA 3FKRA 2H3BA 4V27A 4IIHA 1KFJA 4M19A 4M56A 1QOPA 3HPZA 3UETA 5HPCA 2A3CA 6XIAA 2QVNA 5CPMA 2O9OA 1Q6QA 3AIEA 4IL0A 1E51A 4LALA 3AO0A 2V8ZA 3FGCA 1I1WA 1AD4A 3OQEA 3NPVA 3PF3A 1WB0A 4EE9A 1R85A 2E0PA 3AZSA 5CSYA 2ZX7A 4F0KA 4MYXA 3EA3A 4HD5A 4ZOCA 4TVCA 5I23A 2ADAA 7CGTA 1EF2A 1TA3A 1FBAA 1REQA 4XIMA 3VIOA 4DUWA 3F2BA 3OQ8A 4GLEA 4DWSC 2PF8A 1YMYA 2VR5A 4Q8UA 4QJ1A 1BFNA 1Q7QA 2WVSA 2P0IA 4QG6A 2ZUSA 4AIUA 2BXVA 3I7QA 2CLEA 2XIQA 4JIEA 4DNHA 3RLHA 2ASHA 2YL6A 2C15A 1QNQA 3QN3A 3MY9A 5KEZA 5D2TA 5D9NA 4LY8A 1YQ2A 4NRSA 3ONCA 1IGWA 3GDBA 3W1LA 1W9UA 2ZVRA 4PR4A 3WMBA 4I5RA 4UZUA 3FLUA 3VNYA 3INPA 2V2CA 2Q09A 3LNMA 1IZCA 1J0ZA 3R89A 3NM1A 4RV3A 1H4PA 4BF9A 1XIIA 3W1AA 3SCUA 2DZVA 2QCDB 1EA0A 1CDGA 2PA6A 3WK3A 1FCQA 4UMCA 4GI8A 1EJSC 4C6DA 2E6DA 2P3ZA 1JDAA 3FXGA 4D6CA 4ZB0A 2XTKA 2O9RA 4GWEA 4W88A 3KS6A 4LT9A 2TAAA 3DFNA 3MHFA 1XPYA 3CO4A 5IM51 1TPEA 2INFA 1C8YA 1M53A 1XIHA 3GHTA 2JKAA 1T5AA 4LB3A 3QTGA 1A47A 1W9BM 5I78A 3DHDA 3DG7A 3OO2A 4AZCA 2OSXA 1WA3A 3GC4A 5LZLA 2V81A 4FB7A 1V51A 1SW7A 3CL8A 3QBUA 1YEYA 1ZJIA 3DX5A 4MWAE 1KM4A 3OZPA 2P8CA 2XH0A 5I3GA 1YNYA 2AMGA 1QPOA 4PMJA 4W86A 3TFCA 1QNRA 2D2GA 3W4RA 2Y7GA 4UTKA 1X8FA 1H7WA 6ALDA 4G56A 1J0JA 2QKFA 4BCEA 2FVLA 4WOZA 4PL2A 2WNQA 3NYZA 3NWRA 3NAVA 4ZFMA 4EXBA 2QUUA 3UJSA 1TPUA 2BY2A 1OFOA 1RALA 1GKRA 5CAHA 3WQCA 4XZLX 4C6LA 3T08A 4NJGA 4UQDA 1OVDA 1YRRA 2QUMA 4PRRA 3TZFA 1EPVA 4BQ5A 3ZQ9A 2FLIA 2RDTA 3BW2A 5DBUA 3C2VA 4C7FA 1FRBA 1WE5A 4ALDA 2CLOA 4LUTA 4NYYA 2EXOA 3WO8A 1GZ1A 3GHUA 3S1VA 1Q2SA 4CD4A 3E5PA 4JTSA 2ZWYA 3C2OA 1KGXA 5ABFB 5XIMA 1B90A 2X42A 4H6RA 2DORA 5LNSA 3Q94A 2BVDA 3FDKA 3W2JA 2GDUA 3UGVA 4RDYA 1Q4WA 4LYQA 4H1ZA 4TTUA 4AD0A 3LCIA 2VZOA 3D46A 1RPXA 4HVXA 4S3EA 2PGRA 3D0CA 3LSCA 1Q2RA 1YNQA 5TIMA 1MUCA 2DQWA 4FNTA 1WNOA 4GYKA 2VC6A 3ZWSA 2VWTA 8XIMA 3AISA 2O7QA 4H2CA 1R5YA 2GLKA 3SN4A 1FXQA 1XSJA 1OIMA 5A8GA 3IJQA 2WNZA 3MO7A 4C1NB 1XUUA 4E4UA 4UTIA 3UR7A 1KRBC 5CPOA 3ZO9A 5A6JA 3AICA 5IBXA 1LG2A 2Z4GA 2ACSA 6CGTA 4S2CA 1DJIA 1TV3A 2X40A 2I5IA 2Z2BA 1US2A 1UKSA 4AFYA 1C7SA 1G9HA 4LEQA 3GB6A 4EXQA 3B40A 4G1KA 3RR1A 1IIGA 2VOMA 3WLKX 3AMGA 1QW9A 5J5DA 4MJMA 1M7OA 2NLIA 3IJDA 3W37A 3UXDA 2XN2A 2INZA 1GVIA 3FVMA 3ANYA 4K68A 4MWAA 5FAGA 5BWAA 1OGGA 2P10A 3L4XA 3REQB 3H23A 2CBVA 2IQTA 2VENA 3QPYA 4ZXOA 4Q6JA 1M6JA 1NWTA 1KLYA 2FB3A 3STGA 1UUQA 1KD0A 5A3HA 4YU1A 1HGYA 3PZMA 4R7JA 2R1LA 1YX1A 4GXPA 2OSWA 1CPUA 4S3JA 2PLCA 1SYTA 1NDVA 4JNMA 1UKQA 1NFGA 2ZZ7A 2VKZG 3FYPA 2JIEA 3P6LA 3B9AA 1UIOA 3QOKA 3ARYA 3NZ1A 3USZA 3AU6A 2WC7A 2PRLA 4BI7A 1LDCA 4CU7A 2TPSA 8RUCA 4B9YA 1Q85A 2OOFA 2B4GA 1RPKA 3EXTA 1O95A 4GRSA 4HMEA 1ML1A 3MZNA 4Y8FA 1YTEA 3KBVA 1U5HA 4O0QA 4TQTA 2D73A 2WB5A 3WH5A 1RP8A 3FAXA 1UG6A 2ZICA 1DWFM 4AEFA 5RUBA 3ZS4A 3UCQA 5JU6A 2BGQA 4NASA 1XQKA 1Y5XA 4X2PA 2ZRXA 4B5SA 3LTYA 5EMUA 1PIIA 3PNUA 3K8KA 4GCAA 1O5RA 1YE6A 1KBKA 3ZJ8A 3LRKA 3KDNA 2DW6A 3T40A 2DDXA 5LHFA 3NO3A 3H8AA 2ZADA 2DV0A 4DM2A 1Q6GA 4H9MA 3U2CA 4QJ5B 3KRSA 3EWXA 3BV7A 4BHYA 1W1B1 3CQJA 3QPEA 1CEOA 3MMDA 1V3KA 3T05A 4MKVA 1YDYA 1AVAA 3L4ZA 3OYZA 3VC6A 3S3GA 2OR2A 3WQOA 1DV7A 4HA1A 1QK2A 1GQKA 1WBHA 2ISWA 3BWWA 4OZOA 1LTDA 1H49A 3B4UA 5A6KA 1JJKA 4YPJA 4Z2HA 