5CPRB

The novel suv4-20 inhibitor a-196 verifies a role for epigenetics in genomic integrity
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
263
structure length
232
Chain Sequence
MSAKELCENDDLATSLVLDPYLGFQTHKMNRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The SUV4-20 inhibitor A-196 verifies a role for epigenetics in genomic integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SUV420H1
total genus 67
structure length 232
sequence length 263
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5cprB01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5cprB02
3BO5A 5LSXA 3KMJA 5JHNA 3S8PA 3M58A 3RU0A 2W5YA 5T5GA 5KJKA 3M56A 3KMAA 4O6FA 3M55A 5CCLA 3RAYA 3DB5A 4MI0A 1ZKKA 1MVXA 2W5ZA 4J7IA 4FMUA 3HNAA 3S7FA 1MUFA 4O30A 3DALA 3IHXA 4J83A 5EG2A 5TTFA 3OXGA 5AYFA 3VUZA 3RIBA 2O8JA 1PEGA 4J7FA 5KJLA 4IJ8A 3MO0A 3EP0A 2QPWA 4AU7A 3F9XA 1XQHA 4IJDA 3TG5A 4LDGA 1N6CA 5EX3A 5CPRB 1MVHA 5T0KA 3M59A 3M54A 4C1QA 3CBOA 2F69A 3M53A 4RZ0A 4JDSA 3F9ZA 3VV0A 4MI5A 3SWCA 5KJNA 5JIYA 4E47A 3FPDA 5F6KC 4J8OA 3OPEA 5ARGA 3CBMA 5F5EA 3TG4A 5F59A 4QENA 3MO5A 3F9YA 3MO2A 5ARFA 5LSZA 5CCMA 3SW9A 5EX0A 1O9SA 3S7DA 4QEPA 3M5AA 4NVQA 3KMTA 3S7JA 5KJMA 2IGQA 5TEGA 2BQZA 5F6LA 5JINA 3MEKA 3N71A 1H3IA 3K5KA 4YNPA 4YPUA 4WUYA 2RFIA 4YNDA 1ML9A 3F9WA 3S7BA 2R3AA 3QWVA 3OXLA 3RJWA 5JJ0A 2JV0A 4NJ5A 3QWPA 4I51A 4BUPA 3OXFA 4Z4PA 1MT6A 3CBPA 3OOIA 5TH7A 2G46A 3OS5A 4JLGA 3RQ4A 5T0MA 5HI7A 1N3JA 4H12A 1N6AA 5HQ8A 3M57A 3QWWA 4YPAA 3PDNA 4QEOA 4YNMA 4YPEA
chains in the Genus database with same CATH superfamily
5KAIC 4XNFA 5J47A 2DT7B 4JYKA 4Z2YA 3JSOA 3KMJA 1U0JA 1W0UA 4NB5A 5F1RA 2IGMA 5J8FA 2DOEA 2CUJA 4XIDA 4DYCA 5HDGA 4ETSA 4RB2C 1I1GA 1X1BA 5T5GA 3PSIA 5EZHA 2KDOA 4FE4A 2PMZA 3DP7A 1W5SA 4DYQA 2BW3A 3DTEA 3AKZA 3DEEA 4LLLA 2FOWA 5F1JA 2HR3A 1W36D 2VT2A 2QZ8A 1QVTA 2ID3A 4XKCA 2KJCA 3KP3A 1ZKKA 3OOUA 3HOSA 4E7JA 3ZQLA 4E6KG 2LD5A 5IP6A 1SFXA 1JKOC 5GAHJ 1WJAA 2WY8Q 4BJ6C 2V6EA 2Y31A 2ZFUA 2LBFB 2D45A 1Z7UA 4I01A 3EDPA 3FXMA 3H3VK 6PAXA 1PYVA 5F04A 4OAZA 2M5WA 1TW2A 2EZKA 5BNGA 2GOXB 4M3FA 3BG9A 3KP5A 1I3AA 3MZ8A 4IXAA 4AYBN 3WGGA 5AONA 4EM2A 5FRNA 2XB0X 4C1QA 2BEOA 4MNUA 2RDPA 3M53A 4ENJA 1G3WA 2R7WA 3PQKA 3VV0A 3SWCA 2Y2ZA 5LEJA 1UCRA 3NARA 2CQNA 1K61A 4N4OB 3CCJI 2GXGA 2X51A 4KITB 2KDZA 2B7EA 2H94A 4MO7A 5F6KC 5EEGA 3KEQA 5L3DA 2FSWA 5TISC 2GIVA 3CMEI 4HQMA 5L3FA 2ECBA 3OR1C 1ZGWA 4ZYDA 3KX2A 1CF7A 4ZC3A 2BYVE 2FOKA 1GHCA 3P5JA 2L9NA 4FX4A 4QTRA 4XLNF 3H92A 4J19A 4IQ4A 3BJ6A 4DYRA 4XLEA 2XC7A 2ACJA 4FETA 4A0ZA 4XMYA 1E3PA 1EF4A 5K5QA 3N71A 3KP4A 2ZSHB 3WU2C 4BJTA 3VYUB 3FZVA 1RPWA 3CDHA 2OU2A 2VQGA 2PJRB 3F9WA 4FHTA 3IH3A 1MIJA 3V7CA 3C2HA 3EQLF 4OMZA 5M5WJ 1HBXG 3T0YA 1FP2A 3OYGA 2NVQJ 3FM5A 4OMYA 3WE2A 1A6IA 1Y0UA 3OXFA 2G0EA 2E34A 4AWXB 4YELA 3DPLC 2CMPA 5HI7A 1OCOH 3IL2A 5FO5A 2LVSA 4YPAA 1LEAA 2RAEA 1WPKA 5FKMA 1WJEA 1IRZA 1USTA 4UB8C 1BJAA 2K4BA 2WAQA 1J59A 2V1NA 5E79C 1UG0A 4WCGA 3FMSA 1DP3A 3EPZA 1FOWA 4II2A 5FB2A 1R1VA 3BWGA 4S0HB 2DBBA 1LPQA 4L5JA 2DT6A 4RA2A 4A3EJ 2JT1A 3DLLF 2Z16A 1R7JA 3K7AJ 4HZFA 5C4JJ 3WHCA 3G4SI 1K4TA 4UV9A 3JAMZ 2AXTC 4XLCA 1IN6A 3A1YA 4BYYA 2VKDA 4ZYGA 1YIJI 2E2HJ 3M8FA 2WAEA 3S7FA 1MUFA 2ZBKA 4N0BA 4Y33A 5EF6A 2LP0A 4EMSA 5KK1A 5ERIA 5AIQA 5DD8A 2UZKA 4XN0A 3EUAA 4HDUA 1AOYA 1M1EB 1F36A 3SYTA 3LSHA 3FDYA 2R7XA 3FF5A 2R7VA 2DO7A 3K4LA 3JRCA 2QYOA 1JHFA 4MLOA 3P7NA 2IAIA 2P5VA 2H09A 1TWAJ 3TP3A 2EIJH 5LFAA 3F3XA 4WXCA 5M3MJ 2JZYA 2L7MP 1XG1A 4PJ0C 3WGHA 2PX9A 2DQLA 3FXJA 4CCNA 1XSDA 3S15J 3ABLH 4XRSA 3O2PE 1FLIA 3J81K 1GDTA 2FA5A 4YG2F 1FMVA 2VT3A 1V54H 3ZMUA 5F0HA 4FCYA 2ZJ2A 5DEQA 4GDFA 2DXIA 4A93J 2UXNA 2OQGA 1Z05A 4TV7A 4JP0A 1SEUA 1OQYA 3SXYA 3HUGB 4Y13A 3BROA 2CW7A 4HRIA 1L3LA 