5CPOA

Crystal structure of xena from pseudomonas putida in complex with an nadh mimic (mbu)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
359
structure length
359
Chain Sequence
SALFEPYTLKDVTLRNRIAIPPMCQYMAEDGLINDWHQVHYASMARGGAGLLVVEATAVAPEGRITPGCAGIWSDAHAQAFVPVVQAIKAAGSVPGIQIAHAGRKASANRPWEGDDHIGADDARGWETIAPSAIAFGAHLPNVPRAMTLDDIARVKQDFVDAARRARDAGFEWIELHFAHGYLGQSFFSEHSNKRTDAYGGSFDNRSRFLLETLAAVREVWPENLPLTARFGVLEYDGRDEQTLEESIELARRFKAGGLDLLSVSVGFTIPETNIPWGPAFMGPIAERVRREAKLPVTSAWGFGTPQLAEAALQANQLDLVSVGRAHLADPHWAYFAAKELGVEKASWTLPAPYAHWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xenobiotic reductase
publication title Better than Nature: Nicotinamide Biomimetics That Outperform Natural Coenzymes.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 130
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cpoA00
3S1UA 1GVOA 3CEUA 3NYZA 3W7OA 1FCQA 1GJPA 4NNCA 2QDHA 1H63A 3O6CA 5U7SA 3C52A 4NZFA 3B0PA 4EOUA 2VXNA 2F84A 1J4EA 2Z1BA 3W1TA 1IGSA 1VRDA 3WJYA 2OT1A 4PODA 3I7QA 2ZZ3A 2WJZA 3NQ2A 1VYRA 3RLUA 1S5VA 3HBLA 3TX9A 1ICPA 1HFBA 3V75A 1JQXA 3GZ3A 4RZ4A 1XXXA 4R34A 1FDJA 3CWNA 3GNDA 2YW4A 1M7OA 4P61A 4BI5A 3TR2A 5CPMA 3HG4A 3A5FA 1Q6LA 4JY8A 1OK6A 4KFNA 3TQKA 5C54A 3IGSA 1H51A 1N7KA 2ZRVA 3OVPA 4C1LA 4ZMGA 4JTUA 1AL7A 5IBXA 2FDSA 3PG8A 2YGYA 5F2MA 2ZRYA 3PSVA 4UTUA 2CLEA 4FXSA 1T0OA 4XUGA 1OFPA 4WJEA 1F73A 4BWLA 2TPSA 2WNZA 4AEOA 1ZY9A 4X2RA 3LLFA 3NVTA 4PCFA 2JK2A 2E6AA 4UNLA 3N9RA 3OG3A 4LNYA 3USBA 3EWYA 5FF2A 1NVMA 1VHNA 5IBXC 1GT8A 5CPOA 4YXGA 1ICQA 8TIMA 5K9CA 4PC8A 3W7NA 1EP3A 2ZZ7A 1VCGA 5LSMA 5E93A 5AYZA 4BWLC 1UJPA 4UUIA 2X16A 5DY2A 1PHWA 1K02A 1KLYA 5AC7A 5FEXA 2NV2A 3S5OA 3M0ZA 2QCNA 4IOTA 3M5VA 3UD6A 5D04C 5C2XA 3L67A 3TW6A 3L0KA 2ATMA 3WK1A 4G1KA 1I2PA 2B7PA 3QMRA 3G1VA 1X7FA 1P0KA 1YDVA 1KM0A 1LLZA 3OIXA 3BARA 5FI8A 4LUIA 1G6CA 5G2HA 5HWJA 3CPRA 1MSSA 4JTFA 4FX8A 5FF3A 3W2LA 1KA9F 1L2UA 1XKYA 7TIMA 4JX5A 2QCLA 5EPDA 1OX4B 4JIQA 2ABAA 1JUEA 3YPIA 1SUXA 4QSHA 2YPIA 1ADOA 2GOUA 2GVLA 4PEKA 4JICA 4UMBA 3HF3A 1I45A 1KW1A 4Z1DA 2AQWA 2CFFA 3F1QA 3UWZA 4O4VA 1AL8A 2VFIA 3TDFA 3W7LA 1YTEA 1XL9A 3LTSA 2QAPA 4K7YA 4JTJA 1QOPA 4WOQA 3DAQA 2QDGA 3TJXA 3B05A 2CWNA 5BRBA 2Y7DA 3V1PA 4JTKA 4NJGA 1LROA 3HMJG 5AHMA 1W1ZA 4O18A 3LBCA 2E77A 1K8XA 1NF0A 1T96A 5LNUA 3NL6A 3VKJA 2GJNA 2WOQA 2CLHA 4K6AA 2OJPA 4O11A 4LOCA 3RK8A 4CNOA 2C14A 4N9EA 4DF0A 4E0CA 1RZMA 4QISA 4UFIA 5LZLA 3LHUA 3S0CA 1O60A 2QAFA 3HGOA 3QM3A 3NNTA 3S5NA 2H8ZA 3HOJA 2NLIA 4WY0B 2OZ0A 1TJPA 4ZVJA 6ALDA 1G4TA 4JTSA 5F4XA 1B4EA 1D3GA 2QUTA 3C4UA 1JCYA 3VI2A 4Q33A 3T44A 5BNKA 5AFDA 3BV4A 4K37A 5DXYA 4PH6A 4PFMA 3LGEA 1JULA 4AHOA 1QPRA 4RK8A 1RD5A 1Z44A 3W7PA 4WX2A 4N6EA 1NSJA 5CZJA 3LRKA 1FWTA 2QF7A 3IIPA 1LOLA 5LKYA 3JR2A 1M5WA 4UNKA 1QMLA 1FWSA 3M5ZA 2I9EA 3LHVA 3NOEA 2I1OA 3RF9A 4H6KA 3N2XA 5D30A 1QNVA 4JD4A 4AHQA 3ZS4A 1OYAA 2ISSA 3MJYA 1H7RA 3M1ZA 4O1BA 3HQ1A 4HHPA 1YXCA 2C3ZA 2C1HA 1ZAIA 5F2LA 1XBYA 4DO5A 1W54A 5TIMA 4K38A 1NF7A 4GUFA 4NX5A 4EF8A 1QO2A 2VFFA 5CKSA 3G0XA 3KVJA 1RPXA 4KWVA 3PVFA 3T7VA 1FWWA 3TSBA 1J2WA 4ORMA 1D3HA 5LHFA 3W1LA 2YR1A 1W5QA 3PUDA 1TMHA 1KTNA 4JTLA 1OX6A 3A9IA 3KRZA 3WJWA 4RV8A 1DBTA 2CZDA 3MHUA 2XN0A 3W1PA 3GYEA 2WQPA 1QFEA 4UTJA 1T99A 3NQAA 4FNPA 1TPH1 3UWWA 3NAVA 4WXZA 3C0JA 1VJIA 2BWGA 2EF9A 3CU2A 2X1SA 3DGRA 4JXCA 3L5LA 5LGXA 1FWNA 5HR6A 3LV5A 5U4NA 3GXPA 3IGXA 2A7NA 5AB3A 3P84A 2F7FA 2E6YA 1KV8A 1YADA 1IXPA 1G4SA 1OFOA 1CI1A 3MUXA 5E1QA 1SO5A 2VFHA 4IWWA 2Z6JA 5LNSA 5DBTA 3W1MA 4NX0A 5K9DA 5CPLA 5DCEA 5MHBA 1UBSA 3RLVA 4GUGA 1PE1A 2QCMA 3OVRA 3W85A 3OHIA 1VCVA 3IEBA 1X6UA 3C56A 5K4XA 3GDLA 1ZALA 3UXDA 1VS1A 5KMYA 3UPBA 4RKAA 2VEMA 3GXNA 3DFSA 1CW2A 3FEMA 1PCKA 3LRLA 5BMXA 2OMAA 4MZ1A 2C6QA 1WQ5A 3NG3A 1V7YA 2VEKA 4OQVA 3M5XA 2CLFA 2YCEA 3QSRA 4QNWA 4O0KA 2CU0A 4TIMA 1RQBA 1OYBA 1S3HA 3EWWA 4MPQA 4AVFA 1G4PA 3UY8A 5FF0A 1G7UA 1N55A 1QAPA 2QCEA 3LDVA 3KXQA 5LGZA 2H90A 3GNNA 2Z0IA 3BGGA 2X30A 2P1FA 2XFWA 1WBJA 2QCGA 3S1WA 5D38A 2JBMA 3EKZA 4OHQA 1KV5A 5H2ZA 1F7BA 4Y96A 4LU0A 1MEIA 5DELA 1SW0A 5KZEA 1GVFA 1G67A 3MHGA 3P60A 2WSRA 4FEZA 3KRSA 3W86A 5EYWA 3DFOA 1YDNA 3KVMA 3BLFA 1X1ZA 4BI6A 2WKJA 2VELA 1Q6OA 1IIHA 3TSMA 5FEZA 2QUUA 3T40A 2EAWA 1J5TA 1AMKA 4ALDA 3BVJA 2QEZA 4JIPA 2R8WA 1MEHA 2XN1A 3W3OA 1Q3NA 3ZWSA 3G1HA 3NXFA 4JEQA 1F74A 1GPWA 5HINA 1C9DA 4BR1A 3CHVA 1WXJA 1SR9A 1KM3A 3DFPA 3B0UX 3OBKA 1JCNA 1TYGA 3E96A 1TRDA 3G1DA 1W5PA 3PUOA 1KBJA 3FFSA 4Z08A 2JKAA 2NWSA 1VHCA 1LORA 2NX9A 4RZ6A 3LCLA 1LRTA 1VLWA 2YZRA 3FJ6A 4J9JA 2W79A 1ML1A 2Y70A 4X9SA 2CLMA 2RH9A 3A24A 3ABOA 1LOQA 3LHZA 2AGKA 4JYEA 3SW6A 4BI7A 4NXSA 5D09A 2X2GA 4MFEA 5DXXA 4DXVA 4AB4A 2KZHA 4HPXA 2ATSA 3R89A 1C29A 3LCGA 4RR4A 3EB2A 1NAL1 3R12A 1ZJIA 3P5ZA 4MYXA 1B9BA 4ADTA 4Q4KA 1FXPA 4DO4A 5I3JA 3W83A 3EX1A 3PS7A 5D32A 1H61A 2ZRZA 3E02A 3U2OA 3NQ8A 2ZDRA 4AWSA 1GVSA 4JY9A 2ZZ2A 4Z0JA 1A53A 1FX6A 2YDAA 4LVGA 1PL9A 1KBIA 3EEGA 2A7PA 3UY7A 1OYCA 1FUYA 3PG9A 2H6RA 3S1VA 2G5WA 3KVLA 4AXKA 3UQNA 4TU1A 2NUWA 4HSNA 4M7SA 2IQTA 3H53A 4YWIA 2FQIA 4YLWA 4UFKA 2FPVA 3M47A 4UXDA 2H3BA 4MIMA 1WDWA 3O16A 