4DEFA 5G1TA 1UBSA 1AL8A 1HJWA 4ATWA 2VEKA 1NDZA 2F9RA 1Q6EA 3EKGA 3W38A 4PTWA 1UR9A 3WBAA 4RXGA 2NXHA 1D9EA 3KS5A 3GR7A 3TWBA 3OZMA 3GK0A 2DSKA 8CGTA 2WKJA 4IQEA 3TAKA 1S3HA 2VT0A 1EJRC 3AHYA 3G0SA 5D03A 4H19A 1IZKA 1TTQA 2HBVA 3MI3A 3P8JA 2V82A 1UR3M 2PCQA 4AWEA 4MDOA 3O6CA 1E4IA 1TCMA 1TPVA 4LBUA 1POJA 2WJDA 2XM2A 4QCFA 4ZO9A 2OX4A 3CIXA 2V5BA 5LSMA 1J0YA 2C18A 1LL6A 3I10A 1JRBA 4XTDA 1RQEA 1U5JA 1JRCA 1S38A 2WXDM 2E8YA 2R91A 5I77A 3KX6A 1GVQA 2CHOA 4ADUA 1EGZA 4UFJA 4AAJA 3B0VC 3KWSA 1EO5A 4HQVA 4RE2A 2BASA 3VD7A 2W9MA 1J01A 4UIOA 3AXIA 3BQ6A 4XUGA 1P0BA 3BLIA 3NYDA 5KZMA 5HWJA 4L4OA 4P5UA 3T07A 1JF6A 3II1A 3SN0A 3NPUA 3M0XA 3W1MA 4QG9A 2WHLA 4QDPA 3CIWA 1CBGA 2ON3A 3UYCA 1JPDX 4LV4A 2B31A 3DC8A 4QS6A 1XG4A 4FS9A 3GRIA 2CXEA 3GLCA 4LNYA 1HL8A 3FYOA 5BRPA 1PCKA 3QSRA 4J3UA 4UMBA 3V4BA 1KCXA 1Q5MA 5JBDA 1CXLA 1FY6A 2G8ZA 4DWDA 1TJ0A 3QHOA 2PD5A 2CHNA 2OEKA 2WQPA 1W91A 3E2SA 2XISA 2NLYA 3O3RA 1PDZA 2REQA 4CD7A 3YPIA 4U2YA 4J35A 3AUJA 5C9WA 1E6XM 3VNJA 3QF0A 3MCMA 2HSAA 3L2IA 4FO4A 1FXPA 3LPGA 4NX0A 4DX3A 1LLOA 1XSIA 1GG0A 5I6SA 3A5FA 1ZNNA 1Q3NA 1M7XA 2JE8A 3ITOA 1M41A 2A7NA 2J9ZA 1SGJA 4LVGA 4Y6GA 5AHMA 3UXKA 2BX7A 3WUGA 1VLIA 4JX5A 5HPOA 3W88A 3B9EA 4AHPA 1V3MA 1A53A 4LAKA 2NUWA 3LI1A 2Z0IA 1ZCOA 3MKVA 1F7BA 3QQ0A 3NXLA 5HDRA 1R86A 1LCOA 1K3UA 4JTIA 2I1OA 3NL5A 5D2XA 5D30A 4P61A 1P1XA 1R38A 5JQ9A 5BMWA 2FFCA 3TQ0A 1CLVA 1KR0A 1BYDA 2EO7A 3G2GA 4ADTA 2G3JA 4HOWA 2YA1A 4O16A 4A21A 4H7VA 3OZYA 3GKFA 3O9NA 6REQA 5D2YA 3JUGA 5TAOA 2VR2A 3MP4A 4AXKA 1EJWC 5CGMA 2ZXDA 1EH9A 5AZ1A 4Z42C 5TD4A 2NQLA 4D6GA 3UF9A 4MIMA 1TPWA 4JCMA 1OWQA 1VBJA 3THAA 1DKWA 1AMKA 1HL9A 2Q3RA 4M24A 5EBAA 1EP1A 4AIOA 1LBLA 2YCEA 5DELA 4MUPA 1FWBC 4CN6A 4RPPA 4X0VA 3LOTA 2BVWA 3L7RA 3VM7A 3AS3A 3QR3A 2WSYA 1XLHA 1Z69A 1TTPA 1ZALA 3AXXA 4PMZA 2WM1A 1NQKA 2WSQA 1H2JA 4MZ8A 4KEMA 1CZ1A 3PPHA 2NSOA 3RFAA 3TEVA 2Y7EA 4XQ6A 1C9DA 1NWSA 2HS6A 3IVUA 5AC4A 4O53A 2D24A 4W4QA 1KM5A 3R58A 3OBKA 3DG6A 4BI6A 1QHZA 4LVDA 3WD3A 4UZSA 5ECUA 2ZRVA 3SQSA 1AUSL 3CWNA 4YMZA 1AH3A 1EJXC 1SR9A 1UWRA 1PX3A 4RX0A 5A94A 1XIJA 4J4KA 1XYAA 4S39A 3OBEA 4PB5A 2QF7A 2QPSA 1V7YA 1GJWA 4DI8A 1P0DA 1QK0A 1O1ZA 1GJPA 1BF2A 1WOAA 3SSJA 1WDDA 2V5CA 4F0MA 5E5CA 1UW9A 4DAFA 4K8GA 2RDXA 4AYSA 1SMDA 3R10A 1ADDA 1FKXA 5C9UA 1LL7A 2FVMA 4WKHA 4W7VA 1XYFA 2HNEA 3ABSA 5BXRA 1EEXA 3O0FA 1ZQ5A 4K39A 3WFAA 2I16A 3VDBA 3FEMA 4WD0A 1W5MA 2EGZA 1Q66A 2W0UA 3C5QA 1IYXA 1RJQA 3BLKA 2WW5A 2OLSA 1IXQA 4NIRA 1BKSA 4PUJA 5T8GA 2JF6A 1VFTA 3MA8A 1OK6A 1D7FA 2PTZA 4Y96A 4YHEA 1RHCA 4FX7A 4YLWA 3VI2A 5M5DA 1P48A 1YHTA 2EJ1A 2CKRA 1J5TA 3WYZA 2CPUA 1WX0A 2HROA 3DI1A 5ABHA 1B5TA 3NQBA 5BW6A 2J9YA 3KXQA 3HV8A 1XSKA 4NF7A 3MSGA 3FAWA 3SFWA 3PBMA 1B3ZA 5BOFA 1T8XA 3PTKA 3TOYA 4AX7A 4RL3A 3RPTA 4TVDA 4C5ZA 1JDDA 1B3OA 4HK7A 2JIWA 1MUWA 2VOTA 2R6OA 2WJZA 4NNCA 3PWGA 3TYBA 1K9FA 4JTEA 5A8QA 2ZA3A 4N0RA 2BNJA 1H11A 1M01A 3EEZA 3QR1A 1IGSA 4Q8TA 4GC3A 8A3HA 3MYPA 2XM1A 2ZZ5A 3S1WA 3N29A 2BSLA 1RR2A 2DZWA 3EX1A 3MHGA 2XFYA 1F76A 4JTGA 5FEPA 1CTNA 4QDMA 3CZGA 2WSRA 3EOOA 1KBIA 4BZYA 5G2HA 5FSDC 3AIUA 1PJ9A 1XDJA 1YPFA 1E4NA 1AZ1A 3CAQA 1TVLA 1Z7AA 4RZ4A 1GOKA 2FFIA 1JZ7A 1ZAJA 2X0SA 4JBRA 2VRKA 