1IXRC 3VSKA 1TZLA 1QVUA 2KIQA 3F72A 5LGUA 2E5NA 2Y69H 5KNLA 3OS1A 1SANA 4QEPA 2YX7A 3M3YJ 2JVHA 2TCTA 3FXLA 1I1SA 3S3MA 3FXQA 4HF1A 1UHSA 1DUXC 2DA6A 1Q1HA 1RETA 3NRVA 3D1NI 3MEKA 3RZOJ 3CCEI 2XAFA 2DJNA 3ZP5A 2M4KA 4D7NA 2RFIA 2YSRA 1DGWY 4LG3A 5FRMA 2XAGA 4RLQA 4FT8A 4EM0B 2MABA 3OIQA 3TEDA 1T6SA 2JMWA 4AUXA 2K9SA 1SFEA 3H9JA 3IRQA 1ETYA 5ED4A 4LG0B 1IN8A 2YU3A 3D0SA 3DEWA 2G46A 1QA6A 1A04A 4ENMA 3LL7A 1ZELA 1JE8A 3PO2J 2RREA 3ULQB 4YPEA 5HS8A 4L0YB 4RAGA 2R7QA 2FF4A 5DV5A 3W3CA 2DA2A 3OYCA 5JHNA 4IOCF 4PJNA 2QM3A 1U78A 1D3YA 2EFNA 2BE5F 4HSRA 5LRRA 3E5XA 3SZPA 1VFCA 3SDGA 2QVOA 2MD0A 4DZPA 4Q4ZF 4KMUX 1L0OC 1G3TA 2X1EA 2ZJRF 4MTEA 3S1MJ 4IKFA 3ECHA 2FQ4A 2FNAA 2XROA 1XMXA 2AHQA 4LOCA 1E3HA 1WGXA 1OCCH 3DTKA 3FWEA 2IXSA 2ISYA 4GFBA 3LFUA 4LLNA 2CYYA 1TLHB 3DU6A 4G7ZF 1ENHA 4RDUA 3BG7A 4I99C 2OAZA 1BR2A 2NS0A 3KIOA 3OYHA 1W1WE 1PUFB 1QO0D 4W1UA 3OYFA 3TGNA 1J2XA 3HOTA 4G6TB 2HZDA 4J7FA 3HZJA 4E7ZA 4MIMA 1FP1D 3ASOH 3F9KA 4IRGA 3HUGA 1KYZA 3FKJA 3H9QA 4PGGA 4UV8A 1HA8A 4HV6A 4MFDA 2BY2A 2EK5A 5CLSA 3A01A 1FIPA 5KCMA 4GYIA 2E1CA 2E1MB 1SVMA 5CPRB 4UUSA 3HKZA 5T0KA 3K9TA 2L54A 3IH4A 1AKHB 1WWXA 2F69A 3BY6A 1K79A 3CTAA 1QGPA 2OF7A 4IOAF 4WF2A 5JIYA 1MMNA 3DLAA 1V55H 4A3LJ 4RB0A 2X1DA 5F5EA 5J4YA 2JWTA 3GZNB 2CUFA 2DCEA 1G4DA 5BS6A 2GIZA 4RB1A 4L9VA 4UUSB 3L2CA 1XSVA 1ZRDA 1IN5A 4EGZA 2BXZA 2K85A 1ZR2A 2MH9A 1ITYA 3OYLA 2L7ZA 2PG4A 2EILH 5IOYA 1PDNC 3I71A 3L09A 1V3FA 4I6ZA 1G59A 3OXLA 1I27A 1G6NA 5D5UB 1T95A 2OTLI 3H1CA 2DPUA 3TW6A 4IVNA 4I51A 1F4KA 4XOTA 3LWFA 4RAZA 1B8IA 1R58A 1T0FA 2X48A 4FTHA 2XKPA 4XR6A 5A2QZ 5K5RA 1YW8A 1H9GA 1MJBA 1LQ1A 1VQLI 4EJWA 2EIMH 4BQOA 1OISA 2K4JA 4YNMA 1OYYA 3PUFA 3J7AY 5D5VB 2O3FA 1NK3P 5CVIA 3ZMSA 4YFKF 1EH6A 5E3LA 4UUVA 4ASNA 2V79A 3VDXA 5FFZA 3HRSA 1IZ1A 3OOPA 3ZOBA 2DOFA 4UB6C 4BDYA 3E6CC 1N78A 2Y0MA 1ONVA 2LSOA 1CF7B 3RAYA 3T1BA 2COMA 3D5SC 2JA8J 2RNJA 3IH2A 2JA6J 2V26A 4FMUA 1UFMA 2EV6A 1FYLA 4LK0F 2WV0A 2JRMA 1OYIA 3PFYA 4R8HA 5ILSA 1Z77A 3ONQA 1HOMA 4HX8A 4BBRJ 4FE7A 1BOAA 2G7HA 3TP0A 3GYHX 2XPUA 1Z3XA 1IRXA 2P81A 1TT0A 2O5RA 1Y0NA 2VN2A 4G6QA 4U7DA 2XUBA 3VWBA 5H2FC 2MC4A 2MFZA 1ORKA 1SD7A 3FXRA 1EH7A 4YIRX 1BI1A 5LBQA 1OR7C 1YOVB 1TC3C 1R5GA 2KRHA 5DM6F 2XV4S 1G8XA 3ZCOA 3V8LA 3Q5FA 1GV2A 2NNNA 9ANTA 3TG5A 2M8GX 5FLXK 4KN4X 2M0MA 1N6CA 2Q2EA 2VLAA 3BZ6A 4E7LA 3C3WA 2O7OA 3HHHA 1S8NA 5LRSA 3KEYA 2ZNZA 2HOSA 3LSIA 3CDIA 4MI5A 1EA3A 3F23A 3A02A 5KJNA 2HTSA 1UJ8A 4KT5C 3RYRA 4KJZA 2CWEA 1XDSA 2KIMA 2V1DA 2ZO4A 4BXFA 1HDDC 3OYMA 2OTJI 2K9MA 1JKRC 4PGHA 2L01A 2K9QA 2V1XA 2W84A 3F9YA 3MO2A 3V4GA 4AD9A 3K1NA 5IY5H 2CQKA 2LFBA 2CV0A 2OZ6A 1AWCA 3BTJA 1X19A 1OCPA 1RUOA 3K5KA 3U2RA 2OV7A 4GCVA 1OYWA 4YPUA 3MWMA 4ENNA 3W6VA 4BJ5C 2OZUA 3F22A 4I98B 1CQTA 3K70C 3DEUA 3QWVA 5ICGA 2CG4A 1VTNC 1KQ8A 3RJWA 4CYDA 3I4PA 3PNTA 4U0WA 4C3HJ 1LJ9A 4BUPA 1B9MA 3MZYA 5J1YA 1FSHA 2EQRA 1POGA 4IPAA 1P4AA 2DMQA 2ZXWH 3GTLJ 4ESBA 1RNLA 3WTVC 4OIPF 2DQRA 1IJWC 5EYRA 2M8EA 2E71A 2V6CA 2HDDA 3T8TA 4O3MA 2IA1A 2MD5A 2ID6A 4EVIA 3TO7A 3BO5A 3E0JB 3ECOA 3BLYA 2IA0A 2PMUA 1STZA 2MSYA 2YX4A 1ETOA 2IP2A 3CDLA 3OYJA 4PJJA 5B66C 4CSWA 3N97A 2EFWA 3V8KA 5GADJ 3RZDJ 1F43A 5JLWA 4NBQA 2JN6A 3TOAA 3GEZA 1GXPA 4MEXF 3GLLA 3JRAA 3X2QH 2JSPA 1SVLA 2D5VA 1AA7A 1OJLA 4F52A 1X1AA 2RNGA 3ZQFA 2KP6A 2WAFA 2VL8A 2GM4A 4IHVA 4A5MA 1MZBA 5DM7F 4XKWA 2DMTA 4GO1A 2WBMA 2A6TA 3FMQA 4LLGF 1D0ZA 1Y8RB 3BOQA 4KICA 2X4HA 3KP7A 3MO0A 2W25A 3JTGA 2A3SA 3RYPA 4M9SA 5E17F 2QQ8A 1LE8B 1OKRA 3L2QA 1XQHA 4KUMA 5IT3A 1ON2A 5ICEA 2HS5A 1U5TB 2VQCA 4HQEA 4A12A 5E3NA 3ERED 2KT0A 4D0PA 4QSHA 5DUKA 2JA5J 4EJTA 4E7SA 3E5QA 3ZMVA 4B43A 3H0DA 1B4AA 2WB1N 4JX4A 5FFXA 3GW2A 4QIWN 3H5NA 4AC0A 3BJOA 2BZTA 3EETA 4HLYA 3G1MA 5ARFA 3U9GA 4KFCA 2O8KA 1OCRH 