5CPRB

The novel suv4-20 inhibitor a-196 verifies a role for epigenetics in genomic integrity
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
263
structure length
232
Chain Sequence
MSAKELCENDDLATSLVLDPYLGFQTHKMNRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SUV420H1
publication title The SUV4-20 inhibitor A-196 verifies a role for epigenetics in genomic integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 232
sequence length 263
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5cprB01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5cprB02
3KMAA 4YNPA 3M58A 3OOIA 5LSZA 5F6KC 3VV0A 3QWVA 3PDNA 4J83A 4YPAA 4YPEA 5CCLA 3M57A 5TTFA 2IGQA 3MO5A 2F69A 4LDGA 3QWPA 3DB5A 3F9YA 3CBMA 4C1QA 4E47A 1MVHA 3RQ4A 4QEPA 3F9ZA 5F59A 5KJKA 4RZ0A 3RJWA 3S7BA 4J7FA 3OXFA 2BQZA 4MI5A 3RIBA 1O9SA 3OXGA 5JINA 5F6LA 3KMJA 3VUZA 3M56A 3TG5A 3MO2A 2RFIA 3IHXA 3EP0A 4I51A 3OPEA 4JLGA 3SW9A 4AU7A 3S8PA 3RU0A 1ML9A 3CBPA 3HNAA 3S7DA 2O8JA 1H3IA 2G46A 2QPWA 4J8OA 3QWWA 1MT6A 4NJ5A 1N6AA 5KJNA 3N71A 3M55A 3S7JA 5LSXA 5EG2A 1N6CA 1XQHA 4QENA 5TEGA 1MVXA 3RAYA 3MEKA 5HQ8A 4H12A 1N3JA 1ZKKA 5EX3A 5T5GA 2W5ZA 5JIYA 5TH7A 5JJ0A 3M54A 3K5KA 2W5YA 4Z4PA 5AYFA 4YPUA 5HI7A 5CCMA 4YNMA 5F5EA 3M53A 5ARFA 3F9WA 1MUFA 5JHNA 4BUPA 3M59A 5T0KA 3DALA 5CPRB 4MI0A 4NVQA 1PEGA 5EX0A 4O30A 3BO5A 3FPDA 3CBOA 5KJMA 3OS5A 3TG4A 5KJLA 4FMUA 4O6FA 4J7IA 3F9XA 2JV0A 4IJ8A 4QEOA 4IJDA 3S7FA 2R3AA 4WUYA 3M5AA 4YNDA 3SWCA 3OXLA 3MO0A 5T0MA 3KMTA 5ARGA 4JDSA
chains in the Genus database with same CATH superfamily
3BC8A 4CGZA 1ZRFA 5DM6F 2VKHA 4C3IJ 3QWVA 3H9GA 5CVUA 5IT3A 4FETA 1UZCA 4RAFA 4NC6A 4PDKA 4E7KA 2GBYA 2IW5A 4JX6A 3FF5A 3LFKA 3S2WA 4C1QA 3RPUD 3GZ5A 4YFKF 2CW7A 2ZJPF 4YG2F 2VL8A 3TGNA 4NBQA 4G7OF 3TL4X 3EUHC 2K5CA 2NS0A 5HLTA 2PMZN 1KQ9A 2K02A 1H88C 3A2KA 3V7CA 4XQFA 4OAYA 1ZKGA 2UZKA 1U5TC 5TJJA 1K79A 1AKHB 1MGTA 2F48A 3ZQHA 4BBSJ 2BOLA 4KICA 3A01A 2G0EA 2A07F 3ABKH 5FD5A 2IJLA 1HW2A 1XSDA 1TWFJ 3C2BA 3JR9A 1YIOA 2O8JA 3J81Z 1X3ZB 5L3EA 2W85A 4UVBA 5IOZA 1QBJA 2BHYA 2IEKA 2NVYJ 1I3QJ 5FLVA 1J7KA 5HLGA 1ZAOA 3BJAA 3SXYA 1XC5A 4R79A 1YYVA 1X1BA 1BM9A 3PUFA 5J40A 1VQPI 2F4OB 2DA3A 2XF6A 4EV0A 3E5XA 4HF1A 4ANJA 3K10A 1BC8C 4C3HJ 3NWSA 4EM0B 5FRNA 2XSDC 2JA7J 3CZ6A 1TNSA 4ZDOA 3SEZA 3GTLJ 2D1HA 3DTKA 1BJZA 3PIPF 2R92J 1ZKKA 3UNGC 5AIQA 3ZRGA 5DV5A 2K9NA 1CQTA 2DMQA 2HWVA 3IWFA 4W97A 1FNNA 2VQHA 1OYIA 2KL4A 3I53A 3SZTA 3K0LA 1CGPA 2CYYA 5J4YA 4CSWA 2LLKA 3HIFA 5H2FC 1WJEA 1HDDC 2JK3A 5CVIA 2CWEA 2BVMA 2ELKA 4G9YA 5D5UB 4RAGA 2B63J 3PNYA 2VLAA 5FO5A 2HTJA 1R71A 2WADA 5JHNA 3TP0A 3DALA 1WRJA 3W2AA 4M9SA 3ASOH 4LLNA 3FM3A 4DBRA 2V1NA 5KJMA 3E1SA 4E7HA 3DU6A 2E7WA 4I02A 2BVLA 4J7IA 2GWRA 2CO5A 2L01A 2CQXA 5J1UA 2BYVE 3HTSB 5FLXK 2VKDA 2HXOA 3G6EI 1HA8A 2BGCA 4EJUA 1GUUA 4YNPA 5IP9J 1R6RA 5F6KC 1UHMA 1Y0UA 5E8GA 1GVJA 2O7OA 1PP8F 4LLGF 2UWMA 2OPTA 4AVPA 5FJ8J 4DBQA 2M8GX 3I0TA 1PJRA 2DFEA 2GXGA 2EV6A 1SAXA 1RI7A 2Y0MA 2DA4A 2DW4A 1USTA 3BR0A 2DPDA 2VUMJ 5CVRA 3DFGA 4ON0A 3AFHA 2K86A 3VSLA 3WGGA 4C3JJ 1E3OC 4EJTA 2Z2SB 5E3LA 4FX4A 3U9GA 2LD5A 5B3SH 4KA4A 2FX0A 1D1BA 5EZGA 5F6LA 5D6EA 1W7PA 1YFHA 2F6CA 4PJ0C 1CF7A 3AG1H 4ESFA 2KQRA 1ZH5A 1RIOH 1B8IA 2DMUA 3FX3A 3NQOA 1IUYA 1D5YA 3S8PA 1REPC 4IHXA 3ABTA 1LPQA 1DGRM 1JT6A 3CDIA 4I0BA 5F1RA 3HOZJ 3PQJA 3S1MJ 2CV2A 4JX4A 4XLCA 2K3FA 2E2HJ 1FT9A 4P96A 4F52A 3FXLA 1WVRA 5CVJA 4BE1A 3BTLA 1Y8QB 3Q9SA 2R5YB 1LFUP 2DMTA 2JWTA 2DPUA 3HOXJ 2QQ9A 3HOTA 3DBHB 1X3WB 3IC7A 1GV2A 2WY7Q 3IH3A 3QYBA 1T8IA 2QGUA 3ZQCA 3BWGA 3B02A 4O3MA 3MEKA 1MMGA 3KP7A 3ESWB 2DT5A 2W84A 2KDOA 1I6XA 3F8NA 2LTPA 4LK1F 3BG5A 4GDFA 2Z1DA 4PUSA 2V9PA 1OMIA 2VN2A 4U7BA 4Z4PA 4H0EA 2X1CA 3LA3A 2R7FA 4DYQA 3LNQA 1MMSA 3FXUA 3K2ZA 3L2UA 4HSRA 2YPRA 3HJEA 3VPRA 2ESNA 2KPMA 1Y8RB 1D1AA 2K9LA 2OZ6A 3ZMDA 5GTIC 4ESBA 1BIAA 3W6VA 4PJJA 4FE7A 1PEGA 3HHGA 3CMMA 4IOCF 2RQQA 5J8FA 2HOEA 4HW0A 3LQQA 2R0QC 3IHUA 4ENKA 1XMKA 3CMYA 2WY8Q 4FMUA 2ECCA 1B9MA 4YELA 3JW4A 4IJ8A 4F55A 4QEOA 4PFOA 2XVCA 2LYCA 4B48A 2R4GA 4V19K 1GV5A 5T0MA 3OYEA 2FQ4A 2M8EA 2QYOA 4A3KJ 1U2WA 3BCAA 5GAHJ 4E7JA 3TW7A 1Z0XA 2DDAA 1H9TA 1J59A 3CBMA 1MVHA 4HLXA 3TDZC 4DJAA 2DA1A 3VYTB 2BW3A 1IN6A 4D5CA 4L9TA 1XB4A 5FLXZ 3HOUJ 2W4SA 3HZJA 4UV8A 2BQZA 1TWHJ 1QZYA 2I8DA 4C9YA 2YUSA 3T0YA 3H3ZA 1YJ9I 1Z6RA 4HYEA 2Q1ZB 4GGGA 2VQGA 4MEYF 3D1NI 3OIQA 1R1UA 3S14J 3VUZA 1QZEA 3H0GJ 1PP7U 2QF7A 4LGWA 3GBGA 2NRAC 4EJVA 2E1MC 3FWEA 3GUDA 4LMYA 4MFDA 1DU0A 2B0LA 1LVAA 2DA7A 4BEHA 4HBLA 2W7NA 1TTYA 4I6ZA 4GYIA 4U7DA 3VWBA 1S7EA 3KEQA 3FXQA 5E20A 3QYFA 3COAC 5ICCA 5L3DA 1I1GA 2L2OA 1ZLKA 1BJAA 1G3SA 1JXSA 5K5OA 3F9KA 2R5YA 5LGUA 4IPAA 3V8LA 4OMYA 2Q2EB 2R7TA 4OIQF 1DP3A 3DU5A 2DT7B 4EEFG 4IOAF 4IO9F 3ELKA 1RRJA 1WPKA 4ZYDA 3GO5A 4V2FA 3I71A 1V5GA 3GF2A 4M6VA 1P2FA 1T95A 1TQPA 5M5WJ 2EZKA 3CESA 1EF4A 3GFLA 1KU7A 1G3TA 3EYIA 1IC8A 1G6NA 3K4LA 1FOXA 1Z67A 4YPUA 3FDYA 2A6TA 2AXTC 1ZGWA 2P7VB 3DWLE 5EJCA 3U1KA 4BKXA 2XB0X 3GTQJ 2ZJRF 3PNTA 4EM2A 1QHGA 3M1CA 2AQEA 3RTRA 1RR8C 1FTTA 4G12A 3WG7H 4Y33A 3TG4A 1YW9A 1JT0A 4PSWA 4JBAA 4F3QA 3BT9A 4HNUA 3F72A 1XTAA 3HYIA 2XAJA 4XSZF 4G94A 3EUAA 2FF4A 3B6CA 2Y30A 2XC7A 1HCRA 5B5EC 5LD2C 4M73A 5KNLA 4UXNA 3WGHA 4ABZA 2HZDA 3R0JA 4L5JA 1FEXA 2YX4A 3GCMA 3OYKA 2V4JC 2VQLA 4F7ZA 3K9TA 3S32A 1U3EM 4YPEA 5TTFA 1IV6A 2IGOA 2UV1A 3B73A 4XN0A 2L9VA 3G71I 1IN7A 2R7WA 4UVAA 3G73A 3CO7C 3JRFA 2OTLI 3F9ZA 3HRUA 2DJIA 3CJTB 5F59A 5DYMA 2OU2A 1J9IA 2EFNA 2GOMA 4AM3A 3RJWA 1FBUA 3DLAA 5M5YJ 3S7BA 2ZBKA 1LE8A 4BBRJ 4L0ZB 2XPVA 4Q47A 3S1NJ 4QWQA 1FIAA 5DS9A 3DBRB 1NTCA 1ZG3A 2CW0F 2RAEA 4ENNA 3CF5F 1BI3A 3IHXA 1SFOJ 5GPCA 2LF8A 3OPEA 3L1PA 2X0LA 4M3FA 3DKYA 3SW9A 1FY7A 1FBSA 2L0KA 4CUGA 1F1ZA 5ILUA 3RKYA 4A3FJ 1ML9A 2ID3A 1FYLA 3TEDA 1XMAA 3PSIA 5EEHA 2F5CA 1YW7A 3WTVC 1T6SA 3KP3A 4I01A 3FKIJ 2BY0A 2PMUA 5FLMJ 2LG4A 2ADUA 1RC9A 1G3WA 2NS8A 2DA5A 1KONA 2LF7A 4RAYA 3V8JA 1ZRCA 2E5NA 3ZP5A 2V1XA 3IH2A 3IRQA 4AC0A 1B72B 3BTIA 2NOGA 2HPMA 1UB9A 2DFIA 2DFHA 2X85A 2Z99A 1MDMA 1RETA 1A31A 3I4PA 3KLNA 1MVXA 2GM4A 3E6CC 3ML6A 1KQ0A 3CQZJ 2FU4A 2KRFA 3K4JA 3TBIA 1HKSA 1X4OA 1W36D 5FB2A 2W5YA 4RGRA 1O4XA 1POGA 2JUCA 1VQ6I 2ZXWH 1LDKB 1L0OC 3MCZA 4LJZF 2HVRA 2M3AA 2RVCA 2H1KA 2A5WA 5AIPA 3RYRA 3RPQA 5ARFA 5L3FA 4C2UA 3E3VA 1FLIA 3ONQA 4KN4X 1IN8A 4XKBA 3LMMA 1YITI 1H8AC 4UNOA 2YU3A 3BP8A 4EATA 4LB6B 3A1YA 4PJLA 2HQRA 5FFXA 3H1CA 4I76A 4FX0A 3K70C 1DGWY 1YRNA 2BXYA 5BMZA 4NQWB 1U9OA 2WAEA 4OAZA 1JUPA 4KMUX 1K4TA 2LSOA 2ME0A 4O6FA 2R7ZJ 2DJNA 1P7IA 3JRCA 3VSKA 4HX8A 3FIWA 3OYDA 3E7LA 3R6SA 1VQLI 3C1DA 1HOMA 4XBFA 2VPRA 1HSJA 3OYGA 2HYFA 2F5EA 3M58A 3IUOA 3OOIA 4N4OB 3WTTC 4LG3A 2W57A 1XGSA 1VQOI 3BZKA 4NB5A 3MZYA 2YU9J 3K1NA 5K5RA 2E34A 5CLSA 5B1BH 2E36A 1WGXA 2A6EF 3CDHA 1E3PA 4A3LJ 2OAZA 4ZDPA 2QKMB 1HW1A 3OYBA 1ETVA 5DDGA 3KP6A 4XOTA 5C4JJ 4EJWA 1OKRA 2F5FA 4O5VA 4A3BJ 3ABLH 3DEEA 2HYGD 3OS0A 3SYTA 2KZVA 1DDNA 1IDYA 4D7NA 4E6KG 4YFXF 4ZDLA 5D8LB 2HS5A 3CUQC 4XONA 1ZR4A 3IKVA 1YI2I 2RKHA 3I55I 2OCCH 1Q1VA 3GFMA 1IN5A 4UUTA 1FYKA 1G4DA 4J19A 5IYBJ 2MD5A 4B09A 1VI0A 2JTVA 2G46A 1D8KA 4UV9A 1MW7A 4HG2A 5LHHA 1FP2A 3TOAA 2HPIA 1ACIA 2GOXB 3EUHA 3CCMI 3OSFA 1JE8A 2AXLA 3K4NA 1R9TJ 1TQIA 4Q4ZF 2QQ8A 2DODA 4M72A 1U5TA 5EEAA 1Y39A 3DPUA 3RSNA 3CCQI 1SFXA 4G7HF 1JTYA 2EK5A 4XLAA 2AO9A 2DYRH 4CH7A 1G3YA 5E1XA 2E1OA 1IV8A 3SFZA 1LEAA 1HKQA 1EH6A 3CD6I 3BG3A 2E71A 5EZHA 4B44A 3HOYJ 4KNYA 4A69C 2K9QA 1QRYA 4HNTA 3CMAI 1YX3A 2GIVA 4YIFA 2DA6A 2V9KA 2X6XA 2Y9YA 3PIOF 2O8XA 2VE9A 1BI2A 3OR2C 3MFKA 3ZCOA 2CS3A 4UB8C 2FOWA 2Z16A 1R22A 5DCFA 4PJNA 4OWRB 2MC3A 5J6XA 3ZOBA 2GIZA 3F9WA 1UG2A 3H0DA 4BNCA 1NHAA 1P92A 1ZG5A 1YOVB 5B66C 1BR4A 1H9GA 1K61A 4IRIA 3ECOA 2AQFA 2E2IJ 1Z05A 3C18A 1MBKA 1AU7A 1KU2A 3RIRA 1R23A 2CJJA 1EJ9A 1JGSA 1SFKA 2QENA 1ITYA 1K4SA 2ZFUA 1F36A 5LEKA 4ESJA 1U6GA 2FBIA 4BHCA 2KDZA 3S7FA 2K85A 2M4KA 3BOQA 2L02A 2B9SA 3KZZA 1BL0A 3KMAA 3DXJF 2GQQA 2BY2A 1DQUA 1ETKA 3S3NA 4KUMA 1MD0A 4CCJA 1HKTA 2M7BA 4IHYA 2PMZA 5DD4A 4I99C 3CUOA 2MH9A 3DV8A 1I5ZA 4N0BA 2D1VA 2J5OA 1Z9CA 4JK1X 4XSXF 4LB5A 3CC2I 3KYDB 2OCEA 1OCCH 1TWGJ 5EEGA 3OYIA 2EH3A 2EZIA 4HQEA 4RZ0A 1YG2A 2KMUA 2A68F 1UAAA 3JSPA 2QEXI 4BHBA 1HC8A 3ZPLA 3LSMA 3GTJJ 2VJIA 5J1YA 3J7AO 1KZHA 4CA0A 3G3ZA 4BQNA 