3P7YA 4V1YA 5GNYA 3M47A 3DENA 1G67A 2F61A 5CBIA 2DZAA 3VIPA 2Y5EA 2V5DA 4UFKA 1XBYA 4J27A 1GTHA 4OFCA 4PUUA 1FX6A 4E2VA 3LUTA 4G7FA 4R27A 1G4SA 1MYRA 3AHZA 4PSPA 4GYPC 2PLKA 3TSDA 4TUFA 3TIMA 1WPCA 3WLQA 2OYKA 2VP8A 4JDYA 4IQDA 4US6A 1KKOA 4TTGA 2XVLA 1VGAA 4DBUA 1CLKA 4GYJA 3W70A 2WHKA 4AD1A 3F2DA 4DYJA 2CZVA 3GU9A 3PP7A 4PMNA 3IK4A 3MW7A 1XBVA 3BSMA 1KTNA 3OG3A 3GAKA 4GGHA 1RBLA 3CS2A 2F2KA 3N04A 3W84A 1ZENA 5FEXA 3W22A 2Y6ZA 4EACA 5LA2A 3AS1A 3DFSA 4URIA 1W3LA 1E6SM 3ARZA 4MM1A 1PTGA 3LLDA 1IWPA 4RZ5A 5F1VA 4INFA 3QZEA 1ISVA 2QT3A 2X41A 1JXKA 3HFTA 4IIFA 1WDWA 2DZUA 4IUGA 2HPMA 1QDSA 3VKDA 1ITCA 3WY1A 4O19A 1JPIA 1VF8A 1VHNA 2O0TA 4WLCA 4POCA 2PDKA 4DF1A 1GCYA 1J4EA 2HISA 4GJJA 4V28A 1KCKA 5AHNA 3VAVA 4HIBA 1MRQA 2V9DA 4UQEA 2CKSA 1E72M 3QYSA 3K8LA 4Q8QA 1JCXA 2CZEA 2YYUA 4MJZA 2VEMA 3DFTA 1C8QA 3TR9A 3IJ9A 4V2XA 1TZ7A 4CEUC 1OD8A 2R9RA 5MKGA 3HO8A 1RLCL 2J6VA 1LM1A 1ALDA 3W87A 3B03A 3VIKA 2FVKA 2VX4A 1DJXA 3HG2A 3NFUA 1XISA 1OZMA 3S1GA 3H2NA 4XD5A 2AKZA 5BXTA 4ADSA 4ZQMA 1YDNA 5AC6A 3N25A 4MKNA 4GQBA 5JVLA 4IM4A 3WELA 2XSBA 3V36A 1WO2A 1BVNP 2WYSA 3IRSA 2J62A 3M5ZA 3LBMA 4QRNA 3HQ1A 3AZTA 3IANA 1HKVA 5A6BA 4YTQA 1FWCC 1JZ6A 2QUNA 1PKYA 2NQJA 4PB3A 3DGRA 4LUIA 5CSUA 1E9YB 1YADA 1HJSA 1FQ0A 3U57A 5BU9A 2VC9A 3MUXA 3A6OA 1M68A 3TDFA 3WD4A 2ABAA 4HZ7A 1VFMA 4HNLA 2QLYA 4ZZ9A 4B5TA 3EX3A 5CSRA 3SCRA 1SO5A 1AW2A 2V3FA 2HRWA 4TX6A 2QPXA 1IWBA 2O92A 2Z2UA 3WLLA 4Y9MA 1GPWA 1KRMA 2ISVA 1NU5A 1UD6A 3WDIA 3CZEA 1MQRA 4B2DA 3M0LA 2WLZA 3GC5A 3F5LA 1OGBA 1Q6OA 4JTDA 1G6CA 3V0TA 3A4JA 3U7VA 4XZMX 7TIMA 5KSWA 4G9PA 3TROA 1QR7A 5F2LA 2WVVA 1MMFA 4ZBCA 2WANA 4FX6M 2ACQA 4UQ9A 3EOUA 1K70A 4F0LA 1E0WA 1PVNA 3ITCA 4AC7C 3KZPA 3WF3A 2ZZ3A 4H01A 1JPMA 1H7XA 2E5BA 4RNFA 2BXZA 4B5NA 2JF7A 1IIHA 4EANA 1H51A 1R3RA 5DMMA 5AC7A 3VZXA 3EB4A 4H8NA 3WQDA 3PC0A 3AAMA 3WMCA 2YBUA 3SM0A 3HPSA 1WZAA 1KM6A 2PWVA 5CSSA 2FZBA 4D6EA 2V2DA 1TE6A 4KWSA 1BLIA 2CLLA 4U5KA 2PDBA 1Z9AA 1QMLA 1XICA 1EZWA 4HSNA 2VDIA 3KRUA 4Q33A 5D9OA 7REQB 1QHOA 1QPNA 2XH7A 5C7VA 3QXBA 2CEQA 2RJHA 3PM6A 3T0BA 3H2CA 3I3EA 2AQWA 3KWXA 4XKYA 3EDDA 4HCLA 4F0SA 4XKMA 1TA3B 2FTWA 1REQB 2QIWA 3KDOA 3W6LA 4OQVA 4NAEA 4NNAA 4IWWA 2V0TA 4WGHA 3FDGA 4JZ5A 4IIGA 3WLRA 4EF9A 4GNJA 1JYNA 1HJUA 3A47A 1P6CA 1XLBA 3QVQA 3L65A 4F40A 1Z32X 5IHSA 5DY2A 3LCFA 4IICA 1SSDA 2A85A 4FK9A 3UZWA 1JPKA 1J2BA 1R47A 2OT0A 3GXPA 2ALDA 3BW4A 1UWAA 4MPQA 3R0KA 1S2WA 2GVJA 4OBTA 4O1EA 4B3ZA 1FCBA 4Q4OA 3IWPA 3CHEA 3KL5A 4HSOA 4NZCA 1CECA 4GG9A 2V6AA 3SIZA 1HKMA 1QUMA 2NVAA 4FOUA 1V79A 3IJ7A 1POKA 4XAZA 1CXHA 2PDNA 3W2NA 3BAXA 3WBXA 2QPUA 3H53A 2BXYA 2HV5A 4I7UA 3PFRA 5H2ZA 3RK8A 4FIQA 3I3BA 5AYZA 3KHDA 3W7GA 1HKIA 3M0ZA 4D8ZA 1A5UA 4UTLA 3M0HA 4LCQA 4WSJA 1AJZA 1E5JA 3MP5A 3FYYA 4QE4A 3U2EA 1XCFA 5LNVA 4Z1YA 4IJCA 5CPLA 3CGTA 3DFHA 2PI6A 2QJIA 4KGLA 1CB2A 1Q63A 1UR8A 3ONBA 3V75A 4AZCB 3PWAA 1IT0A 1XIDA 3WLOA 4OU1A 1RXOB 4EIVA 3IUDA 2WQDA 3GXMA 3VGEA 1J0HA 3A3WA 4M29A 2YL9A 3U2OA 1T8QA 5CBBA 4B5XA 2YL8A 4XD3A 2HPIA 3CEUA 4GCXA 2BG5A 3ORWA 1QI4A 5FJUA 1RUSA 1EX5A 3AHVA 1E3XA 4NP7A 2NX3A 3A64A 3UZZA 5I03A 2VX6A 2VXNA 2CESA 1JG9A 3WMLA 5GVJA 3LGGA 5DLCA 4HU0A 4QXIA 5FF7A 2VRJA 4PMUA 3W7PA 3S47A 