5LSZA 2JJ7A 2O61A 3S1QJ 3F0CA 3O8HA 1JUPA 5D6FA 3H3ZA 1PUEE 1DQUA 3GLXA 4G9YA 3P9CA 4C2TA 5IYDJ 2XASA 3F8NA 3RDIA 2NVXJ 4XRFA 2ZJQF 2KRCA 2X1CA 4WUYA 1X4OA 4B4CA 1W36C 5EJCA 2HQAA 1B8IB 3S7BA 3RCOA 4M9ZA 2F5DA 2WWYA 3WU0A 3WTXC 2XAUA 3VFZA 4NHJA 3QWPA 2R93J 2ETHA 2XSJC 4Q47A 2HFHA 1UZCA 3G3ZA 4B8XA 5E8IA 3CUQC 4A3CJ 4JLGA 2NNYA 4CH7A 1PVEA 4YIIA 1P7IA 2DMNA 3CC4I 5HQ8A 3E1SA 2I5UA 2KPMA 1WSUA 2STTA 1ZYRF 5JR3A 2EINH 2ZMEB 2QGUA 2O0YA 2XRNA 3FBNB 2X6YA 1MBFA 2KFDA 3GZ6A 2RKHA 3OIPA 3OWTA 2HOEA 1U9NA 3JRHA 1N75A 3LA3A 4PSXA 2LREA 2KHMA 4DGWB 1YRNB 5TJJA 3KMAA 5CVJA 5DTDA 4HF0A 3A01B 1IRFA 4A6EA 2H6BA 2ICWG 4LIUA 3M55A 3ZXSA 4CCJA 1SFKA 3BR1A 3VPRA 3C2BA 1WJFA 4XM3A 3HNAA 3ABKH 4O30A 2XF7A 3F21A 3OSGA 5CJ9A 4A6DA 4Y4RA 1TTYA 3MKLA 3RKXA 4EQQA 4A5NA 3RQIA 1XCBA 3C2GA 4OIOF 1WH7A 4JX6A 2HI3A 4A3BJ 2GAUA 1A6QA 1FWZA 2QBYA 1K7AA 2WTEA 2MC3A 3EYIA 4A3FJ 4IHXA 4L9JA 2HPIA 2OC6A 2DYSH 2O03A 3GFMA 2IW5A 4O6JA 2VODA 4LDGA 1PUFA 2V7FA 4I2OA 3QYEA 2HDWA 2MLKA 4HNUA 2GLOA 3P9IA 4HG2A 3H3UA 3GFIA 3GMEA 1UG2A 3DKYA 1DPRA 4V19K 4RBOA 3JCUC 3LSGA 2R5YB 3R6SA 4KDPA 5HS9A 3MEXA 3SDBA 2XDVA 3LA2A 2PI0A 2Y0SN 1XS9A 3CCRI 2VBXA 1R5HA 1JJ8C 3VODA 2KKOA 1MNEA 1W7PA 3S7DA 4PUSA 2FUG2 2Z99A 5BPDA 1QU3A 5KJMA 3W6KB 2CU7A 1BR1A 1SMYF 1YIOA 2XF5A 3BDDA 1VQ5I 3HOVJ 2Q8KA 2P8TA 3SFZA 4BY7J 1YITI 3HJEA 4L5IA 3GTPJ 5E20A 2NVTJ 3OV8A 1H8AC 1YYVA 2R7TA 1T56A 1ZLJA 2Q1ZB 3R61A 5ILVA 3FMRA 4DBQA 2IPQX 1QRYA 1IUYA 1A36A 5IOZA 4Z4PA 4ON0A 4AVPA 3MKYB 1QHHD 3CF2A 4B48A 1R4MB 5D8LB 2EFPA 2Y48A 2LC2A 3IKTA 1N6AA 2F48A 3BZKA 1RI7A 4OOIA 1XTAA 5HVQC 3MFKA 4M6XA 1VZ0A 1MBGA 5JLXA 1HKQA 5HLHA 1QZEA 3CJNA 2HOAA 5EEHA 2FNPA 1LDKB 4A3JJ 2BHZA 2ZMEA 1IDZA 1DDNA 1K78A 2BBYA 3S16J 2BHYA 2VKEA 4HOBA 5CCLA 2E1MC 2YS9A 1B72B 5HODA 1PP8F 2EZLA 4R79A 1HLVA 4NC6A 4K2EA 3HKZN 3ZQ7A 4HX4A 5H6QA 1FSEA 2B9SA 3VEPA 3UR3C 4RAYA 1LFBA 1ODDA 2GA2A 2R7ZJ 4U0YA 1QNTA 3DF8A 2DDBA 3M07A 2F5FA 4Q5SF 3QAHA 4KYWA 1P7JA 1TQIA 4OAYA 1J9IA 5EX3A 1WRJA 5D5WB 2NRAC 1D1CA 1W5CC 3EYYA 1YX5A 4QPQA 2FMLA 5K7FA 2DI3A 2PEXA 4C9YA 1R49A 1D0YA 5E3MA 1BJZA 1IW7F 3AG4H 1YG2A 2IGOA 3LQRA 3WODF 3CJQB 4UNOA 1KGSA 2CSOA 3L7WA 1VQMI 5HLGA 2K3FA 4IL6C 2FU4A 2XF6A 4RB3C 4BQQA 1LEBA 2V9PA 3HOUJ 1W4MA 4NUBA 3V42A 2H1KA 4OWRB 2K9NA 4V2FA 1C0WA 1LE8A 2LG4A 1FBSA 3FK7A 1FOKA 4CYCB 2E2IJ 4IO9F 4WK8F 2IT0A 1YQAA 3SHFA 3G73A 2NYXA 5EG0B 1MW7A 2QKLB 1ML9A 2R3AA 4JOMA 1R9TJ 1A35A 4OIQF 2XPVA 3HEFA 2V4JC 1U8BA 1RRJA 1JKQC 3R0JA 3S1NJ 2PQ8A 4UHTA 4BAYA 3I59B 5JJ0A 2VC0A 1YW7A 3S1RJ 1WH5A 3CUQA 1MT6A 2DYRH 1MH4A 1WJCA 5DDGA 1Z3YA 4HSTA 5GAGJ 1BW6A 5T0MA 2EIKH 1HC8A 4CICA 4BXUA 1X1CA 2JK3A 4F3QA 4D7MA 5D5XB 1TBXA 2LOOA 2AS5F 2BV6A 3SEQA 2Q0OA 3GUDA 1W0TA 1D1AA 4LB6B 1IXSB 5JI6A 2E19A 1TWFJ 4Y15A 3PO3J 2VKVA 3NAUA 1TW3A 1D5VA 4MGRA 3ZQGA 3BG6A 4XBFA 3U1DA 2VBYA 1F9NA 4NDLA 3LSKA 3M56A 1BA5A 2DA3A 2DA5A 4HEA2 5J3LA 4FISA 2V9KA 3BC8A 1FC3A 3HB9A 4O6FA 2LF7A 3ABUA 4C3IJ 2LY2A 2E7XA 2LLKA 4IX7A 1N25A 1ZRFA 4CO8A 3DKXA 3MKZA 3SJMA 4EJUA 1KU2A 4M71A 1HF0A 4J7IA 4I7HA 1Z6RA 1ACIA 2QQAA 2F4OB 2F2EA 1E17A 1EV7A 2RC4A 4RM2A 1ZLKA 5IPAA 2MBFA 2WB1A 4KA4A 5HS7A 1WJBA 3CLQA 4DJAA 3H5AA 4FASD 2X6WA 1MDMB 1VI0A 2R7RA 1AU7A 1J09A 3E5UA 2HGCA 4Y52J 1S7AA 4AU7A 4XRSG 4D5CA 2EJRA 2VASA 4FQGA 1RESA 3BTIA 1MSEC 4C2UA 4IRHA 2JTVA 4F55A 2FJ1A 3M1CA 4RGXA 4ZYEA 2QA4I 5J4VA 4UVCA 3FBIB 4BE2A 4HF2A 4AM3A 1P4XA 3JTHA 3QU6A 1S3JA 2M7BA 3TL4X 2F5CA 3S2HJ 3L2RA 3FX3A 1JGSA 2R0QC 4I0BA 2OBPA 1VQNI 1YLFA 1YJ9I 3HGYA 5HLTA 3O3KA 1MJ9A 1U9OA 2K27A 1IN4A 2VXDA 4L5EA 4PJMA 1R4NB 3KFWX 2VOOA 3RKQA 3BT9A 4Y7NJ 1HXDA 3CUOA 1S72I 1O9SA 2F4IA 2D2WA 1KZHA 3I56I 3K2ZA 3KMTA 3HG9A 4ZTJA 2PBIA 5TEGA 1SD6A 2DFFA 2M0CA 3IWFA 1W5TA 3L9FA 1LKXA 3MVPA 5CVVA 4BBSJ 2BQZA 