2NV1A 4DELA 2DP3A 4TMCA 3VE7A 4LVFA 3TUUA 3IIVA 4ML9A 2QUVA 4ZQRA 2ZZ1A 3P80A 1F6KA 2HS6A 2CZEA 2NXHA 3QW4B 1F2JA 5F4SA 3HGSA 3LHWA 5FESA 1SSDA 1DKWA 4UR7A 3CIXA 4AF0B 3DFNA 3PUEA 3DENA 1LYXA 3EXTA 1NEYA 2JGQA 2J27A 3LCWA 3MW7A 3QQ1A 5E0KA 3SI9A 1MXSA 1SSGA 4MYAA 2GQAA 3NA8A 4A22A 4QIUA 3DZ1A 3QRHA 4I9AA 2BTMA 4UFMA 2RHGA 2PRMA 3LM7A 3O6DA 1JQVA 2DJLA 1A5AA 3W76A 5D2WA 2VOMA 1AW1A 2ZRUA 1ZENA 1WV2A 4YCOA 2ZZ5A 3MI6A 4PTNA 4O10A 3TAOA 4O1AA 2A7RA 3H54A 4K8EA 2NWRA 4O53A 3TQ0A 4N2YA 3PY2A 3F4WA 3SR7A 4NJHA 5DCBA 1TTQA 5FEPA 3IRDA 3RMJA 5T26A 4N6FA 3W2NA 2A21A 1VC4A 4NJIA 1OK4A 4GXMA 3CT7A 1KFLA 5EA9A 3E0IA 1F6PA 4JS3A 3L66A 3G8EA 1PIIA 1TV5A 3TH6A 2CLLA 2GVJA 1SQ7A 3HG2A 1XI3A 1JCLA 3O15A 4XQ6A 4RCXA 1EWEA 1R2SA 4KFOA 1H1ZA 4TR9A 3ZR4A 2R14A 2X1RA 4OWGA 3W7MA 3ABRA 2GQ9A 3L65A 3NO5A 3LERA 3DH7A 2WO5A 1I8JA 4E38A 4WZHA 4AHPA 3HPSA 3THQA 3BPWA 3GR7A 3FS2A 2CLKA 1UUOA 1BTMA 3PSWA 4I7VA 2JKPA 1THFD 1H7XA 3WK0A 3UWQA 1VR6A 3MYPA 4HNVA 2QCFA 2VFGA 1GYLA 2GUUA 3GLCA 4ONVA 3STCA 1W8SA 3STGA 3L0GA 3W2MA 4YMZA 1A50A 1OG0A 1SFJA 5D2XA 1ALDA 2EKCA 1VZWA 4IMDA 4LRTA 2P0OA 3LOTA 4AAJA 4DPQA 1X1OA 5AYYA 4MY8A 1TPVA 4N9BA 3TK7A 3W75A 1D9EA 4M7TA 1YLVA 4W9TA 3LLDA 4CCEA 1SO4A 4NUWA 5I3IA 3B8DA 4LS1A 2DZTA 2C19A 3QZEA 1GVQA 3BO9A 4CCCA 2X1UA 4ZQCA 1KFEA 4MOZA 5J5DA 1P5BA 1ME7A 1V5XA 3W1AA 1IXNA 3IVSA 3LHTA 3MMTA 3G1SA 3QMSA 4UFLA 2Q8LA 4B5NA 4CNPA 2YYUA 5EBUA 4S1FA 1IXQA 1YXYA 1EB3A 3TFCA 5KINA 1PHQA 3GAKA 5J5RA 5EY5A 1A5BA 2NZLA 5I3FA 3W23A 3NDOA 1TSIA 1DOSA 4LS0A 4UFJA 3W7GA 3N3MA 1I2OA 5DY3A 5A8GA 1KM5A 1GZGA 3NM1A 2CLIA 3L5AA 4P2VA 5K9XA 1LZOA 1DJQA 1DL3A 1OFEA 1LTDA 2YFNA 3VCRA 3W07A 3L68A 3TFXA 1KM4A 1JCJA 5AC8A 3EXSA 1DQXA 3P67A 4WUIA 1QR7A 3TNOA 3KHJA 3N2MA 2LLEA 3N73A 3NQCA 2OX1A 3O63A 5C55A 1FXQA 1ONRA 1TREA 5AHEA 3T55A 4KKXA 3TIMA 2FB3A 3I7SA 2XN2A 2TSYA 2FB2A 1TPFA 3W88A 3LCHA 1GG1A 4OE7A 4FNUA 5FF4A 3TJLA 4IPJA 3QEZA 1ZFJA 1OFRA 1X8FA 3Q94A 2PURA 3RFAA 2VEPA 1P1XA 4ICNA 3L21A 3B04A 1XBXA 1HUVA 1YYAA 5HQEA 4LT9A 3R2GA 2G97A 1U5JA 4OV4A 1I4NA 1R30A 3GIYA 3CIWA 3OA3A 3F4NA 1T8XA 3G0UA 4MLJA 3PBUA 4K39A 3P7YA 4CNNA 2Y88A 1O5XA 3R13A 4GNJA 2ZYFA 3W7CA 1VCFA 3TSDA 3G3MA 3NL2A 5DN1A 2C0AA 1A5SA 4CLMA 4LC8A 1AG1O 3HO8A 3NM3A 1RQHA 3L5MA 4NT0A 2QCDB 3BW3A 1SW7A 1VLIA 3LXAA 1ZCOA 3W1RA 3UPWA 4JGDA 1JRBA 3NQMA 1HO1A 5SWUA 1VYPX 3G22A 4IJBA 3M44A 2V0TA 5D2TA 3S42A 1OFBA 2FTPA 1S5TA 1R47A 5CSSA 1CX9A 4WQ6A 3IV3A 1I2NA 3LCFA 1YXDA 3G3DA 4LV9A 5AHIA 4R53A 3JRKA 4N9DA 3W84A 1F05A 2J6XA 4C1KA 3ABQA 3O1NA 3W2JA 1W0MA 2QJHA 1GWJA 1O5KA 3G8RA 1R46A 1SU5A 1UASA 1I2RA 3QC3A 3GVGA 3W9ZA 2FIQA 3PBYA 1TPWA 4LRSA 3N9SA 1YTDA 1YDOA 4E2BA 1K03A 2Y61A 3DFQA 4TO8A 3U6WA 4XKYA 1HO4A 2WV8A 4GE8A 3N34A 1P4CA 1RQEA 4IMFA 3W7KA 4FO4A 3MP5A 5AOUA 4UTKA 3MWAA 1WYIA 1TTPA 3W7JA 1BWKA 1Y0EA 4WY0F 4XTDA 1FCUA 4GUIA 2J9ZA 3QPZA 2YX0A 4RZ5A 3BLIA 1H7OA 2DZPA 3TC6A 3W1XA 2VC6A 4IXHA 4O4WA 4DO6A 1SW3A 3EX2A 2JKEA 5HNRA 1H7NA 1Z42A 3DHDA 2PE4A 4HT3A 4OV9A 4NVTA 3WFAA 5CZ0A 1KFJA 1TPUA 4IUOA 4FF7A 2PRHA 4S2BA 5AHFA 1TTIA 1M6JA 4IXXA 4JTTA 4FNSA 1FCBA 3ATYA 2QKFA 3G0SA 5HUPA 1EIXA 3PC0A 2BX7A 4M19A 1LP6A 4IQLA 3GDMA 3DI1A 4UTHA 1GEQA 1TPC1 4M6VA 5D37A 5EL1A 3C2RA 2E5BA 4NU7A 1TB3A 2YSWA 4DPPA 4YCPA 1ME9A 5AYXA 3W1QA 4O8RA 4UMAA 4NJKA 2V5BA 3OVQA 4FNRA 3CWOX 2PRLA 1TPDA 3P74A 3MP4A 1XDMA 3QF0A 5KZDA 1M7PA 1EUNA 4UTMA 1SFLA 4JNMA 1L6SA 1LBMA 3D0CA 3VE9A 4IX2A 3C2FA 2TRSA 2QJGA 5LHEA 1SO3A 5LNWA 2ZA3A 1H60A 3W6YA 1EX5A 1JVNA 5BW6A 2VFDA 3LCXA 2GJLA 3FIGA 3PF3A 1OVDA 3PWAA 3B4UA 2UV8G 3TW7A 2D73A 1W37A 3IGUA 4IMCA 2FPTA 3NPXA 1F5ZA 3NZRA 1TV8A 2C18A 1TRIA 4U28A 1Z41A 2O7QA 5D2YA 5BOOA 1OF6A 3EX3A 4E2DA 3GKFA 3W1NA 3TQVA 3L0NA 4JDBA 2WSYA 2Y7EA 3I7RA 2ZBTA 2OT0A 4EWND 1FBAA 1UCWA 5KTLA 3LB0A 2QCCA 3W22A 1QOQA 1KFCA 1TO3A 3Q58A 2HMCA 4ZQOA 4MZ8A 4JR5A 4H4IA 4XBKA 4GUJA 3F03K 3PB0A 2I14A 5G4EA 1IF2A 2RDUA 4N9CA 4EIVA 3EXRA 1OX4A 2NX3A 3W70A 2ZRXA 4HPJA 1A5CA 4Y9AA 3DKLA 4JTHA 1FDZA 2PC4A 4UCGA 5FEWA 4O52A 1LCOA 4A3UA 4Z1BA 2EGZA 1K7EA 3NL5A 3G1YA 1SZNA 1B57A 3W7RA 4CQAA 5F1UA 5D03A 4DBEA 5K3VA 4MZYA 3K30A 1RR2A 4IPIA 4M5PA 3HJZA 3EWBX 3SSJA 4XZ9A 1IIGA 4NXKA 3W87A 2J9YA 3PBVA 5L9FA 3O05A 3UZ5A 5G2WA 4GBUA 4WD0A 4Z1CA 1LM1A 3L2IA 1LOSA 5EMUA 2DU2A 2RDWA 3NPVA 1JUBA 1OJXA 2E6FA 5I3KA 3RNDA 1KTCA 1DQWA 1YPIA 2ZA2A 3VFLA 1S5WA 2E09A 1FDYA 1LRNA 5KZMA 2C16A 1TQXA 1WOAA 4WY0A 1TJRA 1LLWA 5HMSA 2BLEA 1QPNA 2Y7GA 1UB3A 4UTWA 4N02A 2DZWA 4PL2A 1KFBA 4GUHA 4I7UA 4EF9A 5FF7A 3B03A 3TMLA 1KLZA 4MY9A 1Q6QA 4O1CA 4ZQNA 4JYFA 3PULA 1OFDA 5AHLA 3MI2A 2G95A 3LI1A 3OEXA 1AK5A 3DFTA 5K4ZA 4JN6A 1QPOA 4QITA 1TQJA 1LRQA 2WSQA 4UTWC 3NEVA 4PA8A 3Q37A 3I6RA 5I3HA 3LV6A 1SZGA 3P82A 1B3OA 2V30A 5IM51 3FOKA 2DZSA 4GRSA 1XDLA 5KITA 4I7WA 3IVUA 2HSAA 4LVDA 2YYTA 2WPBA 3UWVA 5DBUA 3EX4A 1K7XA 2B0MA 2ZRWA 3WJZA 3LXCA 1WA3A 4Y90A 5D05A 4JX4A 3HG5A 1AW2A 4CQ8A 1R2RA 4MUZA 4JTEA 3PBWA 3O06A 4PL1A 4HN4A 3S8HA 1XM3A 2EHHA 2QCDA 1W31A 2JGYA 1G4EA 3W73A 3ANYA 1OHLA 3LTPA 4FX7A 4Z1AA 3FKKA 5ABTA 2E1DA 1GG0A 3T4CA 4MJZA 5LNRA 3A22A 5HJLA 2Y89A 3MP3A 5H91A 4O54A 