3GNOA 3F4NA 3LCXA 2EKGA 1BYBA 5DMLA 3DFYA 3EDFA 4DIAA 2Z24A 2VEFA 4IP5A 1VS1A 2PS2A 3W7DA 5A6MA 1W1A1 1UHVA 3UR2A 2X1SA 5I0DA 4HBKA 1GEQA 3IIVA 4K6AA 2BHZA 4GX8A 5E93A 2CW6A 2CHRA 2QZRA 1O66A 3G1DA 3W7EA 1W1TA 1Y5VA 1OFBA 4LUTB 4NL1A 4S3BA 1D3GA 4LS2A 3NGFA 3RIKA 3GZAA 3DECA 3TTQA 4FLRA 3GNNA 3E0FA 4L6HA 2V5JA 2VFEA 4XD4A 4E4PA 1R0MA 1E43A 2QCEA 4UFLA 4AY1A 1QRQA 5GQBA 1J5SA 4QNWA 1E0UA 3M0VA 3BUVA 1W54A 4PRTA 3URNA 1QI3A 4KCWA 4Q4QA 2AL2A 2QUTA 2E25A 3QY6A 1XYLA 2X2YA 3KL3A 2PLMA 3BL3A 4QQ3A 2Y5SA 3DERA 3RNDA 5C9ZA 2Z1VA 1XRSA 1BPLB 3S5YA 1GTEA 1XC4A 2GYIA 1NDYA 2ZKMX 2JGQA 4IPNB 3S6DA 4CQBA 4ORIA 3MUZ1 2FGZA 1QJWA 3PZUA 4UOQA 1KTBA 5HANA 4PCSA 3FA4A 3T1GA 2BP1A 2PP0A 3H55A 3UWUA 1Z3NA 3P82A 3RX2A 2CWXA 3Q58A 4GZIA 4NQ1A 5I7GA 4NU7A 5F7UA 3B8SA 3S2NA 2VYOA 4F4RA 4S3CA 4HCDA 3BH4A 1QPKA 3C8NA 1EYEA 4R34A 3TYUA 1U22A 2V2HA 2Q8XA 2A3LA 3CTTA 3UZXA 3VILA 2G41A 4MWAB 1TWSA 2FZ9A 3QZAA 4X9SA 1PIFA 1GK8A 4N4QA 4NZ5A 1Q45A 2AGKA 1IZJA 5EB8A 1QU4A 2YGYA 3IIPA 3N9SA 3TAOA 2PP3A 5D02A 3O6YX 3ITGA 5GPRA 1ZGDA 4KBXA 2CFFA 4AQLA 2AMXA 3C0LA 1TSIA 4JR5A 1MEWA 4JEQA 1DWIM 2V5LA 4AZ5A 1AQFA 3MSDA 4GUJA 4S3GA 5FF0A 5I3FA 1PX4A 3ABZA 4BK9A 5DF0A 1A4MA 3T81A 3BLEA 1EHNA 2QW5A 3BOXA 3E2QA 2I17A 1OABA 3RILA 3RR4A 2WPBA 3GAYA 4M5PA 4GXMA 1H63A 1P1MA 3W1RA 2FH6A 3M43A 3NJ3A 1TV2A 3GDTA 5KZEA 1TQJA 3IK2A 1QNSA 2WMHA 4IOTA 1TJ2A 3DBNA 1FFRA 3S2MA 3VIIA 1UWQA 4GIAA 4E5TA 2DGAA 2LLEA 1DL3A 1DHPA 3P5YA 3VD5A 1YIXA 2C8NA 3Q2DA 4GYFA 4O52A 2VI0A 1GT8A 1V0NA 2X1TA 2XWDA 3G1RA 3MI6A 3W1XA 1JD7A 5LNWA 1EJUC 4JIQA 4YN5A 3BMXA 1PBGA 3MVIA 4GYPA 2V3DA 3LTSA 1WZLA 4JD4A 1A5CA 2HMCA 3LEPA 3RDKA 4KRZA 2QCHA 3CPUA 4QJ4B 1GOWA 4LF1A 5HATA 2DY3A 4AYGA 3G1AA 3NSNA 3V18A 3AXMA 1LROA 3EDEA 3R43A 2DIEA 4DXVA 3HGOA 2WHMA 3SY8A 1SO4A 3WNPA 5I5RA 1KFLA 1SPQA 3R7MA 4WJ8A 1OK4A 1FWGC 4GZ7A 3SQLA 4UTWC 3Q67A 2PBGA 4N42A 1W8SA 2IMRA 4JIIX 1DQXA 1OYCA 2BODX 4F66A 2IKIA 4FXFA 4F8XA 6PTDA 3GUWA 4PODA 1KWGA 3KTSA 4LAZA 4GKTA 1AFSA 4ZQOA 5H8PA 3VDAA 3LY0A 3K46A 5KITA 2VDGA 2RKXA 5HMEA 5BRQA 3WUEA 4XUYA 1RA5A 2ESCA 2W6RA 3EXRA 4H41A 4XISA 5I3KA 2OKOA 4LC6A 5CZTA 1ADOA 2NT0A 4DBSA 3DEQA 4HJFA 3CHDA 4IPIA 1K9TA 5ABFA 4UBPC 4QS5A 1O5QA 1IQ8A 3CO8A 3IJ6A 4M51A 3URQA 3W1NA 4F9DA 2GDVA 4TV6A 3PJUA 3EKZA 2ZXQA 3A24A 1IEIA 4C6NA 1EQPA 4WSHA 3SUVA 3GW0A 3UT0A 1RCOB 4HA0A 1PCWA 2P8BA 3PBYA 4Q8NA 3N12A 4Z17A 1DJYA 1XRTA 4G8TA 4BEUA 1WP6A 3GG0A 4CQDA 2CZDA 4B16A 1BRLB 4XO6A 3JS3A 3AS2A 4NJKA 2PWGA 3G1YA 4C90A 5DANA 3ATYA 1TV7A 3TYZA 4RE3A 4NYUA 3PZ9A 3T6CA 4YTUA 1AH4A 3VOJA 1EHAA 2VC7A 4JTRA 1VD6A 4MOZA 3HM7A 5H1WA 3DH7A 4EOUA 3S2CA 1RBAA 4ZO7A 3L5AA 4LH8A 2ZUMA 1JXJA 3RM9A 1OZQA 4RE4A 3WFZA 2REQB 3STPA 1E6NA 2BDQA 3ZJKA 1H62A 1HVXA 4ICCX 2XU2A 1XLGA 4NNBA 1HN1A 1SZFA 1S5NA 2XZ9A 2VQUA 3STEA 5AC8A 1BSIA 5C55A 1JQVA 1XM3A 4PUKA 2OO6A 2YSWA 2CERA 1RLDA 4J40A 5LIKX 4YCOA 2PDPA 1AJ0A 1L8PA 4PBFA 1PAMA 2H6RA 1BWKA 1LF1A 4LFYA 3N14A 3TP4A 3OA3A 3KLLA 2BGNE 1AH0A 3K4WA 4NY2A 3PBGA 1TCDA 2VGIA 1UP2A 4EKJA 3TV8A 2VHLA 1XI3A 4L5ZA 3WD2A 2QV5A 3W72A 6TIMA 2HS8A 2A1YA 2EPHA 2YDRA 4NRRA 1ZL1A 1RP9A 3QW3A 1GOQA 2UY3A 1ICSA 4L6DA 4B3KA 4UFIA 3G22A 4OUEA 4O28A 2WLYA 1MXDA 2BS9A 