4M6VA 2FD5A 2LKXA 3DWLE 3WG7H 2CQ7A 1I5ZA 2ESHA 4G7HF 3F8MA 3MQ0A 3FXKA 3CC2I 1N77A 1BI0A 3OYIA 3LAPA 5CVRA 3G1OA 3ROUA 2TRTA 1G2HA 4XORA 3RPQA 1QPIA 1REPC 1SVOA 4BEHA 2HKOA 2VPRA 1YHQI 4W97A 2F5VA 2Z3YA 3OYAA 1MBKA 2JUGA 2LH9A 3ZPLA 1Y56A 2Q2EB 1U6GA 4YRVA 2W48A 1KYWA 3GTMJ 1ZAOA 2LNBA 5HNFA 3QQAA 3AG1H 3LSPA 4WX9A 3LOCA 3PNVA 5A2QK 5LLQA 2CV2A 5BOXA 2LR8A 3AG3H 4UUTA 5FKKA 1VQ8I 3M4OJ 3JREA 2RN7A 2L7FP 2A6EF 5FGMA 4RGUA 1BC7C 3LFKA 1BW5A 1W7PB 4I09A 2M3AA 3CMAI 4E7IA 1JGGA 2VKHA 1DU6A 4IZZA 3K4BA 3TQNA 4E4HA 2D1HA 1IC8A 2XKOA 2ISZA 1UMQA 2DW4A 2DOAA 2W1OA 3RI4A 3C1DA 1MGTA 3SQNA 5F64A 4HV5A 4AVZA 1PP7U 4IHSA 2YPRA 4A3IJ 5FKLA 3MKWB 4I76A 2MLGA 3I5UA 4E7KA 3CC7I 5DCFA 2NOGA 1LFPA 1T33A 2A68F 5J6XA 4KIFA 3ABMH 3HYIA 1XSXA 2VXZA 3GTKJ 3OSFA 2CUZA 5L3GA 3BG5A 4Y3OA 4XLFA 5TTFA 1ETXA 1FMWA 3WGIA 2A5YB 2FBHA 2V1UA 3AL0C 3RJPA 3CJTB 2QEXI 1Z67A 4BHBA 1ZQ3P 1EH8A 4QPOA 2HPMA 1APLC 5L3BA 1F1ZA 3PJRA 2XIGA 3BQZA 2MA3A 4CA0A 1MVHA 1T39A 4N9IA 1J7KA 4XKBA 2ZJPF 1HW2A 3L2UA 4L0ZB 2EV5A 3S32A 4PFPA 4HAMA 3VB2A 3GTJJ 4XKVA 3CCUI 3MZHA 1P2FA 1Y1WJ 4RZ0A 3HHGA 2VBZA 5CQGA 2MYSA 3D5LA 2H8RA 4E47A 3K4MA 4P1WA 3PM1A 2KZVA 5FD6A 3DXJF 2LKPA 3LA7A 2IGNA 3TG4A 2ECCA 3FKIJ 4HA8A 5D4SA 1YRNA 2L4MA 4DW6A 1I6HJ 1JTXA 5IP7J 2R5ZB 1S7OA 1ZG5A 4XOPA 5BQTA 1V4RA 4KIGA 3GWZA 3CMMA 3BTLA 2QCOA 2ZXHA 2EFOA 4HNTA 2ZC2A 2XRLA 5FLVA 2VE8A 2DK8A 3K6GA 1SD5A 5E18F 4QLCU 2PMHA 4M3GA 4RM3A 3NWTA 1FBUA 1RC9A 4IF4A 3OL4A 2L5QA 3BR2A 3QOEA 2PJPA 5JVTA 3K69A 1WKMA 2YU9J 3I4MJ 4M3DA 1MDMA 1LNWA 1IO2A 3QPLA 5IYBJ 3QYBA 3F6VA 2F6CA 1TWCJ 2HYJA 3WTYC 2GXAA 3K4KA 5K5OA 1O4XA 3KPHA 2R5ZA 3NEUA 3OYKA 2CGPA 1NH3A 3RQ4A 2DMPA 1BM9A 2E2JJ 4H12A 3GBGA 3QWWA 3HOXJ 4O5VA 2JSCA 2VBWA 5D8KB 1FPQA 3S14J 5E3OA 5LSXA 1SAUA 1ZGAA 5JVGF 4LD5A 5LHHA 1D1BA 1NHAA 2FRHA 2W00A 3GXOA 3KLNA 3Q0WA 2EFQA 1SFOJ 3HXLA 1ZG1A 1XCVA 5JHFA 2E60A 3H36A 3S3NA 1ZGJA 1RKTA 5KJKA 3ZR8X 1J5YA 2E7WA 4ZDOA 1BC8C 4LK1F 1ETQA 2BVMA 3G6EI 1HQCA 2COBA 5FD5A 2VJ4A 3B6CA 2H8WA 3HGGA 2O9LA 2HZTA 2TDXA 5B5EC 4EJOA 3TW7A 3CCSI 4ZZDA 2VJ5A 4XSXF 1DP7P 3DALA 2GWRA 3JRBA 2RGVA 2RVCA 4YFXF 3GTQJ 1I3QJ 2AO9A 2F5EA 2BOLA 1XX5A 4U7BA 1OLTA 3RIBA 1IUFA 2A61A 3PL8A 3TDZC 1ZH5A 4HX7A 4Z6YA 2AQFA 1OR7A 1GV5A 3FHNA 3FXUA 4BHCA 4BS9A 1IG7A 4IJ8A 5KJLA 2ZSIB 3WTWC 4XK4A 1DU0A 3HDDA 3WU1B 4DNCA 1KU3A 5BMZA 2ZMEC 4RGSA 5F27A 1ZK8A 3OYEA 1HW1A 3ZMZA 3K4NA 3S3OA 2F4MB 2HYFA 2GZWA 3QOPA 2JA7J 3HRMA 2BGCA 3C18A 1MNMC 3WE3A 3HOYJ 2DU9A 1RKWA 4BE1A 3GX4X 1Z1DA 1MMDA 3GF2A 3K4JA 2MG4A 2P6TA 3N05A 4CCLA 4U88A 4QWQA 3FPDA 2GBYA 2ZKZA 3BR5A 4M6YA 2WA0A 3ZQQA 4EEFG 1QPMA 3K1MA 2X9DA 2K5CA 4H4KC 4AIHA 3J7YJ 2LY1A 3ZN1A 2VOPA 5LD2C 2NVYJ 2HXOA 1T98A 3V7RA 3S17J 4PSWA 1KU9A 5HOOA 5EX0A 3E7LA 4ZYHA 4NVQA 5CYVA 1VF9A 1WZ2A 2EA4A 2R3SA 4UY8I 5F6FA 1IV8A 1ZG3A 1T8IA 5JINA 1Y8QB 2P7CB 4BKXA 4BXXJ 4YNDA 1BI3A 5IYCJ 4DOZA 1VQ9I 4NNJA 2O6GE 1XGNA 2JV0A 5C4XJ 1WCMJ 3KP2A 2LBFA 1UHWA 4HLXA 2RV8A 4IHTA 4PJLA 3SEZA 1XB4A 2DN0A 4CHUA 3TO9A 2QUFA 3KEOA 3LSTA 1N3JA 4YEJA 3QYFA 5KHDA 5K1YA 2P5LC 2GA1A 2R4GA 3ZQCA 3HTSB 3PDNA 3BTCA 4QEOA 3E97A 1ETKA 2K86A 4A0XA 1ULYA 4IEJA 2G9WA 1Z21A 5JHUA 1K78B 2XAHA 2XSDC 3NWSA 1YTYA 1RR7A 1UHMA 2JPBA 1DGRM 3CCQI 2KL4A 2X6XA 2R7DA 1Z7LA 2L2OA 3M8EA 3U21A 2OD5A 5GPCA 3ELKA 2X6OA 1RZ4A 4MTDA 3PUBA 4CUGA 3FISA 4I0AA 5DYMA 3J81Z 4F92B 1X58A 2M7AA 4PCQA 4R1HA 1JHHA 2ZNYA 5F08A 3CCMI 2CV1A 1LUJB 4DZJA 5E1ZB 4X0GA 4G6DA 4BY1J 3QPHA 1KA8A 1B6AA 4XL9A 4DQ2A 3F8FA 4J01A 1FOXA 1Z6TA 4RS8A 1MJAA 2XHKA 3OMYA 4DBRA 1BBYA 3DPTA 1K4SA 3GZ5A 4EV0A 3J7ZI 3Q9SA 3VYTB 1D0XA 3QWLA 4CZCA 4HW0A 5ICCA 1E2XA 3I3LA 1FYMA 3F9XA 3DBHB 3WTTC 4HNVA 2ZB9A 3KZYA 2JVGA 2K9LA 4ESJA 3QU3A 3WTUC 3QP6A 3GFLA 4ESFA 3CCVI 1V5FA 2L02A 1WHUA 3ISPA 