2FOKA 2CFOA 3TOBA 3GZ6A 1YTYA 1WJBA 5LLQA 2ZMEA 4HA8A 4L18B 2WV1A 3HUGA 4AU7A 1DUXC 1ZRDA 2EZHA 2XHKA 2JA5J 1O57A 4DNCA 4QIWN 1S7OA 2BY1A 2GA2A 2G9WA 4P5OA 3GTMJ 4UY8I 5C4XJ 3CCSI 3S7DA 3JRDA 3S3MA 5K7ZA 2QPWA 1MH3A 1FSHA 4J8OA 3QWWA 1W7PB 4HF2A 3OOUA 2K4BA 1CF7B 1B8IB 1OR7C 1FOYA 4IHVA 3E6BA 1WFXA 4II2A 2KJCA 4WX9A 2XGDA 2DXIA 1LQ1A 1XQHA 1YIJI 3R0AA 5TEGA 3SEQA 3LSRA 5E17F 3MKWB 4BJTA 3Q0UA 2DTRA 1RKWA 3JTGA 1NG6A 2IGMA 3LA2A 2CUJA 1D3YA 3KE2A 3D5RC 3I56I 3RYPA 5T5GA 5LHIA 1JHFA 3QAHA 2OC6A 3N05A 4NC7A 2DBBA 3I4MJ 3HL2A 2L4AA 3KP4A 1Z7UA 4IHWA 2O0YA 3VOEA 1HDPA 2FNPA 2RQPA 3A4CA 4F92B 2HOSA 2K40A 2W1OA 3ZN1A 5D6FA 4A3EJ 3NWTA 4X6AJ 1PUEE 4WXCA 3FK7A 2NVUB 5JVTA 4KIFA 3FKJA 1TWAJ 4M6YA 1R4NB 2CQKA 3AL0B 2CH0A 1MJBA 4RGSA 4IRGA 4XLPF 4J00A 3OOPA 2E1NA 3LQRA 4L5EA 4FCYA 1YJNI 2IVMA 2IBDA 5IP6A 2IS6A 1YJWI 1Z7LA 2XAGA 5DEQA 4BXFA 4YFNF 2IS1A 3FPDA 1UG0A 2HFHA 3K4CA 3DTEA 2X6OA 2RNGA 3JTHA 4XRFA 2IAIA 4IJDA 5C3EJ 3V42A 2XKOA 4M3DA 3WTYC 3FISA 4LOCA 1R7JA 2R5ZA 2M34A 2LBFA 1JKOC 3K1PA 5IYCJ 3H92A 4CYDA 2CW8A 4KMFA 2WAQN 4MQ9F 5JVGF 4J83A 1MBHA 3F3XA 5HS8A 3NRVA 2ZCWA 1A04A 2DK8A 4EGZA 3IAM2 1AA7A 1H0MA 3QQAA 3ZQ7A 4HAMA 3G1MA 1IUFA 2TDXA 4A6DA 3ZGKA 2DT6A 3AG2H 2M1BA 5LFAA 2BZTA 3BTCA 3BZ6A 2X48A 4C30A 5KJKA 3DF8A 4XORA 5HDGA 3NARA 4HQMA 1XDSA 1QU3A 2ESHA 3CP8A 2NOJB 2NXNB 4J7FA 4DIQA 3IP4B 2DTZA 4A3GJ 3A02A 1O9SA 3Q5FA 4MLOA 2LY2A 3RDIA 3KZIC 3WE3A 4A5NA 2NVXJ 1QGPA 4ZYHA 3KMJA 3M56A 2EIJH 1WH5A 4BJ5C 1BN5A 1T56A 4Y15A 3RQIA 3S1RJ 2KJBA 2ZMEC 4BY1J 2OF7A 3RU0A 1OCPA 3EUKL 1SANA 2BW3B 4XK4A 2YX7A 5JI6A 1R5HA 4RS8A 2E5ZA 3GW2A 4D7MA 1TT5B 4BXUA 2VKVA 3GTOJ 1T08B 3F8CA 3I5UA 1XGOA 2DI3A 4CZCA 1F9NA 4MHGA 2FRHA 2EA2A 2G7UA 3HSEA 4M9XA 1VQMI 2LC2A 1IAWA 4ZYEA 3HB9A 3OSGA 2X6YA 2W25A 3OV8A 2ME6A 4BACA 2A61A 3QP6A 5M3MJ 4BQOA 3OYJA 2JVGA 3CCYA 2XRLA 2M87A 5FFZA 4M3GA 4ZZLA 1BIBA 4BEHB 1R49A 2KLOA 1HF0A 2KISA 4AD9A 3WTXC 4X1EA 4RGUA 2JN6A 1FJLA 3F23A 4H12A 1IW7F 2JRMA 5TH7A 2GXBA 5GADJ 5EYRA 3TMOA 2ID6A 2CUFA 2XUBA 5FKKA 2CUEA 3OYCA 2EPFA 3DQVC 2H94A 3I3LA 4B8XA 3M53A 3GWZA 2A5YB 2L4MA 2MSYA 4WK8F 4KT6A 2FBKA 2Z5UA 3W6JB 3F0CA 3CCJI 1F4KA 3REOA 2L7FP 2MA3A 1MBJA 1JTXA 5J3LA 4ZTFA 3H5NA 2A05A 4IQ4A 1X1DA 4PK4A 1D5VA 1HW5A 3TO6A 3LWFA 2QA4I 3CBOA 1K6YA 2QSHX 2R93J 5F0CA 4WCGA 4B3AA 1C0WA 1OCOH 1X2NA 2M5WA 2O9LA 3M5AA 2BXZA 3OXLA 3OL4A 5CKTA 5EGOB 1IDZA 2OA4A 3KMTA 1EV7A 2Z3YA 1P9QC 2QQBA 3FXKA 3PL8A 1GT0C 2EQRA 5CCLA 3LSTA 1SVOA 1EH8A 2W00A 1BOBA 3SDBA 1IRFA 3PFIA 1ETOA 1LFPA 2COBA 4RB1A 2IRFG 4OIOF 3OYNA 2IA2A 1KA8A 3FXJA 3OMYA 2VT3A 4ZTJA 3MKZA 1PUFA 3E5UA 5D5VB 1QVUA 4H4KC 3GFJA 4PGHA 4U0VA 1TQMA 2ZXJA 4XL9A 2FMYA 2LK2A 3VEPA 3ZQIA 2M0CA 3CC4I 4CCLA 2HVSA 1W1WE 1SD4A 5HVQC 2E35A 4EM1A 3RZDJ 4UUSA 4MEXF 2BEOA 2FXAA 3QPLA 2KRHA 2M0MA 1EKEA 1BC7C 3J7ZI 4GRIA 3W2VA 3HNAA 1WI9A 2LNBA 1LE8B 2NNYA 1NK2P 4CXFA 1JKQC 1UFMA 3P9CA 2M9HA 3CJNA 2VPLA 4XLNF 1W5TA 2MABA 5ED4A 3LFUA 3L09A 1X4PA 2KFDA 2OZUA 4OMZA 1IZ1A 4R8HA 2RC4A 1RKTA 1ULYA 3K4BA 4IJAA 2IS2A 1S29A 4A0XA 1JUSA 2ZXIA 2V1DA 5J8CA 3N71A 1TC3C 2IPQX 3S7JA 2GXAA 4AYBA 1Z3YA 5HLIA 1FWZA 3I64A 2CGPA 1N6CA 1NG7A 2GAUA 3L2WA 1FYMA 1OLTA 4XKCA 3V4GA 3RAYA 2IA0A 3F6OA 2CQ7A 2Y9ZA 3EDPA 4IXAA 3T1BA 2FQ3A 1A35A 4XR6A 4II3A 4ZYGA 3DCFA 1TT0A 2ZJQF 5JJ0A 1HSTA 2K3PA 4C2TA 1B59A 4Z2YA 2RNJA 3OYHA 1JJ8C 2ZJ2A 4D9JA 1MDMB 3MWMA 3GVAA 2HKOA 3QU3A 3J80K 1QQIA 1W36C 4Q5SF 5F5EA 4QSHA 5B1AH 3PFYA 3LSKA 4DGWB 2OD5A 1MJ9A 4CICA 5CPRB 3QPHA 4S05A 1SEUA 2NS7A 3MZHA 2M30A 1GDTA 4O30A 3G2BA 4RAZA 4OIPF 1U9NA 3C3WA 2KIMA 5IT9K 1EH7A 1F5TA 2HOTA 2OV7A 1MBFA 3JAMK 3E6MA 4BYYA 1ON2A 1RESA 5H20A 4CYCA 1WCMJ 4DOZA 5CVVA 4AYBN 2JMWA 3HDDA 2P5VA 4JQFA 4M6XA 2VXDA 3N4MA 3LSIA 3S2DJ 1RNLA 2M7AA 3TO7A 2VE8A 2XPWA 1YRNB 1YHQI 5EGOA 3MD2A 3O8GA 3L2CA 5LRRA 3WGIA 4RMNA 2HQAA 1LUJB 2MFZA 2F5DA 2YSRA 4ETSA 2JSPA 1HXDA 2O6GE 4R1HA 3CF2A 4HPQA 2RN7A 3E97A 1ZYRF 5GP9A 3TW6A 2FA5A 1V5FA 4KYWA 2HNHA 3DLLF 2QUFA 1E2XA 2X1DA 5K1YA 2ZNYA 1FOKA 1FX7A 3R61A 4M9ZA 4IKFA 5D4RA 3MO2A 3Q9VA 4ZYAA 4KISA 3H5AA 2GZWA 4XM3A 3VYRB 2X51A 1MBGA 3KFWX 3ZQLA 1O3SA 3LSJA 4YIIA 3C2GA 5ERIA 4LG0A 4EJOA 3KEYA 4NC8A 5JHFA 1H3IA 2P6SA 3IKTA 1F43A 3H36A 2DCEA 3RPUA 4DYCA 3JREA 2ICWG 3KCCA 2E2JJ 3OY9A 3I59A 2DMPA 5L3CA 1N6AA 2IP2A 4Z6YA 3HOWJ 3DBLB 2P0WA 1JKRC 3J7YJ 3FHZA 2H8WA 2P8TA 1QA6A 1QZZA 3OIOA 2CG4A 3OL3A 3KLOA 4ZC3A 2VJ5A 3CCVI 3CUQA 2ISYA 2K9SA 4XNFA 2K27A 4I7HA 2XASA 3K2AA 4A5MA 1AOYA 1DPUA 5JLWA 2J5PA 3S17J 1I27A 2EIMH 3V8KA 2CQQA 3BG6A 4BE2A 4QPOA 2W5ZA 1T0FC 3T8RA 2ZSIB 3ABMH 3KETA 3M54A 5HODA 3FMRA 1J2XA 3K4KA 1U5TB 1MSEC 2M2EA 4HRIA 4XLFA 1R5GA 3WHCA 3OYAA 3EYYA 1S3JA 4M74A 4XIDA 2WV0A 5KAFC 2BE5F 2MLKA 1WQ2A 2HXIA 5IP7J 2R7UA 3QYEA 5EX0A 3FXMA 1I39A 1MSFC 4OIRF 2VB6A 3KX2A 3BPVA 4RB2C 3S2HJ 3L2RA 1RUNA 4F91B 3BR5A 2PJRA 1W7PD 4HV6A 3M8FA 1R00A 3F9XA 4MO7A 1UHWA 2E19A 3ISPA 4RBOA 1GLNA 3J80Z 4HDVA 1SFEA 1X1AA 3SWCA 1QVTA 2ZFWA 3E6DA 3ZQQA 1USSA 1IF1A 4G6TB 3KYLA 2P4WA 3H9JA 5FRMA 4L9NA 2QCOA 5BPDA 4HSTA 2D2WA 4G8XA 2ZXHA 2DFFA 3F8BA 2UXXA 5IT9Z 2F69A 1FSEA 3QWPA 3FHNA 3F9YA 3JAMZ 3CO6C 5GAEJ 2QZ8A 3TQNA 1YS7A 3C7JA 3W3CA 4RGXA 3VODA 3DEUA 4OU0A 2KHMA 2FBHA 2O3FA 2KT0A 4MTEA 4BY7J 4N9HA 2MH2A 3IL2A 1Y56A 3TG5A 2RFIA 1XCBA 2VBYA 5LBQA 3OR1C 3SZGA 2NNNA 3SHFA 3MMYB 3R4KA 1OFCX 2EB7A 1NK3P 2DLLA 3QPTA 5KHDA 1BW6A 4P9FA 3CC7I 1Z1DA 4LFUA 2XAQA 2LKPA 5DD8A 3HPHA 1YO5C 4MQVA 2ZMEB 5JHUA 1K78A 2WTEA 4Y17A 3CDLA 3HUGB 3LAPA 4IVNA 4A0YA 5FKLA 3JRAA 2X6WA 2XGXA 1BI0A 1P6RA 1GXQA 3OS1A 3S3OA 1LDJA 2CRGA 5EX3A 2L9RA 2BY3A 3HGGA 4QPQA 4E7SA 3BG9A 4F93B 1VFCA 3PO3J 1D8JA 3WODF 1VTNC 5ILSA 3CCLI 4MFEA 3T5XA 4D5FA 3BY6A 1OR7A 3H5RA 4CCOA 4S0HB 2XAUA 3LL7A 2H8RA 1LNWA 2EWNA 2P81A 1MMDA 3HM5A 2QVOA 4HNVA 2DMNA 5BS6A 4RM3A 1KYWA 2K9MA 2XAFA 5F27A 1PYVA 3Q0WA 1SD7A 3JRIA 2MD0A 5KVRA 1YLFA 2VJ4A 3BG7A 4KN7X 4RA2A 1ON1A 4ZZDA 1OCTC 2LKXA 2XAHA 4YIRX 1X3UA 2VOOA 3G4SI 3VDXA 1U8RA 2OBPA 4TV7A 1WZ2A 1Y0NA 3CCEI 1ZHFA 4JP0A 3X2QH 1XG1A 5JLXA 3MKLA 1T98A 4CCNA 5F1JA 2HDWA 1ZELA 4Y7NJ 4EMSA 2FD5A 2GA1A 3AG3H 4KJZA 2FMLA 4AIHA 2HGCA 3VYSB 2LRDA 5LSZA 2M4GA 3GTGJ 3VV0A 2A6HF 1LKXA 4CCKA 4E7IA 1J75A 2ZC2A 1D1CA 3ERED 5F64A 2UXNA 5LHGA 3CJQB 3WU2C 4XLHA 5DUIA 3M3YJ 4E47A 5ICGA 3K7AJ 3WTUC 1K7AA 4WXDA 5TRDA 2IA1A 3OYFA 1VZ0A 1S8NA 2LBFB 1IN4A 4M71A 5K5QA 2R5ZB 4MI5A 4L9JA 3A0BC 4YEJA 1BR2A 3CLQA 2V26A 2DK5A 4E4HA 4BDZA 3OYLA 1SAUA 1TBXA 3SZPA 3S15J 4G6DA 1WJFA 4I51A 2JA8J 2VXZA 5FGMA 2Y31A 2ELJA 3PO2J 3O8HA 1J09A 2F5VA 2DYSH 3C2HA 2V1UA 1E17A 3I4NJ 1TWCJ 1VNDA 1ZN2A 5TISC 5D8KB 2V9VA 4RB3C 4MTDA 3AKZA 1XS9A 1E0EA 2EILH 1N77A 2R7QA 2EFPA 4RB0A 3H35A 3RKXA 1LEBA 2QBYA 2W82A 2HKXA 3SDGA 5LGNA 2R7OA 2H6CA 1V3FA 3VFZA 3BLYA 3FMQA 2UUZA 3M55A 5LSXA 2VOPA 5A2QK 3HBLA 2H1LA 3W2WA 3CLOA 2FEZA 4PJMA 4QENA 4XOPA 3I54A 3BJ6A 2VIXA 3S93A 4FASD 1IXSB 4I0AA 4KFCA 2WWYA 4BL0B 1JHHA 3M8JA 3I58A 3HGYA 1ZGAA 1GVDA 2K7LA 4WXHA 5JIYA 4MIMA 4E7LA 3MZ8A 4A93J 2DN0A 1J0RA 4AWXB 3K69A 3L9FA 1KYZA 1Z77A 5HI7A 1V4RA 4A3DJ 3E5QA 4LIVA 2E1MB 4CDGA 1XX5A 2BV6A 2R7DA 2JUGA 4I09A 3M59A 5JR3A 3WTZA 1KU3A 1MNEA 1SD6A 4MI0A 4NVQA 3GX4X 2F2EA 1LB2A 2PLYA 4BDYA 1FTZA 5HDKA 5EDNA 2XIGA 5IY5H 3DP7A 3D5SC 1OCZH 3RCOA 2WAQA 3D0SA 3JCUC 4HEA2 2EFWA 1OYWA 4B43A 4IF4A 4XRSG 4FQGA 2DOAA 1N75A 2HOAA 3J7AY 2XF7A 4B1RA 3GXOA 3UKGA 1GXPA 1VQ8I 5EG0A 1XSXA 3HTUA 4YPAA 1ETXA 3WU1B 3ZQFA 2ELHA 1APLC 4NUBA 3MO5A 3M4OJ 2FE3A 2L5QA 3ZMTA 4LDGA 1MH4A 1YS6A 2CFXA 3TP3A 4PFPA 2OJED 3OXFA 1ZLJA 3FM5A 2XROA 1UMQA 2BBYA 5J47A 1IGNA 4N9IA 4XRMA 1S5LC 5BQTA 3EP0A 2E7XA 3HG9A 4I98B 3O6BB 1R1VA 2CV0A 3QRFF 1JI8A 5GTHC 2EFQA 1SMTA 4YRVA 4DZPA 1V55H 3HOSA 1ETWA 3CCUI 1PUFB 4LIUA 2EFOA 5DM7F 1R1TA 4FHTA 2MGQA 3RKWA 3BJOA 1OPCA 1JGGA 2QWWA 1P7JA 1IRZA 2COMA 4XLEA 3JRBA 1HBXG 2ZB9A 3IAS2 4UUSB 3B6AA 2YR2A 3FBNB 2O03A 4NDLA 2XB5A 1B9NA 3HRTA 1S9HA 4AIJA 2KIUA 2X4HA 4A12A 1FMWA 4B4CA 4EQQA 3QP5A 4LITA 3HXLA 3Q0VA 4IHSA 1BOAA 4HX7A 2DO7A 2H09A 4QTRA 2LY1A 2ZKZA 3K5KA 5CQGA 5E1ZB 1Y6IA 2RGVA 1QO0D 5FKOA 5HS7A 2R7XA 4IRHA 1IRXA 1MZBA 2WA0A 2P5LC 1UJ8A 1ZARA 2VT2A 5CCMA 5A2QZ 4YNMA 1WJ5A 2ACJA 2I5UA 4GO1A 3VYUB 4BUPA 1YX5A 5HDNA 4KIGA 3SJMA 4PCQA 1AWCA 3EETA 1SMYF 5HLHA 3DKWA 5ICFA 4XKVA 1X58A 3ECHA 1IRGA 