5CPOA

Crystal structure of xena from pseudomonas putida in complex with an nadh mimic (mbu)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
359
structure length
359
Chain Sequence
SALFEPYTLKDVTLRNRIAIPPMCQYMAEDGLINDWHQVHYASMARGGAGLLVVEATAVAPEGRITPGCAGIWSDAHAQAFVPVVQAIKAAGSVPGIQIAHAGRKASANRPWEGDDHIGADDARGWETIAPSAIAFGAHLPNVPRAMTLDDIARVKQDFVDAARRARDAGFEWIELHFAHGYLGQSFFSEHSNKRTDAYGGSFDNRSRFLLETLAAVREVWPENLPLTARFGVLEYDGRDEQTLEESIELARRFKAGGLDLLSVSVGFTIPETNIPWGPAFMGPIAERVRREAKLPVTSAWGFGTPQLAEAALQANQLDLVSVGRAHLADPHWAYFAAKELGVEKASWTLPAPYAHWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Better than Nature: Nicotinamide Biomimetics That Outperform Natural Coenzymes.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Xenobiotic reductase
total genus 130
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cpoA00
1H7PA 1R46A 2NWRA 5L6UA 3CQ0A 1OFPA 2V81A 2CLLA 3HJZA 3A21A 3FYOA 5K9CA 4N6EA 4J9JA 4YLWA 1BTMA 1KFBA 2C18A 1A5AA 3BW3A 2A85A 3CWOX 2J9XA 3MW7A 3W1NA 3LCXA 3EX1A 3INPA 1TV8A 1LBLA 1GVOA 3PAJA 1A5SA 3PSWA 4ONVA 3W1MA 3HGSA 3LCWA 2QCCA 3G1FA 4PA8A 1PL9A 3BK0A 1W5MA 3D0CA 1XDLA 3MWAA 4M19A 4HKPA 5L9FA 2GQ9A 4MYXA 3C6CA 4ZQNA 1R2TA 1GJPA 4A3UA 2GQAA 3GB6A 4UFIA 3RLVA 4NU7A 4ML9A 2Q3OA 3BG9A 3USBA 3DFPA 3W1XA 4FX6M 4ADUA 2VC6A 4XKYB 1UUMA 4LY8A 3GXTA 1B4EA 3PG9A 3NL3A 3DHFA 3N34A 4WX2A 1EEPA 4DF2A 1AW2A 1KM2A 5LNWA 2XFWA 1OFOA 5G2IA 4O15A 2GVLA 4KKXA 2X30A 4O1DA 3BLFA 2GOUA 1LBFA 3R2GA 4NNBA 1PIIA 2FTPA 3I6RA 1WXJA 4LS0A 3M43A 4RZ5A 4FB7A 2H3BA 5AHIA 3CEUA 5D04C 4Z08A 3W83A 1TPEA 4FNTA 1FCVA 3TXVA 3MO7A 1GVQA 4FNSA 2QCNA 1P5BA 5K7JA 2XN0A 4IJBA 2VEKA 4OWGA 2GJNA 4UTLA 3MYPA 4ADSA 2GVGA 2TSYA 1VYPX 3CEPA 5HNRA 2CFFA 3NQAA 1M7PA 4JICA 3SGZA 3EWWA 4CNOA 3T7VA 1TPWA 3LHYA 1D3GA 4FNPA 4IPIA 2X1RA 1SPQA 4YL2A 3G1DA 4POCA 1L6YA 2C1HA 5F2IA 4L4MA 4WXZA 1R2SA 2GUUA 1A5CA 1MEWA 2F7FA 3UZ5A 2PRMA 1DKWA 5EYWA 5E93A 5AYYA 2DZUA 3HG2A 2NV2A 5DBUA 3G8RA 1JQXA 3E12A 3HO8A 5E1QA 3AO0A 3NM1A 4BWLC 2Y63A 3S5ZA 3FKKA 2NXGA 3O15A 4O12A 5F2LA 3NAVA 4MZ1A 5LNVA 3P61A 1S5TA 4KFOA 2B7QA 4NJIA 1F76A 3PVFA 3B0UX 3W75A 4MPQA 5TQLA 3MI2A 3B8DA 1I2NA 3LTPA 1G7VA 1JULA 4UNKA 1MZHA 3IIOA 4GJ1A 5AHNA 3RFAA 3EEGA 4DBEA 1F7BA 4K38A 3W73A 2CZEA 4AWTA 3G3MA 3NQMA 3BW2A 3CM4A 2H8XA 4NT0A 4JTUA 1HO4A 1VYSX 3M44A 1JVNA 2GQ8A 5CPOA 1CW2A 4FX7A 2JK2A 2X1TA 3NQ6A 3IV3A 2VELA 2NUWA 5LGZA 1O5KA 3KFTA 3AJXA 4IUOA 3W7LA 5FF3A 4LT9A 4MJZA 4HSOA 3O63A 3MP5A 1F5ZA 1FBAA 2ZZ2A 1WV2A 1W5OA 4O16A 3QQ1A 3B4UA 4LWWA 4DBDA 5LGXA 5CZTA 3T44A 2YFNA 2CLMA 3TV8A 3E02A 1TTIA 3LX9A 1RR2A 3HQ1A 3G24A 3QH2A 3SGUA 1NSJA 5KITA 4XKYA 4MIMA 1BWKA 1VLWA 5AC7A 1DQWA 2ZRUA 5D03A 3W70A 4JTFA 5IBXC 1VHNA 4O1AA 2CW6A 3P8IA 2FJKA 4HPJA 4N9BA 3MBFA 3BPWA 5AHMA 1QPQA 2QUVA 2HTMA 5LKYA 2TYSA 5F2GA 4DELA 6TIMA 1OABA 2TRSA 1V7YA 1VJIA 1G6CA 2P0OA 4IXXA 2DORA 3L66A 2Z0IA 2TMDA 4UTJA 4CCCA 3HOJA 1AW5A 2WJZA 1OFQA 1RPXA 3UYCA 1H50A 3G22A 3L9CA 3O1NA 3NL6A 2H90A 3YPIA 5KSWA 3KX6A 3VNDA 3P5ZA 2RHGA 3LV6A 3MJYA 4LTSA 1YXDA 5HWMA 2YSWA 2QUTA 1VR6A 1Z44A 3EX3A 4E2BA 3OVRA 4GUJA 3UD6A 1SO6A 5J5DA 3B05A 5D37A 5D09A 1ADOA 2WNQA 3PUOA 5FEXA 1K8ZA 1YPFA 3GX9A 3TUUA 1OYBA 2QUUA 3SW6A 5U7SA 3U6WA 3B03A 4NXKA 1K3UA 3O16A 2B7PA 5CZSA 5AC8A 1SSDA 2Y6ZA 1N55A 4UTTA 1KM0A 4RXGA 1PHWA 3G1XA 5KZDA 1Q3NA 1OFBA 3P67A 3DU0A 1LTDA 1ME9A 4LC6A 2C3ZA 4RLIA 4EVZA 2HMCA 1XXXA 3TC6A 2ZZ4A 4HNTA 4O28A 4O14A 3EB2A 3DKLA 3H53A 3LV5A 1WQ5A 1KTBA 1I8JA 1P0NA 4JD4A 2RKXA 1DVJA 2R8WA 3O6CA 5K9DA 1XUUA 2NUYA 1KFJA 5KINA 3PF3A 1I2RA 1ZAIA 4ZQOA 2V5LA 1OX4B 3LHWA 5FF0A 4MY8A 1VPXA 1TSIA 4TMBA 1GYLA 3N14A 2CLOA 1F74A 2A5HA 5HR7A 1XL9A 1ZHAA 4E0CA 2Y89A 3W22A 4NUWA 1W3TA 3RF9A 4JYFA 1SO5A 5HQEA 2VEMA 4OHQA 2TPSA 5H91A 5EA9A 4QSHA 3NOEA 2V30A 1M7OA 1H7WA 2P10A 1H5YA 1Z42A 3TNOA 1IXPA 1U5JA 1S5VA 2G96A 1G69A 1VS1A 3HBLA 3W1TA 1FWNA 2C15A 4LV4A 1L9WA 1XM3A 4HSNA 3NL5A 3R8RA 5F4WA 4I7WA 5MHBA 3IIVA 2WV8A 1KW1A 2ZZ3A 2YPIA 4GUIA 4UXDA 2ISSA 1KV8A 3M41A 3OHIA 4UTWC 4UFLA 3LCGA 2H3DA 2DZPA 3S5NA 3HG5A 5HWNA 3CHVA 1J2WA 2ZDRA 4EWND 3TQVA 4E2DA 5C54A 2BXVA 3W7DA 3DFSA 3QSRA 4WOZA 1G67A 1VRDA 5K2ZA 4GWEA 1H7XA 1LCOA 3GKFA 2FDSA 4CQAA 4JTGA 4U28A 1ICSA 2V2CA 2AAMA 2VENA 3C2FA 1I45A 3EXRA 1JUBA 4WY0F 3W23A 4UMCA 4LUJA 1H63A 2WSQA 1XI3A 4TU1A 4EF9A 3N2MA 2NUXA 4UFMA 4Z0JA 3VE7A 5EKYA 2ZZ6A 4IQLA 3TQ0A 3QPZA 4EIVA 1VCFA 4AAJA 2HS6A 3PWAA 2ISWA 3DH7A 4RZ4A 2EHHA 4LRSA 1A53A 3MP3A 2OMAA 5AHLA 2ZCGA 5KTLA 1PVNA 4UMBA 4G1KA 1XBVA 5HJLA 2NX9A 3NQDA 3NQGA 1NF0A 3S1WA 1B4KA 1JRBA 3TH6A 1C9DA 2X1SA 2DZXA 1UB3A 1Q6RA 1VYRA 3P81A 2EGZA 2RDUA 4GE8A 3QQ0A 3L0KA 2ZRXA 1TO3A 4H6KA 3MHUA 2V0TA 1Q6LA 5FEWA 1YTDA 4UR8A 4XTIA 1OFDA 3S1UA 3OBKA 3KVMA 3T40A 3C52A 1FWSA 3N2XA 3LHTA 1FY6A 4JTKA 4DPQA 4BF9A 4IMCA 1ZJIA 3A5FA 3PB0A 3UPBA 2C13A 3KRSA 4AH7A 1YTKA 3RMJA 2QEZA 3QRHA 4DO5A 2VFHA 4K36A 1P0KA 4HNVA 4MKNA 3C3NA 3NQVA 3IEBA 4N9DA 1HO1A 4OT7A 3TSDA 4PCFA 3UWUA 4JTJA 3VE9A 1BKSA 1JRCA 3TJXA 3V1PA 4NJHA 3M5VA 5TIMA 3P62A 2QJHA 1W0MA 3CIWA 3PBUA 1VC4A 1TPH1 4LVGA 3BVJA 5EBUA 1QOPA 3W6YA 2YXGA 2A1YA 1G4TA 4EF8A 