3CD6I 3BP8A 1JJ6C 4JDSA 3F9ZA 4HPQA 1E3OC 1BL0A 1YS6A 3W2VA 4AIDA 5D4RA 1Y1VJ 5IT9K 3OYDA 3TMOA 2ZXIA 1A31A 4XONA 3OYBA 2E1NA 3L2WA 3BR3A 2W85A 4IHYA 4QENA 5K7ZA 4EATA 1TNSA 5ILUA 1XGMA 3IAS2 2X0LA 3E6BA 4WXHA 3BG3A 2DA1A 2NAZA 1U2WA 3J80Z 3HRUA 2H27A 3JW4A 3CESA 2BXYA 4F91B 4IRIA 4Q48A 4G12A 3IP4B 4RAFA 2VJIA 1GT0C 2DAOA 3I0TA 2DFIA 1UELB 3MCZA 3RTRA 3M1EA 3JRFA 4E7HA 3M8JA 2XGXA 2R7FA 1S7EA 1MKMA 2YUSA 2DMUA 1W7PD 5IP9J 1YFHA 2WAQN 4D9JA 1FZPB 3J7AO 5LGNA 4XN3A 3DCFA 4A2UA 1O3RA 2EWNA 4FX0A 4WXDA 2A69F 2KRFA 3CCLI 1LVKA 2MH2A 2FBKA 3F8BA 2HOTA 1HKTA 3RSNA 2HYGD 4PZJA 1O3SA 1KQ9A 3ZMDA 2AQEA 2NVUB 2L9VA 2V9VA 4GYGA 2NXNB 1RIOH 3RKWA 3EUHC 2BW3B 4MFEA 5C3EJ 2BVLA 1LDDA 3ZN0A 4XLAA 4B3AA 1MD0A 3GVAA 1YS7A 2K02A 2EV0A 3D5RC 1WJDA 2W4SA 3M7GA 3MD2A 3V8JA 1GVDA 4H0EA 2Y30A 3CCYA 3VOEA 1B9NA 4XQFA 3HL2A 1SAXA 4GXOA 4BH9A 4XRMA 5L3CA 2W5ZA 1R00A 4J00A 4ABZA 2DDAA 2OPTA 4OU0A 1Y39A 1YX3A 2KQRA 4AYBA 3O8GA 1XD7A 3ZGKA 2R92J 1QBJA 3RKYA 5EZGA 3I58A 4UVAA 1BIAA 2FX0A 2ELHA 3PIOF 1Z91A 2UXXA 1PEGA 2IS4A 1PJRA 5FROA 3S2DJ 5GAEJ 1O3QA 1XDUA 1WQ2A 3N4MA 2UWMA 3EP0A 1JUMA 2IJLA 3H0GJ 3TO6A 5LHIA 1ZTRA 4B3XA 4LB5A 4G7OF 3H5RA 4BHPA 4A3MJ 5E1WA 2CUEA 5GTHC 2LY9A 1TP4A 2D1VA 1B59A 4P5OA 3M54A 2OUMA 3MAJA 2M1BA 3CBOA 4A0YA 1R1UA 1FNNA 2WV1A 4ZTFA 2OA4A 2W82A 2R7UA 2HKXA 1QZYA 2A6HF 2AXLA 2BY0A 2ESNA 3BPXA 2HQRA 3K4CA 5ARGA 3HC7A 1IV6A 3CBMA 1TL8A 5F59A 5LGTA 3JRIA 3E3VA 3LQQA 4BDZA 2K7LA 3IHUA 4CGZA 3I4NJ 4LIVA 5CCMA 4B47A 1FIAA 1IXCA 2FBIA 3RPUD 2A05A 2L3DA 5CQEA 1R1TA 3FHZA 3H9GA 4CCOA 3JRDA 3H35A 4MQ9F 4JQFA 2R5YA 3ABTA 4PK4A 2M87A 3A0HC 4HBLA 2E5ZA 3VYSB 4E70A 4AIJA 4ZDLA 3DTIA 2XB5A 3MMYB 4ZZLA 5HLIA 1Y6IA 3HIFA 1E0EA 1YW9A 1S5LC 4A69C 4ZYAA 1GUUA 2B0LA 3BJAA 5DUIA 3CBPA 5TH7A 4KISA 1D5YA 3L2VA 4G94A 1LFUP 1R36A 5J40A 4P9UA 3OS0A 2ADUA 5HDKA 5JFRA 2Z2SB 4KN7X 4ENKA 1T0FC 4ZJZA 1ETWA 2PFBA 5TGTA 3A4CA 3K10A 3RU0A 2JPCA 4OIRF 3R0AA 2CS3A 2DFEA 4BU2A 3BCBA 1ZARA 3JRGA 4N4NB 1TQMA 3NQOA 1Z9CA 1SFUA 2Y9ZA 4NC7A 4M3BA 1JXSA 1K6OA 2QSGX 3DKWA 4U87A 1F5TA 1VQ7I 1HDPA 3ZRGA 2IS6A 1S29A 4BE0A 3K0LA 3W6JB 4WWCA 2LKSA 3IHXA 2P4WA 4S05A 3GFJA 5EG2A 2OJED 1MMAA 4X6AJ 2C6YA 4P55A 3I54A 3ZQHA 5AYFA 2ZCWA 2XGDA 2O8JA 2P6SA 2XAQA 3CO6C 3L00A 1CGPA 1ZREA 4BQNA 5FLMJ 2CFOA 5GTIC 4KIBA 2QPWA 1MBJA 3IUOA 4C3JJ 3OS2A 2ZXJA 1ON1A 5HNHA 3K1PA 3W2AA 1X2NA 3TBIA 4BACA 5FLXZ 5B1AH 3PSFA 2EBIA 1FTTA 3Q3SA 1X2MA 1MMSA 4JX5A 1R5ID 2G7UA 1D8JA 2IGKA 3ESWB 3HRTA 1Q1VA 3PIPF 1JTYA 2KIFA 2HQNA 2NOJB 3KP6A 3GCMA 1XGOA 3IAM2 5FJ8J 4M9XA 3GTGJ 4RMNA 2YR2A 5AIPA 1IRGA 2LRDA 2Y9YA 1GXQA 1TWHJ 5LEKA 2A07F 3JSPA 3SW9A 4BL0B 2PN6A 1JI8A 2IEKA 2J5PA 2VONA 3S7JA 2MW8A 2L9RA 2CFXA 2E35A 5CKTA 3ML6A 2DA7A 1R22A 1AHDP 3I64A 1JKPC 1H3IA 4ITVA 5M3FJ 5FKOA 1V5GA 4NQWA 3IKVA 3EUKL 4KMFA 1O3TA 1MH3A 2PJRA 4D1QA 3HSFA 2OCEA 1HW5A 1T2KA 3HTUA 1WI9A 3TDUC 2K3PA 1QZZA 1ZN2A 3HSEA 3SZGA 2NS8A 3CUQB 1X1PA 2JQ7A 3CZ6A 1VNDA 2W57A 5DCMB 1BN5A 1FEXA 2VB6A 3ASNH 5DCMA 2ELJA 4CYCA 2O8XA 3QPTA 2VE9A 3M58A 1OPCA 2DA4A 1U5TA 4U0VA 5H20A 3AAFA 1YI2I 1U8RA 1P92A 3I59A 1KONA 2FE3A 1YJWI 4CCMA 2HVQA 5EG0A 3I53A 3DB5A 3B6AA 5FKNA 1IDYA 5EEAA 4NC8A 3IRRA 3JR9A 1OCZH 2Y0SA 4BQAA 3GTOJ 4J83A 2MGQA 4ANJA 1ERDA 5E1XA 3OXGA 2CQQA 2ME6A 3Q0UA 5L3EA 3P9KA 1X4PA 2EPFA 3UKGA 2CO5A 2DJIA 2M2EA 5DS9A 2VC1A 1G3SA 2JUCA 4PFOA 1IN7A 2JA2A 3KZIC 3OIOA 2I10A 2RQQA 3HPHA 5EGOA 2ZFWA 2QSFX 3QP5A 1HSJA 3DFGA 3SZTA 3WHBA 2CW0F 2L9SA 2QQBA 3KYLA 1XMAA 1WVRA 2NS7A 3QPSA 4F93B 2WADA 2HU9A 3HBLA 3BR0A 3HPGA 3WG9A 3B02A 1FBQA 5HDNA 1S6LA 3BZCA 1B72A 1BOBA 1A5JA 3DU5A 2BY1A 3BR6A 3MO5A 3B73A 1XC5A 2QENA 2K40A 3T8RA 2A5WA 3SFIA 1TT5B 4C2MJ 1OMIA 1YJNI 3HOWJ 4XLPF 2EA2A 1LVAA 3M5AA 3DV8A 2VUMJ 3U1KA 1AKHA 5B3SH 1MMGA 3LAJA 