3TA6A 4HNUA 2NUXA 5CZSA 5HWMA 5AHNA 1EA0A 2A6LA 1Q6RA 3PB2A 3BG5A 1O94A 4H3DA 1EP1A 2ALDA 4LTSA 2V5LA 1N8FA 5F2GA 1EEPA 4ZQPA 1XUZA 3NQ6A 1W5OA 1Z48A 3AJXA 1W3IA 3MO7A 4OT7A 5AC6A 2WNQA 4FNTA 4FIRA 4RXGA 4UTIA 3IIOA 2YXGA 4K36A 3UNDA 3LCIA 3M6YA 3G18A 3M5YA 3NGJA 3CLMA 5TBOA 1W5NA 3TE9A 1SO6A 2GVGA 3IIZA 2B7OA 3P81A 4LC6A 1QO5A 4GFSA 2ISVA 2QJIA 3S5ZA 4KWWA 4BF9A 1O4UA 4O50A 2ZCGA 3L9CA 3BLEA 4R33A 3PM6A 4CQ9A 2P10A 2W6RA 1ZNNA 2E68A 2A0NA 2W0UA 1DJNA 3LTYA 4LS2A 1JUKA 5K2ZA 4O19A 5K7JA 4YL2A 1O95A 1TTJA 4M6QA 1HG3A 2H8XA 3IVTA 4QAIA 3TMQA 5DCDA 4M6PA 1GTHA 1EPXA 3MYOA 3TXVA 2ZTJA 1VQTA 2YFOA 3QFEA 4L4MA 5KSWA 1VH7A 1OF8A 4XBSA 2DZVA 1F76A 4AMAA 3GXTA 1I2QA 3P5YA 3THAA 1QPQA 3MI3A 3B06A 2Y62A 3S9YA 3GB6A 3NQDA 1TPB1 3O8AA 1VPXA 5LNVA 2WNNA 4MLRA 3NQ7A 4ADUA 1NFBA 4OU1A 2TYSA 3W7QA 3BG9A 4LY8A 3RU6A 2BXVA 1VGAA 4O17A 4U4MA 4RXFA 1K7FA 5C5YA 3DKJA 4DBDA 3R5EA 5G1YA 4FXRA 4HKPA 1K8ZA 1QWGA 2Y85A 4O13A 4QJ1A 3W71A 3E12A 1KM1A 1MZHA 5D2VA 3W72A 1W5MA 1XBZA 1XUUA 2PCQA 5CSRA 1GTEA 3NL3A 3S5YA 1LBLA 3EX6A 4A21A 3MBDA 2V8ZA 1KM2A 3QH2A 4LVBA 1ZHAA 3INPA 1DORA 1FQ0A 3SZ8A 3I68A 3QYQA 3FLUA 4O12A 3QPYA 4HIBA 3QSTA 4R7JA 1L9WA 2V9DA 2Q3OA 5G2IA 1UUMA 3TV8A 1FCVA 1K8YA 5F4WA 3WJXA 1SZEA 5EKYA 2ABBA 1EP2A 4K7VA 4K8HA 1H1YA 4KFPA 3W1UA 3LX9A 1OX5A 3PR2A 1KTBA 2C13A 3DI0A 4O15A 3HPXA 3HB9A 3PAJA 4O1DA 3TAKA 3GAYA 5AN7A 3LRMA 4JX6A 4D2JA 1B4KA 3WK2A 4DEFA 1XFBA 2HS8A 2V82A 4QQ3A 4Y6GA 1W3TA 1WOBA 1RV8A 1H7WA 2Q8ZA 2OCZA 1JRCA 3C8FA 3CC1A 3C2VA 3M7WA 4UR8A 3B0VC 2A5HA 3U8GA 4X22A 4UTTA 4Y8FA 3KOFA 3W7EA 4O16A 1H7PA 4Q32A 3GDTA 3NPUA 3MHFA 1WAUA 2E6DA 3BGJA 2ISWA 3NPWA 4LV4A 4BFAA 4NZJA 4WXYA 2V2HA 3ZWTA 4O14A 1RVGA 3SIZA 3WJSA 2Y63A 2X1TA 2ZZ6A 4QM1A 3TC7A 3BG3A 1C8VA 2VKZG 3S1XA 3NZ1A 3W2KA 2Z2UA 4UTTC 2A1YA 3P8IA 3CB8A 3IIXA 4N4PA 4POCA 5HWNA 4MY1A 3O6YX 4AWUA 5L6UA 2DORA 3N14A 1G69A 3W7DA 3SFKA 3HPZA 2DJXA 4IMGA 1PVNA 1LBFA 3W74A 4IX0A 2FJKA 4XWUA 1TIMA 4RX0A 5F1VA 4IGHA 4UMCA 2V2CA 5G5IA 1G7VA 3Q2DA 1TPEA 3I65A 5HR7A 2ZTKA 3LXBA 5G1TA 3QQ0A 3C6CA 1XC4A 2DZXA 4DF1A 4X3ZA 1DVJA 4EVZA 4FHAA 4GC4A 2CZ5A 4WOZA 3CEPA 4N4QA 5A5WA 3UWYA 3T78A 3BW4A 3NQEA 1HL2A 2E5CA 1ICSA 2H3DA 3SGUA 4NJJA 4MFDA 4BK9A 4UFHA 2CZFA 4O0ZA 4AF0A 4FNQA 2A4AA 3FA5A 3ZFHA 3UZJA 4L4LA 4MVAA 4A29A 3STFA 2GPTA 3EWXA 2B4GA 4Z0SA 3M41A 1LDCA 3P61A 3SY5A 3ATZA 3A5VA 3C3NA 1EUAA 3G1AA 1P0NA 2RFGA 3JS3A 1PCWA 4FX6M 3CTLA 1U83A 2V2DA 3QJAA 3ABSA 2CW6A 3C61A 3NQGA 4A2RA 4OGZA 2G96A 1ME8A 3KFTA 3M9YA 1OFQA 4LUJA 1YTKA 1YPFA 3NR0A 3W7HA 1PS9A 3R8RA 5BMWA 3HG3A 2V81A 4XTIA 1GYNA 3AO0A 5C6MA 2A6NA 1ZAHA 3FYOA 3SGZA 2GQ8A 1H5YA 1JCMP 4JDYA 1GVRA 4S2CA 1TV7A 1IXOA 3TKFA 1R2TA 3UWUA 4OBTA 2Z6IA 4AWTA 2Q3RA 3ELFA 3KX6A 3HGJA 2NXIA 5I3GA 3KVKA 2FFCA 1FWRA 4JTIA 3GKAA 4MJMA 4FB7A 4JTGA 1SPQA 4HNNA 1H62A 4GWEA 3STEA 3P8JA 4DF2A 3BK0A 4ORIA 1DV7A 2ZZ4A 4LWWA 4AH7A 1AW5A 1VYSX 3MBFA 4ZQMA 5HULA 4ZL1A 2NXGA 3P62A 4QNEA 1MO0A 5G4WA 1JJKA 3LI0A 3M16A 3FJLA 1L6YA 4A2SA 3G24A 2O7SA 2RDTA 3DBPA 4O28A 3CQ0A 5D33A 3A23A 3CM4A 3GR8A 1EWDA 3EKLA 1L6WA 1OABA 2CLOA 1K3UA 1MEWA 4MKNA 2J24A 4HNTA 2ZQ0A 4NNAA 1GQNA 3NQFA 2Y6ZA 4GJ1A 4JYDA 4UTLA 3GK0A 1QCWA 3C2EA 3TROA 3C2OA 1QDSA 1DHPA 4LVAA 6TIMA 5CGQA 2J9XA 3UYCA 1GOXA 5CG7A 4IMEA 3W2UA 1HTIA 4DQWA 5F2IA 3A21A 3FKRA 1Q45A 1ZAJA 3G1XA 3SJ3A 5DLCA 3S6DA 3TXZA 4UIOA 3KAOA 3H55A 3E49A 3LHYA 2R94A 2A2IA 3BW2A 2DZUA 5CPNA 2YW3A 2FPYA 2R91A 1W3NA 1XBVA 2B7QA 2ZFAA 2QCHA 3O07A 4UC5A 3N19B 5TQLA 2A85A 1WBHA 2B7NA 4NNBA 3VNDA 1OFAA 2TMDA 4RJEA 1KFKA 1E51A 1PV8A 3DHFA 1TCDA 2C15A 2HTMA 3G1FA 3FYPA 2QR6A 5D02A 1H50A 1BKSA 3QMTA 1W56A 1BWLA 3UXAA 4NQ1A 1SZFA 2NUYA 3KRUA 2BZNA 3NQVA 2J88A 4LW7A 3TU9A 3HGRA 5GVJA 4XKYB 4CCDA 2VEIA 3DU0A 2FLIA 2ZA1A 2EPHA 1KM6A 2AAMA 4TMBA 2VFEA 4HSOA 5HUOA 3TCEA 3QW3A 3SECA 3EWZA 4FIQA 3GDRA 3M43A 3LBMA 3DXIA 2E5DA 3EWUA 1XCFA 3GX9A 1JCXA 2VENA 4ADSA 5CZTA 1FY6A 3GDKA 1WX0A 2Y7FA 3HIJA 3E9AA 2RKXA 1BEUA 4RLIA 4TX9A 4ZZ9A 4O57A 3W7IA 3WK3A 1JR1A 2NX1A 2BSLA
chains in the Genus database with same CATH superfamily
3S1UA 4KGJA 3NYZA 3TA9A 3EKGA 3EOSA 4KETA 4ZO7A 2QDHA 2WZHA 2VURA 5ECVA 4EOUA 2VXNA 2VOTA 3HM7A 3E6EA 1VFOA 2Z1BA 2BXYA 1IGSA 1VRDA 2OT1A 4PODA 3I7QA 3TX9A 3QFWA 3R7MA 4AZHA 1HX0A 3GZ3A 4R34A 4H04A 1XQKA 3UR7A 2AQOA 4A8LA 4US6A 3ITGA 1N82A 3TR2A 1D7FA 1P6WA 3A5FA 4MWAA 3VIJA 1Q6LA 2WJEA 4E4FA 1SJBA 4XUYA 2XTKA 5TAOA 2ZRVA 4C1LA 3OA5A 5A6KA 4M0XA 2YGYA 1UQZA 4YIWA 3TWAA 1QJWA 4XVEA 2ZRYA 3WDRA 1KKOA 4UTUA 3VGDA 3MUAA 3WH6A 1T0OA 1OFPA 3OB8A 2WNZA 4X2RA 2DSWA 4PMZA 3NVTA 2E6AA 1J10A 4BQ5A 2CWXA 1UWSA 2BVWA 4YXGA 1ICQA 5AVHA 4RE4A 4PC8A 2Y2WA 3W53A 4UUIA 3UJFA 4JKLA 5DY2A 4G5DA 1K02A 5AC7A 2OEJA 1SFTA 2PTZA 2QCNA 4GCXA 1R3SA 3BMVA 3WDJA 1KXTA 1S5NA 1AH0A 2DIJA 3WY1A 1U30A 3G1VA 5FI8A 4HTBA 3FGCA 2J7GA 4IGSA 3VDCA 4JX5A 5EPDA 1TUXA 4IJCA 3YPIA 5ENLA 2YPIA 2GOUA 4U5KA 4UMBA 1I45A 4UZSA 3UWZA 1BPLB 4KT2A 4FI4A 4XSLA 3LTSA 2QAPA 4M56A 2HZGA 2WANA 4K7YA 4C6KA 3DUGA 3DAQA 4C6OA 2WNWA 3BSHA 4G8TA 2YDSA 3AYVA 3RO6A 3WH5A 2EG6A 4EP8C 1JZ8A 5HOSA 5BRBA 1UWAA 3N2BA 4NJGA 1S2VA 1AH4A 