4NJJA 3LI1A 3NGJA 3TC7A 4YCPA 1FCBA 1TV7A 2ZZ7A 3W86A 1ICPA 4IX0A 1ICQA 5CSSA 2FLIA 2I14A 3DZ1A 1K7XA 2YYUA 2VFEA 1RVGA 4AHPA 3LGEA 2JKAA 4R7JA 2WO5A 2NX3A 2O7QA 3KVKA 4XBKA 1JCLA 1SFJA 4FXSA 2Q8LA 3W7KA 4LS2A 4X9SA 3QPYA 1C29A 2VEPA 2VFIA 3W76A 3PUDA 3GAYA 4JNMA 2ZTKA 3O07A 5K3VA 2CLIA 3G8EA 2O7SA 3WK1A 1DQXA 1GVRA 4AEOA 1GT8A 1TTPA 4CQ9A 1PHQA 1YTEA 4QNWA 4N02A 2BWGA 8TIMA 1FXPA 1KFLA 2J88A 2VEIA 1G4PA 4JTEA 3C4UA 1LRTA 5D2TA 1KLYA 2KZHA 3I68A 4PH6A 4UFHA 2ZA3A 1LBMA 1FCQA 1F73A 2XN1A 3LM7A 2ZRVA 1SUXA 3ATYA 3F1QA 1WOBA 1PCWA 5I3KA 3WJYA 4GUFA 4A21A 4NQ1A 2I1OA 1TRDA 2E77A 4B5NA 3W7RA 3IIPA 1OVDA 3Q2DA 2YCEA 1NVMA 4R53A 3L0GA 1KFEA 2DZTA 3EWYA 2ZA1A 1SQ7A 5FI8A 3GNDA 3W1AA 4FIQA 1GEQA 1TPB1 5FEPA 1U83A 4QISA 1VQTA 3ELFA 3BGGA 4ZQRA 3B0VC 1ZENA 3QC3A 5SWUA 3OVPA 1C8VA 1D3HA 2XN2A 2G5WA 4MLJA 4N9EA 3M5YA 3KOFA 3LBCA 4UTUA 1TQJA 1N7KA 2FPTA 3L5AA 5A8GA 1KM3A 2E1DA 3LXAA 4BWLA 4AMAA 4UTTC 2A7PA 1AG1O 3QW4B 3WJSA 2NWSA 2B7NA 3EXSA 3PSVA 4ORMA 1OFAA 3S8HA 1ZAHA 1VGAA 1W3NA 1XBXA 4DO4A 2PRHA 4IPJA 2W6RA 1A5BA 5DCBA 3SZ8A 2J6XA 1WAUA 2R14A 4Z1CA 3GR7A 3HGJA 5AOUA 3HF3A 4GUGA 4Y6GA 1KTCA 4PL1A 2JKEA 3I7SA 1KM1A 1G4EA 3FEMA 4UFJA 4YMZA 3M5ZA 3K30A 1LOSA 1TPVA 4PFMA 3I65A 2ZRYA 3SR7A 1EIXA 1GWJA 4KWWA 4DPPA 3CIXA 2A4AA 4IMDA 3QM3A 4LU0A 4AF0A 3W7EA 4JTIA 1EA0A 1MXSA 2FIQA 3I7QA 4MZ8A 3ZR4A 3NQ7A 4MOZA 2ZBTA 4UTMA 4UTIA 3TKFA 4LV9A 3RLUA 3KRUA 1YYAA 1J4EA 1GVFA 3LI0A 2JBMA 3W7MA 3G1HA 3HPXA 2DU2A 3HG3A 4S1FA 4FNQA 1XFBA 4P61A 4MLRA 5C2XA 4JX6A 2YGYA 2E68A 4O11A 3NG3A 1KTNA 2ZZ5A 5IBXA 3L21A 3P84A 1TTQA 2CZ5A 1IXQA 3EWXA 4UTWA 5LSMA 2J24A 3PUEA 4K7YA 4JTSA 5EMUA 1LLWA 1UCWA 4ZL1A 3NYZA 4XWUA 4ZVJA 4LUIA 3M9YA 2VFDA 2VOMA 4JX4A 4DF1A 3QJAA 3GVGA 1SO4A 4WOQA 1AL7A 4JGDA 2F84A 1K7FA 4K8EA 3E49A 3DFTA 4PEKA 1KFCA 2QJGA 5DXXA 3R13A 4O57A 1SZFA 2Z2UA 4IOTA 2WNZA 3CLMA 3W87A 3GR8A 5D2VA 3W7CA 3TMQA 1YDVA 1P1XA 2YDAA 3W2MA 4LNYA 3EWBX 3UWQA 4YWIA 1JQVA 3L65A 2CZDA 4QNEA 4RX0A 3SECA 5HINA 3VI2A 3LCIA 3L0NA 1JCYA 1QNVA 3LXCA 5C55A 3ABQA 4BI6A 4ICNA 4WJEA 3TE9A 3S9YA 4MFDA 3LHUA 2Z1BA 1K02A 2Q8ZA 2VKZG 2V2HA 3B06A 4HNUA 4ZQPA 3CWNA 4D2JA 3S1XA 3M5XA 3LHVA 4OE7A 2E6AA 1XUZA 5DCEA 2H6RA 4O4WA 3T4CA 3NPXA 4OV4A 3EWZA 4N2YA 4DQWA 1W31A 3QZEA 5BW6A 2OJPA 2AQWA 1I4NA 4WY0B 5FF4A 2PE4A 4ORIA 4OQVA 3FIGA 4HHPA 2CWNA 1TPDA 4K39A 3Q58A 1P4CA 2QKFA 1K8XA 4M7SA 4UIOA 3IVSA 3QFEA 3ATZA 4QQ3A 5F4SA 4RCXA 3M7WA 2B4GA 4FIRA 5CZ0A 2Y88A 4XBSA 3SSJA 1EPXA 3ABOA 1X7FA 6ALDA 4N4PA 4OGZA 3SIZA 4OU1A 2DJLA 2HSAA 3FJLA 1QWGA 2BZNA 4LVBA 2FPYA 3W1LA 3BGJA 5CPNA 3M16A 1YPIA 4H4IA 3U2OA 2QAPA 1X1ZA 1G4SA 3KVJA 1QMLA 4Q32A 3DHDA 3IVTA 4JIQA 1R30A 2A6LA 2P1FA 1OG0A 4XTDA 3W85A 2Q3RA 4H3DA 1XKYA 4NZJA 5H2ZA 3BARA 1V5XA 4UTKA 2B0MA 2PRLA 4M6PA 4AWUA 1LYXA 4O18A 3HIJA 4A2RA 2OCZA 2WKJA 3W88A 4ZMGA 3EX6A 5D2YA 1SFLA 3NO5A 2A7RA 1Z41A 3NQ8A 2EPHA 3W07A 1RQBA 1OHLA 3LHZA 1K8YA 2X1UA 1DL3A 2DZVA 1JR1A 4MYAA 4IWWA 4JR5A 4LW7A 3THAA 3M0ZA 5K4ZA 2BX7A 2ZA2A 3RK8A 2A2IA 3IRDA 4TR9A 1CI1A 1EWEA 4Z0SA 2Y61A 4MVAA 3QYQA 2QCHA 1L6WA 4DEFA 3NR0A 2QCDA 1SU5A 2C16A 3W72A 2V8ZA 4IX2A 5K9XA 4UCGA 2QDHA 2QDGA 4FHAA 4AWSA 3BLEA 4CNPA 3G1VA 1X6UA 4JDBA 4Y9AA 3OIXA 3NPUA 3S6DA 1OK4A 2J9YA 2YFOA 1W5PA 3N3MA 3EX2A 4GXMA 4FF7A 1FWWA 1YXYA 1W8SA 1O4UA 4NVTA 4Y8FA 3GDRA 5FF2A 3HMJG 3KXQA 1DORA 1OFEA 5D33A 3TK7A 1QPNA 5AFDA 2ABBA 4ZZ9A 2QR6A 1VCVA 3UQNA 3W7QA 1AL8A 1EP1A 1TB3A 1JCJA 3GDTA 3CU2A 5LHEA 4RZ6A 1W5NA 2J27A 1NEYA 1GG1A 4RK8A 2YR1A 4WZHA 4O4VA 1ZNNA 3STFA 3W7OA 5I3JA 4GBUA 1ML1A 1DHPA 1OX4A 3DI1A 2QCGA 2Y7EA 5D32A 1WBHA 1O60A 2GJLA 3M6YA 1VZWA 3OVQA 3LOTA 2A6NA 1H7RA 5AYXA 1H60A 1Q6QA 1TMHA 3C56A 3R12A 3GKAA 1KM6A 3KRZA 2I9EA 1OX6A 4W9TA 2QCEA 3TCEA 1B3OA 3NZ1A 3QMRA 3N19B 2W79A 1F6PA 4Z1DA 2EF9A 3QMTA 4CQ8A 3MUXA 3PULA 2Y70A 4MJMA 2CLEA 4A29A 5BNKA 3UNDA 2CZFA 4OBTA 5LNSA 1ZAJA 2NLIA 1WDWA 4JYDA 1MEHA 3TMLA 1H62A 3EXTA 5BRBA 1IIHA 4IXHA 3RNDA 1FDYA 1ZY9A 3UWVA 5HUPA 5I3GA 3LXBA 1E51A 4O13A 1F6KA 3W74A 5HWJA 2BLEA 2ATMA 1HTIA 4YCOA 3IGXA 5DELA 3PY2A 3ABSA 2CLHA 4LRTA 2DP3A 1XBZA 1SW3A 3E9AA 1QPRA 1L2UA 1SZEA 1BWLA 5D38A 5F1UA 3CPRA 4GRSA 4TX9A 4FO4A 4BI7A 1NAL1 4BK9A 1OJXA 2C0AA 1LORA 3LTSA 1OF6A 3LERA 5AHEA 5I3HA 4AVFA 1HL2A 2J9ZA 3NPVA 1I2QA 1FXQA 1B57A 2D73A 4O1BA 3P8JA 1LP6A 3WK0A 4HN4A 5KZEA 1LOQA 5G2HA 3P5YA 4JY9A 1LLZA 2ZTJA 5D02A 3UY8A 3G18A 4NX5A 1EX5A 1BEUA 1Z48A 2JGQA 1VH7A 3G1SA 4NJKA 4UNLA 1Q6OA 4FXRA 3L2IA 4PODA 3W1RA 3S1VA 3W7JA 3P60A 3F03K 3L67A 3MYOA 4N9CA 5I3FA 5CZJA 4RR4A 5HR6A 2V9DA 1IXNA 4O17A 1IGSA 3A5VA 3CC1A 4DXVA 1YDNA 4A22A 3M47A 4LVFA 4IGHA 4NX0A 3OG3A 4Z1BA 3W1PA 3MI6A 5K4XA 4IMGA 1QDSA 2FFCA 3BV4A 4WY0A 1IXOA 4JN6A 4MFEA 3LDVA 2JGYA 4O0ZA 1QCWA 3PM6A 3LCHA 1KLZA 3W2UA 1FUYA 3TXZA 3I7RA 2VXNA 5EL1A 3THQA 1CX9A 2G97A 2YW4A 5E0KA 1EUNA 1VHCA 3DFOA 1JUEA 4O1CA 3CT7A 4QAIA 2PURA 3TIMA 4JEQA 3H54A 4GC4A 3V75A 5DLCA 3LRLA 3ZWTA 4UMAA 3EKZA 4CLMA 4S2CA 3C0JA 1H7OA 1JUKA 4RJEA 4FNRA 1GPWA 1Y0EA 3EWUA 1S3HA 3CB8A 1SSGA 1OF8A 4JTTA 3GAKA 4ZQCA 4O0KA 5DY2A 4ADTA 4Y90A 5D2XA 3GK0A 3DI0A 3BLIA 5KZMA 1ZCOA 3W1QA 3TQKA 