2CWNA 3E1F1 3C3NA 1ZZMA 1GONA 2CLIA 3BW3A 3OJGA 4PMDA 4PTNA 2V38A 2HXUA 2QAPA 4L6OA 3B05A 3WQPA 4Z2LA 6REQB 5G4HC 1TV8A 3LQGA 3ZJ6A 5HK4A 1FWIC 3XIMA 1OFQA 1RVKA 3TR2A 5BU6A 3OLIA 1S5TA 3I3DA 3A3XA 2J7FA 1VFLA 5HR7A 3N15A 4P2VA 3TTYA 4C6PA 3DIPA 2FTPA 4AVOA 2XPKA 3BAJA 3S6OA 4C6OA 4AD3A 2ZA1A 2ZRYA 2R1KA 4IL2A 3DI0A 4BEQA 1B54A 5EGRA 3GR8A 4LCSA 4A3RA 1NEYA 3I4KA 3W7HA 3W7RA 4KGJA 4U4MA 4GVHA 3QV6A 2DVXA 4A2RA 1BF6A 2E6AA 3ECQA 5LIYX 2KX9A 3GXDA 3ZT6A 1RVGA 4GFSA 1HP5A 1DQWA 4KT2A 3GVRA 3BGGA 5FA5A 1CNVA 5CZJA 4O50A 3AALA 3IUIA 1AQHA 2NV1A 1QBBA 4US5D 2YW4A 5BRBA 4DJFA 2D3NA 3BJTA 4DWSB 3GXIA 2Z00A 2IUZA 3CZJA 1XF0A 5A2AA 4GHRA 3A5VA 2QJMA 5A95A 1UPPA 2OLHA 2OQLA 3MKKA 5H91A 5EPDA 4N02A 1V03A 3VKKA 3DAQA 2OB3A 2B81A 1FHUA 1G5AA 3T8LA 4IISA 5HINA 3I7RA 3AIWA 5GNZA 4CKQA 1UA3A 3QC0A 2IPFA 2OX1A 3M6YA 5B7YA 4I3GA 4A6GA 1FHLA 1HIZA 4J28A 2JALA 4JHOA 2ICSA 1PKMA 1M1BA 3AIVA 1DTUA 4K1WA 1L8NA 2OEJA 4L64A 3TJIA 4NG3A 3TX9A 2OXNA 3L9CA 1OB0A 3N73A 4HZ8A 1XLFA 3SJNA 1BQCA 1TPFA 4DPQA 1JQXA 3F4WA 1FWRA 2V30A 5T91A 1OJXA 1IE7C 2HVNA 1ZUAX 3E38A 4KFPA 3AROA 1FH9A 4QBXA 4L4LA 3CQIA 1A5OC 5LNRA 1IWAA 4BQ3A 3K4DA 1OIFA 1KFBA 2J75A 3R12A 3KP1A 1UJQA 3W2KA 4PH6A 1I60A 2UZ9A 1RY8A 3EX4A 3ABRA 3LDVA 1UROA 4M81A 1EJVC 4NUWA 1R2TA 2YXGA 1I6NA 1SJBA 3CZLA 4KMQA 2OVLA 2PTYA 3AJ7A 4J3SA 4NAFB 3BV4A 3KCOA 5C6MA 4N6FA 3WG6A 3TC3A 4C6MA 2UWFA 1UASA 2BBFA 3ARPA 1J6OA 1FP8A 2TSYA 4IH3A 3VCNA 1V7AA 3T78A 2B7NA 3RO8A 2EG6A 4L65A 1SFSA 1JDEA 3EMQA 5TBOA 6XIMA 5MF5A 3OG2A 3NM3A 3QFWA 2VZVA 1V4YA 4Y9NA 5DCBA 1BEUA 4KERA 3SGZA 4MHBA 2Y8UA 4O0ZA 4Q4MA 1FCVA 3UBPC 3EBVA 4HN8A 3WBEA 1R46A 4C6BA 3WDQA 4P8UA 2GGIA 1BG9A 1U1HA 5JIPA 1ICPA 5D32A 2QCGA 3LV5A 3EA1A 4D72A 1P6BA 4Y9AA 4ILSA 1AQMA 4UQAA 1OCBA 4WDXA 3QHMA 4ZSTA 3S5OA 4Z08A 1VFOA 1XDMA 2VUYA 1RZMA 3AZRA 2NWRA 1EJ7L 2YA0A 2YCKX 3CZKA 4X22A 3P67A 3U8GA 3ABXA 5AFDA 1T99A 2VVSA 4KIRA 3W7CA 1R3WA 1EBGA 3WDJA 4QM1A 5I3IA 1OX5A 2IQ0A 5CCZA 2MANA 3EWUA 4DRSA 4Q3MA 3QGAC 5HNTA 4UTUA 5E09A 2P88A 2WHJA 1SZEA 3CZ8A 1X96A 5FAJA 4KCTA 2YX0A 1BXBA 3BG5A 4IPPA 4QX4A 1LWIA 2E6FA 3QGKC 2ONEA 5LIUX 1MZHA 2CLHA 2XFFA 3PB2A 3OVQA 1UC4A 4QHRA 3VMNA 1UD3A 1A49A 3W85A 3M0KA 2EG7A 3FA5A 3NGJA 4NXSA 4C7DA 4LBSA 5F2MA 3H21A 1AA1B 2J88A 1YW1A 2AKMA 5HQMA 4JL1A 1PXGA 3HBLA 5A69A 3SCPA 3L21A 5FD0A 4WDWA 1A5MC 1XYCA 3NQ2A 3OP2A 2E28A 3ITVA 2EAWA 4D2JA 1C9WA 1HNYA 1TR1A 2QCCA 1XH2A 1R9YA 2D20A 1S46A 3LBCA 2DIJA 2J7EA 1DWHM 1KTCA 2POTA 3P84A 3H2OA 3N2OA 3LNPA 1NDWA 3CUZA 3KBWA 2FZDA 2PWFA 1PYMA 4FXJA 3QEZA 1MEHA 1OF8A 3EWBX 1XWYA 4CQCA 3WF2A 1NIUA 4LSBA 2NQZA 3R25A 3LCGA 5HWMA 3AQUA 3KEHA 3QTPA 3VOHA 5AHEA 3WJYA 1UD8A 4HK5A 3WEMA 2DT0A 3T09A 1X8CA 1Q6DA 5D05A 2J8TA 4DUOA 4UR9A 1ZJBA 2YDQA 2IW0A 1W1IE 1JCJA 2GVGA 2EG8A 3A22A 3TJ4A 4MKSA 1X98A 4ZEPA 1PWMA 4PULA 2JFEX 1SZRA 4AHOA 3OVPA 3KOXA 3ZSSA 2GQ8A 2ZUTA 1OQFA 3VXGA 1OT1A 4JTUA 1R2RA 1SUXA 1XBZA 4F79A 3UZJA 3G24A 5CXPA 3TW6A 4A3YA 1U5VA 1GOMA 4HYWA 4TR9A 1D7KA 3ITTA 1AG1O 5DMYA 3K1GA 1F5ZA 1M3UA 3TLLA 2ZZ2A 4J9JA 4CU8A 1TO3A 4QQUA 4RNJA 3DN5A 1ESWA 3MMTA 2DUZA 4XV0A 1IEQA 1UQYA 4NT0A 3E3HA 2NVCA 4M6VA 4I9AA 4WCJA 2IS7A 1ONEA 4RDVA 1OEPA 2WAGA 1VRDA 5G1YA 3W2MA 