1DJIA 3ARQA 2E77A 1TVLA 2WOQA 2VDHA 4CNOA 4XO6A 2BGNE 2C14A 2OFJA 4MAZA 4DF0A 4E0CA 3BC9A 4UFIA 3LPOA 2OPJA 2QAFA 3TN4A 3EMZA 3HOJA 3GRIA 4IIHA 5JIWA 2WPGA 2NLIA 1VBGA 1EJTC 2P53A 1W6TA 6ALDA 4JTSA 1IEQA 1JCYA 4AD2A 5BNKA 4K37A 3WUEA 1YKWA 2PTWA 3W7PA 1SZRA 4N6EA 1NSJA 1LOLA 4LY4A 2IKIA 3VOCA 4UNKA 3ERPA 2P5NA 2GDUA 2I9EA 3LHVA 5D9NA 3RF9A 1CTNA 3R1ZA 3T2QA 2FZ9A 2R1PA 3CZ8A 3KZSA 4JD4A 3VFCA 1US0A 1BLIA 1RUSA 2C3ZA 5E0CA 1KRAC 1QI4A 4FS9A 1NF7A 4MSSA 5CKSA 4KWVA 1ODZA 2WC4A 3TSBA 4H9TA 1UYQA 1T40A 4XG1A 2YR1A 1TV3A 3PUDA 2ZADA 4JTLA 1OX6A 3A9IA 2UBPC 3KRZA 5T8GA 8XIMA 4S3GA 4MNMA 2XN0A 1V6VA 1QFEA 4ZA0A 1KQYA 3T2PA 1T99A 2EBNA 3A9BA 4FNPA 3C0JA 1VJIA 3U5YA 3W24A 1TR1A 2EF9A 3B4YA 4EXQA 3N3TA 7A3HA 2X09A 3CAWA 4IMAA 3LV5A 3GXPA 3DX5A 1A0EA 1JPKA 2CETA 4HOWA 3P84A 2F7FA 3V5CA 3VABA 1J6PA 4KCVA 2GDVA 2MUCA 1CI1A 1C8YA 3URBA 3ZT5A 1BAGA 3MUIA 3N6HA 2WZIA 5HBFA 4CUCA 4DX3A 1MUMA 3L7RA 4NX0A 2BY2A 3RLVA 3OVRA 3W85A 1VCVA 1X6UA 1WE5A 5ABFB 1GVEA 3VVGA 2PP1A 2FMOA 3GXNA 1XGZA 3W38A 3B3DA 1M1BA 1H5VA 5BMXA 2C6QA 4ERGA 4KEVA 1CXFA 2ZIDA 4AD3A 2CLFA 2F6KA 3DC8A 3VKKA 2A3EA 4IFRA 1RQBA 7PTDA 4AZCA 4AVFA 1G4PA 1N55A 1Q8JA 3MPGA 6A3HA 1BVZA 5LGZA 3TEVA 3GDBA 4GD0A 1PKMA 5DX7A 4OTKA 3SIMA 1XJBA 3WLSA 3GHUA 2OQLA 4B91A 5H2ZA 4Y96A 2G3FA 5DELA 1ZPTA 3GFXA 4UBPC 3MHGA 2WSRA 1OCBA 2YL5A 4JPGA 4DUVA 4LPCA 4AY1A 3W6LA 1UQYA 2R1MA 1X1ZA 4BI6A 3TSMA 3ARZA 1AMKA 1MXGA 4JIPA 1XSIA 2WK2A 3PJWA 3QGVA 3GIQA 3VKCA 1MEHA 2XN1A 1TG7A 4N42A 1Q3NA 3ZWSA 3NXFA 3LZ3A 1C9DA 4BR1A 1PWMA 2CCRA 1R8LA 3OGRA 3HPAA 1TRDA 1KRMA 3NSNA 3G1DA 1W5PA 3GIPA 3PUOA 1T6MA 4DLFA 2NWSA 4IP5A 7ENLA 1E9IA 1QNRA 5KEZA 3VX0A 1JGMA 2X7WA 2YZRA 1ISWA 3WQ5A 3SUUA 4X9SA 3R8GA 3ABOA 1VJZA 3AC0A 4J35A 2WMHA 4BI7A 1REQA 4K3ZA 2HWGA 1R0MA 3QC0A 3FW6A 4D72A 5A6BA 1ZGDA 1CIUA 3V3WA 3EB2A 1NAL1 2ADAA 1HP5A 1B9BA 4ADTA 1FXPA 5C70A 3CQJA 3WLHA 3W83A 3EX1A 3GHSA 1PKLA 4M80A 3NCOA 4J3WA 4LCSA 4JY9A 2J8GA 4EPEC 2WQDA 1A53A 3MKVA 5C7VA 4LVGA 3HPFA 2C91A 3EEGA 3UY7A 1OYCA 2ICSA 3SCTA 2H6RA 3Q65A 1EJVC 1RVKA 2BP1A 4HSNA 2IQTA 5CLWA 4YWIA 2FQIA 1G94A 3M47A 3GU9A 4CN1A 4LVFA 3KCJA 1P7TB 3IIVA 4C65A 3BMWA 2QUVA 4ZQRA 1F6KA 3OLGA 4YYFA 2YXOA 4J3TA 3I4KA 3UU0A 4MMWA 1EGMA 8CGTA 3PUEA 1HJWA 3DENA 3PNZA 4NY2A 2J27A 3QQ1A 2FYMA 1ECQA 1MXSA 4MYAA 1SSGA 1P0EA 1J0KA 4P7OA 3NA8A 4TUFA 1ISZA 2BMBA 4QIUA 4A22A 2ZDSA 2RHGA 3LM7A 4XAGA 1A5AA 3KP0A 1FP8A 2WHMA 1E72M 3CK5A 4QP0A 3BMXA 4W86A 4TX6A 3MVIA 1S3TC 4XAFA 2YB4A 4YCOA 3MI6A 3H12A 3U48A 4PTNA 3H26A 3MUY1 2NWRA 3KS6A 2I5QA 1W9XA 3SR7A 2RDXA 2W92A 2ZXBA 3W2NA 4XZIA 3E0IA 1QK0A 3G8EA 2GVEA 1NDVA 4XSMA 1SQ7A 2XH2A 4P7QA 2CNCA 1E4LA 3SCUA 1OT1A 3N9KA 1C90A 2GK1B 2YZ5A 3R0KA 4IUGA 3ZR4A 2R14A 4IIDA 2X1RA 3W7MA 5G4HC 2GQ9A 1K77A 3VOIA 2BB0A 3M0HA 2Q01A 3NO5A 3N4FA 1V6YA 3BLOA 3Q45A 1WO2A 3GM8A 5EGRA 5CJ5A 3FS2A 1UUOA 3FK4A 2EPLX 3KZPA 4I7VA 4PMUA 4WR3A 1H7XA 3GBDA 4C90A 4H9MA 1HJSA 4ZB0A 3LPGA 3RX2A 6ENLA 1F9CA 1SFJA 7REQB 4S23A 1G0CA 2EKCA 5BYWA 1VZWA 4IMDA 4LRTA 3NFUA 3WLOA 3S5SA 4IZGA 2F6UA 3KTXA 1X1OA 3VOFA 3QV6A 4MY8A 3GVVA 4UQEA 4Z2GA 4Y2WA 1XYMA 1XIGA 2W63A 4JQ4A 2Y5SA 4U10A 2C19A 2FJUB 4OBSA 3BO9A 3S6OA 2X1UA 3P93A 4FMVA 1P5BA 4GINA 1ME7A 1UG6A 1V5XA 2FGZA 2JFEX 3SY8A 3IVSA 3MMTA 3PTMA 1DXEA 4UFLA 1KCKA 3SURA 2PGFA 2YYUA 5EBUA 4CNPA 1IXQA 4P8UA 1DJWA 1PHQA 2FVMA 3MY9A 4Q4QA 4R7OA 4HZ7A 3W23A 2QJJA 4HD5A 3W7GA 1I2OA 3HQOA 1UR8A 5A8GA 3SGGA 3EGJA 4JTDA 1LZOA 3U2ZA 4YNGA 3VCRA 1KM4A 5AC8A 2YBUA 3EXSA 1DQXA 3KHJA 4GNKB 2V38A 1AODA 1LG1A 3MVTA 2B81A 5FJPA 2EO7A 7XIMA 3I7SA 4DUWA 1UR2A 1Q6CA 4KIEA 4MB5A 3TJLA 4DZAA 4IPJA 1KC7A 2DT0A 1YHTA 1ZFJA 1OFRA 4OFCA 3KRBA 2D0HA 2OO0A 2PURA 2VWSA 4PMOA 3RFAA 2VEPA 1S2AA 4ICNA 5HQEA 3R2GA 2VTFA 1CLKA 2G97A 3OBEA 1I4NA 3VZZA 2WC3A 2ANUA 4L4OA 1HKKA 4G56A 1T8XA 3PBUA 1UWIA 2HCVA 1EIBA 4ECLA 2G8ZA 3W7CA 3CHEA 1VCFA 2XIIA 2J25A 1JYXA 4DI8A 3M0XA 5FACA 3F2BA 3TSDA 5DN1A 2NVCA 2PLCA 3U57A 4ZE5A 4LC8A 4B4FA 2OOFA 4B4HA 4D6CA 2YJQA 1NWRA 4EANA 1UPPA 1RQHA 3BANA 3IARA 3T6CA 1K4HA 3W1RA 3NDYA 4MUPA 1I1XA 3RX3A 3JZUA 3NQMA 3EZ4A 2QDEA 5SWUA 4KWSA 2NVDA 1VFHA 3G22A 4IJBA 3KOYA 1UOZA 5D2TA 2W62A 1R47A 4FXJA 2YXXA 4JFSA 3IV3A 4B9ZA 3LCFA 3TYCA 4LV9A 2POZA 5AHIA 2D2HA 4R53A 3U9IA 1F05A 3M6DA 3O1NA 1W0MA 2QJHA 4V33A 4MB1A 3AYRA 4B2DA 2FIQA 3NSMA 3PBYA 1TPWA 4IF2A 4K8GA 3WL1A 1VF8A 3ES8A 4H6RA 2PA6A 2VUNA 1T41A 2WWCA 4C6CA 4C7GA 3KBMA 4F0KA 1XYLA 3EWCA 1MYRA 5A6JA 4QE1A 2VVSA 2Q8XA 4D6GA 1HO4A 4EACA 1RQEA 3A3XA 2WCAA 4UTKA 1XYAA 3MWAA 6PTDA 5JBEA 1WYIA 2PEVA 1BWKA 4PMXA 4XTDA 1FCUA 4Y8EA 3IRSA 2FZNA 1SR0A 2DZPA 4US5A 2ZWYA 1YQ2A 3WH8A 1UR1A 4CGTA 5HNRA 4NYYA 5I2UA 2ZXAA 1B90A 4NVTA 4RPQA 3PPCA 5CZ0A 4IUOA 4S2BA 2PRHA 4W5UA 1XLHA 1XKJA 4JIHA 4IXXA 4GBDA 3PP7A 4DY1A 4FNSA 3ATYA 1EYEA 4FP1A 3PC0A 5DQPA 5EMKA 2EEXA 3OZPA 4UTHA 1CDGA 3OYXA 2WXDM 3FXGA 4JKKA 5EL1A 4AYSA 1CBGA 2IPFA 5AYXA 3SCRA 3B0YA 3M7SA 1XDMA 2IKHA 3G2GA 3LQLA 3GH7A 1N8WA 1TWZA 4KESA 3VE9A 2QJGA 2ZA3A 4CD4A 1W1PA 1NOFA 2VFDA 1IE7C 1KCZA 5CZKA 3SCOA 3F4DA 1JAEA 1W3LA 1OVDA 2DDXA 3PF3A 2ZOXA 4MNKA 2RUSA 3TW7A 4E2VA 