2I10A 3HOVJ 3WTWC 1IXCA 2FSWA 2JA2A 3Q3SA 5K7HA 2NYXA 5IPAA 3H3UA 5GPAA 1DU6A 2STWA 2L9SA 2ZNZA 3MO0A 2HQ5A 1XGMA 4EGYA 2Y69H 1T39A 2EV0A 1SVLA 4WWCA 4L5IA 2B7EA 3PDNA 2P7CB 2IGQA 3CP2A 1K83J 4Y3OA 1AKHA 1QHHD 3T8TA 5IYDJ 3DB5A 2Y2ZA 4BQQA 5HS9A 3GMEA 4UUVA 4CYCB 1LDDA 4QLCU 3P7NA 2HEOA 3ZMVA 1UCRA 3MKYB 4LK0F 1S6LA 3SFIA 1UHSA 3OXGA 2Z33A 5JINA 3BCBA 4Q48A 2JA6J 1I50J 1Z3XA 2XPUA 2OQRA 2V79A 4B47A 2LY9A 4ZJZA 1FMVA 1OCRH 2OQGA 3KZYA 3RJPA 2MW8A 4ASNA 4AIKA 2QQAA 1QPIA 3OS2A 5F0HA 3HSRA 3ULQB 1O3RA 1WI3A 4IL6C 2MC4A 1PDNC 1N78A 1BBYA 2W48A 4G6QA 5F08A 3ZMZA 3LSPA 3ERMA 3EQLF 3HPGA 2RREA 3GLLA 2LFBA 5LRSA 2WAFA 1ZREA 2GLOA 5L3GA 2DOEA 2JZYA 5DTDA 2FUG2 3S1QJ 2HQNA 1KQ8A 1OYYA 3P9IA 1Z91A 1R5ID 4CHUA 5DUKA 5EG2A 4BE0A 1ZTRA 3M7GA 1JKPC 1ENHA 4LG0B 1R58A 2P6TA 2DQRA 4V2GA 1A6QA 3CJRB 4D1QA 3IRRA 3D5LA 2PG4A 3ZMSA 4BGDA 2IXSA 4J01A 4XKWA 4NHJA 1M1EB 3FXRA 3O3KA 1QPMA 3I59B 2STTA 2DOFA 1MJAA 2O5RA 3QODA 4KIBA 4IHTA 4C2MJ 2HTSA 1O3QA 2OUMA 2A3SA 2BHZA 4IX7A 2HU9A 3CUQB 2LOOA 1AHDP 4DW6A 3BR3A 2PQ8A 5HNFA 4S04A 2ISZA 4P55A 5KK1A 3IV5A 3HRMA 4AVZA 3PSFA 4U88A 5KCMA 5H6RA 3M9AA 4CCMA 2HR3A 5KAIC 2YS9A 1XSVA 3DPTA 2Y0SA 3GYHX 2WBMA 1T0FA 4A3JJ 5KJLA 2KIQA 1Q1HA 4M3EA 3A0HC 1X1CA 1SFUA 2LP0A 2X1EA 2V6EA 1MBEA 1OQYA 4FE4A 4A0ZA 4ENJA 3LSHA 3RZOJ 2DAOA 1I1SA 5IOYA 5ARGA 1QNTA 5E1WA 4EVIA 4A3CJ 1U78A 3U1DA 2JPCA 5FD6A 4XN3A 3JSOA 3KYCB 4OINF 3M57A 1P4XA 1JUMA 4Y4RA 3MVPA 1Y1VJ 2RV8A 5F0FA 3U21A 2PJRB 3OWTA 3RQ4A 4QEPA 3HC7A 2PX9A 2CU7A 1X19A 2D45A 2XKPA 3OIPA 1WJCA 5HNHA 3PJRA 3BTJA 1B6AA 3MN2A 2EINH 1VQ5I 1BA5A 4UB6C 3RIBA 3F21A 1ZGJA 2Y48A 1MNDA 3DKXA 1W4MA 5AONA 2JRTA 3QWLA 1TP4A 2PEXA 1MIJA 2XRNA 3ZQGA 1RUOA 3HEFA 4IEJA 2VONA 1G8XA 4ITVA 2Y0SN 3M07A 3HHHA 4LD5A 1BR1A 2JSCA 4ENMA 2XF5A 4HF0A 2JVHA 4IZZA 3K4MA 3WE2A 2CMPA 3AL0C 3H9QA 4CZZA 3M8EA 1E3HA 2E60A 2WC2A 4PZJA 3HRSA 5F6FA 2CSOA 5M5XJ 3HSFA 3L7WA 3FZVA 5KJNA 1FC3A 2JJ7A 2HZTA 2ETHA 4D0PA 2DU9A 2VI6A 3LA7A 1P4AA 4BQAA 2VBZA 1T38A 3ASNH 4L0YB 5HQ8A 2L7MP 1FBQA 1N25A 4HZFA 3MAJA 3CTAA 4A6EA 2L3DA 4PSXA 1B4AA 4KITB 1ZG1A 1K78B 1VQ9I 2KP6A 5AYFA 3WG9A 2O61A 3MQ0A 1L3LA 2Y75A 3ZR8X 5BNGA 2JQ7A 3PM1A 1T2KA 3TO9A 4HOBA 1ERDA 1W0TA 2R7VA 2EV5A 2LREA 3CMEI 3GFIA 4BH9A 3AG4H 2EBIA 3BO5A 3F8MA 2IGNA 5E3OA 4B3XA 1K6OA 3FBIB 2F4IA 2EJRA 1V5EA 5FKNA 3H3VK 3K1MA 1WWXA 2KRCA 2JV0A 4UHTA 4A2UA 1SVMA 4GCVA 3L2VA 4WUYA 4YNDA 1MMNA 2VC0A 3F22A 2JT1A 1RPWA 2P5KA 3ABUA 1D0ZA 2LR8A 4DYRA 2L7KA 3AAFA 3S16J 3JRHA 4BU2A 1R36A 1YW8A 4XRSA 1Y1WJ 2XSJC 2EZLA 3KP2A 4RDUA 1A36A 2EIKH 3L2QA 2PI0A 2QSGX 5CYVA 5J4VA 3KP5A 4O6JA 2E1CA 5K7FA 3PNVA 4U87A 2XDVA 4W1UA 2VJJA 2HYJA 2WB1A 3BZCA 3M1EA 3NEUA 4FTHA 4I2OA 2NAZA 1HQCA 1VQ7I 1ETYA 1GHCA 3HKZA 1U0JA 2MG4A 3G1LA 1STZA 3SQNA 2PMHA 1TZLA 1I3AA 4JLGA 3L00A 2VBXA 2V6CA 2Q2EA 1FIPA 4P1WA 1Z21A 4AUXA 5LEJA 2LKSA 2Q8KA 2IT0A 3P5JA 4GXOA 3ZXSA 1LFBA 5DCMB 5BPIA 3PUBA 1A6IA 1RZ4A 2AHQA 4K2EA 1X2MA 2H6BA 3LOCA 5TGTA 3E0JB 2LH9A 1MKMA 3DPLC 3V7SA 4XICA 1V54H 2CQNA 3EPZA 3WHBA 4FISA 3WTSC 4KT5C 5FROA 4GFBA 3JRGA 2IGKA 3DEWA 1J5YA 5E3NA 1HLVA 2FNAA 2PFBA 2CUZA 2W24A 3BQYA 5BOXA 5D5WB 2DA2A 4BHPA 1N3JA 2H27A 3QPSA 1O7FA 2WB1N 4HLYA 2QBYB 3GTKJ 3W6KB 1I6HJ 5CQEA 2RDPA 1XDUA 3HKZN 3NAUA 2L9NA 4N4NB 1MNMC 2D5VA 9ANTA 2K4JA 1BW5A 4X0GA 3KPHA 3N97A 3KEOA 2L7ZA 1DP7P 2HVQA 2VASA 2XGCA 1RR7A 3FMSA 1VQ4I 4NNJA 1EA3A 2L54A 1MUFA 2C6YA 5T0KA 5E3MA 5EF6A 4A3IJ 3FXOA 1P4WA 1B1BA 3BPXA 4U0WA 1S72I 3DTIA 2DDBA 1JJ6C 1TLHB 3BROA 2NVQJ 1O7LA 1KU9A 2FJ1A 3RI4A 3LSGA 5D4SA 2VBWA 1SD5A 3OYMA 1VQNI 2LDUA 1LVKA 2F4MB 4DQ2A 3BR2A 5D5XB 2ECBA 2HDDA 1WJDA 1ONVA 1X1PA 4MNUA 3CCRI 5FKMA 1VQKI 2TRTA 4UVCA 4JDSA 1XGNA 4WF2A 4A3MJ 3BDDA 2KZGA 3ROUA 3BR1A 2VC1A 5LGTA 1XPXA 3F6VA 2VODA 3GLXA 1ZR2A 1FPQA 3GZNB 4HX4A 4HV5A 1G59A 1FP1D 4JOMA 3QOEA 2OTJI 1XCVA 2QSFX 3QU6A 2A69F 4E70A 2KIFA 4G7ZF 4XMYA 3IWZA 2ZSHB 5H6QA 2KKOA 1TW2A 2QM3A 1TNTA 3J81K 4HDUA 1WJAA 3MEXA 2CV1A 2DQLA 2PN6A 1ETQA 1VF9A 5EG0B 2Q0OA 1O3TA 3A01B 3GEZA 2PBIA 5JFRA 2Z9OA 5C44J 5F04A 1MMAA 1XN7A 3BR6A 1YE9A 1KGSA 1R4MB 1B72A 5CJ9A 3ZMUA 1U8BA 2LVSA 3F8FA 5E18F 4RLFA 1BI1A 2MBFA 1XMXA 4RLQA 2R7SA 1S7AA 3IH4A 2HI3A 3ZN0A 4P9UA 2HDCA 3CBPA 4GYGA 1SC7A 3QOPA 1G2HA 3O2PE 4JYKA 2EA4A 2R7RA 3TDUC 4DZJA 1ZK8A 3I9V2 1NH3A 2QLZA 4KDPA 3TKYA 4U0YA 1MT6A 1TL8A 3GTPJ 4JX5A 4NJ5A 5HOOA 1W0UA 2QKLB 4BS9A 1WHUA 2M45A 5DCMA 2ZO4A 1WSUA 2VQCA 1W5CC 5ICEA 2TCTA 2MYSA 2R3SA 4FT8A 4MGRA 3VB2A 4BXXJ 3BQZA 4E7ZA 6PAXA 1IXRC 3WU0A 4Y52J 2IS4A 4CO8A 1YQAA 5E79C 2VKEA 1DPRA 2N8GA 1ODDA 1XD7A 1IG7A 1UELB 1ZQ3P 2NVTJ 3PQKA 1FZPB 3FK6A 1A5JA 4NQWA 2X9DA 4RM2A 4AIDA 2AS5F 2PJPA 4ZH4F 4BJ6C 1H89C 1IJWC 1WKMA 1TW3A 1FOWA 3G1OA 2JPBA 5L3BA 3K70D 1T33A 1PVEA 4OOIA 4BAYA 2O8KA 3KIOA 1IO2A 4L9VA 1ORKA 1LJ9A 3K6GA 5ILVA 3UR3C 5M3FJ 4LLLA 1OJLA 4IQJA 1Z6TA 1WH7A 1D0YA 3R60A 3OS5A 2LMDA 5GAGJ 2XV4S 4PGGA 3LAJA 1OISA 3V7RA 2V7FA 3RKQA 2G7HA 5E8IA 4Y13A 1D0XA 2XGEA 2R3AA 3A03A 2MLGA 4M3BA 3U2RA 3P9KA 1W5SA 5J1RA
chains in the Genus database with same CATH topology
3M58A 3BC8A 3IUOA 3OOIA 4N4OB 2M7AA 4LG3A 2VKHA 3QWVA 3PDNA 3H9GA 3MD2A 4FETA 2IGQA 3CP2A 4RMNA 4Y3OA 2HQAA 1QHHD 4E7KA 2MFZA 3DB5A 4BQQA 4C1QA 3RPUD 2JSPA 3CF2A 2CW7A 4HPQA 3MKYB 2VL8A 4ZDPA 2QKMB 1V5FA 3OYBA 2HNHA 3TL4X 3EUHC 2K5CA 2X1DA 3OXGA 5HLTA 4XOTA 5JINA 3BCBA 3A2KA 1Z3XA 4XQFA 3DEEA 4OAYA 3OS0A 4IKFA 3SYTA 2KZVA 3MO2A 4E6KG 4ZYAA 4B47A 4KISA 4ZDLA 4ZJZA 1FMVA 3H5AA 4XM3A 3VYRB 2X51A 2BOLA 4XONA 3OS2A 3C2GA 2MC4A 3KEYA 4NC8A 1N78A 2O8JA 5JHFA 1H3IA 2G46A 3HPGA 1MW7A 4HG2A 2RREA 2DCEA 2HPIA 2GOXB 2WAFA 3OY9A 4R79A 1X1BA 1N6AA 3K4NA 2FUG2 2XF6A 2P0WA 4ANJA 3K10A 3OL3A 3NWSA 3DPUA 5EG2A 4ZC3A 3RSNA 4BE0A 5FRNA 2VJ5A 4XNFA 4XLAA 3CZ6A 4CH7A 3CJRB 4ZDOA 3SEZA 4D1QA 3D5LA 4BGDA 3DTKA 2IXSA 4J01A 4XKWA 1ZKKA 4B44A 3BG6A 3UNGC 4BE2A 4QPOA 2W5ZA 1T0FC 3ZRGA 4HNTA 1YX3A 2ZSIB 2V9KA 2X6XA 3M54A 2VQHA 2KL4A 2O5RA 3QODA 3K4KA 3OR2C 3ZCOA 2CS3A 4CSWA 2Z16A 2OUMA 1WJEA 4IX7A 2BVMA 2HU9A 4PJNA 4OWRB 4HRIA 4XLFA 2LOOA 3PNYA 2VLAA 3OYAA 3F9WA 2WADA 5JHNA 5HNFA 3H0DA 3W2AA 3DALA 4AVZA 3PSFA 2R7UA 5KCMA 3QYEA 1BR4A 5EX0A 2AQFA 4CCMA 4DBRA 2V1NA 3DPTA 2VB6A 2Y0SA 3KX2A 5KJMA 2WBMA 3E1SA 5KJLA 4E7HA 3DU6A 3L2RA 4F91B 1SFKA 2BVLA 2PJRA 4J7IA 2ZFUA 3F9XA 1X1CA 1GLNA 2X1EA 2V6EA 3S7FA 1X1AA 3SWCA 2VKDA 3LSHA 3ZQQA 2M4KA 1HA8A 5ARGA 3KMAA 4YNPA 4G6TB 3KYLA 3H9JA 5FRMA 1DQUA 3S3NA 1R6RA 5F6KC 4HSTA 4XN3A 4CCJA 2M7BA 2UWMA 2PMZA 2ZXHA 3M57A 4DBQA 2F69A 4Y4RA 1PJRA 3QWPA 3U21A 3FHNA 2PJRB 3F9YA 3OWTA 3RQ4A 4QEPA 3HC7A 3OYIA 1X19A 3OIPA 1WJCA 3W3CA 5HNHA 3PJRA 4RZ0A 2KMUA 3AFHA 3VSLA 1UAAA 2Z2SB 2KHMA 3RIBA 1MNDA 1D1BA 3DKXA 3LSMA 2VJIA 4CA0A 5F6LA 2F6CA 4BQNA 1Y56A 3TG5A 2KQRA 2CFOA 2RFIA 1WJBA 3OR1C 3SZGA 1G8XA 4ITVA 3MMYB 4AU7A 3S8PA 1BR1A 2XF5A 4IZZA 2JVHA 3K4MA 1DGRM 4P5OA 2CMPA 5KHDA 3AL0C 3S7DA 2CV2A 3H9QA 4XLCA 3S3MA 2QPWA 2E60A 4F52A 3QWWA 4J8OA 4BE1A 3OOUA 3HPHA 1OR7C 5KJNA 3HOTA 1WFXA 4II2A 3HUGB 2DXIA 1XQHA 2WY7Q 3SEQA 5TEGA 3QYBA 3MKWB 4BJTA 2X6WA 3MEKA 1NG6A 2IGMA 1MMGA 5HQ8A 2CUJA 3OS1A 2KDOA 3S3OA 3D5RC 5EX3A 4QPQA 4E7SA 4F93B 5T5GA 2OC6A 3N05A 2Z1DA 4PSXA 4NC7A 4PUSA 4KITB 4U7BA 4Z4PA 3HL2A 2KP6A 5AYFA 2X1CA 3H5RA 3A4CA 4F92B 4CCOA 2W1OA 2XAUA 3LL7A 4HSRA 3L2UA 3NWTA 1MMDA 3ZR8X 2KPMA 1D1AA 3FKJA 2K9LA 3AL0B 4RM3A 1ERDA 2CH0A 4PJJA 1PEGA 2K9MA 4J00A 2R7VA 1PYVA 2LREA 3CMMA 2MD0A 2RQQA 2VJ4A 3BG7A 3BO5A 2IS6A 3FPDA 2IS1A 1Z7LA 4BXFA 2IGNA 2WY8Q 3VDXA 1UG0A 4B3XA 4FMUA 3FBIB 3K4CA 2F4IA 1V5EA 3DTEA 4YELA 2RNGA 2KRCA 2JV0A 4IJ8A 4F55A 4QEOA 4PFOA 4IJDA 4CCNA 2LYCA 3V42A 4B48A 2R4GA 2HDWA 1ZELA 3L2VA 1MMNA 4WUYA 4YNDA 4KJZA 5T0MA 3OYEA 2LBFA 3VYSB 1D0ZA 2CW8A 2LRDA 3BCAA 5LSZA 2M4GA 2L7KA 4E7JA 3VV0A 4J83A 1LKXA 4BU2A 4CCKA 4E7IA 2XSJC 1D1CA 3CJQB 3IAM2 1AA7A 4XLHA 3L2QA 3CBMA 4E47A 1MVHA 3ZGKA 2DT6A 5LFAA 4C30A 4DJAA 5KJKA 4XORA 3VYTB 2BW3A 3PNVA 4U87A 1QU3A 2W4SA 3CP8A 2NOJB 2XDVA 4J7FA 4DIQA 3OYFA 2BQZA 2VJJA 1VZ0A 2I8DA 3IP4B 2LBFB 4C9YA 4MI5A 2WB1A 1O9SA 4MLOA 2LY2A 4YEJA 1BR2A 2Q1ZB 2V26A 2VQGA 3OIQA 3HKZA 4E4HA 1U0JA 3KMJA 3M56A 3VUZA 4BDZA 3OYLA 1SAUA 4BJ5C 1TZLA 1WJFA 3GBGA 4I51A 4JLGA 2VXZA 2E1MC 3RU0A 2ELJA 1J09A 2F5VA 2BW3B 3EUKL 3C2HA 2E5ZA 4P1WA 4BEHA 1Z21A 2W7NA 4CZCA 1E0EA 