4EAYA 3FA3A 2ZUUA 4QLJA 1VKFA 4JY9A 4TVUA 4C6FA 1H09A 1B57A 3CL6A 3ZZ1A 3GYCA 3PVFA 3PR2A 3OHMB 3LB0A 1B30A 4PTXA 2E40A 4PMYA 4Q22A 1FWEC 3W53A 2WMIB 3IGHX 1LORA 3W7MA 3AMKA 3S9ZA 3UJFA 3NO1A 3NEHA 2WVVB 1PTAA 3CK5A 1OYAA 4FEZA 1UD5A 3GKAA 2PFHA 4UNIA 1W0MA 4JX6A 3W07A 4ZXLA 3GNRA 4UTMA 5DY3A 4QDWA 1LUCA 4ZMGA 3UR5A 2OMAA 2X7VA 1Q7MA 3CB8A 1EFZA 4ZVJA 2Y70A 4IUOA 4FLOA 3ITXA 5D2VA 4DJFD 1CENA 4GC4A 1N2VA 5E0KA 3OB8A 2E6YA 5IOBA 3GDRA 2Y63A 3UP8A 1E0VA 5CC5A 4DO7A 4HT3A 1X6NA 3GIYA 3P0WA 3IIOA 4I9JA 3GQYA 1CI1A 3UG8A 4BWLA 3C0SA 3LMYA 5EFFA 1W31A 4NZ1A 3WZ0E 4M80A 2VFFA 3SCVA 4U33A 3VC5A 2BLEA 4GKLA 1JCLA 1DIDA 4GGBA 3KTXA 1FWHC 4JYDA 4NAEB 3EPNA 1O7AA 3OLEA 1GOIA 2WSKA 1JEZA 3UWZA 3RAOA 4IHCA 3TOPA 4I8YA 2BVYA 2OOGA 3CASA 3OGRA 3WLMA 2FTYA 2DVTA 3LLFA 1QHPA 3UVAA 5JXQA 1Y0EA 5F4XA 3KL0A 2ZC8A 4GQQA 5BNKA 2RDWA 1EKOA 1YE4A 3B4YA 3DFOA 3OIHA 1C91A 9XIAA 3W29A 4O0KA 4Y9OA 5CPQA 3GH7A 5MHBA 1SZNA 1XCXA 3AWOA 3F4VA 2W63A 1DPMA 4Z1BA 1K6AA 3CPGA 1Q6RA 3ES8A 2GK1A 2PDLA 3IUHA 4PFHA 3WH7A 3Q37A 4JQ1A 3FCPA 3L2LA 3WDHA 4O13A 1BYCA 1A3XA 4GO9A 3CUGA 3T0CA 2VO5A 3O0KA 3GG1A 4GVIA 4GNVA 3PBUA 4OECA 4Z1AA 3KCJA 2DSWA 1NVMA 1FWDC 2C1IA 1ECQA 5H8MA 2ZX8A 2WMFA 4XZHA 5I06A 3PY2A 3HJEA 1F07A 2AQOA 3SY5A 3K1DA 4AIEA 2VZUA 1EZ2A 1O6IA 3GC2A 3N34A 4JIPA 4XX6A 1H7RA 4G1NA 1VCFA 3IJIA 4MAVA 1QBAA 1DJHA 4G6CA 1QCWA 3FJLA 2BFGA 3ALGA 2A2IA 4F3HA 4WJXA 3RG6A 2H8XA 1TTIA 2FKPA 4IP7A 1PSCA 2DSVA 4H6EA 4V33A 2GOUA 3NEVA 2C79A 5D4YA 3GWQA 3OYXA 3K30A 8XIAA 4QTGA 4H8VA 3HN3A 4N7QA 5IDIA 3GXNA 2PPGA 3TTSA 2GJRA 7A3HA 5U7SA 1JFHA 3W82A 1IEXA 1UMLA 4QAWA 3IGSA 3D3AA 1WDPA 4XBSA 4S2BA 3UJ2A 1K7XA 4ZA0A 1V6UA 5C9XA 1UB3A 5F1UA 1CWYA 5IFTA 1R3QA 2MNRA 4DZIA 5FIPA 2HK0A 3CUJA 3G1VA 3NG3A 4JPGA 1N8FA 3L4UA 1XIGA 1LYXA 4JAWA 3CTLA 1OCNA 4CUCA 3T0TA 1A5KC 4LANA 3TLQA 1C7TA 4B92A 3UGRA 2VCBA 4HPHA 2EPKX 3NURA 1LOSA 4M6QA 3AYVA 3L4VA 3CWOX 3EPOA 1TIWA 3WSUA 4R7OA 3H4XA 3SGGA 2OWXA 5I09A 2D23A 2G50A 3LM7A 3VGBA 3SCNA 3HFYA 2P1FA 4IFKB 2WNWA 3QV8A 3GBEA 3LLXA 4GUGA 4ACZA 4DVOA 4LYKA 4PUWA 2YFOA 1YTKA 3N3TA 3LPPA 4D6HA 4FR6A 3HV9A 3DHUA 1OC6A 4BS0A 3KM8A 1VJIA 1UWTA 4S3KA 3IVSA 2Y4SA 4CNPA 3UESA 4F48A 4A8RA 4FXRA 4JL2A 1XH1A 3UA3A 4I5XA 5HMSA 1OHLA 3H70A 2HWGA 1IXOA 4GZEA 5FEWA 3GHSA 3IV3A 4JEJA 3QR0A 2PMQA 3UXLA 4M1RA 3LA4A 3EWWA 1LQ2A 4LV9A 1TPC1 3GU1A 1QI5A 3CUIA 1M7JA 3R5EA 7REQA 5HJXA 1L6YA 2VWSA 1OC5A 1VZWA 3M0JA 1LLZA 1EGVA 1F3XA 3TYCA 2O55A 1A5NC 4R9OA 4WY0A 3DKJA 3APYA 3NUKA 2AAAA 5M2FX 5CAKA 2P76A 3RITA 3KBJA 1KFEA 5CGQA 4LYRA 4K38A 4Z2IA 4JN7A 4FLSA 1E6ZA 3W7LA 1J0IA 1X7IA 3M46A 2HJPA 4K36A 1OFPA 3UA4A 1KQZA 3SUUA 1EUAA 5A5WA 5CC3A 2HK1A 5G2IA 1ELSA 1J8VA 2XDFA 1GOXA 3W9ZA 3TCSA 2FDSA 3KHJA 4GX9A 1UC5A 3PZGA 1X38A 4HA4A 2PGEA 4LS0A 1CGWA 4O1AA 2WO5A 3RLUA 3G3DA 4TIMA 2BV9A 1KV8A 1UYQA 2X0HA 1JULA 3DU0A 4UTHA 1MW1A 2YKKA 4PA8A 4P7QA 3WJWA 2WCGA 1QNPA 3F03K 3GH5A 4A22A 3RU8X 2D22A 1MDLA 2YA2A 4O15A 1XLDA 2FZMA 4O14A 5CJNA 4IGHA 3GYEA 1O1HA 1DIOA 3MVTA 3ATZA 3V5CA 1FHDA 3L2MA 1W1PA 1CX9A 3FHAA 4Q8OA 2QDGA 2QULA 4QR6A 1JNEA 5E6YA 3ARTA 2JKPA 3C2YA 4HZ6A 4EAMA 3N2BA 4B4FA 2AGTA 4LEFA 5E0CA 3TSBA 3W24A 3PUDA 4MDPA 1KFWA 4MLRA 3VFCA 