4BZYA 1M03A 2D73A 2QS8A 4IMCA 2FPTA 1R38A 1CLVA 3FVDA 3CH0A 4AVNA 1EXPA 1RH9A 4D8AA 5D2YA 2O7QA 4OOZA 5AECA 5HPOA 2V68A 1QHPA 3TQVA 4U2ZA 1QNSA 2WSYA 2ZX8A 1UR3M 2OT0A 4GJJA 4EWND 1EGVA 5A6MA 1EPVA 4X61A 2QNEA 3FSTA 2VRKA 3HFTA 1KFCA 3D3AA 3A3HA 2HMCA 1EFZA 4X2PA 4H4IA 4XZLX 4GUJA 3PB0A 5G4EA 4N9CA 1OX4A 2I5GA 4DWSB 5FSEC 4TVCA 3ECQA 3MMWA 3W70A 3BAXA 3SAZA 3IUHA 4Y9AA 4JTHA 1FDZA 3N4EA 5E6ZA 5FEWA 1U1JA 3GTHA 4O52A 3E0VA 1Q65A 3P0XA 4Z1BA 1K7EA 3G1YA 1RP8A 2MNRA 3AIEA 3BAYA 3MS8A 6REQA 3EWBX 3SSJA 5KETA 3L4VA 5I09A 1B1YA 3UZYA 4P8WA 3SUVA 3PBVA 5T9BG 5L9FA 2XYLA 2D3NA 4KGLA 4W7VA 2OZ3A 2J62A 3UZ5A 4GBUA 3L2IA 2DU2A 1XG3A 3NPVA 3VGEA 4GYFA 5I3KA 1KTCA 1NIUA 3H4GA 3E0FA 3FAWA 4JFVA 1HQTA 5D8ZA 4WY0A 3OLDA 3E0LA 2H9AB 1DIKA 2DZWA 1W9VA 5HNUA 1MQRA 1V3MA 3TMLA 4IIEA 1Q6QA 2IQ0A 1GQIA 3EB4A 2WCSA 3VOHA 4F2TA 3BOLA 4NHVA 3CYJA 3H7UA 1QPOA 1XH0A 2XIBA 2WMIA 5A8NA 1R3RA 3M0MA 3P82A 4WHBA 5IM51 4GRSA 2D2GA 3WBEA 1CPUA 2GJXA 4XV0A 2CBUA 4G7FA 3GWQA 2YYTA 1EKOA 2WPBA 5DBUA 2J47A 4Q4MA 4LF1A 3QTGA 1K7XA 2FFIA 3LXCA 2Z24A 4E4UA 3S3GA 1WA3A 4NAFA 1DE6A 1XH2A 3WMCA 1F8IA 4JX4A 1AW2A 4MUZA 1QW7A 2PDIA 4A3YA 1V3IA 3LMZA 1OHLA 4Z1AA 3V5OA 2E1DA 1QU4A 1N2VA 4LX4A 4QJ3B 3A22A 2Y89A 3MP3A 5H91A 3FJNA 2NUXA 4AD0A 3DOPA 1AH3A 2ALDA 1N8FA 2IS7A 4DJED 3SCQA 5HNNA 2PDUA 3NQ6A 5CEWA 1OCJA 1KCXA 3AJXA 1P43A 3HQPA 2GQ3A 4H7ZA 1LL6A 4FIRA 4WSJA 2BY3A 4I5UA 4UTIA 2YXGA 2O9OA 3LCIA 3M5YA 4ES4A 3CLMA 2J7HA 1PZ3A 2GVGA 3CZEA 4LF2A 2QVNA 4GFSA 2QJIA 2INFA 1O4UA 4DYKA 1NDZA 3PJXA 4GI6A 3Q4DA 3L9CA 4DM2A 3V36A 1AQHA 3KWXA 3W37A 4QROA 2W0UA 1DJNA 2FZBA 1KNWA 2DPEA 1JL8A 4C5ZA 1BSIA 4CNUA 1NARA 5D9MA 2IW0A 3F4VA 5FIPA 3AHZA 1FFQA 1R87A 4O19A 1TTJA 1HKVA 2G3MA 3UCCA 3GNRA 4AZIA 1HG3A 5A2BA 3TMQA 4M6PA 1GTHA 1EPXA 3MYOA 2Z1KA 3SB0A 1YIXA 2DVTA 2YFOA 3AFBA 3GXTA 1IYXA 3THAA 3VNLA 1LWHA 1AJ0A 2E8YA 3B06A 4A8NA 3GW3A 5HPCA 1H09A 3CH9A 1S2UA 1XGEA 3NQ7A 2VMFA 3CLWA 4ADUA 4S39A 4OU1A 3W7QA 1AQFA 1XIJA 1K7FA 1MUCA 4KW2A 4KH2A 1NWSA 3GC4A 3E12A 1XCXA 3AMDA 1XBZA 2PCQA 1S2WA 3NL3A 3UG5A 3S2LA 3MBDA 1KM2A 4LVBA 3INPA 1DORA 1IT7A 3VPLA 1V0NA 1BFNA 5CAHA 1UJQA 4C5YA 4R7JA 4WSHA 5BWFA 3TV8A 3K1GA 1SZEA 1UD8A 4K7VA 1H1YA 2F8QA 4ZEPA 2QV5A 4DYJA 3LRMA 1B4KA 1JPDX 2HS8A 3WQPA 3KHDA 1TJ0A 2QPUA 2Q8ZA 4PMNA 3C8FA 4PTVA 3CC1A 1B3XA 3C2VA 3LS9A 4PTWA 3M7WA 1OGSA 2DW6A 3GXDA 1OIMA 2A5HA 1RXOB 3WD1A 3U8GA 4J27A 2ODOA 4RPPA 3W25A 3W7EA 3GDTA 1QRQA 3MHFA 4H8NA 3QV9A 3BGJA 2ISWA 4EK7A 2ZVRA 1BD0A 4G6CA 4O14A 4EPBC 3M64A 2VGGA 4QS5A 1E0UA 1XRSA 3H6OA 3S1XA 1S2CA 3WQDA 1D8CA 2C1IA 3AWNA 3QZ6A 4UTTC 3CB8A 4MY1A 2DORA 1G69A 3HPZA 2DJXA 3OP2A 2O9PA 4H00A 4IMGA 2EPMX 4PE8A 4UMCA 3UZZA 1V3LA 4ZO8A 5G5IA 1G7VA 2GWGA 5LA1A 5HR7A 3FGCB 4NI8A 3MZNA 3GXFA 3OODA 3S2MA 1XC4A 3CMFA 3IAPA 4JIIX 1SGJA 4WOZA 4G2DA 5A5WA 1V03A 4NAEA 1FWFC 2E5CA 3GNPA 4AU0A 4MFDA 1XV8A 4DJFD 2CZFA 4I9MA 4ZO9A 1OCQA 3WNKA 2D20A 3FA5A 3ZFHA 2YA2A 3RM8A 1CENA 2GPTA 3EWXA 5FSDC 1W3KA 1QASA 3SY5A 4GX8A 1M3UA 3C3NA 4BCEA 2VQTA 2RFGA 1F3XA 1U22A 2XGIA 3CTLA 1U83A 2X1IA 1MZRA 2ON3A 2WBGA 3NQGA 4A2RA 1V3HA 2G96A 1HKWA 5GJMA 4M1BA 3UWEA 3M9YA 1K70A 4CN6A 4LUJA 4IP7A 3W7HA 4PB4A 1EDTA 1QK2A 4XTIA 1GYNA 3AO0A 5C6MA 3GHTA 6TAAA 3SGZA 2GQ8A 4GZIA 1H5YA 4CU7A 1JCMP 1MRQA 3I4EA 3VUSA 4GNVA 1TV7A 2CBVA 3TKFA 1HKMA 3EOEA 2AMXA 2Z6IA 3ELFA 4IQDA 4D1JA 3HGJA 2NXIA 5LA0A 1RPKA 4AY7A 4JTIA 4WSKA 3OW1A 2C8NA 4KQNA 3E2RA 2INZA 3AI0A 5F7UA 4HNNA 4GCAA 4GWEA 3VNZA 2O9RA 3RLHA 3DC0A 3P8JA 4O1FA 5FAJA 2QIIA 3HFYA 3T9PA 3TLLA 4AH7A 3UR8A 3MBFA 5A95A 2NXGA 2D0FA 1JJKA 3VMNA 3LI0A 3M16A 2VL4A 4GVIA 3W0KA 2PZNA 1E0XA 1JDCA 1ITXA 3A23A 4LXFA 3RLGA 1MEWA 3L4WA 3TZNA 1A47A 3GH4A 1UWUA 3NQFA 2Y6ZA 4HP5A 3WDHA 2QV4A 3R4IA 1E0WA 8RUCA 3A4AA 4LVAA 3M07A 2J9XA 3BJTA 2CC0A 1DEDA 1FKWA 4GISA 1J2BA 4ERAA 3F5LA 2VEFA 3B9DA 3SJ3A 2RAGA 4C6IA 3ABXA 3S6DA 3E49A 1HVXA 3V4BA 5XIAA 3PPFA 1XIEA 3I3DA 1FHDA 2ZFAA 4YYCA 4L1XA 1LUCA 3A4XA 3O07A 3EWDA 5TQLA 1WBHA 4NNBA 2E3ZA 4CVUA 2TMDA 1LLOA 1EJSC 3DHFA 1TX2A 2Z4GA 2HDJA 2C15A 1VIWA 1UKOA 1TWIA 4L1WA 1H50A 2PC8A 1XIBA 4DJDD 3CPUA 4MNLA 3V35A 2VM8A 1FWHC 4W7UA 2PWEA 5EMLA 2CYGA 2BZNA 5FJOA 2J88A 4LW7A 1XQLA 5HQMA 2MANA 5GVJA 3BLLA 2FTYA 4WVXA 2AL1A 4Q8PA 2BG5A 3N18A 2ZA1A 2I7GA 2QYGA 3D47A 5HUOA 1Y5VA 3QR3A 4FIQA 1MQPA 4B5VA 2GDQA 4DBWA 3E0WA 4PBGA 4ADSA 4MG4A 1FY6A 1WX0A 2Y7FA 3PNUA 4JEJA 2VDGA 3WLIA 4TX9A 3W7IA 3N15A 2CHRA 3RCNA 2NX1A 4A3RA 2VNCA 3BOXA 1QNOA 3W7OA 1GJPA 3O6CA 3VMPA 4AC7C 5CPSA 4AZCB 4NZFA 4HU8A 4WKHA 2F84A 1S2TA 4E4PA 1PX4A 3W1TA 3WJYA 4W4QA 3NQ2A 4LUTB 3HBLA 1HFBA 5CH9A 5CBIA 4RZ4A 4M24A 3URNA 3CWNA 3GNDA 3WLPA 2WVTA 1M7OA 4P61A 3QOKA 4R7WA 2W61A 3PJUA 2O56A 3HG4A 2C0HA 4AIEA 3T0DA 3TQKA 1S1PA 3IGSA 5IBXA 3PG8A 3QLLA 5EFDA 2QLYA 2CLEA 5HDRA 1UKSA 1XCWA 4FXSA 4XUGA 5CAKA 5HNTA 4BWLA 1JF5A 3TTSA 3ZJKA 3H22A 1EBGA 4W93A 4PCFA 1JAKA 3SN0A 4R88A 4B5WA 3N9RA 3OG3A 2RGMA 3EWYA 3ZLHA 1H1NA 5FF2A 4FA3A 3IJIA 1VHNA 1GT8A 2WHLA 5CPOA 5FKYA 3W27A 5K9CA 3P6LA 4E2OA 4AZ5A 3XINA 5J8LA 2X16A 2YBVA 5FEXA 3SUTA 5A6LA 4IOTA 3M5VA 4BY3A 5BROA 3UD6A 2QZRA 5D04C 5C2XA 