4IHWA 4BNCA 4HYEA 4XSZF 4A3KJ 2IGQA 3FM3A 2HVSA 2QWWA 2N8GA 1RUNA 4YNPA 2WC2A 2Z33A 1J0RA 3CO7C 5F0CA 1LDJA 2DODA 5J8CA 1X1DA 2LMDA 2QLZA 1R6RA 2IBDA 2Z1DA 2DK5A 4JBAA 3IV5A 1FJLA 2H1LA 1JT6A 1JT0A 3PQJA 3PFIA 2VIXA 5H6RA 5J1RA 3LSJA 2STWA 3M9AA 5EGOB 3OS5A 2QQ9A 1IGNA 3I55I 1HKSA 3S93A 1QQIA 2HNHA 4S04A 2HQ5A 3S2WA 2DLLA 1SMTA 3CQZJ 3MN2A 1I39A 1EKEA 4CDGA 2Y75A 5M5XJ 1ZR4A 3OR2C 5GPAA 1IAWA 1VQ4I 1FY7A 2RQPA 2EH3A 5M5YJ 4Y17A 3LNQA 3HM5A 1FTZA 3C7JA 1K83J 1X3ZB 5K7HA 3WTSC 4LITA 2OCCH 2P7VB 1FX7A 3R4KA 2KIUA 1IF1A 2R7SA 2M45A 2L7KA 3KETA 3F8CA 5GP9A 2XGEA 3G1LA 3CP2A 2CQXA 4M72A 1H89C 4MI0A 2KJBA 2EZHA 1GVJA 2E36A 1SC7A 1NK2P 1QHGA 1HSTA 2CRGA 3IWZA 1XMKA 4B44A 2IRFG 2QSHX 2LYCA 1O7FA 3E6MA 4DIQA 1YO5C 2IA2A 4XICA 2HEOA 2FQ3A 3VUZA 2KMUA 1K6YA 5B1BH 4UVBA 2J5OA 1WI3A 3E6DA 1S9HA 1EJ9A 2E1OA 2GQQA 4MEYF 3LSMA 4IJDA 2WY7Q 1NTCA 4LMYA 2CJJA 2HXIA 4PDKA 1P4WA 4F7ZA 3LSRA 2LF8A 1OFCX 3R60A 3OY9A 1R23A 3K70D 3AFHA 1VQKI 3M59A 1P6RA 1GLNA 2UV1A 2OQRA 2UUZA 1JUSA 4EJVA 3V7SA 1VQ6I 3OYNA 1H88C 1D8KA 3EUHA 2ELKA 4NQWB 2KISA 3DBLB 3HOZJ 4MHGA 3OPEA 4CXFA 3VSLA 4B09A 3LMMA 4J8OA 1I6XA 2I8DA 3RPUA 1ZHFA 1MBEA 1R71A 1B1BA 2KZGA 3PNYA 2M9HA 1DPUA 3DQVC 1MBHA 2XGCA 1NG7A 1MNDA 5TRDA 4RGRA 4LGWA 2QKMB 1T08B 5E8GA 1X3UA 5BPIA 2LK2A 5F6LA 1XGSA 2PMZN 1X3WB 3I9V2 4L9NA 1TNTA 4AIKA 1O57A 1G3YA 2VQLA 4P9FA 3G2BA 3CLOA 1BI2A 3TKYA 4NJ5A 1KU7A 2VPLA 2VQHA 4LJZF 4L9TA 3BPVA 3AG2H 3BQYA 3CF5F 3A2KA 3OOIA 1J75A 3G71I 2VI6A 4N9HA 4IQJA 2GXBA 2L4AA 2CW8A 2DFHA 4I02A 4YFNF 2BY3A 4YIFA 2R7OA 2PLYA 1WJ5A 1YE9A 3F6OA 3L1PA 1LB2A 1Z0XA 4M74A 3S8PA 3DPUA 1U5TC 4G8XA 2W5YA 4CZZA 1H9TA 3A03A 3CP8A 2M30A 3COAC 1BR4A 1U3EM 2EB7A 3ERMA 3QODA 3T5XA 4II3A 4V2GA 1P9QC 1RR8C 3KYCB 3GO5A 4D5FA 3VYRB 2FMYA 3AL0B 4LFUA 1MVXA 5IT9Z 5KVRA 4IJAA 4ZDPA 4A3GJ 3O6BB 1XPXA 1WFXA 1FT9A 2QF7A 4OINF 3RIRA 4BGDA 2XVCA 5J1UA 1T38A 2W7NA 2CH0A 4UXNA 1UB9A 1USSA 2HVRA 2B63J 4M3EA 3CMYA 1XN7A 4MQVA 2P0WA 2DTRA 1SD4A 2EZIA 3DBRB 3KYDB 5D6EA 5EDNA 3JAMK 2FXAA 3KLOA 4P96A 1TQPA 2LDUA 3KE2A 3Q0VA 1V5EA 2DTZA 1O7LA 4CCKA 4ZH4F 2W24A 1UAAA 5C44J 2KLOA 1TWGJ 5DD4A 2H6CA 1ETVA 4KT6A 3A0BC 2L0KA 2ME0A 5KAFC 4X1EA 5F0FA 3WTZA 2IS2A 5CVUA 1ZRCA 4KNYA 2VJJA 4RLFA 4B1RA 1FYKA 1H0MA 2Z9OA 1ZKGA 5ICFA 3BCAA 1VQOI 4GRIA 2FEZA 1VQPI 3REOA 4LG0A 1OCTC 3IC7A 2M4GA 3OL3A 2XAJA 3FK6A 2HDCA 2LTPA 3CJRB 2DT5A 4BEHB 2IS1A 3HSRA 3FIWA 3J80K 1I50J 4JK1X 2HWVA 4EM1A 1HCRA 4L18B 2GOMA 3Q9VA 3FXOA 2JRTA 3QRFF 3KZZA 2QBYB 3KCCA 5LHGA 1NG6A 2Z5UA 1FOYA 2XPWA 2M34A 3ZMTA 2HTJA 4A3DJ 2P5KA 2IVMA 3UNGC 4C30A 3TOBA 4EGYA 1MSFC 1KQ0A 2X85A 3ZQIA 3K2AA 3M57A 1BIBA 4HDVA 4GGGA 4M73A 4XLHA 2DPDA 3W2WA
chains in the Genus database with same CATH topology
4XNFA 2DT7B 2Z2SB 3E0JB 3BO5A 3KMJA 1T0FC 4ZJZA 3BLYA 1U0JA 5TGTA 3A4CA 3K10A 2M3AA 2IGMA 4E7IA 2VKHA 2CUJA 4IZZA 3RU0A 3OYJA 4PJJA 3K4BA 1X1BA 4E4HA 5T5GA 3PSIA 2CS3A 2KDOA 4BU2A 4CSWA 3BCBA 2PMZA 2DOAA 2BW3A 2W1OA 4N4NB 3DTEA 3AKZA 3DEEA 4AVZA 1W36D 3MKWB 2JSPA 4NC7A 4XKCA 1AA7A 4F52A 4E7KA 1X1AA 2RNGA 1ZKKA 2KP6A 2WAFA 2VL8A 3OOUA 4U87A 3HOSA 3ZRGA 4E7JA 2IS6A 4E6KG 1LFPA 4BE0A 3IHXA 1WJAA 2WY8Q 4XKWA 4BJ6C 2V6EA 2VXZA 5EG2A 2ZFUA 2CUZA 2LBFB 1MMAA 4Y3OA 2WBMA 2A6TA 1FMWA 4XLFA 5TTFA 5AYFA 1D0ZA 2O8JA 1PYVA 3AL0C 4OAZA 3MO0A 4QPOA 2GOXB 4BQNA 2CFOA 2HPMA 3PJRA 2QPWA 3IUOA 3OS2A 3L2QA 1XQHA 4CA0A 5HNHA 3W2AA 1MVHA 3TBIA 4XKBA 4BACA 2VQCA 3L2UA 5FRNA 3S32A 4PFPA 4C1QA 4XKVA 3PSFA 3M53A 4RZ0A 2R7WA 3VV0A 3SWCA 5CQGA 2MYSA 2IGKA 4E7SA 4N4OB 3D5LA 4E47A 2X51A 4KITB 2NOJB 3K4MA 4P1WA 4B43A 2KZVA 3H0DA 5F6KC 3IAM2 2IGNA 4RMNA 3H5NA 3TG4A 3OR1C 3KX2A 2LRDA 5ARFA 4ZC3A 5LSZA 4XOPA 2L9NA 3SW9A 4BL0B 3CMMA 1JI8A 2ZXHA 4IQ4A 4HNTA 3S7JA 4XLEA 2XC7A 5CKTA 3K6GA 4FETA 