1XC4A 1ME8A 5TBOA 1WA3A 2ATSA 3R5EA 4UC5A 1L6SA 1W5QA 1F05A 3QSTA 3O6YX 3NEVA 1JJKA 3PBYA 3IGUA 2AGKA 3GZ3A 2NXIA 3BW4A 3FYPA 4O50A 5HUOA 3NXFA 1TCDA 3NQFA 1QOQA 4GNJA 1KM4A 2IQTA 3A9IA 4QIUA 2NXHA 2R94A 4PTNA 3GIYA 3HB9A 1LROA 2ZRWA 1DBTA 4M5PA 2X16A 3NQCA 1WBJA 3FA5A 3IVUA 3LRKA 4JTLA 2A7NA 3W84A 3OEXA 1SR9A 3Q94A 3LTYA 5CG7A 3NQ2A 3C2EA 4ALDA 4AHQA 2V5BA 1H7NA 2RDTA 3N9SA 3LB0A 3WFAA 3TSMA 3EX4A 1XBYA 1MSSA 1PS9A 3RU6A 5G5IA 3PR2A 3W71A 1DOSA 3F4WA 3ZWSA 3BO9A 4JDYA 3NDOA 3NPWA 5BMXA 4LVDA 3TSBA 1K7EA 4RKAA 5AYZA 5J5RA 5D30A 4BI5A 5D05A 2UV8G 1KM5A 2ZZ1A 5F4XA 3STEA 4HIBA 1TJRA 4AXKA 2C6QA 5DN1A 1DV7A 3GLCA 1FQ0A 2E5DA 1QO5A 3GNNA 4O53A 3ZFHA 1NFBA 3TFXA 4P2VA 3VCRA 2E09A 1GQNA 3W1UA 4Q33A 2QAFA 3W2KA 5ABTA 2WOQA 1HG3A 5GVJA 2RH9A 3S42A 2Z6IA 1ZALA 5G4WA 3QMSA 5F1VA 3TAKA 1H51A 3GDLA 3S0CA 2JKPA 2Y85A 5F2MA 2WNNA 1M5WA 3A23A 2QCLA 3HGOA 1TQXA 3M1ZA 4JX5A 1H1YA 2QCFA 3JS3A 3PBVA 4CCDA 4QJ1A 1TPFA 4LOCA 1FWTA 3STGA 5D2WA 4JXCA 3L5LA 3W7GA 4S2BA 4MY1A 3CTLA 5A5WA 3GYEA 3G3DA 1RZMA 3A24A 3HPSA 4QM1A 3U8GA 3LLFA 4O19A 4XQ6A 5LNUA 7TIMA 1I2PA 1EWDA 5CPLA 3IIXA 3NVTA 4HT3A 2EKCA 3WJWA 1R47A 2NZLA 4K8HA 3C2RA 3G0UA 4WUIA 1T8XA 2W0UA 2CU0A 2PCQA 5G4EA 1H61A 1O94A 2E6DA 3W2NA 5EY5A 5LHFA 1OX5A 4M6QA 4X2RA 2VFGA 3DBPA 3FKRA 3L5MA 3ZS4A 4N4QA 1XCFA 2ABAA 2DJXA 1DJNA 4YXGA 5G1YA 1I2OA 5AN7A 4L4LA 3DENA 3LCFA 2ZRZA 4UTHA 3C61A 1W3IA 3W7PA 4AB4A 4JIPA 1FCUA 2C19A 4LVAA 3A22A 1ZFJA 2ZYFA 4JTHA 5U4NA 2DZSA 1KFKA 2YW3A 3FJ6A 1F2JA 1LOLA 3PB2A 3Q37A 5FESA 4DF0A 4O10A 1SW0A 1RV8A 1FWRA 3GDKA 1UJPA 1JCMP 3GDMA 3TW6A 2OZ0A 1GZGA 3TAOA 3DFNA 4OV9A 1TV5A 2ALDA 3UWZA 1A50A 4PL2A 1ME7A 1T0OA 2G95A 3FS2A 3TW7A 2NV1A 3LCLA 4FX8A 3WK2A 1MEIA 1YLVA 4HPXA 4MY9A 1KV5A 1X1OA 1AMKA 3G0SA 1X8FA 3JR2A 1LRNA 2YYTA 4K37A 2RFGA 1OYAA 4JY8A 3LRMA 1EB3A 3MBDA 2GVJA 2Y7GA 2WPBA 1KA9F 4LC8A 3WJXA 1O5XA 2A21A 4HNNA 3FLUA 3HGRA 3O06A 4O52A 2FB2A 3MI3A 4FNUA 2R91A 3BG5A 1JCXA 1G7UA 1SZNA 4NZFA 5DCDA 2V2DA 5CPMA 2YZRA 3IGSA 2X2GA 4EOUA 3T78A 5BMWA 1W56A 1TTJA 3UZJA 4K7VA 4QITA 1QR7A 3W3OA 2EAWA 4O8RA 3L68A 5CKSA 3STCA 3P7YA 4KWVA 3MHGA 2Y7FA 2CLKA 3TROA 2FB3A 3FFSA 2RDWA 2E6YA 2OX1A 5AHFA 3DGRA 3O6DA 3PBWA 3SJ3A 1D9EA 1FDZA 5T26A 2YX0A 1RQEA 3NM3A 2FPVA 1FX6A 2FQIA 1H1ZA 1OK6A 1SW7A 1EP2A 1GTHA 4GUHA 3LLDA 3TR2A 3W9ZA 1LM1A 3FOKA 4JS3A 1O95A 2ZFAA 1WX0A 4NXSA 4R33A 4RXFA 1UUOA 5CGQA 4UFKA 1LRQA 1NF7A 1TYGA 3PC0A 1B9BA 2OT1A 3NQEA 3HG4A 2QCDB 4Q4KA 1LDCA 3PG8A 1THFD 4FEZA 4KFNA 3UWWA 2ZQ0A 1EP3A 1SZGA 3GXNA 4GFSA 5DY3A 1HFBA 1WOAA 2B7OA 2Z6JA 3QEZA 3TA6A 4WQ6A 4AHOA 1J5TA 3F4NA 4DO6A 3DXIA 3DAQA 2QCMA 1QO2A 4IMFA 3W7IA 2Y62A 3O8AA 4CNNA 3TFCA 3SFKA 5C5YA 1AW1A 4X22A 2CLFA 3W2JA 1GG0A 1UBSA 1GVSA 1ONRA 3SY5A 4WD0A 4NNAA 1OYCA 2OT0A 5AB3A 1TPUA 1KBIA 3SI9A 2LLEA 1YXCA 2WQPA 3UY7A 3W2LA 4JYEA 4TMCA 1AK5A 3C2VA 3QW3A 4N6FA 3UXDA 5LNRA 5LZLA 5HMSA 1JCNA 1VLIA 3UWYA 4A2SA 3S5YA 4PC8A 5IM51 2WSRA 1VCGA 1W1ZA 1M6JA 2E5BA 3P82A 3TX9A 5KMYA 3VFLA 3T55A 5C6MA 3DKJA 3G1AA 1XDMA 4NNCA 2V82A 3HPZA 4LS1A 4MZYA 1T96A 1Q45A 4M6VA 3WJZA 3TDFA 4X3ZA 3MP4A 4CCEA 3BG3A 1PV8A 5G1TA 3DFQA 3NA8A 3N73A 3EKLA 1GOXA 2ISVA 3VKJA 1GYNA 3NL2A 5BOOA 2QJIA 2PC4A 2Y7DA 2QF7A 3GXPA 2E6FA 3IIZA 5G2WA 4C1KA 2WSYA 3B0PA 2NX1A 3WK3A 4TIMA 3S5OA 4M7TA 3W7NA 3LBMA 1SO3A 3W7HA 1QFEA 4R34A 1EUAA 3MHFA 1TRIA 4KFPA 3G1YA 1TIMA 3PS7A 4WXYA 4NJGA 3JRKA 3ANYA 5CSRA 4MUZA 4Z1AA 5EPDA 4TO8A 4ZQMA 3E96A 1PE1A 3P80A 3N9RA 1ALDA 1FDJA 3NNTA 3UPWA 3TU9A 1RQHA 3ABRA 3UXAA 4UUIA 2VFFA 1GTEA 4O54A 3O05A 4K6AA 1PCKA 3QF0A 1KBJA 5DXYA 3OA3A 3G0XA 2BTMA 4Y96A 3E0IA 1MO0A 1TREA 3NZRA 3KAOA 4BFAA 1W54A 1IF2A 4U4MA 1R2RA 1DJQA 1W37A 1TJPA 3H55A 1S5WA 5I3IA 1T99A 1LZOA 2GPTA 1N8FA 5AC6A 4UR7A 4RV8A 2H8ZA 1OFRA 4I9AA 4BR1A 1UASA 4C1LA 2E5CA 1IIGA 1YADA 5HULA 3C8FA 2A0NA 1K03A 1QPOA 1RD5A 2DZWA 2C14A 4I7UA 1QAPA 1YDOA 5DBTA 3R89A 4E38A 5FEZA 4IMEA 4XUGA 3C2OA 3KVLA 1TPC1 1WYIA 2BSLA 2HS8A 3KHJA 4XZ9A 3TJLA 1HUVA 3B04A 5FF7A 3P74A 4AF0B 4I7VA 3MMTA
chains in the Genus database with same CATH superfamily
1EO5A 1H7PA 2QJMA 1EX1A 2XVGA 2YXXA 1HJSA 5L6UA 4AYGA 3CQ0A 3HJZA 3QY8A 4JBRA 2WSKA 4GI6A 4YLWA 1BTMA 1KFBA 2C18A 3BW3A 3GYCA 1AQMA 2WHLA 3H23A 1DHKA 3ERPA 1V77A 4FMVA 3T81A 3PSWA 1EJTC 4CUCA 3W1MA 3HGSA 1ZJBA 3LCWA 2QCCA 1UH4A 3TOYA 3H7UA 4L6OA 1ECQA 1PL9A 1P6BA 1W5MA 2VVNA 3AMGA 3P3BA 4NYUA 5L9FA 3ZT7A 4MYXA 2WMFA 4W7UA 1B3XA 4D6CA 1R2TA 2PTYA 1YE4A 1ADSA 4UFIA 2X09A 1E1CB 2CHOA 5KZ6A 2DZBA 3USBA 3DFPA 3RCMA 3KP1A 2REQA 3BWWA 2XGIA 2PWDA 1O1HA 2BBFA 1Y8BA 4LY8A 4ASTA 1B4EA 3NL3A 3N34A 4WX2A 4US6A 3WF0A 4DF2A 5CC6A 4G5DA 2QZRA 5T91A 2GOUA 4XO6A 1VJZA 4GYFA 4LAOA 3OJGA 1K8CA 3D3FA 1W9XA 1Q5MA 2ZC8A 3RPDA 1M7JA 4FNSA 2D0HA 4FF5A 2QPSA 3N4AA 2JE8A 4IJBA 1PKMA 4R7OA 3MYPA 2HISA 3WF4A 2GVGA 2TSYA 2VZOA 1DIOA 1VYPX 3GBDA 1HKIA 4K68A 4ZB5A 2FJUB 2W67A 2PDGA 3BL3A 1QI5A 3BAJA 1DJGA 3LHYA 3W0KA 4DJDD 3N4FA 4YL2A 1JGIA 3G1DA 1NH6A 2C1HA 4WXZA 4AD1A 1MEWA 4YVXA 1OINA 1Q2RA 4DWSB 3H2OA 5AYYA 4CU6A 6REQA 1JDFA 1JQXA 3CZKA 2XISA 4DNHA 5LNVA 4MZ1A 4F66A 4KFOA 4PRTA 1OCQA 3TR9A 1S46A 