3W6MA 2EJ1A 3V1HA 5EFFA 2XSBA 2OYMA 1I2PA 1X7FA 1YDVA 3IAQA 4LUIA 1ZP4A 2I9UA 4UQBA 3MCOA 1UC4A 1C92A 4JTFA 1RY8A 5FF3A 3UG3A 7TIMA 5I06A 3H7VA 4BQ2A 4BQ4A 1JUEA 4W5ZA 2A79A 1ADOA 1Q8AA 1XDJA 3KM8A 2DT1A 4Z1DA 3F1QA 1BXNA 2VFIA 3W7LA 1YTEA 1XL9A 5I5RA 2BDQA 1WKYA 4WOQA 3TYZA 2QDGA 4DXXA 3TJXA 4HMDA 2Y5EA 2CWNA 4CEUC 2Z00A 1LROA 5A8PA 4O18A 3CPGA 1K8XA 1NF0A 3WQVA 3VD9A 2PDFA 3L12A 2CLHA 2DSZA 1Q4NX 3A47A 5H1WA 3RK8A 3WN6A 1XYCA 4GO8A 1O60A 4JTCA 4P7LA 2QDDA 2H8ZA 5HANA 4LALA 3ZJ7A 4KCTA 2E1WA 4H9UA 2UZ9A 1G4TA 3G6MA 3VDBA 2X0YA 1VRXA 3C4UA 3ONCA 1D3CA 5DXYA 4PH6A 4LQ1A 1TA3B 1QPRA 4RK8A 4WX2A 1OB0A 4DWDA 5CZJA 1FWTA 5HA7A 3JR2A 1M5WA 5BOFA 3KP1A 3E1F1 3N6JA 4I9JA 2I1OA 4HK7A 3ARRA 2CXGA 1E55A 1U1HA 1GOQA 2Y24A 4H6KA 2OYKA 1QNVA 4ATWA 4AHQA 3ZS4A 1PAMA 3IACA 1H7RA 4O1BA 1YXCA 2G50A 1E6QM 1V0KA 1ZAIA 2Y1HA 3LY0A 1VIZA 1XBYA 4K38A 4WLCA 1M68A 1GVYA 4NX5A 1QO2A 3RRAA 1XC6A 4WKAA 4ATLA 2DEPA 4A8IA 3CAVA 3WD2A 1IHIA 1DE5A 3ZT6A 3ARPA 4O1EA 1FWWA 1XLMA 2GGEA 1Y7VA 1J2WA 3ENLA 4JHZA 4ORMA 5LHFA 2PTYA 1IR2A 4DZ5A 3IK2A 2VGFA 4RV8A 4RDVA 1C7TA 1SM9A 1SJCA 3V18A 3WDIA 1PDYA 1TPH1 3NAVA 4GMEA 4HA4A 5DMNA 3GU2A 2Y4SA 4IGNA 4NZ5A 2WBKA 3L5LA 3MANA 3RG6A 1XX1A 2INEA 1W9UA 2OQHA 5AB3A 4AIBA 4Z2KA 4XIMA 2E6YA 1KV8A 1V77A 1ZJBA 1IXPA 1G4SA 3TQPA 3MUXA 5AC4A 1DPMA 2HROA 4V2XA 5DBTA 2V67A 5MHBA 1UBSA 2QCMA 5A6AA 2ZWZA 2PS2A 1V3JA 5ABEA 4URIA 3AS0A 3C56A 5K4XA 4RL3A 1RK6A 1LQ0A 1ZALA 4ZO6A 1C3FA 5KMYA 3UPBA 1BXBA 2VEMA 3IJ7A 4D6IA 4JNZA 1PCKA 2REQB 1PTDA 2ZUTA 5DEZA 1B31A 1EH9A 4O0KA 2CU0A 3DYOA 1R85A 2WB5A 7TAAA 3F2DA 1QAPA 2H90A 2JF7A 3RN6A 3GS6A 2HPMA 1BTCA 4CD7A 2J7FA 3S1WA 4YTSA 2JBMA 4L1GA 2AAAA 4OHQA 3WD4A 1V51A 3OJGA 3WELA 1E15A 1UROA 2CITA 4DYEA 3B9AA 1G67A 1AUSL 1H4PA 3P60A 4FEZA 4IISA 3W86A 5EYWA 3KVMA 3BAKA 4DI9A 3GTNA 3LYEA 2PDMA 1XIMA 2WKGA 5FEZA 5M17A 1J5TA 9XIAA 2QEZA 2R8WA 4D6FA 1O66A 3I6EA 2VR5A 1KRCC 1GPWA 4TTGA 1UWRA 1WXJA 3NWRA 1SR9A 2I5IA 4H9YA 3B0UX 3W29A 2ZUUA 3OBKA 3ZR5A 3E96A 1UZ4A 4XD4A 4PGLA 3V0TA 1KBJA 2C1GA 2DT3A 4AWEA 4K2SA 1LORA 3MO4A 4RZ6A 4XB3A 1VLWA 1BVNP 4J9JA 4YHEA 1AQMA 2W79A 1ML1A 2Y70A 2YBTA 3H7RA 3KDNA 3A24A 1LOQA 3SW6A 4JYEA 2CHOA 5D09A 2X2GA 4DXVA 1IWAA 2WVVA 4HPXA 1GKPA 2ATSA 4TV5A 1C29A 1HP4A 2J6VA 3LCGA 1EO5A 3REQA 3WX7A 4MJ4A 3P5ZA 1RP9A 2PLMA 4Q4KA 4DO4A 4GGHA 5I3JA 4MNJA 3EA1A 2QJNA 4S3FA 5HMDA 2ZDRA 4AWSA 2X05A 4HA3A 2FGLA 2ZZ2A 1HW6A 2UWFA 2OODA 2WMKA 1GOOA 1SYTA 4ICCX 1PL9A 3WMBA 2A7PA 1BGGA 1VFFA 4C6DA 3PG9A 1NOUA 3S1VA 2G5WA 3KVLA 4AXKA 4M7SA 2B31A 3B8IA 3VZYA 4YLWA 4QCFA 1DWIM 4FALA 1UD3A 4UCFA 2H3BA 4MIMA 4BA0A 2DP3A 4TMCA 3VE7A 3AUOA 3BAJA 4ML9A 1CEOA 2ZZ1A 2QUMA 1EL3A 2GJPA 1J12A 3WLTA 5FESA 3CMGA 3VIMA 4XZNX 4UR7A 3CIXA 2R9RA 3DFNA 3PTQA 3EXTA 4REQB 2CBJA 2DZBA 2JGQA 3LCWA 1JZ6A 5E0KA 3F7JA 2GQAA 1JDAA 1JPMA 2V5JA 2DFAA 5FJUA 3HA1A 4AX7A 4I9AA 3PZ9A 3KBSA 3CYVA 4HK6A 3RITA 5H8PA 3W76A 2VOMA 4JQ3A 4FPSA 4HTYA 4UOJA 1R3TA 3VK5A 1JNDA 3BWWA 2PWFA 3HV8A 4RDYA 3H70A 2BVTA 3R0DA 1UH4A 1OGGA 4P8VA 1E56A 2PU1A 4DWSD 3TAOA 4K8EA 3K4WA 1KWKA 3LUTA 4DUOA 1EO7A 1NTHA 1HJQA 4NJHA 5DCBA 2Z2BA 3RMJA 4N6FA 1GKRA 3LEPA 3PBGA 2O4QA 1KFLA 4JS3A 1TV5A 3TH6A 4NSBA 1E1CA 4PUUA 1HKJA 2PDNA 3HG2A 1RSCA 3UXKA 4RE0A 3O15A 2G41A 4RCXA 2W66A 2G3IA 2HQAA 2ZC1A 1H1ZA 1U1UA 5JBFA 1OD8A 1Z9AA 3VNYA 2R82A 3ABRA 4EKJA 1DJYA 1W3HA 1JFXA 1ZCCA 3TYAA 3CV1A 1I8JA 1ZBWA 4TOQA 4E38A 1O1ZA 2W4XA 2CLKA 1CGXA 5I77A 1BTMA 2JKPA 1BHGA 8XIAA 1XLLA 4MB4A 4J2MA 4HVXA 3R43A 3WK0A 1VR6A 2J7CA 1VJSA 3KS5A 4F66A 3VOJA 4G1NA 4Q7NA 1I9CB 3GLCA 1US3A 4QLJA 2VO5A 3WNMA 4ONVA 1FWIC 3T0CA 1Z69A 1TUFA 3W2MA 1GUVA 1DYSA 1OG0A 5BXRA 5D2XA 1LT8A 1P48A 5H8UA 2BODX 2UY2A 2Z27A 1XIFA 5BU9A 1R3WA 1VEOA 5GPRA 3AU6A 2NT1A 5A2CA 1TPVA 4QLKA 4N9BA 1KGWA 2PF8A 3HJEA 3R25A 4NZ3A 1D9EA 3NZQA 4M7TA 1YLVA 2ZX7A 2W5FA 4W9TA 3LLDA 2J7BA 5I3IA 1WXZA 3B8DA 3B8WA 1V0LA 2X41A 1Q85A 1EJ7L 4IPNB 1ITQA 5HXMA 5J5DA 1XLDA 4ZOBA 3VIHA 4IP4A 3W1AA 1OQFA 1IXNA 3QR1A 4LGXA 3L4ZA 3LHTA 4LYKA 6REQB 3AOFA 3G1SA 3QMSA 2Q8LA 4C91A 2YCKX 1DJGA 2FZMA 3KLLA 1EB3A 2XISA 3FAXA 5J5RA 5EY5A 1A5BA 2NZLA 5I3FA 4L6HA 2WMGA 3B8TA 1Q2RA 4LS0A 4UFJA 2OX4A 2IXUA 3QGAC 3WUFA 5DY3A 3OTRA 3L5AA 5K9XA 4RNHA 1OFEA 4S3AA 3SEPA 3GG0A 4Q8OA 1H11A 3ARWA 2DSKA 3APGA 1VEMA 4WUIA 3KBVA 2LLEA 1TMLA 3NQCA 2OX1A 3O63A 1FXQA 1ONRA 1TREA 3EDFA 1UR0A 3TIMA 2FB3A 3SCSA 3K8MA 5FF4A 4HMNA 2VX6A 3FNDA 5IDIA 3Q94A 4PUJA 2OLHA 1P1XA 1U33A 1F07A 3B04A 3RILA 3QY7A 1U5JA 2V3DA 3CIWA 2VD9A 1J0YA 4Q8UA 3OGSA 5CGMA 4QRNA 3P7YA 2PDPA 3CL7A 3FN9A 4DAFA 3QY6A 4NAFB 1U2YA 3NL2A 2P76A 2BY0A 1VKFA 5JU6A 3LQGA 2ZC8A 3VNJA 3LXAA 1TR9A 1ZCOA 3UPWA 1HO1A 4CD5A 1PZ2A 3POCA 4PUMA 4HBKA 2V0TA 3S42A 1S5TA 4KCWA 4PMRA 1K9DA 4S3BA 1CX9A 4B92A 1UP0A 4WEVX 3UG4A 4F3HA 3C3UA 1C8XA 2J4GA 3U3HA 2VRJA 4D71A 2XH0A 4PB3A 4E3TA 4NI3A 1E6NA 3G8RA 1R46A 1UWQA 1SU5A 2OYLA 1QW8A 3ZR6A 4JQAA 3GVGA 1ZJAA 1OEPA 1JXKA 3OO2A 3N9SA 1YTDA 4YTRA 4YS1A 2DZAA 4E2BA 3T1GA 3K4AA 2Y61A 4FOKA 2OG9A 3DYMA 3V5FA 4CD8A 4CQCA 4XKYA 3TTYA 1TFVA 2L5HA 5TF0A 3W7KA 4DJEA 1AJ2A 2Y5JA 1TE1A 1TTPA 1E4NA 3W7JA 1GOKA 