1DQUA 4XMYA 4C2TA 4RM3A 3NWTA 3OL4A 1H3IA 3N71A 2L5QA 4ITVA 2KRCA 2ZSHB 4BJTA 1V5GA 3VYUB 3QOEA 2X1CA 4WUYA 1X4OA 3EUKL 1W36C 2VQGA 2PJRB 2HQAA 3F9WA 3S7BA 2PJRA 4D1QA 3RCOA 3C2HA 3QYBA 2F6CA 2K3PA 2XAUA 3OYGA 3QWPA 3K4KA 3SZGA 3OXFA 3OYKA 2XSJC 4YELA 4JLGA 3RQ4A 3CZ6A 3DPLC 2CMPA 4CH7A 5HI7A 4H12A 3GBGA 3E1SA 2KPMA 3QWWA 5HQ8A 4YPAA 1WJEA 2VB6A 2WAQA 2V1NA 2ELJA 1UG0A 5LSXA 1SAUA 1DP3A 3FBNB 1D1BA 2W00A 2X6YA 3M58A 3EPZA 4II2A 3HXLA 3OIPA 3OWTA 5JHFA 2E60A 3S3NA 1N75A 4PSXA 5KJKA 2LREA 2DT6A 2KHMA 3ZR8X 4DGWB 3KMAA 2Z16A 4ZDOA 1KONA 2BVMA 4CCMA 2HVQA 4LIUA 3M55A 2VJ4A 3ZXSA 4CCJA 3DB5A 4XLCA 3A1YA 1SFKA 2VKDA 4NC8A 1WJFA 4XM3A 2WAEA 3HNAA 3S7FA 1MUFA 2VJ5A 2XF7A 2Y0SA 4Y33A 3DALA 4O30A 4Y4RA 4J83A 2BOLA 4ANJA 4XN0A 4U7BA 3EUAA 1ERDA 3OXGA 3C2GA 1OLTA 3RIBA 3SYTA 3PL8A 3LSHA 3FDYA 2R7XA 2R7VA 2AQFA 1X4PA 3FHNA 4BS9A 5KJLA 4IJ8A 2DJIA 2ZSIB 3K4LA 4MLOA 2HPIA 2OC6A 4PFOA 2JA2A 3OYEA 3K4NA 5LFAA 3S3OA 2RQQA 3HPHA 4LDGA 2V7FA 3QYEA 2HDWA 4HNUA 4CCNA 2L9SA 4HG2A 3KYLA 4BE1A 3DKYA 1MMDA 3K4JA 4F93B 2WADA 2HU9A 1FMVA 3N05A 3HPGA 4CCLA 3LSGA 3FPDA 2DXIA 2WA0A 3ZQQA 3SDBA 2XDVA 2K5CA 4H4KC 1BOBA 3DU5A 3MO5A 3HUGB 2CW7A 2LY1A 4HRIA 2A5WA 5LD2C 3VSKA 1TZLA 3OS1A 4PSWA 2E5NA 1MNEA 5HOOA 5KNLA 5EX0A 3S7DA 4QEPA 3M5AA 4PUSA 4NVQA 2FUG2 2JVHA 1MMGA 1QU3A 5KJMA 3S3MA 2IGQA 1BR1A 2HVSA 2XF5A 5JINA 3MEKA 4YNPA 2M4KA 2RFIA 4YNDA 1X1DA 1DGWY 2Z1DA 4LG3A 1R6RA 3OS0A 2Q1ZB 4RLQA 5FRMA 2R7TA 4DOZA 4NNJA 2MABA 3OIQA 4DBQA 2JV0A 3H9JA 2VIXA 2LBFA 4Z4PA 3MKYB 1QHHD 3CF2A 4PJLA 4B48A 3SEZA 2G46A 3OS5A 3LL7A 1ZELA 3S93A 1N3JA 2LC2A 2HNHA 3QYFA 2RREA 4YEJA 5KHDA 1N6AA 2R4GA 3PDNA 4QEOA 4YPEA 2R7QA 5HVQC 3W3CA 1Z21A 1VZ0A 3OYCA 5JHNA 3OR2C 4PJNA 3NWSA 1DGRM 4HSRA 2KL4A 2X6XA 1LDKB 1Z7LA 2L2OA 2MD0A 3U21A 4LITA 2X1EA 4IKFA 3PUBA 4CUGA 2R7SA 2L7KA 5CCLA 3DTKA 2E1MC 3CP2A 4F92B 4MI0A 2IXSA 2M7AA 2CV1A 3LFUA 4R79A 3DU6A 4X0GA 1QHGA 4B44A 3BG7A 4XL9A 2LYCA 1BR2A 4DIQA 3OYHA 4J01A 3UR3C 3OMYA 4DBRA 3DPTA 3OYFA 3HOTA 3VUZA 4G6TB 2HZDA 2KMUA 4J7FA 3VYTB 1K6YA 1D0XA 4E7ZA 4CZCA 3F9KA 3H9QA 3FKJA 1HA8A 1S9HA 3I3LA 3F9XA 5KCMA 3LSMA 4IJDA 2E1MB 2WY7Q 2JVGA 2K9LA 4OAYA 5CPRB 5EX3A 1D1CA 1YX5A 3HKZA 4QPQA 5T0KA 3OY9A 3K70D 3M59A 3AFHA 1V5FA 2F69A 1GLNA 4C9YA 2UV1A 1D0YA 2UUZA 4JDSA 3F9ZA 4HPQA 3W2VA 5JIYA 3OYNA 3OYDA 2IGOA 4NQWB 3TMOA 1MMNA 2ZXIA 3DLAA 3OPEA 4J8OA 3VSLA 3LMMA 4XONA 3CJQB 2I8DA 2X1DA 3OYBA 5F5EA 3L2WA 4QENA 3PNYA 4EATA 2DCEA 3IAS2 3DQVC 2XF6A 4BQQA 1NG7A 1MNDA 2QKMB 4NUBA 3CESA 3V42A 4OWRB 4F91B 3OYLA 5F6LA 3I9V2 2LG4A 2VJIA 3IP4B 1UELB 2VQLA 3RTRA 1ML9A 1MW7A 2QKLB 4E7HA 3G2BA 3M8JA 4JOMA 2R3AA 1G59A 3OXLA 2V4JC 1T95A 5JJ0A 4NJ5A 4D9JA 2VPLA 4I51A 2VQHA 4XOTA 4XN3A 1MT6A 3A2KA 1WJCA 3OOIA 1Z3YA 4HSTA 4XR6A 1LVKA 5T0MA 3RSNA 4IQJA 2CW8A 2AQEA 1X1CA 4BQOA 4YNMA 4F3QA 3J7AY 2R7OA 2LOOA 1WJ5A 1YE9A 3EUHC 2BW3B 3SEQA 1D1AA 2BVLA 3S8PA 3DPUA 3VDXA 4XLAA 2W5YA 3CP8A 3BG6A 1BR4A 3QODA 3LSKA 4BDYA 3M56A 4HEA2 4II3A 2V9KA 3BC8A 1P9QC 1N78A 3D5RC 1WJDA 2W4SA 3MD2A 4O6FA 2LY2A 3VYRB 4XQFA 3HL2A 3RAYA 4IX7A 3AL0B 3D5SC 3DKXA 3MKZA 4J00A 1MVXA 2W5ZA 2V26A 4FMUA 4J7IA 1YX3A 2KQRA 4AYBA 4ZDPA 3PFYA 3ONQA 3ZGKA 1WFXA 4RM2A 2WB1A 4BGDA 1Z3XA 1IRXA 2W7NA 1TT0A 2CH0A 2O5RA 2HVRA 3VWBA 1PEGA 1WJBA 1PJRA 2MC4A 2MFZA 5FROA 3H5AA 4DJAA 2IS4A 4FASD 2X6WA 2R7RA 1OR7C 1J09A 2UWMA 2P0WA 3EP0A 2KRHA 4AU7A 1G8XA 3ZCOA 2VASA 4B3XA 1V5EA 3TG5A 3H5RA 2M0MA 4C2UA 1N6CA 4CCKA 1UAAA 4F55A 2VLAA 3M1CA 4E7LA 2KLOA 4P5OA 3M54A 2OUMA 4KT6A 3CBOA 3FBIB 4BE2A 3KEYA 3LSIA 4MI5A 1EA3A 3TL4X 2M7BA 4ZTFA 2W82A 2R7UA 2IS2A 5KJNA 3L2RA 4KJZA 2VJJA 4BXFA 4RLFA 3K4CA 3OYMA 5ARGA 2K9MA 3HC7A 5HLTA 3CBMA 3BCAA 5F59A 2VXDA 4GRIA 4BDZA 4PJMA 3F9YA 3MO2A 2M4GA 4LIVA 5CCMA 4B47A 3OL3A 2CV0A 