3AKZA 3ZXSA 3VWBA 1N77A 2R7QA 3QYFA 3PUBA 2LC2A 3H35A 5TGTA 2W82A 2L2OA 2X6YA 2LH9A 2R7OA 3DPLC 3E0JB 4BACA 3BLYA 3M55A 2UUZA 3EPZA 3F9KA 4BQOA 3OYJA 5LSXA 2JVGA 5FROA 3W2WA 4PJMA 4QENA 2Q2EB 2R7TA 4XOPA 1DP3A 4BEHB 3DU5A 2DT7B 2IGKA 2KLOA 2VIXA 3S93A 4FASD 2CUZA 4H12A 4BL0B 1V5GA 1N3JA 3M8JA 1T95A 5JIYA 5TH7A 5CQEA 4E7LA 3CESA 3TMOA 2L9NA 4N4NB 4X0GA 3K4LA 4YPUA 3OYCA 3FDYA 3DQVC 5HI7A 3I3LA 2A6TA 3M53A 2HVQA 2E1MB 2VASA 4LIVA 4KT6A 3DWLE 4NNJA 1EA3A 2JUGA 1MUFA 3M59A 5T0KA 1MNEA 4MI0A 4NVQA 3PNTA 4BDYA 1QHGA 3DTIA 3M1CA 3H5NA 4IQ4A 4ZTFA 2AQEA 1X1DA 4PK4A 3RTRA 3D5SC 3RCOA 3CBOA 4Y33A 2WAQA 1K6YA 4HEA2 3TG4A 3LSGA 4PSWA 4F3QA 4B43A 4HNUA 3OYMA 1LVKA 3EUAA 2XC7A 5LD2C 3M5AA 5KNLA 1WJDA 2DOAA 3OXLA 1N75A 2HZDA 3OL4A 5CKTA 3J7AY 3KMTA 2XF7A 4JDSA 1P9QC 3OYKA 2V4JC 2VQLA 3PL8A 3S32A 4YPAA 4YPEA 5CCLA 5TTFA 2IGOA 2UV1A 2W00A 1BOBA 4NUBA 3SDBA 4XN0A 2L5QA 3MO5A 4LDGA 1LFPA 1G59A 2R7WA 4JOMA 3QOEA 3OYNA 4PFPA 3F9ZA 2DJIA 3OMYA 5F59A 3RJWA 4ZTJA 2GOMA 3S7BA 3MKZA 3DLAA 4XMYA 2ZSHB 3OXFA 4H4KC 1WJAA 4XL9A 2CV1A 4CCLA 2HVSA 5HVQC 3IHXA 1MMAA 3EP0A 3HG9A 1YE9A 3OPEA 3SW9A 3DKYA 2CV0A 2KRHA 2M0MA 4RLFA 4CUGA 1ML9A 4RLQA 1JI8A 2R7SA 4YRVA 4GRIA 3W2VA 3CBPA 3HNAA 3HOSA 3PSIA 4LIUA 2R7RA 2VPLA 3I9V2 2MABA 3LFUA 1X4PA 2LG4A 1MT6A 4XLEA 1KONA 4NJ5A 5HOOA 3K4BA 2E5NA 2IS2A 2QKLB 2ZXIA 3IAS2 4BS9A 3FBNB 2HPMA 3N71A 3S7JA 4AYBA 1Z3YA 1S9HA 2X85A 1N6CA 1NG7A 3L2WA 2VQCA 1OLTA 4XKCA 1FMWA 2MYSA 1MVXA 3RAYA 4E7ZA 4LITA 3HXLA 2IS4A 3K4JA 4XR6A 3TBIA 2LY1A 4II3A 1UELB 1X4OA 1TT0A 1W36D 5JJ0A 2K3PA 3K5KA 4RM2A 5CQGA 1Y6IA 4C2TA 2W5YA 2R7XA 4BJ6C 1IRXA 2WA0A 1LDKB 3OYHA 5CCMA 4D9JA 2HVRA 2M3AA 4YNMA 2A5WA 1W36C 5F5EA 1WJ5A 5ARFA 3K70D 3PFYA 3LSKA 4DGWB 4C2UA 3ONQA 4XKBA 3VYUB 3LMMA 4BUPA 1YX5A 5CPRB 4EATA 3A1YA 4PJLA 3K6GA 3UR3C 3K70C 1DGWY 3G2BA 4O30A 4IQJA 4NQWB 1D0YA 2WAEA 4XKVA 3OS5A 4OAZA 4O6FA 2OV7A 2V7FA 2JA2A 3VSKA 1D0XA 4DOZA 3OYDA 2R3AA 4JQFA 2L9SA 3MO0A 2VXDA 3OYGA 3LSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KMA A;  4YNP A;  3M58 A;  3OOI A;  5LSZ A;  5F6K C;  3VV0 A;  3QWV A;  3PDN A;  4J83 A;  4YPA A;  4YPE A;  5CCL A;  3M57 A;  5TTF A;  2IGQ A;  3MO5 A;  2F69 A;  4LDG A;  3QWP A;  3DB5 A;  3F9Y A;  3CBM A;  4C1Q A;  4E47 A;  1MVH A;  3RQ4 A;  4QEP A;  3F9Z A;  5F59 A;  5KJK A;  4RZ0 A;  3RJW A;  3S7B A;  4J7F A;  3OXF A;  2BQZ A;  4MI5 A;  3RIB A;  1O9S A;  3OXG A;  5JIN A;  5F6L A;  3KMJ A;  3VUZ A;  3M56 A;  3TG5 A;  3MO2 A;  2RFI A;  3IHX A;  3EP0 A;  4I51 A;  3OPE A;  4JLG A;  3SW9 A;  4AU7 A;  3S8P A;  3RU0 A;  1ML9 A;  3CBP A;  3HNA A;  3S7D A;  2O8J A;  1H3I A;  2G46 A;  2QPW A;  4J8O A;  3QWW A;  1MT6 A;  4NJ5 A;  1N6A A;  5KJN A;  3N71 A;  3M55 A;  3S7J A;  5LSX A;  5EG2 A;  1N6C A;  1XQH A;  4QEN A;  5TEG A;  1MVX A;  3RAY A;  3MEK A;  5HQ8 A;  4H12 A;  1N3J A;  1ZKK A;  5EX3 A;  5T5G A;  2W5Z A;  5JIY A;  5TH7 A;  5JJ0 A;  3M54 A;  3K5K A;  2W5Y A;  4Z4P A;  5AYF A;  4YPU A;  5HI7 A;  5CCM A;  4YNM A;  5F5E A;  3M53 A;  5ARF A;  3F9W A;  1MUF A;  5JHN A;  4BUP A;  3M59 A;  5T0K A;  3DAL A;  5CPR B;  4MI0 A;  4NVQ A;  1PEG A;  5EX0 A;  4O30 A;  3BO5 A;  3FPD A;  3CBO A;  5KJM A;  3OS5 A;  3TG4 A;  5KJL A;  4FMU A;  4O6F A;  4J7I A;  3F9X A;  2JV0 A;  4IJ8 A;  4QEO A;  4IJD A;  3S7F A;  2R3A A;  4WUY A;  3M5A A;  4YND A;  3SWC A;  3OXL A;  3MO0 A;  5T0M A;  3KMT A;  5ARG A;  4JDS A; 
#chains in the Genus database with same CATH topology
 3BC8 A;  4CGZ A;  1ZRF A;  5DM6 F;  2VKH A;  4C3I J;  3QWV A;  3H9G A;  5CVU A;  5IT3 A;  4FET A;  1UZC A;  4RAF A;  4NC6 A;  4PDK A;  4E7K A;  2GBY A;  2IW5 A;  4JX6 A;  3FF5 A;  3LFK A;  3S2W A;  4C1Q A;  3RPU D;  3GZ5 A;  4YFK F;  2CW7 A;  2ZJP F;  4YG2 F;  2VL8 A;  3TGN A;  4NBQ A;  4G7O F;  3TL4 X;  3EUH C;  2K5C A;  2NS0 A;  5HLT A;  2PMZ N;  1KQ9 A;  2K02 A;  1H88 C;  3A2K A;  3V7C A;  4XQF A;  4OAY A;  1ZKG A;  2UZK A;  1U5T C;  5TJJ A;  1K79 A;  1AKH B;  1MGT A;  2F48 A;  3ZQH A;  4BBS J;  2BOL A;  4KIC A;  3A01 A;  2G0E A;  2A07 F;  3ABK H;  5FD5 A;  2IJL A;  1HW2 A;  1XSD A;  1TWF J;  3C2B A;  3JR9 A;  1YIO A;  2O8J A;  3J81 Z;  1X3Z B;  5L3E A;  2W85 A;  4UVB A;  5IOZ A;  1QBJ A;  2BHY A;  2IEK A;  2NVY J;  1I3Q J;  5FLV A;  1J7K A;  5HLG A;  1ZAO A;  3BJA A;  3SXY A;  1XC5 A;  4R79 A;  1YYV A;  1X1B A;  1BM9 A;  3PUF A;  5J40 A;  1VQP I;  2F4O B;  2DA3 A;  2XF6 A;  4EV0 A;  3E5X A;  4HF1 A;  4ANJ A;  3K10 A;  1BC8 C;  4C3H J;  3NWS A;  4EM0 B;  5FRN A;  2XSD C;  2JA7 J;  3CZ6 A;  1TNS A;  4ZDO A;  3SEZ A;  3GTL J;  2D1H A;  3DTK A;  1BJZ A;  3PIP F;  2R92 J;  1ZKK A;  3UNG C;  5AIQ A;  3ZRG A;  5DV5 A;  2K9N A;  1CQT A;  2DMQ A;  2HWV A;  3IWF A;  4W97 A;  1FNN A;  2VQH A;  1OYI A;  2KL4 A;  3I53 A;  3SZT A;  3K0L A;  1CGP A;  2CYY A;  5J4Y A;  4CSW A;  2LLK A;  3HIF A;  5H2F C;  1WJE A;  1HDD C;  2JK3 A;  5CVI A;  2CWE A;  2BVM A;  2ELK A;  4G9Y A;  5D5U B;  4RAG A;  2B63 J;  3PNY A;  2VLA A;  5FO5 A;  2HTJ A;  1R71 A;  2WAD A;  5JHN A;  3TP0 A;  3DAL A;  1WRJ A;  3W2A A;  4M9S A;  3ASO H;  4LLN A;  3FM3 A;  4DBR A;  2V1N A;  5KJM A;  3E1S A;  4E7H A;  3DU6 A;  2E7W A;  4I02 A;  2BVL A;  4J7I A;  2GWR A;  2CO5 A;  2L01 A;  2CQX A;  5J1U A;  2BYV E;  3HTS B;  5FLX K;  2VKD A;  2HXO A;  3G6E I;  1HA8 A;  2BGC A;  4EJU A;  1GUU A;  4YNP A;  5IP9 J;  1R6R A;  5F6K C;  1UHM A;  1Y0U A;  5E8G A;  1GVJ A;  2O7O A;  1PP8 F;  4LLG F;  2UWM A;  2OPT A;  4AVP A;  5FJ8 J;  4DBQ A;  2M8G X;  3I0T A;  1PJR A;  2DFE A;  2GXG A;  2EV6 A;  1SAX A;  1RI7 A;  2Y0M A;  2DA4 A;  2DW4 A;  1UST A;  3BR0 A;  2DPD A;  2VUM J;  5CVR A;  3DFG A;  4ON0 A;  3AFH A;  2K86 A;  3VSL A;  3WGG A;  4C3J J;  1E3O C;  4EJT A;  2Z2S B;  5E3L A;  4FX4 A;  3U9G A;  2LD5 A;  5B3S H;  4KA4 A;  2FX0 A;  1D1B A;  5EZG A;  5F6L A;  5D6E A;  1W7P A;  1YFH A;  2F6C A;  4PJ0 C;  1CF7 A;  3AG1 H;  4ESF A;  2KQR A;  1ZH5 A;  1RIO H;  1B8I A;  2DMU A;  3FX3 A;  3NQO A;  1IUY A;  1D5Y A;  3S8P A;  1REP C;  4IHX A;  3ABT A;  1LPQ A;  1DGR M;  1JT6 A;  3CDI A;  4I0B A;  5F1R A;  3HOZ J;  3PQJ A;  3S1M J;  2CV2 A;  4JX4 A;  4XLC A;  2K3F A;  2E2H J;  1FT9 A;  4P96 A;  4F52 A;  3FXL A;  1WVR A;  5CVJ A;  4BE1 A;  3BTL A;  1Y8Q B;  3Q9S A;  2R5Y B;  1LFU P;  2DMT A;  2JWT A;  2DPU A;  3HOX J;  2QQ9 A;  3HOT A;  3DBH B;  1X3W B;  3IC7 A;  1GV2 A;  2WY7 Q;  3IH3 A;  3QYB A;  1T8I A;  2QGU A;  3ZQC A;  3BWG A;  3B02 A;  4O3M A;  3MEK A;  1MMG A;  3KP7 A;  3ESW B;  2DT5 A;  2W84 A;  2KDO A;  1I6X A;  3F8N A;  2LTP A;  4LK1 F;  3BG5 A;  4GDF A;  2Z1D A;  4PUS A;  2V9P A;  1OMI A;  2VN2 A;  4U7B A;  4Z4P A;  4H0E A;  2X1C A;  3LA3 A;  2R7F A;  4DYQ A;  3LNQ A;  1MMS A;  3FXU A;  3K2Z A;  3L2U A;  4HSR A;  2YPR A;  3HJE A;  3VPR A;  2ESN A;  2KPM A;  1Y8R B;  1D1A A;  2K9L A;  2OZ6 A;  3ZMD A;  5GTI C;  4ESB A;  1BIA A;  3W6V A;  4PJJ A;  4FE7 A;  1PEG A;  3HHG A;  3CMM A;  4IOC F;  2RQQ A;  5J8F A;  2HOE A;  4HW0 A;  3LQQ A;  2R0Q C;  3IHU A;  4ENK A;  1XMK A;  3CMY A;  2WY8 Q;  4FMU A;  2ECC A;  1B9M A;  4YEL A;  3JW4 A;  4IJ8 A;  4F55 A;  4QEO A;  4PFO A;  2XVC A;  2LYC A;  4B48 A;  2R4G A;  4V19 K;  1GV5 A;  5T0M A;  3OYE A;  2FQ4 A;  2M8E A;  2QYO A;  4A3K J;  1U2W A;  3BCA A;  5GAH J;  4E7J A;  3TW7 A;  1Z0X A;  2DDA A;  1H9T A;  1J59 A;  3CBM A;  1MVH A;  4HLX A;  3TDZ C;  4DJA A;  2DA1 A;  3VYT B;  2BW3 A;  1IN6 A;  4D5C A;  4L9T A;  1XB4 A;  5FLX Z;  3HOU J;  2W4S A;  3HZJ A;  4UV8 A;  2BQZ A;  1TWH J;  1QZY A;  2I8D A;  4C9Y A;  2YUS A;  3T0Y A;  3H3Z A;  1YJ9 I;  1Z6R A;  4HYE A;  2Q1Z B;  4GGG A;  2VQG A;  4MEY F;  3D1N I;  3OIQ A;  1R1U A;  3S14 J;  3VUZ A;  1QZE A;  3H0G J;  1PP7 U;  2QF7 A;  4LGW A;  3GBG A;  2NRA C;  4EJV A;  2E1M C;  3FWE A;  3GUD A;  4LMY A;  4MFD A;  1DU0 A;  2B0L A;  1LVA A;  2DA7 A;  4BEH A;  4HBL A;  2W7N A;  1TTY A;  4I6Z A;  4GYI A;  4U7D A;  3VWB A;  1S7E A;  3KEQ A;  3FXQ A;  5E20 A;  3QYF A;  3COA C;  5ICC A;  5L3D A;  1I1G A;  2L2O A;  1ZLK A;  1BJA A;  1G3S A;  1JXS A;  5K5O A;  3F9K A;  2R5Y A;  5LGU A;  4IPA A;  3V8L A;  4OMY A;  2Q2E B;  2R7T A;  4OIQ F;  1DP3 A;  3DU5 A;  2DT7 B;  4EEF G;  4IOA F;  4IO9 F;  3ELK A;  1RRJ A;  1WPK A;  