3PVFA 3OLEA 4AZCA 1JAKA 1UKSA 4C6BA 3BLKA 3APTA 3LTPA 1G7VA 4DUVA 3KHDA 1JULA 3AUOA 2CETA 2P5NA 2YB4A 2F2HA 5C2GA 4Q8VA 3EEGA 2ZVRA 3IK4A 2A3EA 2D23A 3NQMA 1CB2A 3CUFA 1TVLA 1ZU8A 5JH2A 3P14A 4D8AA 1TWZA 3IV3A 2NUWA 5TNVA 2XIQA 3GBEA 3KFTA 1DWJM 4LT9A 2XZ7A 1DIEA 4UQDA 1LWHA 3MP5A 1FBAA 5M3WA 2NSXA 3RLHA 2ZX6A 3WUGA 4F79A 1J0YA 1XIMA 1KXHA 1NARA 5ENLA 3QQ1A 5DMYA 5LGXA 2INFA 3T44A 3SSZA 3TV8A 2MUCA 3QZ6A 3NSXA 4AIEA 4GI9A 1TTIA 1RR2A 3G24A 3QH2A 4XAGA 4Q4RA 4DZ5A 3WNMA 4MIMA 1Y5VA 1VLWA 3ARTA 4IP4A 2ZRUA 4B5VA 4FAMA 4HVXA 1MW2A 4I5UA 1ZJAA 4O1AA 5M5DA 1EGVA 3GDBA 3WLMA 2GJPA 2VX5A 3MBFA 3RXZA 1UMLA 3A6OA 5AHMA 2WVUA 2QUVA 3SIMA 3C86A 5F2GA 8RUCA 1M41A 2OGJA 1V7YA 1VJIA 4Q8TA 1YRRA 4IXXA 4PMQA 4GH3A 2R6OA 3CLWA 3HZ3A 1FVPA 4CCCA 2WJZA 3OQEA 1UD5A 1RPXA 4I9MA 4AZHA 1PAMA 1H50A 3QGKC 3B8VA 2AL1A 5H6HA 3OVGA 3LV6A 1EDGA 4LTSA 3EZ4A 4XD5A 4YHEA 3WKZA 1XIIA 3VIHA 3E0LA 2FH6A 4J27A 2IPWA 4QQUA 3O3RA 3EX3A 2X0SA 1PKNA 3M0IA 4MWAA 4PTXA 5D37A 2WNQA 2DSKA 1K8ZA 1YPFA 3N29A 3FN9A 5DMNA 4S3FA 3WF3A 4URIA 5U7SA 4A3HA 3U6WA 3B03A 4NXKA 5CZSA 2B7PA 5AC8A 2PD9A 5CG0A 2IUZA 3WG6A 2IW0A 1Q3NA 4NYYA 3P67A 1XSJA 1LTDA 1ME9A 4LC6A 2C3ZA 2PGWA 3WBWA 1A4MA 4O28A 3I6EA 1B3WA 3EOSA 4L65A 2R1LA 3N13A 3VKKA 2PUZA 1GZ1A 4OUIA 3UR5A 1M03A 4GIAA 2WBKA 3GNPA 5M03A 3PF3A 3H24A 1I2RA 1UA3A 4C6DA 1ZAIA 4WSKA 4H8UA 1VPXA 1QUMA 4D6GA 3L2LA 1HW6A 1R38A 3N14A 5LXXA 5AVHA 1H2JA 1W1TA 2W5FA 2GUYA 3W22A 2ZXBA 4IJCA 1W3TA 4JYFA 1FKXA 2Z4GA 3FEQA 3QQWA 3WQWA 4ERAA 3MKKA 3L23A 1M7OA 1RXOB 1DJWA 1EZ2A 1CWYA 1U5JA 1S5VA 3LPPA 2Z29A 1G69A 2VC7A 4NZ1A 1FWNA 4M56A 1JNEA 3BAYA 2PPGA 1E6PA 1JGMA 4CN6A 1KW1A 2OZ3A 3CASA 3VIOA 4ZCWA 3OHIA 1E6ZA 3GG0A 5A6SA 1XLKA 5HWNA 1E4IA 3CHVA 2ZDRA 4PUJA 4D6HA 3DFSA 3QSRA 3PBGA 5DX7A 1VRDA 2FVMA 4GWEA 1LCOA 2C0HA 3K1DA 4JFUA 2XH2A 4V1YA 3CQJA 3WH5A 2VENA 3HJEA 3C2FA 1R3QA 4DIAA 5G4HC 4WY0F 1SYTA 4LUJA 3N2MA 5EKYA 2ZZ6A 7PTDA 4EIVA 1I1WA 3DH7A 3AWNA 1E0VA 4F2UA 1C3FA 3GFYA 3VX0A 1OD8A 1PVNA 4G1KA 5HJLA 4IZGA 3GG1A 1NF0A 3BLDA 1B4KA 3TH6A 1J6PA 4ROQA 1Q6RA 2OTDA 1BXNA 4H6KA 1Q7ZA 5LYRA 4BA0A 1HZYA 2I7GA 1DYSA 4LX4A 2F6XA 1K9FA 2DT0A 4CEUC 2I16A 4XTIA 4DHGA 1S2UA 3REQA 1FWSA 3SQLA 1F61A 3LHTA 4JTKA 1P7TB 2WSPA 1UR0A 2Z25A 3F5JA 4IMCA 3H6OA 4GMEA 3UPBA 2OSYA 3D47A 3QRHA 5CGTA 4DO5A 4MKNA 2R1MA 3IEBA 4OT7A 3TSDA 3UWUA 4XD6A 4ATWA 1JRCA 1I0BA 1V7AA 3E74A 1JYVA 3UVAA 3P62A 3CIWA 3PBUA 2ZXAA 1VC4A 1TPH1 4EXBA 1XPGA 4K3ZA 1RP8A 1UR4A 1QOPA 1RA5A 3K2GA 4W89A 1HX0A 1EEXA 2HPIA 4IX0A 1CENA 5CSSA 1JZ4A 2J13A 4AHPA 4PMJA 4R7JA 3SUWA 2O7QA 3KVKA 4XBKA 3UZZA 2C91A 4RE3A 1SFJA 4FXSA 2Q8LA 4LS2A 3QPYA 2VEPA 5EMJA 2VFIA 4N7QA 3W76A 4H00A 5HANA 3GAYA 4N0RA 4MWAE 5K3VA 2O7SA 3V18A 1GT8A 1ITCA 1QNPA 3EOEA 5BRQA 2Z1VA 4G56A 1PHQA 3FXYA 2BWGA 5B80A 3IGHX 2CXGA 4C6IA 1KFLA 4AY7A 1JDAA 3WLPA 3C4UA 3EPMA 5D2TA 2KZHA 1WDRA 3R4IA 4PH6A 3VTRA 4XZLX 4XIAA 2H9AA 2WVVA 1FCQA 4QJ3B 3LM7A 1SUXA 1E9IA 2PA6A 5I3KA 1QT1A 2ON3A 1Q66A 3WJYA 1SMAA 2E77A 4B5NA 5CJNA 3QV8A 3W7RA 1UR2A 3WSUA 3CHDA 2AQOA 2YCEA 3L0GA 4OVXA 5BXPA 1SQ7A 2G4FA 1E4NA 3P0WA 2FVLA 1U83A 3VC6A 2R1NA 1ZZMA 1VQTA 1PKYA 2POZA 3BGGA 4O1FA 1Q6GA 4F0SA 4LCSA 3T2QA 3B0VC 5E9XA 1HP5A 2WHKA 3CHEA 4E4FA 2WCAA 1B9ZA 1W3KA 4N9EA 1CYGA 2VX4A 3KOFA 1TQJA 3LBCA 4UTUA 2VR5A 4Q4SA 1O68A 1KM3A 4QP0A 4BWLA 4DJFA 2V3FA 4UTTC 1ITQA 3QW4B 1QHZA 3AZRA 2NWSA 1YMYA 3L12A 4RDWA 1OFAA 3F4CA 8CGTA 1ZAHA 3CUHA 3DOPA 4GQ0A 2VEFA 2C1GA 4MNKA 4PCTA 3VOFA 3TTOA 2YBTA 3WFLA 2A3BA 4Z1CA 5HPOA 3B40A 3HF3A 3TTYA 4GUGA 1NP2A 1KTCA 4HJWA 4W7VA 2INZA 4N42A 4ZB2A 1AZ2A 1VFFA 3M5ZA 3K30A 4C6JA 3IUDA 4Q4PA 3SR7A 3S9IA 1GWJA 4DPPA 4IMDA 2YIHA 3ITOA 3QM3A 1AMYA 1GVYA 2E40A 4AF0A 4M0XA 3NIYA 2YBUA 2FIQA 4MF4A 3V7PA 4DAFA 5I07A 4JIHA 3CB3A 3T0TA 2OEMA 3RR1A 4Q8QA 1K6AA 5A6BD 5CBJA 2MNRA 2CHNA 2V68A 3DN5A 4EACA 3LI0A 4KEUA 1UKQA 2JBMA 3OO2A 4OOZA 3G1HA 3HG3A 1H3GA 2VMFA 1FWGC 4MLRA 4AD2A 1S5NA 2YGYA 3SRFA 1JYXA 1BKHA 2E68A 3VGDA 1KTNA 5IBXA 3L4TA 4KRUA 4JTAA 4UTWA 1OY0A 1IHIA 2XSXA 2PS2A 3S46A 3HV8A 4PGLA 4GQBA 3KOZA 5ECUA 4QG9A 4XWUA 4H8HA 3M9YA 3E3HA 3GVGA 3UXLA 4WOQA 5BZAA 3DFTA 5DXXA 3R13A 5GQBA 4IOTA 2WNZA 1CTNA 2E7FA 3TMQA 1YDVA 3WH7A 1JPDX 2PBGA 4AXNA 1Z3NA 2WLYA 3WMBA 1B30A 3LCIA 3RM9A 5C55A 1Z89A 4WJEA 4LSBA 4MFDA 4M82A 4A3QA 2Q8ZA 2VKZG 2V2HA 3CWNA 1WKDA 3LHVA 4OE7A 2Q09A 1POJA 2H6RA 4OV4A 1AH4A 1GCYA 3CPUA 2G0WA 3QZEA 4GFIA 1DEDA 3R8HA 3FIGA 4GNKB 1TPDA 4K39A 3GTIA 3SCQA 1BGGA 5XIAA 3KOYA 4CCZA 3M7WA 2GGHA 2FZNA 2XH0A 1NFPA 3QGVA 4C5ZA 3AQUA 3BZGA 3L7RA 3C5QA 2AQVA 3ARZA 2DJLA 2CXEA 3FAWA 2G3MA 3TNBA 4CVWA 4H4IA 3U2OA 5EFFA 3VIGA 1QMLA 3E6EA 3DHDA 1FWEC 3W85A 2Q3RA 4H3DA 4U2YA 2B0MA 2OCZA 4GZEA 2CZVA 1OHLA 4D1JA 2OSXA 4ZTXA 3WH9A 2DZVA 1UR9A 3PAOA 4PMUA 5A8PA 4B3KA 2IPGA 2G3FA 3M0ZA 4ILSA 1TVNA 4H2CA 3IRDA 1Q4WA 3VKAA 1CI1A 4OECA 2Y61A 3QYQA 1H0IA 5FA5A 2EG6A 3VO0A 4F0MA 2CHRA 1EC7A 4IX2A 4K2SA 3QFWA 3ZJ8A 2DVUA 2VP8A 2YDQA 1ONEA 1BYAA 3LY0A 4A05A 2E9LA 1W5PA 1CDGA 3N3MA 3T6CA 2VQTA 2FHCA 3EX2A 3SURA 2X2YA 4U31A 1FWWA 3ABZA 3MA8A 1HP4A 2FGLA 4Y8FA 3CMJA 1DORA 3TK7A 1PYMA 3EDJA 3BSHA 