3EPMA 4W89A 2HISA 3N13A 1UP2A 1E73M 3WENA 1ISXA 1XD1A 2YIHA 3W1XA 3IPWA 4X0VA 5H8MA 3WLQA 1H7NA 3FA3A 4X0NA 5HAOA 3WDQA 4GIYA 1KD0A 4L6OA 4FR1A 3WLLA 3GVQA 1TPUA 1HL9A 3AHTA 4D1IA 5IXEA 1TWSA 1TTIA 1LG2A 2J8TA 4O0QA 1O6IA 3G6LA 4HOXA 3CUZA 4OECA 2NW0A 1OWQA 1GGOA 4M19A 1LP6A 4IQLA 2BFGA 9CGTA 1GEQA 1ODUA 4NU7A 4DPPA 4YCPA 3DG7A 3CO8A 3RCYA 3SRKA 6XIMA 1GOIA 2QMJA 2PRLA 3CWOX 5E09A 3P74A 3MP4A 1ZZMA 1X98A 3QF0A 1KQZA 2PODA 5FJTA 4MDPA 1Z6KA 4XKMA 5FA5A 3WDPP 3N2TA 3UG8A 3VD5A 1DJXA 1KO0A 4C6QA 1LBMA 3QBUA 1W9BM 2TRSA 2GL5A 3C2FA 5LHEA 1SO3A 1YNPA 3DECA 2GWNA 3ZIZA 5BW6A 3BAIA 1EJWC 1JFHA 1TZ7A 4GACA 2GJLA 2HJPA 3FIGA 2UV8G 1IEVA 2P50A 5C8BB 3NPXA 3NZRA 1KKRA 2C18A 3MDUA 1V4YA 4E2DA 3TN5A 2YLLA 3L0NA 1FKXA 5TNVA 3I7RA 4HJWA 1FBAA 2XVGA 3GG8A 2PP3A 3LB0A 2PDKA 2QCCA 2J8FA 1XRFA 2J7DA 1K9EA 3U7BA 3H2CA 4M1RA 1J0JA 2I14A 4EIVA 3EXRA 3NDZA 2DSVA 1V6WA 2NX3A 2POTA 3SDOA 1W2VA 5I03A 3BQ5A 1MVYA 5LYRA 1Y65A 4F0LA 1XYFA 2ZRXA 4DZHA 3U2EA 3UF9A 5HJXA 4H01A 3WG6A 1AQ0A 3ITOA 5GNXA 4PZVA 4J28A 3VD4A 1HT6A 1M9HA 2EGZA 5LIKX 1AD4A 1NJJA 4A3HA 3AZRA 1SZNA 2A3BA 2VD8A 3W7RA 1Y8BA 3WD3A 3WQ6A 1IIGA 3QV7A 5DT7A 2J9YA 4QE4A 3VGBA 2KAUC 5ECUA 3W81A 5G2WA 1BQCA 3C5QA 4NIRA 4NAEB 1OJXA 2E6FA 3EBVA 3VKDA 3RNDA 1DQWA 2ZUVA 3WD0A 1KR0A 4YVXA 4Q6JA 2VZUA 4Q4RA 1F3EA 1WOAA 1TJRA 2P3ZA 4XZBA 1DTNA 1XICA 1VFSA 3UBPC 2UY4A 2F2KA 2V5DA 1KFBA 4HNCA 4GUHA 4J1OA 4HZMA 2GGHA 4O1CA 5JIPA 1VENA 3PULA 1OFDA 5A94A 3IV8A 3NYDA 2G3NA 3LI1A 2GGJA 3OEXA 3AYTA 3DFTA 3S9ZA 2VDIA 5A8QA 1S5MA 2G4FA 4V15A 1TQJA 3GYCA 3K5XA 1LRQA 3S1GA 4UTWC 5M3WA 3Q37A 3I6RA 5I3HA 3GH5A 3LV6A 1AZ1A 1ONXA 2V30A 3FOKA 2OGJA 2DZSA 3WEZA 4AY8A 4I6KA 4DJFA 4NRSA 3PZTA 1TMQA 2PB1A 3UGRA 1EJXC 2ZRWA 3EX4A 2QGYA 3EEZA 1R3VA 5D05A 4IQEA 1RK5A 2QQ6A 4JTEA 3O06A 3S8HA 1XM3A 2EHHA 3AU2A 2QCDA 1W31A 2JGYA 2XM1A 1G4EA 5DF0A 3ANYA 3LTPA 1FFRA 1WCGA 3IJQA 5CG0A 4MJZA 2FDMA 4HNUA 5CZSA 4UQDA 1EA0A 2A6LA 3ZVIA 1KWGA 1E6RA 1O94A 4H3DA 2OSYA 1EP1A 4W7WA 5F2GA 2Y0FA 2F9RA 4ICMA 2XJ7A 4OT7A 4GABA 4RXGA 4BQ3A 2QW5A 3NGJA 4GX9A 4AEFA 2WM0A 5CSUA 1V7AA 4YTQA 2B7OA 4AD4A 4IG2B 2DSUA 1QO5A 4NASA 2ISVA 3TTOA 1PYFA 3VGGA 4O50A 4MPKA 3BLEA 4GIRA 3M0IA 1CYGA 1LUCB 5I79A 1PBGA 2W6RA 3GG7A 4EXBA 1WDRA 2NT0A 3VIGA 2ISDA 2VGBA 5K7JA 4YL2A 1O95A 4M6QA 1U5HA 4QAIA 4JZ5A 5DCDA 2Z7GA 3TXVA 4GYPA 2W27A 2HE5A 3TN3A 1VH7A 4XBSA 4CU8A 1I2QA 4GGBA 3MMUA 3EDKA 5AZ0A 3MI3A 4MM1A 3ITYA 4XIAA 4H9XA 1G9HA 2Y62A 1PWLA 3S9YA 1R86A 3I3BA 3NQDA 1BGAA 1W1IE 4FSAA 4C6PA 4B5TA 4GXPA 2TYSA 3BG9A 4O17A 4ACZB 1X97A 3PK7A 2P8CA 2Y85A 4DJDA 3W72A 1XUUA 1OM0A 3S5YA 2QULA 1EHAA 1C7SA 1LBLA 1ONWA 3EX6A 3LGGA 3ALGA 1UR9A 3VKBA 1KBKA 3I68A 3QYQA 3FLUA 2XM2A 3QPYA 1A4LA 3B8SA 4FR6A 3QSTA 2V9DA 1DXFA 4A6GA 1FCVA 4NRRA 1K8YA 2A3CA 3WLJA 5JBDA 4E8DA 4QS6A 1OX5A 3PR2A 1KTBA 4PUDA 2OOGA 4PUNA 3SQLA 3HB9A 4BEUA 5AN7A 1QBBA 5FJIA 1GOWA 4D2JA 1XINA 1FHVA 1F61A 1J9YA 4DEFA 3QLDA 3BXWA 1W3TA 3AMGA 5J04A 2Z25A 4XAZA 1US2A 1KCLA 4AC1X 1B54A 7ODCA 1W91A 1I1WA 3STPA 4U33A 5CPTA 2CBIA 1W8GA 4Y8FA 1A80A 2FTWA 2C79A 1G1YA 5D9OA 5LIYX 2EPNA 3AYSA 3MWCA 5C2GA 1WDQA 1Q6GA 1RD6A 3DG6A 3GTFA 3NPUA 1WAUA 4LV4A 2V2HA 4V1XA 3TYUA 3TC7A 3A3WA 2VKZG 1GZJA 4ZR8A 3O6YX 4AWUA 5L6UA 1J0ZA 3N14A 5A69A 3EDDA 3W7DA 2XVKA 3LD5A 4DWSC 1WDSA 5A6TC 1IZJA 1PO9A 4IGHA 4CQDA 2V2CA 2DW7A 3AIBA 4JFUA 3Q2DA 2IKGA 3A4WA 3I65A 2ZTKA 4S3DA 1ZUAX 4QXIA 5BWAA 4LYQA 2GSEA 4EVZA 4FHAA 4RV3A 3NQEA 1B3WA 1L8PA 5DANA 1ICSA 1VBJA 4PMQA 3W02A 3AHYA 1VB9A 1ENUA 1CB2A 2AMGA 1Z89A 4QGCA 3STFA 2B4GA 2EJAA 3H8AA 2WSKA 4Z0SA 3M41A 2X42A 1LDCA 3ATZA 1YBQA 5C9RA 1M65A 3KL5A 1EXBA 4RW5A 3QJAA 1NQ6A 3NEHA 3T08A 4PRRA 2E4TA 2DUXA 1PB0A 4JHOA 3Q67A 1YTKA 1PS9A 2V81A 2WW5A 4B16A 2A6NA 3QPEA 1XD0A 3FYOA 3ZJ8A 1XSKA 1PEZA 4UQ9A 5LIWX 4JDYA 1IXOA 1YE4A 1EHNA 3UWUA 3WCZA 4KF1A 2Q3RA 1UZDA 3BUVA 5I3GA 4BF7A 3EB3A 2FFCA 4QEEA 1B5TA 1PXGA 4FB7A 3APTA 3ZSTA 5JUVA 1SPQA 3VU2A 1C91A 1Q4WA 3AJ7A 1DJHA 3LA4A 2Y8KA 2HVNA 2V3FA 3ZJ6A 4F40A 1DV7A 2ZZ4A 1AW5A 1X6LA 4ZQMA 5HULA 1W1VA 3P62A 4QNEA 4H1ZA 1M7XA 2HV5A 2X0SA 1Q7ZA 2CPUA 4TXEA 3AMKA 4QDPA 2RDTA 1R3QA 2OWCA 3O9NA 4O28A 3E74A 3CM4A 3AXXA 3GR8A 1L6WA 1OABA 2CLOA 2ZUNA 3SQSA 4LJ3A 1HVQA 3C0LA 1CGWA 1GQNA 3VIKA 3AS1A 4GJ1A 2E9MA 3R58A 1UWTA 7REQA 3B97A 3C2OA 1XPYA 2FGBA 3UYCA 5CG7A 4IMEA 1HTIA 3CO4A 4DQWA 2YL8A 5F2IA 3A21A 1Q45A 3WEMA 1ZAJA 2XFYA 2YCIX 3FEQA 1DTUA 1V8EA 5D9PA 3TXZA 3H55A 2OR2A 1E70M 3LHYA 3HTWA 2R94A 3DG3A 1X39A 3BW2A 4HZ8A 5CPNA 2YW3A 1W3NA 5M03A 2O92A 2A85A 4YPJA 2VZOA 3OYZA 3ARTA 3VIOA 1H2JA 4RJEA 1JPHA 3VO0A 2Z1VA 3H2NA 3HZ3A 2PTDA 3CUGA 3FYPA 4H2CA 5D02A 1BKSA 1XHGA 2E8ZA 1OGBA 1XS2A 1BWLA 2DH2A 3WMLA 1X6NA 3UXAA 3THDA 4NQ1A 1SZFA 1EOMA 3PZQA 3WQEA 3AXHA 3HGRA 2VC5A 3WIJA 2ACSA 4MJ2A 2FLIA 1OC5A 2NSXA 2QF8A 3VC6A 1E9YB 3UCQA 1Q6EA 3SECA 4GG9A 3EWZA 4CNSA 3M43A 3EWUA 1XCFA 2VENA 3R10A 3CWHA 4HOZA 1RA5A 4U3CA 1BEUA 4RLIA 2WZEA 1WZKA 3WK3A 1YEYA 4E3VA 1WDPA 3CEUA 4J3UA 1NELA 4NNCA 1DJZA 1H63A 5U7SA 3C52A 2OU4A 1OINA 4Z2JA 3B0PA 4GYKA 3CQHA 1J4EA 5M5DA 2QVHA 2ZZ3A 3K13A 2OSXA 1EF3A 1DHKA 3RLUA 3V75A 3CUXA 