4ZYD A;  3GO5 A;  4V2F A;  3I71 A;  1V5G A;  3GF2 A;  4M6V A;  1P2F A;  1T95 A;  1TQP A;  5M5W J;  2EZK A;  3CES A;  1EF4 A;  3GFL A;  1KU7 A;  1G3T A;  3EYI A;  1IC8 A;  1G6N A;  3K4L A;  1FOX A;  1Z67 A;  4YPU A;  3FDY A;  2A6T A;  2AXT C;  1ZGW A;  2P7V B;  3DWL E;  5EJC A;  3U1K A;  4BKX A;  2XB0 X;  3GTQ J;  2ZJR F;  3PNT A;  4EM2 A;  1QHG A;  3M1C A;  2AQE A;  3RTR A;  1RR8 C;  1FTT A;  4G12 A;  3WG7 H;  4Y33 A;  3TG4 A;  1YW9 A;  1JT0 A;  4PSW A;  4JBA A;  4F3Q A;  3BT9 A;  4HNU A;  3F72 A;  1XTA A;  3HYI A;  2XAJ A;  4XSZ F;  4G94 A;  3EUA A;  2FF4 A;  3B6C A;  2Y30 A;  2XC7 A;  1HCR A;  5B5E C;  5LD2 C;  4M73 A;  5KNL A;  4UXN A;  3WGH A;  4ABZ A;  2HZD A;  3R0J A;  4L5J A;  1FEX A;  2YX4 A;  3GCM A;  3OYK A;  2V4J C;  2VQL A;  4F7Z A;  3K9T A;  3S32 A;  1U3E M;  4YPE A;  5TTF A;  1IV6 A;  2IGO A;  2UV1 A;  3B73 A;  4XN0 A;  2L9V A;  3G71 I;  1IN7 A;  2R7W A;  4UVA A;  3G73 A;  3CO7 C;  3JRF A;  2OTL I;  3F9Z A;  3HRU A;  2DJI A;  3CJT B;  5F59 A;  5DYM A;  2OU2 A;  1J9I A;  2EFN A;  2GOM A;  4AM3 A;  3RJW A;  1FBU A;  3DLA A;  5M5Y J;  3S7B A;  2ZBK A;  1LE8 A;  4BBR J;  4L0Z B;  2XPV A;  4Q47 A;  3S1N J;  4QWQ A;  1FIA A;  5DS9 A;  3DBR B;  1NTC A;  1ZG3 A;  2CW0 F;  2RAE A;  4ENN A;  3CF5 F;  1BI3 A;  3IHX A;  1SFO J;  5GPC A;  2LF8 A;  3OPE A;  3L1P A;  2X0L A;  4M3F A;  3DKY A;  3SW9 A;  1FY7 A;  1FBS A;  2L0K A;  4CUG A;  1F1Z A;  5ILU A;  3RKY A;  4A3F J;  1ML9 A;  2ID3 A;  1FYL A;  3TED A;  1XMA A;  3PSI A;  5EEH A;  2F5C A;  1YW7 A;  3WTV C;  1T6S A;  3KP3 A;  4I01 A;  3FKI J;  2BY0 A;  2PMU A;  5FLM J;  2LG4 A;  2ADU A;  1RC9 A;  1G3W A;  2NS8 A;  2DA5 A;  1KON A;  2LF7 A;  4RAY A;  3V8J A;  1ZRC A;  2E5N A;  3ZP5 A;  2V1X A;  3IH2 A;  3IRQ A;  4AC0 A;  1B72 B;  3BTI A;  2NOG A;  2HPM A;  1UB9 A;  2DFI A;  2DFH A;  2X85 A;  2Z99 A;  1MDM A;  1RET A;  1A31 A;  3I4P A;  3KLN A;  1MVX A;  2GM4 A;  3E6C C;  3ML6 A;  1KQ0 A;  3CQZ J;  2FU4 A;  2KRF A;  3K4J A;  3TBI A;  1HKS A;  1X4O A;  1W36 D;  5FB2 A;  2W5Y A;  4RGR A;  1O4X A;  1POG A;  2JUC A;  1VQ6 I;  2ZXW H;  1LDK B;  1L0O C;  3MCZ A;  4LJZ F;  2HVR A;  2M3A A;  2RVC A;  2H1K A;  2A5W A;  5AIP A;  3RYR A;  3RPQ A;  5ARF A;  5L3F A;  4C2U A;  3E3V A;  1FLI A;  3ONQ A;  4KN4 X;  1IN8 A;  4XKB A;  3LMM A;  1YIT I;  1H8A C;  4UNO A;  2YU3 A;  3BP8 A;  4EAT A;  4LB6 B;  3A1Y A;  4PJL A;  2HQR A;  5FFX A;  3H1C A;  4I76 A;  4FX0 A;  3K70 C;  1DGW Y;  1YRN A;  2BXY A;  5BMZ A;  4NQW B;  1U9O A;  2WAE A;  4OAZ A;  1JUP A;  4KMU X;  1K4T A;  2LSO A;  2ME0 A;  4O6F A;  2R7Z J;  2DJN A;  1P7I A;  3JRC A;  3VSK A;  4HX8 A;  3FIW A;  3OYD A;  3E7L A;  3R6S A;  1VQL I;  3C1D A;  1HOM A;  4XBF A;  2VPR A;  1HSJ A;  3OYG A;  2HYF A;  2F5E A;  3M58 A;  3IUO A;  3OOI A;  4N4O B;  3WTT C;  4LG3 A;  2W57 A;  1XGS A;  1VQO I;  3BZK A;  4NB5 A;  3MZY A;  2YU9 J;  3K1N A;  5K5R A;  2E34 A;  5CLS A;  5B1B H;  2E36 A;  1WGX A;  2A6E F;  3CDH A;  1E3P A;  4A3L J;  2OAZ A;  4ZDP A;  2QKM B;  1HW1 A;  3OYB A;  1ETV A;  5DDG A;  3KP6 A;  4XOT A;  5C4J J;  4EJW A;  1OKR A;  2F5F A;  4O5V A;  4A3B J;  3ABL H;  3DEE A;  2HYG D;  3OS0 A;  3SYT A;  2KZV A;  1DDN A;  1IDY A;  4D7N A;  4E6K G;  4YFX F;  4ZDL A;  5D8L B;  2HS5 A;  3CUQ C;  4XON A;  1ZR4 A;  3IKV A;  1YI2 I;  2RKH A;  3I55 I;  2OCC H;  1Q1V A;  3GFM A;  1IN5 A;  4UUT A;  1FYK A;  1G4D A;  4J19 A;  5IYB J;  2MD5 A;  4B09 A;  1VI0 A;  2JTV A;  2G46 A;  1D8K A;  4UV9 A;  1MW7 A;  4HG2 A;  5LHH A;  1FP2 A;  3TOA A;  2HPI A;  1ACI A;  2GOX B;  3EUH A;  3CCM I;  3OSF A;  1JE8 A;  2AXL A;  3K4N A;  1R9T J;  1TQI A;  4Q4Z F;  2QQ8 A;  2DOD A;  4M72 A;  1U5T A;  5EEA A;  1Y39 A;  3DPU A;  3RSN A;  3CCQ I;  1SFX A;  4G7H F;  1JTY A;  2EK5 A;  4XLA A;  2AO9 A;  2DYR H;  4CH7 A;  1G3Y A;  5E1X A;  2E1O A;  1IV8 A;  3SFZ A;  1LEA A;  1HKQ A;  1EH6 A;  3CD6 I;  3BG3 A;  2E71 A;  5EZH A;  4B44 A;  3HOY J;  4KNY A;  4A69 C;  2K9Q A;  1QRY A;  4HNT A;  3CMA I;  1YX3 A;  2GIV A;  4YIF A;  2DA6 A;  2V9K A;  2X6X A;  2Y9Y A;  3PIO F;  2O8X A;  2VE9 A;  1BI2 A;  3OR2 C;  3MFK A;  3ZCO A;  2CS3 A;  4UB8 C;  2FOW A;  2Z16 A;  1R22 A;  5DCF A;  4PJN A;  4OWR B;  2MC3 A;  5J6X A;  3ZOB A;  2GIZ A;  3F9W A;  1UG2 A;  3H0D A;  4BNC A;  1NHA A;  1P92 A;  1ZG5 A;  1YOV B;  5B66 C;  1BR4 A;  1H9G A;  1K61 A;  4IRI A;  3ECO A;  2AQF A;  2E2I J;  1Z05 A;  3C18 A;  1MBK A;  1AU7 A;  1KU2 A;  3RIR A;  1R23 A;  2CJJ A;  1EJ9 A;  1JGS A;  1SFK A;  2QEN A;  1ITY A;  1K4S A;  2ZFU A;  1F36 A;  5LEK A;  4ESJ A;  1U6G A;  2FBI A;  4BHC A;  2KDZ A;  3S7F A;  2K85 A;  2M4K A;  3BOQ A;  2L02 A;  2B9S A;  3KZZ A;  1BL0 A;  3KMA A;  3DXJ F;  2GQQ A;  2BY2 A;  1DQU A;  1ETK A;  3S3N A;  4KUM A;  1MD0 A;  4CCJ A;  1HKT A;  2M7B A;  4IHY A;  2PMZ A;  5DD4 A;  4I99 C;  3CUO A;  2MH9 A;  3DV8 A;  1I5Z A;  4N0B A;  2D1V A;  2J5O A;  1Z9C A;  4JK1 X;  4XSX F;  4LB5 A;  3CC2 I;  3KYD B;  2OCE A;  1OCC H;  1TWG J;  5EEG A;  3OYI A;  2EH3 A;  2EZI A;  4HQE A;  4RZ0 A;  1YG2 A;  2KMU A;  2A68 F;  1UAA A;  3JSP A;  2QEX I;  4BHB A;  1HC8 A;  3ZPL A;  3LSM A;  3GTJ J;  2VJI A;  5J1Y A;  3J7A O;  1KZH A;  4CA0 A;  3G3Z A;  4BQN A;  2FOK A;  2CFO A;  3TOB A;  3GZ6 A;  1YTY A;  1WJB A;  5LLQ A;  2ZME A;  4HA8 A;  4L18 B;  2WV1 A;  3HUG A;  4AU7 A;  1DUX C;  1ZRD A;  2EZH A;  2XHK A;  2JA5 J;  1O57 A;  4DNC A;  4QIW N;  1S7O A;  2BY1 A;  2GA2 A;  2G9W A;  4P5O A;  3GTM J;  4UY8 I;  5C4X J;  3CCS I;  3S7D A;  3JRD A;  3S3M A;  5K7Z A;  2QPW A;  1MH3 A;  1FSH A;  4J8O A;  3QWW A;  1W7P B;  4HF2 A;  3OOU A;  2K4B A;  1CF7 B;  1B8I B;  1OR7 C;  1FOY A;  4IHV A;  3E6B A;  1WFX A;  4II2 A;  2KJC A;  4WX9 A;  2XGD A;  2DXI A;  1LQ1 A;  1XQH A;  1YIJ I;  3R0A A;  5TEG A;  3SEQ A;  3LSR A;  5E17 F;  3MKW B;  4BJT A;  3Q0U A;  2DTR A;  1RKW A;  3JTG A;  1NG6 A;  2IGM A;  3LA2 A;  2CUJ A;  1D3Y A;  3KE2 A;  3D5R C;  3I56 I;  3RYP A;  5T5G A;  5LHI A;  1JHF A;  3QAH A;  2OC6 A;  3N05 A;  4NC7 A;  2DBB A;  3I4M J;  3HL2 A;  2L4A A;  3KP4 A;  1Z7U A;  4IHW A;  2O0Y A;  3VOE A;  1HDP A;  2FNP A;  2RQP A;  3A4C A;  4F92 B;  2HOS A;  2K40 A;  2W1O A;  3ZN1 A;  5D6F A;  4A3E J;  3NWT A;  4X6A J;  1PUE E;  4WXC A;  3FK7 A;  2NVU B;  5JVT A;  4KIF A;  3FKJ A;  1TWA J;  4M6Y A;  1R4N B;  2CQK A;  3AL0 B;  2CH0 A;  1MJB A;  4RGS A;  4IRG A;  4XLP F;  4J00 A;  3OOP A;  2E1N A;  3LQR A;  4L5E A;  4FCY A;  1YJN I;  2IVM A;  2IBD A;  5IP6 A;  2IS6 A;  1YJW I;  1Z7L A;  2XAG A;  5DEQ A;  4BXF A;  4YFN F;  2IS1 A;  3FPD A;  1UG0 A;  2HFH A;  3K4C A;  3DTE A;  2X6O A;  2RNG A;  3JTH A;  4XRF A;  2IAI A;  4IJD A;  5C3E J;  3V42 A;  2XKO A;  4M3D A;  3WTY C;  3FIS A;  4LOC A;  1R7J A;  2R5Z A;  2M34 A;  2LBF A;  1JKO C;  3K1P A;  5IYC J;  3H92 A;  4CYD A;  2CW8 A;  4KMF A;  2WAQ N;  4MQ9 F;  5JVG F;  4J83 A;  1MBH A;  3F3X A;  5HS8 A;  3NRV A;  2ZCW A;  1A04 A;  2DK8 A;  4EGZ A;  3IAM 2;  1AA7 A;  1H0M A;  3QQA A;  3ZQ7 A;  4HAM A;  3G1M A;  1IUF A;  2TDX A;  4A6D A;  3ZGK A;  2DT6 A;  3AG2 H;  2M1B A;  5LFA A;  2BZT A;  3BTC A;  3BZ6 A;  2X48 A;  4C30 A;  5KJK A;  3DF8 A;  4XOR A;  5HDG A;  3NAR A;  4HQM A;  1XDS A;  1QU3 A;  2ESH A;  3CP8 A;  2NOJ B;  2NXN B;  4J7F A;  4DIQ A;  3IP4 B;  2DTZ A;  4A3G J;  3A02 A;  1O9S A;  3Q5F A;  4MLO A;  2LY2 A;  3RDI A;  3KZI C;  3WE3 A;  4A5N A;  2NVX J;  1QGP A;  4ZYH A;  3KMJ A;  3M56 A;  2EIJ H;  1WH5 A;  4BJ5 C;  1BN5 A;  1T56 A;  4Y15 A;  3RQI A;  3S1R J;  2KJB A;  2ZME C;  4BY1 J;  2OF7 A;  3RU0 A;  1OCP A;  3EUK L;  1SAN A;  2BW3 B;  4XK4 A;  2YX7 A;  5JI6 A;  1R5H A;  4RS8 A;  2E5Z A;  3GW2 A;  4D7M A;  1TT5 B;  4BXU A;  2VKV A;  3GTO J;  1T08 B;  3F8C A;  3I5U A;  1XGO A;  2DI3 A;  4CZC A;  1F9N A;  4MHG A;  2FRH A;  2EA2 A;  2G7U A;  3HSE A;  4M9X A;  1VQM I;  2LC2 A;  1IAW A;  4ZYE A;  3HB9 A;  3OSG A;  2X6Y A;  2W25 A;  3OV8 A;  2ME6 A;  4BAC A;  2A61 A;  3QP6 A;  5M3M J;  4BQO A;  3OYJ A;  2JVG A;  3CCY A;  2XRL A;  2M87 A;  5FFZ A;  4M3G A;  4ZZL A;  1BIB A;  4BEH B;  1R49 A;  2KLO A;  1HF0 A;  2KIS A;  4AD9 A;  3WTX C;  4X1E A;  4RGU A;  2JN6 A;  1FJL A;  3F23 A;  4H12 A;  1IW7 F;  2JRM A;  5TH7 A;  2GXB A;  5GAD J;  5EYR