1UHVA 1TMQA 2ABBA 2QR6A 1VCVA 3UQNA 3C3UA 2QUNA 1TB3A 2J27A 3WMSA 2BOEX 3F4DA 1V3JA 2ZUSA 3ARVA 3FYYA 3N04A 1OX4A 2QJJA 4GD0A 1J0KA 5DRIA 4DLFA 3VD3A 3RG6A 5MKGA 1Z9AA 5AYXA 5C9XA 1VENA 5BYWA 5C70A 2JIWA 1TMHA 2HBVA 3R12A 4A6GA 3CL6A 4IG2A 4XD3A 1ODUA 4BY3A 1GQJA 1XIEA 4BF7A 2QV4A 1M1BA 2HNEA 5IDIA 3IJDA 3QMRA 2OO0A 3N19B 4QBXA 4Z1DA 4CQ8A 3B8SA 1SJCA 1U5HA 4MJMA 2CLEA 4FPSA 3THCA 1WUEA 1US3A 4B15A 4X63A 4OBTA 5GNYA 1MEHA 4Y7EA 4X0VA 4IXHA 3VK5A 3EAUA 2I17A 2BY0A 2P53A 3UWVA 1GKRA 4U3CA 4DZIA 5FACA 3S2NA 3LXBA 1E51A 3OTRA 2BLEA 2ATMA 1S1PA 3AWOA 2HV5A 3IGXA 3PY2A 4PTDA 3BLPX 4LRTA 4H9XA 3PJXA 1XYCA 4JQ1A 1BYBA 3E9AA 4WIWA 1QPRA 1L2UA 1LL7A 3FHQA 1TZZA 5F1UA 2VZTA 4PZVA 1XRTA 4NY2A 4HMDA 2P3EA 4BK9A 1OJXA 2GK1B 1PIGA 1LORA 1XGEA 3S83A 1FWAC 3AIRA 3NPVA 1W32A 5JH1A 4O1BA 2D73A 4ZODA 3T2PA 1J0IA 3P8JA 4HN4A 1O5QA 4JY9A 4HU8A 2ZTJA 5D02A 1E15A 1FOBA 4NX5A 1EKOA 1Z48A 2DY3A 4RDYA 4NJKA 4B4FA 4JOMA 3W1RA 3S1VA 1ITUA 3F03K 2GVEA 3AXKA 1VRXA 1VD6A 5I0DA 4HGXA 2W27A 2YDSA 1IGSA 3A5VA 3CC1A 4XKMA 4W86A 3KZPA 4A22A 1BRLB 4ECLA 5CXPA 3OG3A 5IHSA 4ZE5A 1E0WA 5I24A 2WC4A 3VNZA 2BHZA 3PPHA 3ZM8A 1IXOA 4MFEA 2OB3A 4GNVA 3RJYA 5HDRA 3DHUA 1Q8AA 2G97A 2YW4A 5E09A 5FCZA 4LAUA 1JFHA 1P43A 1BVZA 1GYMA 3PFRA 1JUEA 4O1CA 1TIWA 3AS2A 4O8AA 4GC3A 4UMAA 2DSZA 4CLMA 1GOQA 3C0JA 3GXMA 1JUKA 1GPWA 1Y0EA 3EWUA 4GQGA 5XIMA 1SSGA 4NI8A 1KO0A 5DMLA 4RPQA 3NFUA 4ADTA 2W91A 4I9TA 1TX0A 2P3ZA 1EJWC 2OYMA 1H11A 1ZCOA 3CZ8A 1B54A 1XC4A 2ATSA 3R5EA 4UC5A 1R8LA 3NEVA 3O6YX 3PBYA 5LA2A 4ZOBA 3GZ3A 4AVOA 5DANA 1A80A 3RM4A 4H1ZA 2PDJA 5CSUA 1BAGA 3MUCA 4GNJA 1KM4A 1TELA 2AAAA 4I8DA 5T9CE 4NG3A 1V02A 2R94A 3MPGA 2FYMA 3GIYA 1ZBCA 3FDGA 4GCAA 4H2HA 1WBJA 1HJUA 2V38A 1P0DA 1JF5A 4H9VA 1KB3A 3NQ2A 1PTGA 4ALDA 3NOYA 1H7NA 2F9RA 2RDTA 3N9SA 4ZENA 3WLTA 2B81A 1XIFA 2Z24A 3CHCA 1WAWA 3ALGA 3NDOA 3CYVA 3W24A 3LD5A 3NPWA 4LVDA 3TSBA 3T2OA 5D30A 4MB5A 1KM5A 2ZZ1A 2J8TA 2BGQA 4JKMA 3WUBA 2C6QA 2W66A 2E5DA 3GNNA 4O53A 1Z7AA 3ZFHA 3UCQA 1SJBA 3E0VA 4UQEA 3TEVA 3TFXA 3VCRA 2E09A 3N2TA 3OP2A 4NP7A 5GVJA 1HG3A 4WJ8A 3S42A 5G4WA 1ADDA 4LNCA 1TV4A 1XYZA 3S0CA 1UD8A 4AIUA 3RAOA 2PC8A 2OQLA 2QCLA 2BHYA 3C0LA 5PTDA 1PZ1A 1TUXA 3EKGA 5FJJA 4CCDA 1TPFA 5CC5A 2WCSA 4BQ3A 4LOCA 4WKHA 5DEZA 4U3AA 1FWTA 5D2WA 2NQ9A 4JXCA 1XINA 3L5LA 1C7TA 3W7GA 1HJVA 3MZNA 2Z28A 3GHRA 5A5WA 2V3DA 3VIIA 3A24A 3H2MA 3F5KA 3U8GA 3LLFA 4K1WA 4O19A 1TV3A 1PBGA 2BY1A 3BV7A 4GBDA 5CPLA 1DTUA 4XZIA 1E0UA 3WJWA 4K8HA 3VOCA 3C2RA 1EH9A 4WUIA 1C8QA 4E6MA 3QY6A 1XG3A 4J2MA 3WQFA 2HVNA 1M3UA 4IL0A 6A3HA 5LHFA 4CD6A 4F2BA 2PDWA 3ZR6A 2IKHA 5ECVA 2ABAA 1VB9A 1XIHA 4GKTA 1PX4A 4D6FA 1UD4A 5A6AA 1KR1A 1V3LA 4UTHA 5CLWA 2WK2A 4U10A 3W7PA 4QSFA 3KWXA 3RCYA 3A22A 3WF2A 2ZYFA 1E0XA 3L4YA 2DZSA 2QLYA 3BAXA 2YW3A 3FJ6A 5LIXX 3N4EA 2L5HA 2ACRA 4CGTA 1RV8A 4AD5A 5DFAA 3SRDA 2WNWA 1HVQA 2JQXA 1LJYA 3PJUA 4OV9A 1RCQA 1GQLA 2QPXA 2ALDA 3TJIA 3FS2A 4HMCA 2NV1A 4IIEA 3THUA 1UR3M 3A3WA 4GIYA 1KV5A 2IQ0A 3OW1A 3QV6A 4KRZA 4K37A 2GVJA 4B91A 1O5XA 2A21A 4HNNA 3HGRA 2POTA 3GM8A 4ZOAA 2R91A 1TR9A 3AC0A 2OEKA 1LQ2A 1A49A 3GHTA 4S3JA 5DCDA 3BANA 4WDXA 2Y5JA 1V6UA 1BQCA 1W56A 7ENLA 1QR7A 3B0YA 1DWFM 3FA4A 1IEWA 4NF7A 3D3AA 4KWVA 2Y7FA 1P0BA 2CLKA 2J79A 4HK5A 3SAZA 1XLAA 4PB4A 3SY8A 4XAZA 3FFSA 2OX1A 5AHFA 4PFHA 1R3VA 2VD9A 1QNQA 2WZTA 2DIEA 3SJ3A 3RX4A 2WAGA 1FX6A 2PGFA 1EP2A 3A4WA 4GUHA 2Z2BA 3TR2A 3CUIA 1LM1A 1DP0A 3VNLA 2BODX 2WWCA 3W38A 1PJ9A 3BOLA 2EKGA 2OT1A 2VC9A 3HG4A 3PG8A 3L4ZA 3GXNA 4GFSA 4OKDA 5DY3A 2Z6JA 2DVXA 2B7OA 3QEZA 4GYPC 3AIQA 2YJQA 2OODA 3F4NA 1A0CA 3DXIA 4QFUA 3UG8A 1E1CA 2WHJA 3DAQA 4IMFA 1QOXA 2VO5A 1X39A 3VOJA 4PYSA 3SFKA 3MUZ1 5C5YA 3OYXA 1AW1A 3VMPA 4XZNX 4G7EB 1SGJA 2CLFA 3HFTA 4Q7IA 2PSNA 3LUTA 3NVDA 5JQ9A 1UR1A 4ZOEA 1KBIA 3U48A 3ITLA 4H8NA 4JYEA 5AECA 4N6FA 3JVAA 5LNRA 4LQ1A 1JCNA 2MANA 3QBUA 2FKPA 3CV2A 4DUWA 4AZ6A 2XIJA 5FIPA 3TW9A 1XDMA 2XSBA 2V82A 3ARXA 1Z32X 3HPFA 3W02A 4DBSA 4NSBA 2Z1XA 3WJZA 4AIOA 1IWPA 1UKPA 4CCEA 2D69A 4D1IA 3UNTA 3DFQA 1NWTA 1I6NA 3WUFA 4E2VA 3NL2A 5AKQA 2ZKMX 1XD1A 4ZO7A 3GXPA 2VL4A 3TN3A 3IIZA 3KW3A 2WSYA 4W4QA 2W62A 2XYLA 3MV11 3AYSA 2VWSA 1QFEA 3CS2A 3EOOA 1EUAA 1TRIA 3HMCA 1BSLA 4IM4A 3G1YA 1TIMA 4J7RA 3OLIA 3UG5A 4MUZA 2G50A 3SFWA 3ZIZA 2WHMA 5I6SA 5I79A 1PE1A 3F7JA 3TYDA 2BP1A 4YTUA 3U57A 1RQHA 4UUIA 2RDXA 4AX6A 4IFRA 4K6AA 1S3TC 4RW5A 4H9TA 1SVDA 4NRRA 1TREA 4ERGA 2VR4A 4BFAA 1W54A 5BXTA 3SCOA 2XGBA 2BVWA 2SFPA 4U5IA 1W37A 2PLCA 1TJPA 2BMBA 4NZ3A 2F38A 3T0CA 1LQ0A 3GY1A 2YLAA 3ZMRA 5I3IA 1LZOA 3BSMA 3V0TA 3BICA 4RV8A 1UIPA 2BGNE 5C0QA 1OFRA 4I9AA 3K46A 2DH3A 1BFNA 4AZ5A 4C1LA 2E5CA 2PODA 5HULA 3C8FA 4FOUA 1RD5A 3PZ9A 1ZL1A 4P7QA 4M24A 3HV9A 1AZ1A 4X61A 3FVMA 3WH6A 5ABFB 3R89A 3MB9A 3AHTA 3NCOA 3L4UA 4XUGA 2ZC1A 3MUY1 4GH1A 1TPC1 1WYIA 2BSLA 1HUVA 3P74A 1E3XA 3KM8A 3VINA 1FH9A 1R46A 4B2DA 4NASA 2HXUA 4HMEA 3W82A 3II1A 2CLLA 4AZIA 1QASA 1JPHA 2XJ7A 3WMCA 1A5AA 3CWOX 2J9XA 3MW7A 3E5BA 4MAZA 2WC7A 1TV8A 1LBLA 1A5SA 2E67A 2PCEA 3UR2A 4PR4A 2OPJA 3G1FA 3FSUA 3DIPA 3D0CA 3TVAA 1XDLA 3MWAA 3COTA 3HM7A 2GQ9A 3POHA 3BDKA 3R79A 1Y5WA 