7PTDA 3QMSA 3SW6A 4DJEA 3FX4A 2DIKA 2B7QA 3SN1A 3MJYA 2G97A 2HXTA 4Q8PA 1H0IA 2HVMA 2POZA 1E73M 2X0YA 1KBBA 4E0CA 4R7WA 3N2CA 3O15A 2TMDA 3W6YA 3L0KA 1THFD 1XP3A 4AZ6A 1RA0A 5FL0A 3R13A 4C6KA 1J79A 1J12A 2DH3A 4WKFA 3TYDA 4QLLA 3APTA 3V16A 2RHGA 3ZMRA 2DVUA 1RJRA 1Z48A 1SZGA 2RGLA 1TZZA 5REQA 3N2XA 3G1FA 3VO0A 1I75A 1FWWA 1GVOA 5DX7A 3DESA 2Y88A 4JTHA 2XGZA 3VNLA 1M04A 3AYSA 3LMZA 4X0NA 4IFRA 2E67A 3C86A 4OV4A 3NSXA 3FSTA 1DORA 4H7CA 3U7BA 4GA8A 4XZIA 1OSEA 1ZHAA 3PG9A 3VUSA 2G5WA 3N6JA 5C2GA 5H6HA 2ZUNA 3UG3A 4AHQA 2ISDA 5HUPA 1NF0A 1U30A 4WKAA 1TUFA 1WV2A 4QLKA 1R3SA 1VFSA 2JK2A 3FSUA 1JUKA 2FGLA 4UWMA 2ZX9A 2UY2A 3THDA 3AI0A 3VUPA 1K9DA 4O1DA 4O10A 4DI9A 3KE0A 1O12A 1UOKA 3CYJA 3CT2A 1LL4A 4PCTA 3S2JA 5D8WA 1G4PA 1XKYA 4MY8A 1J18A 4DLFA 5M3WA 2PC4A 4GUIA 1G4TA 4P7LA 4TV5A 2J77A 2QCFA 4DY1A 1VBUA 4PRWA 3NZQA 3UCDA 4ATDA 1XLLA 3OBAA 3EOLA 3BZJA 2Q71A 3PAJA 1W3TA 3GFXA 2XVPA 2W4XA 1I45A 1PIGA 2J66A 1XKJA 2V63A 4EP8C 1UR1A 1WZKA 3LCWA 5JUVA 2VD8A 3TN5A 4Q8VA 2BY1A 1DJWA 3S0CA 3SCTA 1HUVA 1A80A 1KO0A 3RJYA 3W7OA 3BDKA 3U9IA 3EMCA 3UWEA 4DZ5A 3P81A 2NUXA 3T9PA 1MNSA 5CG7A 1EC9A 2WBKA 5T9BG 3E5BA 3QJAA 3CBWA 4WIWA 1IF2A 1NFPA 2VELA 2D0GA 4AG0A 2G95A 3N6QA 4REQA 1HX0A 3A4AA 3TQPA 2JEQA 2EPNA 1PZ1A 2H90A 2BHUA 4C6IA 1JZ2A 4JTAA 4ZR8A 5F4WA 4AEEA 3NZRA 2WKLA 7ODCA 4AIBA 5EMJA 3F4CA 1F8MA 1SW3A 4RJEA 4D8LA 2XH4A 2Z2AA 2UV8G 3E0WA 3GS6A 3WJZA 4NI8A 2C6QA 4W93A 1UZ4A 1BKHA 1A5AA 1JIBA 3BE7A 2J7BA 3EYPA 3QY7A 2E4TA 2PU0A 3MUAA 3C61A 3VD4A 2OGJA 2WBGA 1R3TA 1TV5A 1WAUA 1W3IA 4B5UA 2XHYA 4M7SA 3KOZA 1W5PA 3NTYA 2YB4A 4A4AA 2A3AA 4N2YA 4QE5A 4B3LA 2Q8LA 1C92A 1XLAA 5SWUA 1MSSA 3A23A 4KKXA 1QNVA 1E1CB 1XUZA 3WUFA 4AZ7A 1YBQA 1CXIA 1EYWA 1ZAIA 1UUOA 2O4QA 5D04C 1T7LA 2A7PA 3F2CA 4W7WA 1EOKA 1S2AA 1PZ3A 2Y62A 3HJZA 3GVWA 3SUSA 1JI1A 4AY8A 4KEUA 1HKJA 3WLIA 1GZGA 2F84A 3ZM8A 1KLZA 4FMVA 3RCMA 4LQ1A 3W7IA 1F73A 4AD4A 1EOMA 3TA6A 3ZFHA 5HQEA 3LM3A 3SEPA 2D2HA 1V02E 1C29A 3UXIA 1V93A 3TH6A 4K7VA 5AECA 2QGHA 1KBLA 2J8GA 1VFHA 2ACUA 4JFWA 1YDVA 4AMAA 4KH2A 3KOWA 5DCEA 2VX5A 2NW0A 2DZXA 1PO9A 1XIMA 4CQAA 4GJ1A 4MNKA 1XX1A 1UD2A 1BVWA 2R14A 1F3EA 2G0WA 1PZ0A 3FJ4A 1TX2A 3HURA 1F3WA 5AYYA 1KCLA 3GVGA 1UZDA 3WQ6A 4AU0A 1F74A 2RAGA 3RYSA 5DFAA 3N4FA 4U3CA 3UWWA 4CCZA 3H4WA 1UA7A 4TX8A 1VRXA 3D6NA 2X7WA 1ZJHA 3S42A 1VH7A 4C6CA 4A35A 1TVPA 4JFTA 1I2OA 2C1GA 4J7RA 3PZTA 2VCCA 3P5ZA 2Q3OA 3PAOA 1J96A 2ZRWA 3QH2A 1B9ZA 1TJ1A 4A8LA 3NSMA 2PODA 3LSBA 4JFUA 3TSMA 4HYVA 5EMKA 2VFHA 2PLJA 3TXZA 4UFMA 3SCQA 1CGVA 3P14A 3WQGA 2YCLA 3WBYA 2B7PA 4UR8A 3EMZA 4L56A 5C54A 1WCGA 3OPSA 3P62A 3R8GA 2C16A 3SCWA 1XD1A 5CZKA 4Y8EA 3ME3A 1VR6A 2QF8A 2X30A 4MTVA 1BRLA 2IKHA 1K8ZA 5BROA 2CIPA 1BAGA 4FF5A 1XYBA 4JHZA 2VJXA 2YOCA 1LT8A 4EPDC 1DXIA 1F4HA 1DVJA 4HU8A 2XWEA 4NJIA 3BC9A 4IMGA 4DBWA 5BZAA 4GBUA 2D3LA 4XWUA 1XBXA 4K7YA 4PEEA 3KLKA 1M65A 4A05A 3QC3A 3B3DA 2ZXAA 1M5WA 2Q6ZA 4OV9A 1SM9A 1WDRA 5PTDA 3T2QA 3MHUA 3SRFA 2XZ7A 3L67A 4DN1A 1NSJA 2VD9A 3WLNA 3U3HA 4AH7A 1D8WA 1X7FA 2CZ5A 3RX3A 3LCLA 2V5KA 3C2EA 1Y65A 2PF0A 4JGDA 1DEDA 1V02A 4QSFA 4DJED 3GFZA 2IPGA 1KGWA 3VOCA 2YJQA 2ZIDA 3R79A 4GMEA 4JYFA 4X9YA 3B8WA 5FACA 4WJEA 5A8OA 1UQZA 3TU9A 