A;  3TMO A;  2ID6 A;  2CUF A;  2XUB A;  5FKK A;  2CUE A;  3OYC A;  2EPF A;  3DQV C;  2H94 A;  3I3L A;  4B8X A;  3M53 A;  3GWZ A;  2A5Y B;  2L4M A;  2MSY A;  4WK8 F;  4KT6 A;  2FBK A;  2Z5U A;  3W6J B;  3F0C A;  3CCJ I;  1F4K A;  3REO A;  2L7F P;  2MA3 A;  1MBJ A;  1JTX A;  5J3L A;  4ZTF A;  3H5N A;  2A05 A;  4IQ4 A;  1X1D A;  4PK4 A;  1D5V A;  1HW5 A;  3TO6 A;  3LWF A;  2QA4 I;  3CBO A;  1K6Y A;  2QSH X;  2R93 J;  5F0C A;  4WCG A;  4B3A A;  1C0W A;  1OCO H;  1X2N A;  2M5W A;  2O9L A;  3M5A A;  2BXZ A;  3OXL A;  3OL4 A;  5CKT A;  5EGO B;  1IDZ A;  2OA4 A;  3KMT A;  1EV7 A;  2Z3Y A;  1P9Q C;  2QQB A;  3FXK A;  3PL8 A;  1GT0 C;  2EQR A;  5CCL A;  3LST A;  1SVO A;  1EH8 A;  2W00 A;  1BOB A;  3SDB A;  1IRF A;  3PFI A;  1ETO A;  1LFP A;  2COB A;  4RB1 A;  2IRF G;  4OIO F;  3OYN A;  2IA2 A;  1KA8 A;  3FXJ A;  3OMY A;  2VT3 A;  4ZTJ A;  3MKZ A;  1PUF A;  3E5U A;  5D5V B;  1QVU A;  4H4K C;  3GFJ A;  4PGH A;  4U0V A;  1TQM A;  2ZXJ A;  4XL9 A;  2FMY A;  2LK2 A;  3VEP A;  3ZQI A;  2M0C A;  3CC4 I;  4CCL A;  2HVS A;  1W1W E;  1SD4 A;  5HVQ C;  2E35 A;  4EM1 A;  3RZD J;  4UUS A;  4MEX F;  2BEO A;  2FXA A;  3QPL A;  2KRH A;  2M0M A;  1EKE A;  1BC7 C;  3J7Z I;  4GRI A;  3W2V A;  3HNA A;  1WI9 A;  2LNB A;  1LE8 B;  2NNY A;  1NK2 P;  4CXF A;  1JKQ C;  1UFM A;  3P9C A;  2M9H A;  3CJN A;  2VPL A;  4XLN F;  1W5T A;  2MAB A;  5ED4 A;  3LFU A;  3L09 A;  1X4P A;  2KFD A;  2OZU A;  4OMZ A;  1IZ1 A;  4R8H A;  2RC4 A;  1RKT A;  1ULY A;  3K4B A;  4IJA A;  2IS2 A;  1S29 A;  4A0X A;  1JUS A;  2ZXI A;  2V1D A;  5J8C A;  3N71 A;  1TC3 C;  2IPQ X;  3S7J A;  2GXA A;  4AYB A;  1Z3Y A;  5HLI A;  1FWZ A;  3I64 A;  2CGP A;  1N6C A;  1NG7 A;  2GAU A;  3L2W A;  1FYM A;  1OLT A;  4XKC A;  3V4G A;  3RAY A;  2IA0 A;  3F6O A;  2CQ7 A;  2Y9Z A;  3EDP A;  4IXA A;  3T1B A;  2FQ3 A;  1A35 A;  4XR6 A;  4II3 A;  4ZYG A;  3DCF A;  1TT0 A;  2ZJQ F;  5JJ0 A;  1HST A;  2K3P A;  4C2T A;  1B59 A;  4Z2Y A;  2RNJ A;  3OYH A;  1JJ8 C;  2ZJ2 A;  4D9J A;  1MDM B;  3MWM A;  3GVA A;  2HKO A;  3QU3 A;  3J80 K;  1QQI A;  1W36 C;  4Q5S F;  5F5E A;  4QSH A;  5B1A H;  3PFY A;  3LSK A;  4DGW B;  2OD5 A;  1MJ9 A;  4CIC A;  5CPR B;  3QPH A;  4S05 A;  1SEU A;  2NS7 A;  3MZH A;  2M30 A;  1GDT A;  4O30 A;  3G2B A;  4RAZ A;  4OIP F;  1U9N A;  3C3W A;  2KIM A;  5IT9 K;  1EH7 A;  1F5T A;  2HOT A;  2OV7 A;  1MBF A;  3JAM K;  3E6M A;  4BYY A;  1ON2 A;  1RES A;  5H20 A;  4CYC A;  1WCM J;  4DOZ A;  5CVV A;  4AYB N;  2JMW A;  3HDD A;  2P5V A;  4JQF A;  4M6X A;  2VXD A;  3N4M A;  3LSI A;  3S2D J;  1RNL A;  2M7A A;  3TO7 A;  2VE8 A;  2XPW A;  1YRN B;  1YHQ I;  5EGO A;  3MD2 A;  3O8G A;  3L2C A;  5LRR A;  3WGI A;  4RMN A;  2HQA A;  1LUJ B;  2MFZ A;  2F5D A;  2YSR A;  4ETS A;  2JSP A;  1HXD A;  2O6G E;  4R1H A;  3CF2 A;  4HPQ A;  2RN7 A;  3E97 A;  1ZYR F;  5GP9 A;  3TW6 A;  2FA5 A;  1V5F A;  4KYW A;  2HNH A;  3DLL F;  2QUF A;  1E2X A;  2X1D A;  5K1Y A;  2ZNY A;  1FOK A;  1FX7 A;  3R61 A;  4M9Z A;  4IKF A;  5D4R A;  3MO2 A;  3Q9V A;  4ZYA A;  4KIS A;  3H5A A;  2GZW A;  4XM3 A;  3VYR B;  2X51 A;  1MBG A;  3KFW X;  3ZQL A;  1O3S A;  3LSJ A;  4YII A;  3C2G A;  5ERI A;  4LG0 A;  4EJO A;  3KEY A;  4NC8 A;  5JHF A;  1H3I A;  2P6S A;  3IKT A;  1F43 A;  3H36 A;  2DCE A;  3RPU A;  4DYC A;  3JRE A;  2ICW G;  3KCC A;  2E2J J;  3OY9 A;  3I59 A;  2DMP A;  5L3C A;  1N6A A;  2IP2 A;  4Z6Y A;  3HOW J;  3DBL B;  2P0W A;  1JKR C;  3J7Y J;  3FHZ A;  2H8W A;  2P8T A;  1QA6 A;  1QZZ A;  3OIO A;  2CG4 A;  3OL3 A;  3KLO A;  4ZC3 A;  2VJ5 A;  3CCV I;  3CUQ A;  2ISY A;  2K9S A;  4XNF A;  2K27 A;  4I7H A;  2XAS A;  3K2A A;  4A5M A;  1AOY A;  1DPU A;  5JLW A;  2J5P A;  3S17 J;  1I27 A;  2EIM H;  3V8K A;  2CQQ A;  3BG6 A;  4BE2 A;  4QPO A;  2W5Z A;  1T0F C;  3T8R A;  2ZSI B;  3ABM H;  3KET A;  3M54 A;  5HOD A;  3FMR A;  1J2X A;  3K4K A;  1U5T B;  1MSE C;  2M2E A;  4HRI A;  4XLF A;  1R5G A;  3WHC A;  3OYA A;  3EYY A;  1S3J A;  4M74 A;  4XID A;  2WV0 A;  5KAF C;  2BE5 F;  2MLK A;  1WQ2 A;  2HXI A;  5IP7 J;  2R7U A;  3QYE A;  5EX0 A;  3FXM A;  1I39 A;  1MSF C;  4OIR F;  2VB6 A;  3KX2 A;  3BPV A;  4RB2 C;  3S2H J;  3L2R A;  1RUN A;  4F91 B;  3BR5 A;  2PJR A;  1W7P D;  4HV6 A;  3M8F A;  1R00 A;  3F9X A;  4MO7 A;  1UHW A;  2E19 A;  3ISP A;  4RBO A;  1GLN A;  3J80 Z;  4HDV A;  1SFE A;  1X1A A;  3SWC A;  1QVT A;  2ZFW A;  3E6D A;  3ZQQ A;  1USS A;  1IF1 A;  4G6T B;  3KYL A;  2P4W A;  3H9J A;  5FRM A;  4L9N A;  2QCO A;  5BPD A;  4HST A;  2D2W A;  4G8X A;  2ZXH A;  2DFF A;  3F8B A;  2UXX A;  5IT9 Z;  2F69 A;  1FSE A;  3QWP A;  3FHN A;  3F9Y A;  3JAM Z;  3CO6 C;  5GAE J;  2QZ8 A;  3TQN A;  1YS7 A;  3C7J A;  3W3C A;  4RGX A;  3VOD A;  3DEU A;  4OU0 A;  2KHM A;  2FBH A;  2O3F A;  2KT0 A;  4MTE A;  4BY7 J;  4N9H A;  2MH2 A;  3IL2 A;  1Y56 A;  3TG5 A;  2RFI A;  1XCB A;  2VBY A;  5LBQ A;  3OR1 C;  3SZG A;  2NNN A;  3SHF A;  3MMY B;  3R4K A;  1OFC X;  2EB7 A;  1NK3 P;  2DLL A;  3QPT A;  5KHD A;  1BW6 A;  4P9F A;  3CC7 I;  1Z1D A;  4LFU A;  2XAQ A;  2LKP A;  5DD8 A;  3HPH A;  1YO5 C;  4MQV A;  2ZME B;  5JHU A;  1K78 A;  2WTE A;  4Y17 A;  3CDL A;  3HUG B;  3LAP A;  4IVN A;  4A0Y A;  5FKL A;  3JRA A;  2X6W A;  2XGX A;  1BI0 A;  1P6R A;  1GXQ A;  3OS1 A;  3S3O A;  1LDJ A;  2CRG A;  5EX3 A;  2L9R A;  2BY3 A;  3HGG A;  4QPQ A;  4E7S A;  3BG9 A;  4F93 B;  1VFC A;  3PO3 J;  1D8J A;  3WOD F;  1VTN C;  5ILS A;  3CCL I;  4MFE A;  3T5X A;  4D5F A;  3BY6 A;  1OR7 A;  3H5R A;  4CCO A;  4S0H B;  2XAU A;  3LL7 A;  2H8R A;  1LNW A;  2EWN A;  2P81 A;  1MMD A;  3HM5 A;  2QVO A;  4HNV A;  2DMN A;  5BS6 A;  4RM3 A;  1KYW A;  2K9M A;  2XAF A;  5F27 A;  1PYV A;  3Q0W A;  1SD7 A;  3JRI A;  2MD0 A;  5KVR A;  1YLF A;  2VJ4 A;  3BG7 A;  4KN7 X;  4RA2 A;  1ON1 A;  4ZZD A;  1OCT C;  2LKX A;  2XAH A;  4YIR X;  1X3U A;  2VOO A;  3G4S I;  3VDX A;  1U8R A;  2OBP A;  4TV7 A;  1WZ2 A;  1Y0N A;  3CCE I;  1ZHF A;  4JP0 A;  3X2Q H;  1XG1 A;  5JLX A;  3MKL A;  1T98 A;  4CCN A;  5F1J A;  2HDW A;  1ZEL A;  4Y7N J;  4EMS A;  2FD5 A;  2GA1 A;  3AG3 H;  4KJZ A;  2FML A;  4AIH A;  2HGC A;  3VYS B;  2LRD A;  5LSZ A;  2M4G A;  3GTG J;  3VV0 A;  2A6H F;  1LKX A;  4CCK A;  4E7I A;  1J75 A;  2ZC2 A;  1D1C A;  3ERE D;  5F64 A;  2UXN A;  5LHG A;  3CJQ B;  3WU2 C;  4XLH A;  5DUI A;  3M3Y J;  4E47 A;  5ICG A;  3K7A J;  3WTU C;  1K7A A;  4WXD A;  5TRD A;  2IA1 A;  3OYF A;  1VZ0 A;  1S8N A;  2LBF B;  1IN4 A;  4M71 A;  5K5Q A;  2R5Z B;  4MI5 A;  4L9J A;  3A0B C;  4YEJ A;  1BR2 A;  3CLQ A;  2V26 A;  2DK5 A;  4E4H A;  4BDZ A;  3OYL A;  1SAU A;  1TBX A;  3SZP A;  3S15 J;  4G6D A;  1WJF A;  4I51 A;  2JA8 J;  2VXZ A;  5FGM A;  2Y31 A;  2ELJ A;  3PO2 J;  3O8H A;  1J09 A;  2F5V A;  2DYS H;  3C2H A;  2V1U A;  1E17 A;  3I4N J;  1TWC J;  1VND A;  1ZN2 A;  5TIS C;  5D8K B;  2V9V A;  4RB3 C;  4MTD A;  3AKZ A;  1XS9 A;  1E0E A;  2EIL H;  1N77 A;  2R7Q A;  2EFP A;  4RB0 A;  3H35 A;  3RKX A;  1LEB A;  2QBY A;  2W82 A;  2HKX A;  3SDG A;  5LGN A;  2R7O A;  2H6C A;  1V3F A;  3VFZ A;  3BLY A;  3FMQ A;  2UUZ A;  3M55 A;  5LSX A;  2VOP A;  5A2Q K;  3HBL A;  2H1L A;  3W2W A;  3CLO A;  2FEZ A;  4PJM A;  4QEN A;  4XOP A;  3I54 A;  3BJ6 A;  2VIX A;  3S93 A;  4FAS D;  1IXS B;  4I0A A;  4KFC A;  2WWY A;  4BL0 B;  1JHH A;  3M8J A;  3I58 A;  3HGY A;  1ZGA A;  1GVD A;  2K7L A;  4WXH A;  5JIY A;  4MIM A;  4E7L A;  3MZ8 A;  4A93 J;  2DN0 A;  1J0R A;  4AWX B;  3K69 A;  3L9F A;  1KYZ A;  1Z77 A;  5HI7 A;  1V4R A;  4A3D J;  3E5Q A;  4LIV A;  2E1M B;  4CDG A;  1XX5 A;  2BV6 A;  2R7D A;  2JUG A;  4I09 A;  3M59 A;  5JR3 A;  3WTZ A;  1KU3 A;  1MNE A;  1SD6 A;  4MI0 A;  4NVQ A;  3GX4 X;  2F2E A;  1LB2 A;  2PLY A;  4BDY A;  1FTZ A;  5HDK A;  5EDN A;  2XIG A;  5IY5 H;  3DP7 A;  3D5S C;  1OCZ H;  3RCO A;  2WAQ A;  3D0S A;  3JCU C;  4HEA 2;  2EFW A;  1OYW A;  4B43 A;  4IF4 A;  4XRS G;  4FQG A;  2DOA A;  1N75 A;  2HOA A;  3J7A Y;  2XF7 A;  4B1R A;  3GXO A;  3UKG A;  1GXP A;  1VQ8 I;  5EG0 A;  1XSX A;  3HTU A;  4YPA A;  1ETX A;  3WU1 B;  3ZQF A;  2ELH A;  1APL C;  4NUB A;  3MO5 A;  3M4O J;  2FE3 A;  2L5Q A;  3ZMT A;  4LDG A;  1MH4 A;  1YS6 A;  2CFX A;  3TP3 A;  4PFP A;  2OJE D;  3OXF A;  1ZLJ A;  3FM5 A;  2XRO