2VGFA 1XG4A 2GQAA 3GB6A 2PP0A 4DRSA 5CEWA 3IK2A 5FL1A 1W8GA 3TZNA 3BG9A 2D2HA 4DJFD 4ADUA 2VC6A 3SO7A 3B8WA 3IACA 4YIWA 3SY1A 2DQXA 3DHFA 3SUVA 1KM2A 1IWAA 2RJGA 3NQBA 1NDYA 1OZQA 5CAHA 3KBJA 2GVLA 3IPWA 4KKXA 2Y8VA 1LBFA 2GZXA 5FD0A 3WL1A 4HCLA 2R9RA 3BMXA 1PIIA 4KH2A 3I6RA 1WXJA 4LS0A 3M43A 4JFSA 3T09A 4JPGA 3V0SA 4RPPA 1TPEA 4AD4A 5CLTA 1AQ0A 3TXVA 3MO7A 5D4YA 1GVQA 3GFZA 2QCNA 1P5BA 5K7JA 3VABA 2WLZA 1M53A 2GJNA 4TOQA 4XO7A 5A8MA 4WRHA 3NQAA 4MADA 3EWWA 4U5KA 5BWFA 3TWBA 4J3WA 4AIBA 3TTSA 1E1FA 4QJ5B 4POCA 1VBJA 2VHLA 4HSHA 4L4MA 1V8EA 2F7FA 3UZ5A 2PRMA 4W5ZA 5CC3A 1F6YA 3IJ8A 2WZHA 3HPAA 5E0CA 1T40A 3W27A 5E1QA 1QW8A 4HNOA 4Q4QA 3AO0A 1DQUA 2Y63A 4DB7A 2QMJA 3FKKA 3LQGA 4WJXA 4L6HA 4O12A 4H01A 3P61A 1TKKA 2O55A 1BQGA 2B7QA 3DEQA 3B0UX 1A47A 3I4EA 1JDDA 3F2BA 1U1HA 4G9PA 1OCJA 5DMMA 4MAVA 1ZB5A 1ISVA 3KE0A 4AD3A 1E0TA 2YLLA 4MHBA 3AMKA 5GJNA 4AWTA 3G3MA 2YL5A 5DT7A 4DAIA 5LA0A 1HO4A 5JBFA 3OPSA 1VYSX 3M44A 1JVNA 2GQ8A 5CPOA 1CW2A 1BWVA 1WZMA 2HXTA 4DBUA 3EDFA 5MF5A 3B8UA 5FF3A 4KWSA 3SN1A 3ANVA 4MJZA 1F5ZA 3Q67A 3KS6A 1K77A 4O16A 3VD5A 1KQZA 3B4UA 3QTPA 4LWWA 5CZTA 1W9UA 3BCDA 1EJUC 4XVDA 2XWEA 4JHMA 3HQ1A 3TTQA 3WQCA 4XD4A 4XKYA 2Q6ZA 2VGBA 3W70A 5CBBA 2Y1HA 5IBXC 1VHNA 1MYRA 2YCLA 5I03A 3ITTA 4HPJA 4F9DA 3BAWA 3GS6A 1GGOA 2FZBA 4C7GA 3O7UA 4TUFA 3FX4A 5LKYA 4RE2A 1MVYA 5T9BG 4QX4A 3QV9A 3EOUA 3WO8A 2HVOA 4OOUA 2DORA 1Q6EA 4JL2A 3KCLA 4UTJA 1OFQA 2YL8A 3QZAA 2XTKA 3G22A 5EMLA 1XLLA 1ZRQA 2YOCA 5KSWA 3WCZA 1NDVA 3CMGA 2BXYA 4FA3A 1YIXA 2DFAA 3N17A 2YSWA 1QU4A 1Z44A 1JZ2A 4GUJA 5FJOA 2QMKA 3B05A 4B9ZA 5D09A 1ADOA 3PUOA 5FEXA 1BG4A 4S3AA 1KGWA 1OCNA 4HA4A 1K3UA 1MWOA 2Y6ZA 3CQHA 1PHWA 3NUKA 2JEPA 5HBFA 3WQEA 1ZUAX 1XXXA 2J8FA 3TC6A 2ZZ4A 2GVYA 1BVNP 1T8QA 3LV5A 5AVNA 4LUSB 4M1BA 7REQA 3N2BA 1FHUA 1QW7A 1WQ5A 3V5FA 4CEXC 3CAKA 1RPKA 1I8JA 1P0NA 3QOMA 3RJXA 4JD4A 2RKXA 4HZ6A 1VEOA 4DZAA 1DVJA 3LPGA 1JI1A 3O6CA 5ABHA 3U2CA 1KBKA 1E55A 3UU0A 4KQNA 3MC5A 1OX4B 3L4XA 1TSIA 2A5HA 4E0CA 2Y89A 2QGHA 1X96A 3RF9A 1SO5A 5HQEA 1REQA 3GC2A 4YTTA 3NXLA 4HHMA 2VGGA 4OHQA 3AHZA 2PDCA 5EA9A 2ZOXA 1H7WA 2VUYA 2Q02A 3G77A 1IXPA 1W2VA 3VNKA 6ENLA 3HBLA 3UPMA 2YA1A 4HSNA 2F8QA 3NL5A 3R8RA 1F8IA 4BS0A 3OZPA 1DE5A 5F4WA 3CAVA 4I7WA 3IIVA 2ZZ3A 4WCJA 4GUIA 1KV8A 4UTWC 3LCGA 1GNXA 2DZPA 4GZIA 4CN1A 3HG5A 1PZ3A 2PLMA 1JD9A 1EF3A 3HQPA 2GLKA 2OVLA 3BJTA 4E2DA 1RBLA 5C54A 4PMYA 1BF6A 4FSAA 2J7HA 1EJXC 5K2ZA 1HQTA 4NRSA 1H7XA 2FDSA 4C60A 4CQAA 4YTQA 3CV7A 4U28A 2RGLA 3WQOA 1ICSA 2V2CA 4IFKA 5JU6A 3QXBA 3AMLA 3EXRA 1JUBA 4OBSA 3V0UA 4R5EA 2X1IA 4EF9A 1H63A 4TU1A 3NURA 4IQLA 3TQ0A 3R43A 3QPZA 1VCFA 4AAJA 1V3HA 1JCTA 3RO8A 4D71A 1A53A 3EEZA 3MP3A 2OMAA 4RE4A 1T6MA 2PGRA 1XBVA 2NX9A 3NQDA 4CVUA 4AEEA 4HP5A 4BCEA 1VPQA 3O0KA 1YHTA 4QROA 2RDUA 2ZRXA 1TO3A 1H0GA 1FP8A 1JF6A 3MHUA 1PO9A 1Q6LA 4QDMA 4V1XA 5HNNA 2QDDA 5IFTA 5FEWA 1YTDA 4CKQA 4AMCA 1ZSXA 4GJIA 3S1UA 3KVMA 2DQWA 1OADA 2O56A 5RUBA 1F3WA 1FY6A 4DPQA 4BF9A 3PB0A 3GU9A 3KRSA 1YTKA 2Z7GA 1E43A 4K36A 1P0KA 4XZMX 3NQVA 1UUQA 4PCFA 1BKSA 1CXLA 3V1PA 1EYEA 4EX4A 3M5VA 1XF0A 4RV3A 1R9YA 2JIEA 4LAZA 1C8XA 4MG4A 3BJSA 2DT2A 3N2OA 3W6YA 3IRSA 2YXGA 2XVKA 1G4TA 4EF8A 3VD4A 3H2CA 4NJJA 1FWBC 3LI1A 1JNDA 4A3YA 1FCBA 1TV7A 8XIAA 4J40A 4LCQA 1ICPA 2JF6A 2QUMA 1FRBA 4GO8A 2I14A 6XIAA 2PDNA 1H49A 1K9EA 1V3MA 3A13A 4X9SA 3T07A 2IKIA 4JNMA 4ZEPA 2PWGA 3GTNA 3H7VA 1GVRA 4LF2A 1PPIA 4IMAA 2Y24A 2V5JA 2YCIX 4YS1A 1YTEA 3KBMA 8TIMA 2BVTA 3FA3A 3VDAA 4OFCA 4JTEA 1UKTA 3GTXA 2OGYA 2HROA 5JXQA 1EHNA 5HAOA 1XH0A 4AC1X 1CT5A 3P6LA 2Z26A 1MXGA 3ATYA 4AUBA 2PWFA 3UR7A 2I1OA 1TRDA 2HK1A 3LPFA 1GJUA 1NVMA 4R53A 2DZTA 3R94A 3K8KA 1CZ1A 4XV0A 3GNDA 4AYSA 1J18A 1GEQA 1TPB1 3ELFA 3NDYA 3N9KA 2QIWA 2QNEA 1PX3A 3SUUA 1UWIA 4ZQRA 1ZENA 3QC3A 3H4XA 3ALFA 3TYEA 1CXHA 2G5WA 1P0EA 3RITA 3AYVA 1FP9A 3POCA 2E1DA 3O9NA 2VZUA 4AMAA 2A7PA 1VIWA 3MSYA 3WJSA 2WMKA 1FFQA 2B7NA 3EXSA 1C7SA 2E8ZA 2OKTA 4DVOA 3CQKA 5XINA 2Z7KA 1A3WA 3VGEA 1XBXA 2PRHA 4IPJA 1A5BA 4IH3A 4I90A 2BS9A 2J6XA 4MDPA 4QXIA 5AOUA 3DYPA 4PL1A 4FS9A 3VXGA 3GNRA 2R1PA 4NL1A 4D8LA 4UFJA 2NT0A 4YMZA 3ZO9A 4M1RA 4Q8PA 4KRTA 4PFMA 3TTEA 1W3HA 3RCNA 2ZRYA 1D7FA 2B31A 3IS4A 4IIFA 5M17A 3CIXA 2A4AA 4LU0A 5HPCA 1S39A 3UZXA 1EA0A 3ARUA 1NY1A 1V03A 2X8RA 3I7QA 1Q85A 3TKFA 4PN2A 3KRUA 1E4LA 1J4EA 2P8BA 4ZOCA 3HPXA 2DU2A 2WW5A 4S1FA 4P61A 5C2XA 5H8MA 1HJQA 4ZSTA 3URQA 3L21A 3P84A 1BHGA 4YVVA 1B3VA 1IXQA 2XVLA 3EWXA 4BQ5A 3PUEA 4DN1A 2FZDA 2GYIA 1UPMB 1UH2A 5EMUA 3BTNA 3NYZA 1Q65A 2IKJA 4LUIA 4BZYA 2VOMA 3QJAA 1SO4A 2F84A 1K7FA 5I09A 1KCLA 1G94A 7REQB 4XSMA 4PEKA 1EC9A 1F3TA 1KFCA 3PZUA 1BXCA 2Z2UA 1FA2A 3UG4A 5C9UA 3W7CA 3UJRA 1QNOA 3IARA 1MDLA 3W2MA 3AIBA 3GVRA 1GW1A 4B3LA 2GDUA 2CZDA 3VI2A 3M64A 3S2MA 3L0NA 1JCYA 3EWDA 2VUNA 3B9NA 3TE9A 5E6YA 3LHUA 2Z1BA 4HNUA 3IJQA 4D6EA 4ZSUA 4ENLA 4KIRA 1MXDA 3UERA 3DDMA 3SN4A 1WP6A 2FHFA 3NSNA 1A4LA 2GGIA 1O5RA 1W31A 4MNLA 3SADA 2OJPA 2PE4A 4I5RA 3Q58A 1CECA 4L9XA 4M7SA 3GZAA 1CGYA 1AODA 4QQ3A 4QR6A 1FTXA 5C7HA 4FIRA 1M7XA 4JIEA 1QHPA 3T0BA 1Z6KA 3G1RA 3SSJA 1FH7A 2UBPC 1X7FA 3U9IA 4YYCA 