3SDOA 4MYAA 3UERA 1ME7A 4EWJA 3QYQA 3QW4B 3ZVIA 1N8WA 1UR2A 3CAKA 3ICJA 3PZIA 2WJEA 1YKWA 2F6XA 1OT2A 5CQ1A 3EDJA 5E1QA 4ZE4A 3VNIA 2FHCA 1VEOA 2XJ7A 2Y1HA 3P93A 4NVTA 2Y5JA 1BGAA 1KBJA 4HNTA 5CJMA 5HMFA 4KWWA 4RR4A 1JDFA 2AAMA 4IIEA 2DZBA 3MWCA 3WD1A 3IPWA 5AYXA 1O5XA 4YTRA 1GVRA 4FR1A 1AJ2A 4EPKA 2P3EA 3HOJA 1UH3A 3AMDA 3IS4A 1GW1A 1KXTA 4OVXA 1JZ5A 1O60A 1BG4A 2E77A 3EB3A 2X8RA 2ZX6A 2PDFA 3TW9A 2NV2A 3KTCA 3VIGA 5G2WA 4GPNA 1SU5A 3E96A 1CGYA 4FF7A 1UD4A 5KZ6A 1TV4A 3SCOA 3MJMA 3TW7A 5I2UA 3GX9A 3CUFA 2JBMA 4JIHA 1M9HA 3W71A 3CMJA 3R4IA 3ZT5A 2W62A 2UY5A 3W1QA 4OOUA 2Z1BA 1PHWA 4HJWA 1HT6A 1KGUA 4PMRA 2Y7DA 4PMOA 1XDLA 4GY7A 4AD2A 1K03A 3WQWA 4A8NA 3POCA 5BXSA 2V3EA 3W27A 2Q8ZA 2NXIA 4DAIA 3VIMA 1UP3A 1FFQA 3QHNA 4DWSA 1HL2A 5LHEA 1XGDA 3H7UA 5JBEA 3BG9A 4C6QA 4LRSA 5A8NA 5CZSA 3ES7A 3EEGA 2PTXA 2OTDA 4D1IA 1J9YA 4O17A 1DE5A 5FJTA 3L5LA 2ZA2A 3N9KA 2GUYA 3AXKA 4LYPA 3T55A 3MZ2A 1TKKA 2OODA 3QFEA 2HNHA 3GIQA 1UUMA 1EIXA 3VPLA 4GVGA 1BWVA 1HJQA 1TMQA 1JI2A 2XINA 2ZE3A 4JDBA 2ATMA 3VDGA 3C4UA 3CU2A 4M1BA 1MQPA 3EA2A 2PGFA 4LVFA 5HAOA 4IG2A 1WKFA 3SO7A 3TYEA 2HZGA 4MWAD 1I4NA 3QM3A 5BOEA 4FXSA 4UCGA 3S4TA 3VCCA 1IR2A 5HWNA 4ATLA 2QAFA 5C9RA 3MSYA 4JTFA 2BOGX 1R87A 3U5YA 3CC1A 2NQHA 1QATA 3GIPA 4JCLA 2DSUA 2GQ3A 3BG3A 3TJLA 1EEPA 1JCMP 1Z42A 3B9DA 3N17A 5A1AA 1QTWA 3UU0A 2DJXA 2F2HA 2XH2A 3H12A 5DO8A 4E2BA 1WZMA 1FWNA 1K4HA 3VGDA 3W74A 4MUZA 3OHIA 1GYLA 4KEVA 1KA9F 8TIMA 3N13A 1JVNA 1F6KA 4NAFA 4YNGA 1LBFA 4PCFA 5EU9A 3FHQA 4ZOBA 3M44A 2J7HA 4N6EA 3E2RA 4G5DA 5KZDA 1SQ7A 1EL3A 4X2RA 1JZ3A 4D6DA 4HTBA 4UTFA 3PWIA 4PMVA 1ZCCA 2FQIA 4HHPA 2JGYA 1M03A 2E3ZA 5CZ0A 1HKKA 3K5XA 1DHKA 2VFIA 1OG6A 2CLKA 1ITQA 1JAKA 5I3DA 1K1DA 3MB9A 3ID7A 3P8IA 1HW6A 1QOQA 4I5UA 4P7NA 4HSHA 3PBWA 4MNJA 4TX9A 5AB3A 1F05A 1KNWA 1KQYA 1E4MM 4DB7A 3GSMA 4Q7IA 1FWSA 1YTDA 3TC6A 1QPQA 5A6SA 1Z41A 3MU7A 3O6DA 5XIAA 3UD6A 3S1XA 3NDYA 1GQNA 2NT1A 1N55A 1SMAA 1LZOA 3DG3A 3WNKA 1LUCB 3FIGA 4WDUA 3PTMA 3TE9A 2PRMA 2YCJA 4ZOEA 2VRQA 1W9XA 1A5LC 4O54A 5K3VA 3AU2A 4UMAA 1IXPA 2ZVIA 5B7ZA 4ML9A 4BY3A 1DWJM 4P8WA 3RUBL 4KPLA 3I68A 1NELA 3D47A 3FVDA 3BO9A 1ZJAA 3N4EA 4KS0A 1F8IA 3LHZA 3TTEA 3MP3A 1H7PA 3WJSA 3KUMA 1ZBCA 5DEZA 3CH0A 1Q65A 1L2QA 4EXAA 3BJFA 1E1FA 4OGZA 3B8DA 2O9TA 4LOCA 4NHVA 3CHFA 4XTIA 4U5IA 2Z1SA 1QWGA 1JNDA 1I0BA 4GNKB 2DP3A 3BLPX 2ZWZA 1KXHA 4NZFA 4BFAA 5HBFA 3ZR5A 2DPEA 3MI2A 1V0KA 3BSHA 2Y0FA 1VB9A 4XZ9A 4IGSA 1IV8A 1WKEA 5D09A 1IEWA 1FCUA 2YZRA 3IRDA 3W23A 1OY0A 3IIZA 4RK8A 3NQ8A 4IFOA 2YBTA 2WZHA 4MNLA 2YCIX 3PPFA 1QOXA 4RDZA 3PB0A 1NWRA 4FOJA 3DGBA 5HJYA 3UQNA 1KKRA 3BCFA 1QXLA 4KCVA 1RBOB 1Q4NX 2O56A 1H0GA 1R30A 3QV7A 1HKWA 5E9XA 3RRAA 1M7PA 3V35A 3H2AA 1BHGA 3BGJA 1X1ZA 3I65A 2XSXA 4N9DA 3GY1A 2GSEA 3CHVA 1B3YA 3WKZA 4MJ2A 4W8LA 3LXBA 1GG1A 3V5OA 1TWDA 3QRHA 1F6YA 4PC8A 2Q01A 2GK1B 2I9EA 3PPGA 1DE6A 1UKOA 1P0NA 3F1QA 4KETA 4WEVX 4B91A 3TFXA 4U10A 4Q4RA 3OVGA 2YW3A 2R24A 4AXNA 4C91A 1D2KA 4CNTA 1X97A 2D2JA 1G4EA 4AZHA 1VBHA 1SO3A 4IIDA 4EWND 2ZDSA 1JCTA 4UUIA 4L1XA 3QMRA 4F2TA 3USBA 2ATSA 2PDXA 2Y8KA 2GUUA 4PBGA 4PGLA 1R7OA 3WMSA 3PULA 2CNCA 3STCA 1LOLA 1V8EA 4JNYA 5HQLA 2CCRA 4ZB5A 5GJMA 2DSZA 3VM5A 1EIBA 4QJ3B 3KVKA