A;  1UMQ A;  2BBY A;  5J47 A;  1IGN A;  4N9I A;  4XRM A;  1S5L C;  5BQT A;  3EP0 A;  2E7X A;  3HG9 A;  4I98 B;  3O6B B;  1R1V A;  2CV0 A;  3QRF F;  1JI8 A;  5GTH C;  2EFQ A;  1SMT A;  4YRV A;  4DZP A;  1V55 H;  3HOS A;  1ETW A;  3CCU I;  1PUF B;  4LIU A;  2EFO A;  5DM7 F;  1R1T A;  4FHT A;  2MGQ A;  3RKW A;  3BJO A;  1OPC A;  1JGG A;  2QWW A;  1P7J A;  1IRZ A;  2COM A;  4XLE A;  3JRB A;  1HBX G;  2ZB9 A;  3IAS 2;  4UUS B;  3B6A A;  2YR2 A;  3FBN B;  2O03 A;  4NDL A;  2XB5 A;  1B9N A;  3HRT A;  1S9H A;  4AIJ A;  2KIU A;  2X4H A;  4A12 A;  1FMW A;  4B4C A;  4EQQ A;  3QP5 A;  4LIT A;  3HXL A;  3Q0V A;  4IHS A;  1BOA A;  4HX7 A;  2DO7 A;  2H09 A;  4QTR A;  2LY1 A;  2ZKZ A;  3K5K A;  5CQG A;  5E1Z B;  1Y6I A;  2RGV A;  1QO0 D;  5FKO A;  5HS7 A;  2R7X A;  4IRH A;  1IRX A;  1MZB A;  2WA0 A;  2P5L C;  1UJ8 A;  1ZAR A;  2VT2 A;  5CCM A;  5A2Q Z;  4YNM A;  1WJ5 A;  2ACJ A;  2I5U A;  4GO1 A;  3VYU B;  4BUP A;  1YX5 A;  5HDN A;  4KIG A;  3SJM A;  4PCQ A;  1AWC A;  3EET A;  1SMY F;  5HLH A;  3DKW A;  5ICF A;  4XKV A;  1X58 A;  3ECH A;  1IRG A;  2I10 A;  3HOV J;  3WTW C;  1IXC A;  2FSW A;  2JA2 A;  3Q3S A;  5K7H A;  2NYX A;  5IPA A;  3H3U A;  5GPA A;  1DU6 A;  2STW A;  2L9S A;  2ZNZ A;  3MO0 A;  2HQ5 A;  1XGM A;  4EGY A;  2Y69 H;  1T39 A;  2EV0 A;  1SVL A;  4WWC A;  4L5I A;  2B7E A;  3PDN A;  2P7C B;  2IGQ A;  3CP2 A;  1K83 J;  4Y3O A;  1AKH A;  1QHH D;  3T8T A;  5IYD J;  3DB5 A;  2Y2Z A;  4BQQ A;  5HS9 A;  3GME A;  4UUV A;  4CYC B;  1LDD A;  4QLC U;  3P7N A;  2HEO A;  3ZMV A;  1UCR A;  3MKY B;  4LK0 F;  1S6L A;  3SFI A;  1UHS A;  3OXG A;  2Z33 A;  5JIN A;  3BCB A;  4Q48 A;  2JA6 J;  1I50 J;  1Z3X A;  2XPU A;  2OQR A;  2V79 A;  4B47 A;  2LY9 A;  4ZJZ A;  1FMV A;  1OCR H;  2OQG A;  3KZY A;  3RJP A;  2MW8 A;  4ASN A;  4AIK A;  2QQA A;  1QPI A;  3OS2 A;  5F0H A;  3HSR A;  3ULQ B;  1O3R A;  1WI3 A;  4IL6 C;  2MC4 A;  1PDN C;  1N78 A;  1BBY A;  2W48 A;  4G6Q A;  5F08 A;  3ZMZ A;  3LSP A;  3ERM A;  3EQL F;  3HPG A;  2RRE A;  3GLL A;  2LFB A;  5LRS A;  2WAF A;  1ZRE A;  2GLO A;  5L3G A;  2DOE A;  2JZY A;  5DTD A;  2FUG 2;  3S1Q J;  2HQN A;  1KQ8 A;  1OYY A;  3P9I A;  1Z91 A;  1R5I D;  4CHU A;  5DUK A;  5EG2 A;  4BE0 A;  1ZTR A;  3M7G A;  1JKP C;  1ENH A;  4LG0 B;  1R58 A;  2P6T A;  2DQR A;  4V2G A;  1A6Q A;  3CJR B;  4D1Q A;  3IRR A;  3D5L A;  2PG4 A;  3ZMS A;  4BGD A;  2IXS A;  4J01 A;  4XKW A;  4NHJ A;  1M1E B;  3FXR A;  3O3K A;  1QPM A;  3I59 B;  2STT A;  2DOF A;  1MJA A;  2O5R A;  3QOD A;  4KIB A;  4IHT A;  4C2M J;  2HTS A;  1O3Q A;  2OUM A;  2A3S A;  2BHZ A;  4IX7 A;  2HU9 A;  3CUQ B;  2LOO A;  1AHD P;  4DW6 A;  3BR3 A;  2PQ8 A;  5HNF A;  4S04 A;  2ISZ A;  4P55 A;  5KK1 A;  3IV5 A;  3HRM A;  4AVZ A;  3PSF A;  4U88 A;  5KCM A;  5H6R A;  3M9A A;  4CCM A;  2HR3 A;  5KAI C;  2YS9 A;  1XSV A;  3DPT A;  2Y0S A;  3GYH X;  2WBM A;  1T0F A;  4A3J J;  5KJL A;  2KIQ A;  1Q1H A;  4M3E A;  3A0H C;  1X1C A;  1SFU A;  2LP0 A;  2X1E A;  2V6E A;  1MBE A;  1OQY A;  4FE4 A;  4A0Z A;  4ENJ A;  3LSH A;  3RZO J;  2DAO A;  1I1S A;  5IOY A;  5ARG A;  1QNT A;  5E1W A;  4EVI A;  4A3C J;  1U78 A;  3U1D A;  2JPC A;  5FD6 A;  4XN3 A;  3JSO A;  3KYC B;  4OIN F;  3M57 A;  1P4X A;  1JUM A;  4Y4R A;  3MVP A;  1Y1V J;  2RV8 A;  5F0F A;  3U21 A;  2PJR B;  3OWT A;  3RQ4 A;  4QEP A;  3HC7 A;  2PX9 A;  2CU7 A;  1X19 A;  2D45 A;  2XKP A;  3OIP A;  1WJC A;  5HNH A;  3PJR A;  3BTJ A;  1B6A A;  3MN2 A;  2EIN H;  1VQ5 I;  1BA5 A;  4UB6 C;  3RIB A;  3F21 A;  1ZGJ A;  2Y48 A;  1MND A;  3DKX A;  1W4M A;  5AON A;  2JRT A;  3QWL A;  1TP4 A;  2PEX A;  1MIJ A;  2XRN A;  3ZQG A;  1RUO A;  3HEF A;  4IEJ A;  2VON A;  1G8X A;  4ITV A;  2Y0S N;  3M07 A;  3HHH A;  4LD5 A;  1BR1 A;  2JSC A;  4ENM A;  2XF5 A;  4HF0 A;  2JVH A;  4IZZ A;  3K4M A;  3WE2 A;  2CMP A;  3AL0 C;  3H9Q A;  4CZZ A;  3M8E A;  1E3H A;  2E60 A;  2WC2 A;  4PZJ A;  3HRS A;  5F6F A;  2CSO A;  5M5X J;  3HSF A;  3L7W A;  3FZV A;  5KJN A;  1FC3 A;  2JJ7 A;  2HZT A;  2ETH A;  4D0P A;  2DU9 A;  2VI6 A;  3LA7 A;  1P4A A;  4BQA A;  2VBZ A;  1T38 A;  3ASN H;  4L0Y B;  5HQ8 A;  2L7M P;  1FBQ A;  1N25 A;  4HZF A;  3MAJ A;  3CTA A;  4A6E A;  2L3D A;  4PSX A;  1B4A A;  4KIT B;  1ZG1 A;  1K78 B;  1VQ9 I;  2KP6 A;  5AYF A;  3WG9 A;  2O61 A;  3MQ0 A;  1L3L A;  2Y75 A;  3ZR8 X;  5BNG A;  2JQ7 A;  3PM1 A;  1T2K A;  3TO9 A;  4HOB A;  1ERD A;  1W0T A;  2R7V A;  2EV5 A;  2LRE A;  3CME I;  3GFI A;  4BH9 A;  3AG4 H;  2EBI A;  3BO5 A;  3F8M A;  2IGN A;  5E3O A;  4B3X A;  1K6O A;  3FBI B;  2F4I A;  2EJR A;  1V5E A;  5FKN A;  3H3V K;  3K1M A;  1WWX A;  2KRC A;  2JV0 A;  4UHT A;  4A2U A;  1SVM A;  4GCV A;  3L2V A;  4WUY A;  4YND A;  1MMN A;  2VC0 A;  3F22 A;  2JT1 A;  1RPW A;  2P5K A;  3ABU A;  1D0Z A;  2LR8 A;  4DYR A;  2L7K A;  3AAF A;  3S16 J;  3JRH A;  4BU2 A;  1R36 A;  1YW8 A;  4XRS A;  1Y1W J;  2XSJ C;  2EZL A;  3KP2 A;  4RDU A;  1A36 A;  2EIK H;  3L2Q A;  2PI0 A;  2QSG X;  5CYV A;  5J4V A;  3KP5 A;  4O6J A;  2E1C A;  5K7F A;  3PNV A;  4U87 A;  2XDV A;  4W1U A;  2VJJ A;  2HYJ A;  2WB1 A;  3BZC A;  3M1E A;  3NEU A;  4FTH A;  4I2O A;  2NAZ A;  1HQC A;  1VQ7 I;  1ETY A;  1GHC A;  3HKZ A;  1U0J A;  2MG4 A;  3G1L A;  1STZ A;  3SQN A;  2PMH A;  1TZL A;  1I3A A;  4JLG A;  3L00 A;  2VBX A;  2V6C A;  2Q2E A;  1FIP A;  4P1W A;  1Z21 A;  4AUX A;  5LEJ A;  2LKS A;  2Q8K A;  2IT0 A;  3P5J A;  4GXO A;  3ZXS A;  1LFB A;  5DCM B;  5BPI A;  3PUB A;  1A6I A;  1RZ4 A;  2AHQ A;  4K2E A;  1X2M A;  2H6B A;  3LOC A;  5TGT A;  3E0J B;  2LH9 A;  1MKM A;  3DPL C;  3V7S A;  4XIC A;  1V54 H;  2CQN A;  3EPZ A;  3WHB A;  4FIS A;  3WTS C;  4KT5 C;  5FRO A;  4GFB A;  3JRG A;  2IGK A;  3DEW A;  1J5Y A;  5E3N A;  1HLV A;  2FNA A;  2PFB A;  2CUZ A;  2W24 A;  3BQY A;  5BOX A;  5D5W B;  2DA2 A;  4BHP A;  1N3J A;  2H27 A;  3QPS A;  1O7F A;  2WB1 N;  4HLY A;  2QBY B;  3GTK J;  3W6K B;  1I6H J;  5CQE A;  2RDP A;  1XDU A;  3HKZ N;  3NAU A;  2L9N A;  4N4N B;  1MNM C;  2D5V A;  9ANT A;  2K4J A;  1BW5 A;  4X0G A;  3KPH A;  3N97 A;  3KEO A;  2L7Z A;  1DP7 P;  2HVQ A;  2VAS A;  2XGC A;  1RR7 A;  3FMS A;  1VQ4 I;  4NNJ A;  1EA3 A;  2L54 A;  1MUF A;  2C6Y A;  5T0K A;  5E3M A;  5EF6 A;  4A3I J;  3FXO A;  1P4W A;  1B1B A;  3BPX A;  4U0W A;  1S72 I;  3DTI A;  2DDB A;  1JJ6 C;  1TLH B;  3BRO A;  2NVQ J;  1O7L A;  1KU9 A;  2FJ1 A;  3RI4 A;  3LSG A;  5D4S A;  2VBW A;  1SD5 A;  3OYM A;  1VQN I;  2LDU A;  1LVK A;  2F4M B;  4DQ2 A;  3BR2 A;  5D5X B;  2ECB A;  2HDD A;  1WJD A;  1ONV A;  1X1P A;  4MNU A;  3CCR I;  5FKM A;  1VQK I;  2TRT A;  4UVC A;  4JDS A;  1XGN A;  4WF2 A;  4A3M J;  3BDD A;  2KZG A;  3ROU A;  3BR1 A;  2VC1 A;  5LGT A;  1XPX A;  3F6V A;  2VOD A;  3GLX A;  1ZR2 A;  1FPQ A;  3GZN B;  4HX4 A;  4HV5 A;  1G59 A;  1FP1 D;  4JOM A;  3QOE A;  2OTJ I;  1XCV A;  2QSF X;  3QU6 A;  2A69 F;  4E70 A;  2KIF A;  4G7Z F;  4XMY A;  3IWZ A;  2ZSH B;  5H6Q A;  2KKO A;  1TW2 A;  2QM3 A;  1TNT A;  3J81 K;  4HDU A;  1WJA A;  3MEX A;  2CV1 A;  2DQL A;  2PN6 A;  1ETQ A;  1VF9 A;  5EG0 B;  2Q0O A;  1O3T A;  3A01 B;  3GEZ A;  2PBI A;  5JFR A;  2Z9O A;  5C44 J;  5F04 A;  1MMA A;  1XN7 A;  3BR6 A;  1YE9 A;  1KGS A;  1R4M B;  1B72 A;  5CJ9 A;  3ZMU A;  1U8B A;  2LVS A;  3F8F A;  5E18 F;  4RLF A;  1BI1 A;  2MBF A;  1XMX A;  4RLQ A;  2R7S A;  1S7A A;  3IH4 A;  2HI3 A;  3ZN0 A;  4P9U A;  2HDC A;  3CBP A;  4GYG A;  1SC7 A;  3QOP A;  1G2H A;  3O2P E;  4JYK A;  2EA4 A;  2R7R A;  3TDU C;  4DZJ A;  1ZK8 A;  3I9V 2;  1NH3 A;  2QLZ A;  4KDP A;  3TKY A;  4U0Y A;  1MT6 A;  1TL8 A;  3GTP J;  4JX5 A;  4NJ5 A;  5HOO A;  1W0U A;  2QKL B;  4BS9 A;  1WHU A;  2M45 A;  5DCM A;  2ZO4 A;  1WSU A;  2VQC A;  1W5C C;  5ICE A;  2TCT A;  2MYS A;  2R3S A;  4FT8 A;  4MGR A;  3VB2 A;  4BXX J;  3BQZ A;  4E7Z A;  6PAX A;  1IXR C;  3WU0 A;  4Y52 J;  2IS4 A;  4CO8 A;  1YQA A;  5E79 C;  2VKE A;  1DPR A;  2N8G A;  1ODD A;  1XD7 A;  1IG7 A;  1UEL B;  1ZQ3 P;  2NVT J;  3PQK A;  1FZP B;  3FK6 A;  1A5J A;  4NQW A;  2X9D A;  4RM2 A;  4AID A;  2AS5 F;  2PJP A;  4ZH4 F;  4BJ6 C;  1H89 C;  1IJW C;  1WKM A;  1TW3 A;  1FOW A;  3G1O A;  2JPB A;  5L3B A;  3K70 D;  1T33 A;  1PVE A;  4OOI A;  4BAY A;  2O8K A;  3KIO A;  1IO2 A;  4L9V A;  1ORK A;  1LJ9 A;  3K6G A;  5ILV A;  3UR3 C;  5M3F J;  4LLL A;  1OJL A;  4IQJ A;  1Z6T A;  1WH7 A;  1D0Y A;  3R60 A;  3OS5 A;  2LMD A;  5GAG J;  2XV4 S;  4PGG A;  3LAJ A;  1OIS A;  3V7R A;  2V7F A;  3RKQ A;  2G7H A;  5E8I A;  4Y13 A;  1D0X A;  2XGE A;  2R3A A;  3A03 A;  2MLG A;  4M3B A;  3U2R A;  3P9K A;  1W5S A;  5J1R A; 