4N4PA 3WNKA 2HCVA 1QWGA 3RR4A 4LVBA 5HMDA 5BXRA 2PZ0A 3W1LA 1CIUA 3M16A 3VIKA 3VDHA 5A8NA 3EYPA 1HN1A 1G4SA 3WDHA 2J7DA 4LAMA 3A4XA 3BARA 1V5XA 4AWUA 3BCFA 5DT5A 2WKJA 3PWIA 3W88A 3EX6A 1SFLA 2O9OA 2A7RA 3LHZA 1K8YA 5CCZA 2X1UA 1DL3A 3SQSA 4PBEA 2FTWA 4IWWA 4ZXLA 2HWGA 5K4ZA 2ZA2A 1HGWA 4TR9A 1PDYA 1EWEA 3H26A 1RY0A 2ZX7A 4GXWA 2DDXA 2IPFA 4X2PA 1BF2A 1POKA 2IXVA 3UCCA 3UXKA 5K9XA 2BXZA 4FHAA 3M0YA 3VMNA 4B16A 2OLHA 3OIXA 1VBUA 2H9AB 2WVVB 2YFOA 1R3YA 1VJSA 4GXMA 4BQ2A 2WBGA 3GNOA 3TJ4A 4NVTA 3T0AA 4GI8A 2GGGA 3GDRA 5FF2A 1XIBA 3WQ6A 3WENA 4C6KA 2VDHA 4ERIA 3ORWA 1AL8A 2DSUA 1AVAA 5LHEA 4RZ6A 3WLKX 1R3SA 3IAPA 4AG0A 5GNZA 1ZS2A 1VEMA 1GG1A 4DO7A 2YR1A 4WZHA 3SCPA 3W6MA 4AZCB 4ROPA 2VJXA 1ZNNA 3STFA 1ML1A 4ZO6A 3DI1A 2QCGA 9XIAA 1V6YA 4W8BA 3LK6A 4XSLA 1XQKA 4DNMA 1B90A 3OVQA 4UQAA 3LOTA 2V5KA 2A6NA 3PN8A 4WSJA 3T1GA 4W5UA 2NVCA 1H60A 1Q6QA 4RW3A 4C6PA 3GKAA 1KM6A 3S4TA 2I9EA 1U22A 1OX6A 3QY7A 5HXMA 1GORA 3WBXA 2J7GA 1ITXA 1MW3A 1QXLA 1OEPA 1KXQA 3QMTA 3PULA 2Y70A 4A29A 1W1PA 2BB0A 1GOWA 4HA1A 3ZOAA 4P7LA 3TMLA 3VNJA 1JZ3A 3ITGA 4P8UA 4V2XA 3RNDA 2CWXA 4BHYA 1HL9A 3W28A 4HYWA 3REQB 5HUPA 4DY1A 4O13A 1D3CA 3S1GA 4UWMA 1GQIA 2Y2WA 5DELA 2HBXA 3ABSA 4PRRA 4GOAA 3VGFA 1XBZA 1I0DA 2C1IA 3EDEA 2J25A 1BWLA 3E2RA 1BYCA 4NKCA 3PZVA 3OLDA 3S2CA 1WDDA 5AHEA 1HL2A 3AUJA 2XIIA 2ZIDA 4FLOA 1U30A 4J5NA 1NU5A 1IQ8A 3VA8A 1B0IA 3XIMA 1R7AA 1IEVA 2BFGA 4IIDA 1UZ4A 4LUTA 1KKOA 2Y8KA 2JGQA 1GUVA 1VH7A 3FY1A 3G1SA 1MUCA 1R7OA 1TZ7A 1M01A 4UNLA 1Q6OA 3P60A 3AZTA 1PWMA 3T4WA 3MYOA 4N9CA 5I3FA 5CZJA 4RR4A 1E72M 5D8WA 4LY4A 1RJQA 4DXVA 3CIVA 3RMEA 3AXMA 2WKLA 4Z1BA 2PDIA 3MI6A 4MWAC 4KEZA 4HD5A 1QDSA 2FFCA 1MRQA 4PE8A 3AISA 4O0QA 4JN6A 4O0ZA 3W29A 1QCWA 3PM6A 1KLZA 1FUYA 3I7RA 5EL1A 3H2AA 4B3ZA 3NTYA 5E0KA 1H1NA 1ZCCA 4Y9MA 1VHCA 5C8BB 7TAAA 2XWDA 4QAIA 2PURA 4B92A 3RILA 4GC4A 2F6UA 5DLCA 1TJ1A 3TN4A 1AD4A 4RJEA 4DJFC 4O1EA 4LEQA 3K5XA 1VBHA 1DJYA 4GY7A 1J2BA 4BQ4A 2CKSA 3OGSA 1GJWA 3V5OA 4GVFA 2ODOA 3GK0A 1J79A 3A3HA 5KZMA 3TQKA 5TBOA 2XHYA 3HN3A 1W5QA 3QSTA 2IPJA 4PUMA 3BLLA 3FYPA 4O50A 5HUOA 1TCDA 3NQFA 3ONCA 3RUBL 4QIUA 2J66A 2NXHA 4DJDA 1XR2A 3VIFA 3UESA 3R0UA 3HB9A 2X05A 1HVXA 4M5PA 2X16A 2D20A 3FA5A 1OSEA 3OEXA 4PTWA 1SR9A 3LGGA 3OHMB 3LTYA 3N11A 3C2EA 2XSAA 3WFAA 4XAYA 3EX4A 1MSSA 1DOSA 3F4WA 2V69A 3WEOA 4JDYA 1UWUA 2YL6A 1EQPA 4WVXA 2G3JA 1NDWA 1IWBA 2UV8G 3ZQ9A 3SUSA 4EWJA 2PU1A 2F6KA 4YVPA 3EDKA 4GIRA 1TJRA 3FV9A 4AXKA 5GJMA 1XRSA 1DV7A 1FQ0A 1ZQ5A 5JIPA 5DF0A 2HE8A 3VDBA 2D2OA 1NFBA 4W84A 1GQNA 4Q33A 3BH4A 2RH9A 2Z6IA 1ZALA 1GZJA 1H51A 4Q6XA 1UP3A 4P7OA 2Y85A 3DBNA 4QRNA 3ARSA 1H4PA 3HGOA 2NSOA 1TQXA 4MGGA 1H1YA 4Z1YA 3A9BA 3CTTA 1J12A 3FVDA 1KR0A 1DWAM 1W91A 2PDYA 3B0XA 4S2BA 2CESA 4EKJA 3CTLA 3GYEA 2D0GA 3USZA 2EXOA 3MUIA 3HPSA 4QM1A 4XQ6A 2WJFA 1N8IA 3UGRA 2VT0A 2PLKA 3CUGA 3TQPA 4H9UA 1R5YA 1R47A 4GI4A 3MZ2A 1GKPA 3G0UA 1TX2A 4UR9A 1DWHM 4J3VA 1LWJA 2V67A 1H61A 1O94A 5FSDC 4PMXA 2AL2B 3ZS4A 1XCFA 2P0IA 1VBRA 4GK8A 4IGNA 3CQIA 1I2OA 1FHDA 1R86A 5CJMA 2NV9A 2VOTA 2ZRZA 4I9JA 5ABFA 2X0YA 7ODCA 1J0ZA 1CPUA 4CQCA 1UWQA 1FCUA 2C19A 3L4WA 1M68A 1C90A 4EXQA 1U2YA 4JTHA 4KS0A 2EQDA 3PB2A 3OYZA 4DF0A 2WQDA 2VCCA 1VEPA 4HTYA 3TAOA 4PL2A 4HCDA 4P8VA 5I2UA 3TW7A 2DIKA 1S38A 1NP0A 4DBWA 4HPXA 4L1XA 1AMKA 1D8CA 1PB0A 3G0SA 1E9LA 1X8FA 2D2JA 3PZGA 3N6JA 1W1IE 5E0FA 3MBDA 3LS9A 4LC8A 2YCKX 3E0FA 3O06A 3FLUA 4ML4A 4O52A 4X0NA 1PSCA 4FNUA 2FB2A 1JCXA 3W00A 4PBFA 1SZNA 4X60A 2V2DA 2HRWA 4EOUA 5A94A 5BMWA 3Q45A 4K7VA 1TFVA 2CITA 1HKJA 1W9DM 3E0WA 1R87A 4IPPA 4KCTA 5CKSA 3P7YA 4OUEA 3MHGA 3BE7A 1R85A 1NOUA 3TROA 3ZZ1A 1A5NC 2FB3A 3CT2A 3U4FA 2VD8A 3OA5A 1V6TA 2E6YA 1MW0A 3DGRA 3O6DA 3PBWA 4S3DA 2ADAA 2YX0A 2HJPA 1H1ZA 1SW7A 1OK6A 3T8QA 1EFZA 5I7GA 1P6WA 1NWRA 3DUGA 1XLBA 3FOKA 4NXSA 4RXFA 3WQ5A 4JTRA 3T0DA 4IFOA 1TYGA 3WUEA 2HE5A 3WEZA 1ZP3A 1THFD 4FEZA 4J3XA 2ZQ0A 1EP3A 5HATA 1M04A 1HFBA 4PB5A 1XICA 3AROA 3UBPC 3PZOA 4AHOA 2PWHA 1W6TA 2RGMA 2O92A 1OD0A 3CGTA 4IP7A 1X8CA 2ZDSA 3W7IA 2Y62A 2E8YA 4S3BA 2ZWYA 3BQ6A 1CGUA 4CNNA 3ICJA 1NQKA 2VZSA 2ZXDA 3W2JA 1GG0A 1GVSA 3ZXWA 4WD0A 2OT0A 2W61A 2FVKA 3CL7A 3AOFA 4L61A 2D1ZA 3LG3A 3OGRA 4F0RA 2WQPA 3W2LA 3DG6A 3CO4A 4D8ZA 3ME3A 3UWYA 1VBGA 4A2SA 2NT1A 4PC8A 5IM51 3OIHA 2WSRA 1W1ZA 2DH2A 1M6JA 3P82A 1DJXA 4MKVA 3TX9A 5ABGA 3VFLA 5C6MA 3U7BA 5D9MA 4L80A 1DIDA 2VURA 3GRIA 3AIVA 5E70A 1LT7A 1WDPA 4QE4A 4PRWA 4MZYA 5HK4A 2VC5A 3LENA 3TDFA 4WGHA 4Q4OA 3ITYA 3AICA 3NA8A 3N73A 3R25A 3ZJ6A 3W4RA 2WANA 1WKEA 3QKEA 2PC4A 3E5PA 2PDFA 2QF7A 2Y7DA 5H8UA 4AISA 5G2WA 4NAFB 2NQHA 3R0KA 4JHOA 1EF2A 1PDZA 3B0PA 3WK3A 2YA0A 3UWEA 4M7TA 3W7NA 2J7EA 3LBMA 3AXHA 2C79A 4QE1A 4E8CA 4JQ2A 3VOIA 3PS7A 1XGDA 5B7ZA 4DWSA 3JRKA 2NW0A 5CSRA 1TVPA 3WY1A 2PTDA 1BXBA 4EPBC 3E96A 2WM1A 3C0SA 3VM7A 1ALDA 1FDJA 3UPWA 3UXAA 2VFFA 3VC5A 3CYJA 1JZ7A 4O54A 4CD7A 4JKKA 3QF0A 1UBPC 2DT1A 3CHFA 5DXYA 3G0XA 3E2QA 4LB3A 3E0IA 1MO0A 1V0KA 3NZRA 4JTCA 1R0MA 2VRKA 3WELA 1A3HA 1HIZA 4QLLA 4Y2WA 1GHRA 1T99A 4AVNA 4MM1A 2H8ZA 4Q22A 2A0NA 3TN5A 1QPOA 2DZWA 1DJZA 5DO8A 2VI0A 1UIOA 1L6GA 2PZNA 4E38A 3IJ6A 