2F38A 3H24A 3SN4A 5ABHA 4UTFA 1LWJA 2YW4A 3TYBA 4XD5A 1TV4A 2EG7A 3ZQ9A 3RPTA 4PTMA 3BSGA 4CU6A 3GUWA 5CPMA 3WO8A 4QG6A 2ZVIA 5C54A 3OVPA 4LH8A 5CLTA 4ZMGA 1AL7A 5F2MA 5C9UA 1NQKA 1TKKA 2TAAA 1XP3A 3QHMA 1F73A 2TPSA 4I5RA 3SM0A 1ZY9A 2OZ8A 1XPGA 3H21A 4MWAC 2JK2A 4LNYA 3WBYA 3USBA 4HPGA 3CZKA 1B9ZA 1NVMA 5AYBA 1A5MC 4KBXA 3RM9A 1R9ZA 1KBBA 1EGZA 2HNEA 3SUSA 4H9VA 4JCMA 1EP3A 1VCGA 5LSMA 4F9JA 3AIUA 4HCLA 1JZ4A 1GHRA 1Q66A 1KLYA 4GZJA 2NV2A 3S5OA 3M0ZA 1IWPA 4R9OA 1OD0A 1R7OA 5CC7A 4G9PA 3L0KA 4H6QA 2ATMA 3WK1A 3TOYA 2B7PA 1FWBC 2NQZA 2PDBA 1LLZA 3BARA 3IS4A 5HWJA 4FX8A 3ZZ1A 1KA9F 1L2UA 3REQB 3SCVA 2QCLA 1NFGA 1ZL1A 4JIQA 4Q8TA 2ABAA 1SUXA 4QSHA 4JOMA 2X8RA 2GVLA 4PEKA 3HF3A 3MC5A 3AHXA 1G5AA 3AIQA 2X40A 4GHRA 1QI0A 1UUQA 4GIAA 4MGGA 4O4VA 4DXKA 5CQ1A 4D6EA 4JTJA 2YKKA 3EOLA 4F8XA 1ECEA 3MSYA 3B05A 1XLKA 3MKKA 1RBLA 3GXIA 4MTVA 3CNYA 3HMJG 2I16A 2XVLA 5AHMA 1W1ZA 1OIFA 5LNUA 3NL6A 3VKJA 2GJNA 3S83A 1W1A1 4K6AA 2OJPA 4O11A 3VGFA 3JZEA 4LOCA 4AW7A 1W1B1 2GOKA 4Z2HA 4QAWA 1O5QA 1PZ0A 3S0CA 4M6UA 3HGOA 3QM3A 4Y7EA 2PWDA 4FZIA 1C8QA 3AXKA 3WNPA 3P3BA 2CXEA 4WDWA 3WQWA 4DNMA 3VIFA 5RUBA 5F4XA 3GBEA 2PU0A 1D3GA 1DIOA 3B8VA 1Z7AA 3S2CA 3T44A 4BEQA 2Z28A 5AFDA 2YL6A 3UXLA 3LGEA 1JULA 3BURA 2VCCA 2WWDA 1K4GA 1RD5A 1Z44A 3FVMA 1WPCA 3LRKA 4GA8A 3RXZA 1UMLA 3BCJA 1QMLA 1FTXA 1XLJA 3NOEA 3T81A 3CS2A 1T8QA 4OBRA 2ZUWA 2D3LA 4UR9A 4ZCWA 1VPYA 2E0PA 4IFKA 1OADA 3ITLA 1OYAA 5AY7A 3MJYA 5B80A 4B3KA 1P0BA 4HHPA 2JF6A 2C1HA 5F2LA 4DO5A 1K9TA 5TIMA 3L4YA 2P3EA 3K4DA 3IJ8A 4GUFA 3RRXA 1LT7A 2VFFA 3G0XA 2W91A 1P0DA 3ARSA 3VIIA 1O68A 3T7VA 2ZUMA 1O5RA 1OCNA 3PTDA 4U2YA 1XLFA 4M29A 3ITCA 2PTXA 3W1LA 4A8RA 1TELA 1BYAA 1KTNA 2YLAA 1UKQA 5EB8A 4CEXC 3WJWA 2ONEA 5CJMA 3ZLFA 2VX4A 2CZDA 3WZ0E 3UVIA 4RDWA 4L6DA 2BV9A 4L64A 2WQPA 3HU7A 3GY1A 4JIRA 3UWWA 2BGQA 4H83A 1Q6FA 1UD6A 2X1SA 3M46A 3DGRA 4IICA 3DBNA 3IGXA 2A7NA 3CB3A 1YADA 1A49A 1TWWA 1OFOA 3A64A 3AXIA 1SO5A 1TVNA 2Z6JA 1J5SA 1FRBA 4AXNA 5K9DA 3W1MA 1X7IA 5CPLA 5DCEA 2I56A 3RX4A 2Z1WA 1R5YA 2D23A 3GDLA 1VS1A 3ITTA 4RKAA 1VEPA 1CW2A 3FEMA 4Z17A 5GNYA 2OMAA 4MZ1A 4H7VA 2AQVA 1WQ5A 3UA3A 1V7YA 4OQVA 4UQCA 4W84A 3VIPA 4TIMA 3PWIA 4GH3A 3EWWA 4MPQA 3UY8A 2R1NA 5FF0A 1G7UA 4JFWA 3PPGA 3LDVA 4TTUA 1J11A 1PKYA 3KXQA 1VFUA 3GNNA 1UD4A 3BGGA 2J77A 5EU9A 4WKFA 2X30A 4KWUA 4XX6A 3OQ8A 2XFWA 2QCGA 4S3EA 4I5XA 3EKZA 2DVUA 3WQ4A 3FX4A 1MEIA 2G37A 3DN5A 1SW0A 5KZEA 1GVFA 1V6XA 4WDUA 3KRSA 5E0FA 4ZBCA 4PMDA 3DFOA 5FJRA 5MKGA 5FL1A 3GNXA 1QI3A 4PCSA 4CKQA 2VELA 2QUUA 3PN8A 2EAWA 3PWGA 4ALDA 3BVJA 1UR4A 3W3OA 2PAJA 1CNVA 4KEUA 4PUEA 5HINA 3CHVA 5FJJA 4F2UA 1ZS2A 4J3VA 1KM3A 1HJUA 3RUBL 3TTQA 1GW9A 1DWHM 4PMVA 3JW7A 3FSUA 4Z08A 2NX9A 4PYSA 1LRTA 1GQLA 3FJ6A 2PWHA 3R79A 4HU4A 3S2JA 2CLMA 4ZSUA 1XRVA 3GG1A 1XGDA 1FH8A 2R1LA 3LHZA 2AGKA 4NXSA 4S3JA 4B3LA 4MFEA 3OOQA 5DXXA 4AB4A 3KBNA 1GVIA 3QVQA 1PIFA 3ZT7A 1JIBA 3LMYA 3KE0A 4RR4A 2GSHA 2AL2A 3R12A 4MYXA 4A3QA 3PUGA 1ISYA 3ARXA 4MADA 3L4TA 1CB7B 4AG0A 1VBUA 2JE8A 2D22A 3KDOA 1H61A 2ZRZA 3E02A 3U2OA 4OZOA 1QNQA 1GVSA 4GQRA 4KS0A 2PDJA 2E7FA 2YDAA 2YCJA 2FHCA 4J3XA 3W26A 1KBIA 3TR9A 4GQGA 1FUYA 4TU1A 3UJSA 4A35A 1CXEA 2FPVA 5B7YA 1WDWA 3O16A 2NV1A 4K68A 2HS6A 3C0QA 1PTAA 5F4SA 3HGSA 2V5KA 4M3PA 2DGAA 2TODA 4AF0B 1LYXA 3GR4A 4LSBA 2E28A 1V02E 3SI9A 4LYPA 2D1ZA 4K1WA 1DIEA 1GPFA 3QRHA 3WYZA 2BTMA 4HNLA 2PRMA 3O6DA 2DJLA 4RE3A 2HNHA 1YW1A 5D2WA 2DUZA 3P14A 4PEEA 1JYVA 1AW1A 1PJ9A 1F3TA 1WV2A 2ZZ5A 5C71A 3T4WA 5CCZA 4XZWA 3PFMA 3PY2A 2NV9A 3MJMA 3MSDA 1BG9A 2A21A 4PSRA 4NJIA 3I3EA 1E4IA 4GXMA 3CT7A 5EA9A 4JNYA 4DB7A 5H6HA 1PIIA 2FKPA 1GNXA 4RE2A 3SADA 3K8KA 3SO7A 1XI3A 1JCLA 1W32A 4XQ6A 1ZTVA 1EWEA 1R2SA 1UA3A 3PZOA 4W8LA 3CTTA 2YDRA 3AIRA 4FF5A 4TR9A 3RR1A 3CQKA 3VD3A 4OWGA 3MQTA 5A8OA 3LERA 3K1DA 2WO5A 1XWYA 3GSMA 4AHPA 1CLXA 3HPSA 3VAVA 1EC8A 2PDLA 3BPWA 1EF2A 3GR7A 4KEZA 4PTDA 3PSWA 2EQDA 3SCWA 3GW0A 5CBJA 3QHOA 1H0GA 2XUCA 3GZAA 5D4YA 4C6FA 3MYPA 3MB9A 2VFGA 1GYLA 1A5UA 1S46A 3QTPA 4IH3A 1J0HA 3STCA 1VFLA 1W8SA 3STGA 3L0GA 4M82A 4YMZA 2ACUA 2HK0A 1E9ZB 3LOTA 4AAJA 4DPQA 4H8UA 1JGIA 1MWOA 1BRLB 4XAPA 2VCAA 3TK7A 3W75A 1PPIA 2Q09A 1UHVA 3B0XA 1EZ2A 2NQ5A 5DO8A 4CCEA 5A2AA 5GQBA 4NUWA 1K8CA 4LS1A 2DZTA 3QZEA 1Q13A 4WJ8A 4ZQCA 3WBAA 1KFEA 1KR1A 1E43A 4LAKA 4PCPA 4H19A 1K9FA 1D7KA 9RUBA 2PMQA 3XIMA 3FA4A 4S1FA 1YXYA 1V08A 3TFCA 5KINA 5AZ1A 1H41A 3MZ2A 4GI4A 3NDOA 4KWOA 4NZ1A 3IJDA 1DOSA 1UW9A 3WQ8A 1GZGA 3T2OA 3GHRA 2CLIA 3UT0A 4P2VA 1DJQA 4QJ5B 4H7CA 4Y9NA 1DL3A 5I00A 4KERA 3L68A 3TFXA 1JCJA 3EDJA 4PBFA 2I57A 2QJMA 4GY1A 3TNOA 1E6SM 3N2MA 1ITUA 3N73A 4OOUA 3T55A 1G01A 2XN2A 3W88A 1GG1A 4FNUA 1MW2A 2VZTA 1J93A 3QEZA 3TLQA 1JZ3A 5LIXX 2WMFA 1BSLA 4IHCA 3VA8A 4LFYA 3L21A 1XBXA 4LT9A 2E40A 1E6XM 1MW0A 2YA1A 3GIYA 4XO7A 4YU1A 3SSZA 3L4UA 1WKEA 3G0UA 4MLJA 4CNNA 4KRUA 1O5XA 3ME3A 1TZ9A 1LL4A 4MWAB 1V02A 1TE6A 4KRZA 2C0AA 1NU5A 1J96A 1AG1O 2XVNA 4A4AA 3HO8A 3PZVA 3L5MA 4NT0A 1GONA 2QCDB 3BW3A 1IQ8A 2Q6ZA 1VLIA 1IWBA 2IPGA 3LM3A 1JYWA 2DH3A 1JRBA 1X38A 2WC7A 3AZTA 3M44A 1I6NA 1OFBA 2FTPA 2NQLA 4WQ6A 1I2NA 2P8BA 1YXDA 3JRKA