#chains in the Genus database with same CATH homology
 3M58 A;  3BC8 A;  3IUO A;  3OOI A;  4N4O B;  2M7A A;  4LG3 A;  2VKH A;  3QWV A;  3PDN A;  3H9G A;  3MD2 A;  4FET A;  2IGQ A;  3CP2 A;  4RMN A;  4Y3O A;  2HQA A;  1QHH D;  4E7K A;  2MFZ A;  3DB5 A;  4BQQ A;  4C1Q A;  3RPU D;  2JSP A;  3CF2 A;  2CW7 A;  4HPQ A;  3MKY B;  2VL8 A;  4ZDP A;  2QKM B;  1V5F A;  3OYB A;  2HNH A;  3TL4 X;  3EUH C;  2K5C A;  2X1D A;  3OXG A;  5HLT A;  4XOT A;  5JIN A;  3BCB A;  3A2K A;  1Z3X A;  4XQF A;  3DEE A;  4OAY A;  3OS0 A;  4IKF A;  3SYT A;  2KZV A;  3MO2 A;  4E6K G;  4ZYA A;  4B47 A;  4KIS A;  4ZDL A;  4ZJZ A;  1FMV A;  3H5A A;  4XM3 A;  3VYR B;  2X51 A;  2BOL A;  4XON A;  3OS2 A;  3C2G A;  2MC4 A;  3KEY A;  4NC8 A;  1N78 A;  2O8J A;  5JHF A;  1H3I A;  2G46 A;  3HPG A;  1MW7 A;  4HG2 A;  2RRE A;  2DCE A;  2HPI A;  2GOX B;  2WAF A;  3OY9 A;  4R79 A;  1X1B A;  1N6A A;  3K4N A;  2FUG 2;  2XF6 A;  2P0W A;  4ANJ A;  3K10 A;  3OL3 A;  3NWS A;  3DPU A;  5EG2 A;  4ZC3 A;  3RSN A;  4BE0 A;  5FRN A;  2VJ5 A;  4XNF A;  4XLA A;  3CZ6 A;  4CH7 A;  3CJR B;  4ZDO A;  3SEZ A;  4D1Q A;  3D5L A;  4BGD A;  3DTK A;  2IXS A;  4J01 A;  4XKW A;  1ZKK A;  4B44 A;  3BG6 A;  3UNG C;  4BE2 A;  4QPO A;  2W5Z A;  1T0F C;  3ZRG A;  4HNT A;  1YX3 A;  2ZSI B;  2V9K A;  2X6X A;  3M54 A;  2VQH A;  2KL4 A;  2O5R A;  3QOD A;  3K4K A;  3OR2 C;  3ZCO A;  2CS3 A;  4CSW A;  2Z16 A;  2OUM A;  1WJE A;  4IX7 A;  2BVM A;  2HU9 A;  4PJN A;  4OWR B;  4HRI A;  4XLF A;  2LOO A;  3PNY A;  2VLA A;  3OYA A;  3F9W A;  2WAD A;  5JHN A;  5HNF A;  3H0D A;  3W2A A;  3DAL A;  4AVZ A;  3PSF A;  2R7U A;  5KCM A;  3QYE A;  1BR4 A;  5EX0 A;  2AQF A;  4CCM A;  4DBR A;  2V1N A;  3DPT A;  2VB6 A;  2Y0S A;  3KX2 A;  5KJM A;  2WBM A;  3E1S A;  5KJL A;  4E7H A;  3DU6 A;  3L2R A;  4F91 B;  1SFK A;  2BVL A;  2PJR A;  4J7I A;  2ZFU A;  3F9X A;  1X1C A;  1GLN A;  2X1E A;  2V6E A;  3S7F A;  1X1A A;  3SWC A;  2VKD A;  3LSH A;  3ZQQ A;  2M4K A;  1HA8 A;  5ARG A;  3KMA A;  4YNP A;  4G6T B;  3KYL A;  3H9J A;  5FRM A;  1DQU A;  3S3N A;  1R6R A;  5F6K C;  4HST A;  4XN3 A;  4CCJ A;  2M7B A;  2UWM A;  2PMZ A;  2ZXH A;  3M57 A;  4DBQ A;  2F69 A;  4Y4R A;  1PJR A;  3QWP A;  3U21 A;  3FHN A;  2PJR B;  3F9Y A;  3OWT A;  3RQ4 A;  4QEP A;  3HC7 A;  3OYI A;  1X19 A;  3OIP A;  1WJC A;  3W3C A;  5HNH A;  3PJR A;  4RZ0 A;  2KMU A;  3AFH A;  3VSL A;  1UAA A;  2Z2S B;  2KHM A;  3RIB A;  1MND A;  1D1B A;  3DKX A;  3LSM A;  2VJI A;  4CA0 A;  5F6L A;  2F6C A;  4BQN A;  1Y56 A;  3TG5 A;  2KQR A;  2CFO A;  2RFI A;  1WJB A;  3OR1 C;  3SZG A;  1G8X A;  4ITV A;  3MMY B;  4AU7 A;  3S8P A;  1BR1 A;  2XF5 A;  4IZZ A;  2JVH A;  3K4M A;  1DGR M;  4P5O A;  2CMP A;  5KHD A;  3AL0 C;  3S7D A;  2CV2 A;  3H9Q A;  4XLC A;  3S3M A;  2QPW A;  2E60 A;  4F52 A;  3QWW A;  4J8O A;  4BE1 A;  3OOU A;  3HPH A;  1OR7 C;  5KJN A;  3HOT A;  1WFX A;  4II2 A;  3HUG B;  2DXI A;  1XQH A;  2WY7 Q;  3SEQ A;  5TEG A;  3QYB A;  3MKW B;  4BJT A;  2X6W A;  3MEK A;  1NG6 A;  2IGM A;  1MMG A;  5HQ8 A;  2CUJ A;  3OS1 A;  2KDO A;  3S3O A;  3D5R C;  5EX3 A;  4QPQ A;  4E7S A;  4F93 B;  5T5G A;  2OC6 A;  3N05 A;  2Z1D A;  4PSX A;  4NC7 A;  4PUS A;  4KIT B;  4U7B A;  4Z4P A;  3HL2 A;  2KP6 A;  5AYF A;  2X1C A;  3H5R A;  3A4C A;  4F92 B;  4CCO A;  2W1O A;  2XAU A;  3LL7 A;  4HSR A;  3L2U A;  3NWT A;  1MMD A;  3ZR8 X;  2KPM A;  1D1A A;  3FKJ A;  2K9L A;  3AL0 B;  4RM3 A;  1ERD A;  2CH0 A;  4PJJ A;  1PEG A;  2K9M A;  4J00 A;  2R7V A;  1PYV A;  2LRE A;  3CMM A;  2MD0 A;  2RQQ A;  2VJ4 A;  3BG7 A;  3BO5 A;  2IS6 A;  3FPD A;  2IS1 A;  1Z7L A;  4BXF A;  2IGN A;  2WY8 Q;  3VDX A;  1UG0 A;  4B3X A;  4FMU A;  3FBI B;  3K4C A;  2F4I A;  1V5E A;  3DTE A;  4YEL A;  2RNG A;  2KRC A;  2JV0 A;  4IJ8 A;  4F55 A;  4QEO A;  4PFO A;  4IJD A;  4CCN A;  2LYC A;  3V42 A;  4B48 A;  2R4G A;  2HDW A;  1ZEL A;  3L2V A;  1MMN A;  4WUY A;  4YND A;  4KJZ A;  5T0M A;  3OYE A;  2LBF A;  3VYS B;  1D0Z A;  2CW8 A;  2LRD A;  3BCA A;  5LSZ A;  2M4G A;  2L7K A;  4E7J A;  3VV0 A;  4J83 A;  1LKX A;  4BU2 A;  4CCK A;  4E7I A;  2XSJ C;  1D1C A;  3CJQ B;  3IAM 2;  1AA7 A;  4XLH A;  3L2Q A;  3CBM A;  4E47 A;  1MVH A;  3ZGK A;  2DT6 A;  5LFA A;  4C30 A;  4DJA A;  5KJK A;  4XOR A;  3VYT B;  2BW3 A;  3PNV A;  4U87 A;  1QU3 A;  2W4S A;  3CP8 A;  2NOJ B;  2XDV A;  4J7F A;  4DIQ A;  3OYF A;  2BQZ A;  2VJJ A;  1VZ0 A;  2I8D A;  3IP4 B;  2LBF B;  4C9Y A;  4MI5 A;  2WB1 A;  1O9S A;  4MLO A;  2LY2 A;  4YEJ A;  1BR2 A;  2Q1Z B;  2V26 A;  2VQG A;  3OIQ A;  3HKZ A;  4E4H A;  1U0J A;  3KMJ A;  3M56 A;  3VUZ A;  4BDZ A;  3OYL A;  1SAU A;  4BJ5 C;  1TZL A;  1WJF A;  3GBG A;  4I51 A;  4JLG A;  2VXZ A;  2E1M C;  3RU0 A;  2ELJ A;  1J09 A;  2F5V A;  2BW3 B;  3EUK L;  3C2H A;  2E5Z A;  4P1W A;  4BEH A;  1Z21 A;  2W7N A;  4CZC A;  1E0E A;  3AKZ A;  3ZXS A;  3VWB A;  1N77 A;  2R7Q A;  3QYF A;  3PUB A;  2LC2 A;  3H35 A;  5TGT A;  2W82 A;  2L2O A;  2X6Y A;  2LH9 A;  2R7O A;  3DPL C;  3E0J B;  4BAC A;  3BLY A;  3M55 A;  2UUZ A;  3EPZ A;  3F9K A;  4BQO A;  3OYJ A;  5LSX A;  2JVG A;  5FRO A;  3W2W A;  4PJM A;  4QEN A;  2Q2E B;  2R7T A;  4XOP A;  1DP3 A;  4BEH B;  3DU5 A;  2DT7 B;  2IGK A;  2KLO A;  2VIX A;  3S93 A;  4FAS D;  2CUZ A;  4H12 A;  4BL0 B;  1V5G A;  1N3J A;  3M8J A;  1T95 A;  5JIY A;  5TH7 A;  5CQE A;  4E7L A;  3CES A;  3TMO A;  2L9N A;  4N4N B;  4X0G A;  3K4L A;  4YPU A;  3OYC A;  3FDY A;  3DQV C;  5HI7 A;  3I3L A;  2A6T A;  3M53 A;  2HVQ A;  2E1M B;  2VAS A;  4LIV A;  4KT6 A;  3DWL E;  4NNJ A;  1EA3 A;  2JUG A;  1MUF A;  3M59 A;  5T0K A;  1MNE A;  4MI0 A;  4NVQ A;  3PNT A;  4BDY A;  1QHG A;  3DTI A;  3M1C A;  3H5N A;  4IQ4 A;  4ZTF A;  2AQE A;  1X1D A;  4PK4 A;  3RTR A;  3D5S C;  3RCO A;  3CBO A;  4Y33 A;  2WAQ A;  1K6Y A;  4HEA 2;  3TG4 A;  3LSG A;  4PSW A;  4F3Q A;  4B43 A;  4HNU A;  3OYM A;  1LVK A;  3EUA A;  2XC7 A;  5LD2 C;  3M5A A;  5KNL A;  1WJD A;  2DOA A;  3OXL A;  1N75 A;  2HZD A;  3OL4 A;  5CKT A;  3J7A Y;  3KMT A;  2XF7 A;  4JDS A;  1P9Q C;  3OYK A;  2V4J C;  2VQL A;  3PL8 A;  3S32 A;  4YPA A;  4YPE A;  5CCL A;  5TTF A;  2IGO A;  2UV1 A;  2W00 A;  1BOB A;  4NUB A;  3SDB A;  4XN0 A;  2L5Q A;  3MO5 A;  4LDG A;  1LFP A;  1G59 A;  2R7W A;  4JOM A;  3QOE A;  3OYN A;  4PFP A;  3F9Z A;  2DJI A;  3OMY A;  5F59 A;  3RJW A;  4ZTJ A;  2GOM A;  3S7B A;  3MKZ A;  3DLA A;  4XMY A;  2ZSH B;  3OXF A;  4H4K C;  1WJA A;  4XL9 A;  2CV1 A;  4CCL A;  2HVS A;  5HVQ C;  3IHX A;  1MMA A;  3EP0 A;  3HG9 A;  1YE9 A;  3OPE A;  3SW9 A;  3DKY A;  2CV0 A;  2KRH A;  2M0M A;  4RLF A;  4CUG A;  1ML9 A;  4RLQ A;  1JI8 A;  2R7S A;  4YRV A;  4GRI A;  3W2V A;  3CBP A;  3HNA A;  3HOS A;  3PSI A;  4LIU A;  2R7R A;  2VPL A;  3I9V 2;  2MAB A;  3LFU A;  1X4P A;  2LG4 A;  1MT6 A;  4XLE A;  1KON A;  4NJ5 A;  5HOO A;  3K4B A;  2E5N A;  2IS2 A;  2QKL B;  2ZXI A;  3IAS 2;  4BS9 A;  3FBN B;  2HPM A;  3N71 A;  3S7J A;  4AYB A;  1Z3Y A;  1S9H A;  2X85 A;  1N6C A;  1NG7 A;  3L2W A;  2VQC A;  1OLT A;  4XKC A;  1FMW A;  2MYS A;  1MVX A;  3RAY A;  4E7Z A;  4LIT A;  3HXL A;  2IS4 A;  3K4J A;  4XR6 A;  3TBI A;  2LY1 A;  4II3 A;  1UEL B;  1X4O A;  1TT0 A;  1W36 D;  5JJ0 A;  2K3P A;  3K5K A;  4RM2 A;  5CQG A;  1Y6I A;  4C2T A;  2W5Y A;  2R7X A;  4BJ6 C;  1IRX A;  2WA0 A;  1LDK B;  3OYH A;  5CCM A;  4D9J A;  2HVR A;  2M3A A;  4YNM A;  2A5W A;  1W36 C;  5F5E A;  1WJ5 A;  5ARF A;  3K70 D;  3PFY A;  3LSK A;  4DGW B;  4C2U A;  3ONQ A;  4XKB A;  3VYU B;  3LMM A;  4BUP A;  1YX5 A;  5CPR B;  4EAT A;  3A1Y A;  4PJL A;  3K6G A;  3UR3 C;  3K70 C;  1DGW Y;  3G2B A;  4O30 A;  4IQJ A;  4NQW B;  1D0Y A;  2WAE A;  4XKV A;  3OS5 A;  4OAZ A;  4O6F A;  2OV7 A;  2V7F A;  2JA2 A;  3VSK A;  1D0X A;  4DOZ A;  3OYD A;  2R3A A;  4JQF A;  2L9S A;  3MO0 A;  2VXD A;  3OYG A;  3LSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...