4IMEA 2CEQA 4IP5A 3KVLA 1MDRA 1QI4A 4DM2A 2HS8A 4XZ9A 5FF7A 5JUVA 4H9YA 1XRVA 4AF0B 3MMTA 4CQDA 5DQPA 2NWRA 2P76A 1BVWA 2DPEA 2VX7A 4OZOA 3DCPA 1F07A 3NYDA 3B9OA 3A21A 3SCWA 5K9CA 1XLFA 1JIBA 1GW9A 4J9JA 2Y5SA 3W1NA 2A85A 3CZLA 1MW1A 3ZLFA 3INPA 3AYRA 3WBAA 1GVOA 3WBYA 4ONVA 1PZ2A 2OEJA 6PTDA 3ONBA 3F2CA 4QGCA 4PA8A 2F2KA 3BK0A 2WZMA 4HKPA 4LCRA 4Q7BA 3C6CA 4ZQNA 4UNIA 4A3UA 3RLVA 1WE5A 2QVHA 5LA1A 4OIFA 2Q3OA 1RVKA 3DERA 4HOWA 3LNPA 4XKYB 3MV01 1EEPA 3TWAA 3I3DA 5HOSA 4AFYA 4D6DA 1NWSA 2XPKA 3BAKA 3SB0A 2XFWA 1XCXA 3CUZA 5G2IA 2XUCA 4PMNA 3S9ZA 2X30A 4O1DA 3BLFA 4AW7A 3KRBA 2J6VA 3R2GA 3QLDA 4NNBA 4DM1A 2ZVIA 1RAKA 4BEUA 4ATLA 1GONA 2FTPA 4M6UA 4RZ5A 1ISWA 2H3BA 4S39A 4FB7A 2OZTA 5AHIA 4LYPA 4E4PA 3MANA 5D04C 4Z08A 1S2AA 4C6NA 4PUKA 1XP3A 2PDPA 1GPFA 3VPLA 4YJ5A 1TA3B 3HA1A 3AXXA 1KWGA 2ZADA 2PP3A 3WMLA 2XN0A 4OWGA 2OYLA 4PUEA 1XLGA 2GWNA 3SGZA 3AIWA 3U3HA 3MO4A 4S38A 1D3GA 1MQRA 1VFSA 3WEMA 3MUAA 4FNPA 4IPIA 2X1RA 2O9TA 2VEGA 1SPQA 4MPKA 1L6YA 4JEJA 4A35A 1RP9A 1R2SA 1DKWA 2HNHA 3ZT5A 4H6EA 2HK0A 5E93A 2NV2A 5LIKX 5DBUA 3G8RA 3HO8A 2EJ1A 3ECQA 4X9YA 2UY4A 3NM1A 2Z1KA 3PZQA 3S5ZA 3NAVA 1FKWA 4MJ2A 1EL3A 2DVTA 4E8DA 1F76A 4L4PA 4TVDA 3W75A 3NO3A 5CBIA 3B8DA 4HA3A 4H6RA 2BY3A 3IIOA 4GJ1A 4LAKA 5AHNA 3RFAA 4DBEA 3ARWA 1F7BA 4K38A 1SJDA 3VYLA 3BW2A 4MB3A 3CM4A 2H8XA 4JTUA 1EJRC 4XK2A 2JK2A 4FX7A 3NQ6A 1O5KA 1K9DA 1EOMA 4P8XA 4IUOA 2WXDM 2IKGA 4J35A 3O63A 1VFHA 3WLLA 1OZMA 4KMQA 1V02E 4ZE4A 4GPNA 1QNSA 2KAUC 1K70A 2CBVA 4DBDA 2YFNA 4J1OA 4B5XA 3TN6A 3GU2A 3IAQA 3LX9A 3RPMA 5LXEA 1JL8A 4R27A 3F5LA 1NSJA 4M80A 5AC7A 1EBGA 5D03A 3N1AA 4JTFA 4YWSA 3P8IA 2D3NA 3EA1A 5IFPA 4N9BA 1QJWA 4GINA 3BPWA 3EA3A 3JZUA 4JFVA 2HTMA 4DJEA 2VNCA 4KCVA 1O6IA 6TIMA 3ARRA 2G4JA 4NI3A 2P0OA 3DC8A 2ZX5A 2Z0IA 2TMDA 1UC4A 3UYCA 4WKAA 1K4GA 4A8NA 5I5RA 3NL6A 3KX6A 3VNDA 3IWPA 2VCBA 3P5ZA 1ZBKA 3MJYA 4R88A 1YXDA 4HHLA 5HWMA 3EB4A 1NIUA 2QUTA 3LZ3A 1KC7A 4I3GA 1VR6A 4E2BA 1SR0A 4IGSA 5CPSA 3UD6A 5J5DA 3GU1A 1G01A 1KD0A 4HOXA 4G7FA 2XFYA 4MDOA 3TUUA 1OYBA 2HEJA 4HYVA 3SW6A 3MT1A 4HPGA 1YX1A 1SSDA 1N55A 1XGZA 4RXGA 3G1XA 3PPGA 1G1YA 4L1WA 3DU0A 3MVTA 4F4RA 3M0HA 1JI2A 1LL6A 4RLIA 4EVZA 3NO1A 1PTDA 4GABA 4GACA 4HNTA 1I1XA 4HPNA 5FSEC 1XLJA 5I06A 1UPPA 1V3IA 3SDOA 1N2VA 4MWAD 5K9DA 2NUYA 2D24A 5I23A 5FL0A 3VIMA 4ZQOA 1AJZA 2V5LA 2V63A 3LHWA 2EPMX 5FF0A 5JBEA 3AAMA 4L9YA 4MY8A 2AOSA 2ZICA 2XVNA 3LLXA 4MJ4A 2CLOA 1Q13A 2ZX8A 5BWAA 5HR7A 5HMEA 1ZBVA 2BVYA 1UMYA 4HK7A 4NUWA 3UGVA 3W26A 3G5EA 4S3EA 4EPEC 2WPGA 3GG7A 1XV8A 2VEMA 1XYAA 4DJDC 5H91A 4QSHA 2V30A 2P10A 1H5YA 1Z42A 3M0VA 3TNOA 1S5MA 2OX4A 4L1GA 3UJ2A 4DXKA 1VS1A 3IJLA 5AYIA 3W1TA 1OWQA 4LV4A 1L9WA 1XM3A 5B7YA 2UY5A 1E5JA 4ATDA 4WDUA 1LF1A 4KCUA 5MHBA 3RYSA 2WV8A 1C8YA 4UXDA 4H19A 4UFLA 3ARPA 2YA2A 2BXVA 1WKYA 4EXAA 3RRAA 3W7DA 4J28A 5KETA 4Q4MA 4NAEA 4JKLA 3GKFA 4FALA 4C6CA 4IGMA 6XIMA 2AAMA 2J4GA 3ITVA 3VKBA 3UG3A 4Q3MA 4TX8A 3K8MA 2QV5A 4Z2KA 3QR3A 4KW2A 4QG8A 4UFMA 2QVNA 3VE7A 2ZUNA 5CH9A 3NGFA 3PWAA 2ISWA 4RZ4A 4LRSA 2ZCGA 5KTLA 4UMBA 3ZLHA 1TJ2A 5EU9A 1PYFA 3NQGA 5GJPA 3KCJA 4UOZA 2AGTA 3K4WA 1C9DA 2DZXA 1VYRA 1L0PA 2CLPA 3QQ0A 4EAMA 1WZLA 3VVGA 3R7MA 4UR8A 1OFDA 1DPMA 3T40A 1W17A 3C52A 3AXIA 2GJXA 3GUWA 1RCXB 3GXIA 1K4HA 1HXJA 3TYAA 3VUSA 2C13A 2IS7A 4AH7A 3RMJA 2QEZA 4B5TA 3VCCA 2VFHA 4W87A 4JN7A 4HNVA 3C3NA 4N9DA 3G6MA 4AX7A 1X7IA 4NJHA 3TYUA 1H09A 1IR1A 1XLMA 2QJHA 4LVGA 3GR4A 3BVJA 3PBMA 4QS5A 3SQMA 1CXKA 4RDVA 3BQ5A 3L4VA 4NIRA 3MMUA 4YCPA 3FSTA 6REQB 3S6OA 1ICQA 2FLIA 3BSGA 3DZ1A 1K7XA 2YYUA 1RVGA 4HNLA 2JKAA 2WO5A 3H2FA 5AC5A 2OOFA 4RZBA 1JCLA 3WZ0E 3A47A 2PAJA 4FLQA 2OZ8A 4LUSA 2CLIA 3G8EA 3WK1A 1DQXA 2CBUA 4AEOA 1AUSL 1TTPA 4C6LA 1QRQA 4CQ9A 2OWWA 4WGXA 4QE5A 2QT3A 4N02A 1FWHC 1KBBA 1FXPA 2J88A 2VEIA 1G4PA 1X97A 5IXEA 5EMKA 7CGTA 1XIGA 3I68A 2AL2A 2ZA3A 4HNCA 1LBMA 1F73A 2PDMA 4L5ZA 2ZRVA 4PUWA 3F1QA 1WOBA 2PWUA 2QULA 4GUFA 1MMFA 4NQ1A 3TP4A 1Y65A 3RM8A 1VP5A 1OVDA 1N8WA 1FWDC 1KFEA 4JCLA 3EWYA 2ZA1A 1C92A 1DWGM 5FI8A 1IYXA 4QISA 1NWUA 2G41A 4F3HA 3LM3A 4K1GA 4JNZA 2E4TA 3CNYA 1WCGA 2D22A 4LANA 5SWUA 1B5TA 2Z27A 4GQQA 1D3HA 4CU8A 4P5UA 4MLJA 3MJMA 4AZGA 1E9ZB 2FPTA 3L5AA 1PTAA 4W93A 1AG1O 4MB1A 3WNNA 3URAA 1WDSA 1KQYA 4GY0A 3R0DA 2FGZA 5CPQA 1FWCC 2YCJA 1W3NA 4DO4A 4LJ3A 2W6RA 5BU9A 1E4MM 4QG6A 2GK1A 5I02A 2WKGA 2R14A 3GR7A 3HGJA 2XGZA 3KTSA 1HKWA 4JHZA 1PX8A 3I7SA 4Z17A 1KM1A 3V35A 3VX1A 1CCWB 1RLDA 2OR2A 1LOSA 1TPVA 4J3SA 2PMQA 4DJED 1EIXA 4JQ4A 4KWWA 1QBBA 3A64A 1W9BM 3OGVA 1V6XA 1NOWA 3EMQA 3VCNA 4GO9A 2GWGA 4JTIA 1MXSA 5TF0A 4QAWA 1XW8A 4MZ8A 4FXJA 3NQ7A 2ZBTA 4MSSA 4UTMA 4UTIA 4OTKA 4LV9A 3RLUA 4KEMA 3V3WA 1I9CB 1WXYA 1YYAA 1GVFA 2ACQA 4GHRA 2IQDA 4HTBA 1YE6A 1Z69A 3EB3A 1W1YA 5CAKA 3I10A 3OODA 4TVCA 4JX6A 3UP8A 4U33A 3NG3A 3TC3A 4PB3A 1TTQA 4C5YA 4GCXA 5G1MA 4K7YA 5A2CA 3GW3A 5J8LA 4TX6A 1TWDA 3I3EA 1UCWA 4ZL1A 1HJWA 2Z2AA 4ZVJA 2VFDA 2UZ9A 3E49A 3KL5A 2E0PA 3T08A 1JYWA 2QJGA 4O57A 4E3VA 3GR8A 4A8IA 4FOJA 4RUBA 4ACZA 1OB0A 1P1XA 1EJVC 4XZBA 4IUGA 4LNYA 4YWIA 3L65A 4QNEA 4RX0A 3SECA 5HINA 3C8NA 3ABQA 4BI6A 4ICNA 1Z8AA 5JBDA