1O9SA 2F4IA 3RPUD 1X19A 3KMTA 3HG9A 4ZTJA 3CJRB 5CQEA 4BEHB 2IS1A 5TEGA 1LKXA 2BQZA 3H9GA 4CCOA 3DWLE 3H35A 3K5KA 2OV7A 4JQFA 4YPUA 4PK4A 2GOMA 4BJ5C 2E5ZA 1N77A 3VYSB 3OYIA 3K70C 3QWVA 4ZDLA 3DTIA 3RJWA 3PNTA 3MMYB 1Y6IA 1NG6A 4XORA 4BUPA 1E0EA 4BEHA 4ZYAA 2F5VA 3UNGC 4C30A 2JUGA 2LH9A 3OYAA 3CBPA 5TH7A 1Y56A 2Q2EB 4YRVA 4KISA 5HNFA 3L2VA 2X85A 3PNVA 2CV2A 3M57A 4XLHA 3W2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BO5 A;  5LSX A;  3KMJ A;  5JHN A;  3S8P A;  3M58 A;  3RU0 A;  2W5Y A;  5T5G A;  5KJK A;  3M56 A;  3KMA A;  4O6F A;  3M55 A;  5CCL A;  3RAY A;  3DB5 A;  4MI0 A;  1ZKK A;  1MVX A;  2W5Z A;  4J7I A;  4FMU A;  3HNA A;  3S7F A;  1MUF A;  4O30 A;  3DAL A;  3IHX A;  4J83 A;  5EG2 A;  5TTF A;  3OXG A;  5AYF A;  3VUZ A;  3RIB A;  2O8J A;  1PEG A;  4J7F A;  5KJL A;  4IJ8 A;  3MO0 A;  3EP0 A;  2QPW A;  4AU7 A;  3F9X A;  1XQH A;  4IJD A;  3TG5 A;  4LDG A;  1N6C A;  5EX3 A;  5CPR B;  1MVH A;  5T0K A;  3M59 A;  3M54 A;  4C1Q A;  3CBO A;  2F69 A;  3M53 A;  4RZ0 A;  4JDS A;  3F9Z A;  3VV0 A;  4MI5 A;  3SWC A;  5KJN A;  5JIY A;  4E47 A;  3FPD A;  5F6K C;  4J8O A;  3OPE A;  5ARG A;  3CBM A;  5F5E A;  3TG4 A;  5F59 A;  4QEN A;  3MO5 A;  3F9Y A;  3MO2 A;  5ARF A;  5LSZ A;  5CCM A;  3SW9 A;  5EX0 A;  1O9S A;  3S7D A;  4QEP A;  3M5A A;  4NVQ A;  3KMT A;  3S7J A;  5KJM A;  2IGQ A;  5TEG A;  2BQZ A;  5F6L A;  5JIN A;  3MEK A;  3N71 A;  1H3I A;  3K5K A;  4YNP A;  4YPU A;  4WUY A;  2RFI A;  4YND A;  1ML9 A;  3F9W A;  3S7B A;  2R3A A;  3QWV A;  3OXL A;  3RJW A;  5JJ0 A;  2JV0 A;  4NJ5 A;  3QWP A;  4I51 A;  4BUP A;  3OXF A;  4Z4P A;  1MT6 A;  3CBP A;  3OOI A;  5TH7 A;  2G46 A;  3OS5 A;  4JLG A;  3RQ4 A;  5T0M A;  5HI7 A;  1N3J A;  4H12 A;  1N6A A;  5HQ8 A;  3M57 A;  3QWW A;  4YPA A;  3PDN A;  4QEO A;  4YNM A;  4YPE A; 
#chains in the Genus database with same CATH topology
 5KAI C;  4XNF A;  5J47 A;  2DT7 B;  4JYK A;  4Z2Y A;  3JSO A;  3KMJ A;  1U0J A;  1W0U A;  4NB5 A;  5F1R A;  2IGM A;  5J8F A;  2DOE A;  2CUJ A;  4XID A;  4DYC A;  5HDG A;  4ETS A;  4RB2 C;  1I1G A;  1X1B A;  5T5G A;  3PSI A;  5EZH A;  2KDO A;  4FE4 A;  2PMZ A;  3DP7 A;  1W5S A;  4DYQ A;  2BW3 A;  3DTE A;  3AKZ A;  3DEE A;  4LLL A;  2FOW A;  5F1J A;  2HR3 A;  1W36 D;  2VT2 A;  2QZ8 A;  1QVT A;  2ID3 A;  4XKC A;  2KJC A;  3KP3 A;  1ZKK A;  3OOU A;  3HOS A;  4E7J A;  3ZQL A;  4E6K G;  2LD5 A;  5IP6 A;  1SFX A;  1JKO C;  5GAH J;  1WJA A;  2WY8 Q;  4BJ6 C;  2V6E A;  2Y31 A;  2ZFU A;  2LBF B;  2D45 A;  1Z7U A;  4I01 A;  3EDP A;  3FXM A;  3H3V K;  6PAX A;  1PYV A;  5F04 A;  4OAZ A;  2M5W A;  1TW2 A;  2EZK A;  5BNG A;  2GOX B;  4M3F A;  3BG9 A;  3KP5 A;  1I3A A;  3MZ8 A;  4IXA A;  4AYB N;  3WGG A;  5AON A;  4EM2 A;  5FRN A;  2XB0 X;  4C1Q A;  2BEO A;  4MNU A;  2RDP A;  3M53 A;  4ENJ A;  1G3W A;  2R7W A;  3PQK A;  3VV0 A;  3SWC A;  2Y2Z A;  5LEJ A;  1UCR A;  3NAR A;  2CQN A;  1K61 A;  4N4O B;  3CCJ I;  2GXG A;  2X51 A;  4KIT B;  2KDZ A;  2B7E A;  2H94 A;  4MO7 A;  5F6K C;  5EEG A;  3KEQ A;  5L3D A;  2FSW A;  5TIS C;  2GIV A;  3CME I;  4HQM A;  5L3F A;  2ECB A;  3OR1 C;  1ZGW A;  4ZYD A;  3KX2 A;  1CF7 A;  4ZC3 A;  2BYV E;  2FOK A;  1GHC A;  3P5J A;  2L9N A;  4FX4 A;  4QTR A;  4XLN F;  3H92 A;  4J19 A;  4IQ4 A;  3BJ6 A;  4DYR A;  4XLE A;  2XC7 A;  2ACJ A;  4FET A;  4A0Z A;  4XMY A;  1E3P A;  1EF4 A;  5K5Q A;  3N71 A;  3KP4 A;  2ZSH B;  3WU2 C;  4BJT A;  3VYU B;  3FZV A;  1RPW A;  3CDH A;  2OU2 A;  2VQG A;  2PJR B;  3F9W A;  4FHT A;  3IH3 A;  1MIJ A;  3V7C A;  3C2H A;  3EQL F;  4OMZ A;  5M5W J;  1HBX G;  3T0Y A;  1FP2 A;  3OYG A;  2NVQ J;  3FM5 A;  4OMY A;  3WE2 A;  1A6I A;  1Y0U A;  3OXF A;  2G0E A;  2E34 A;  4AWX B;  4YEL A;  3DPL C;  2CMP A;  5HI7 A;  1OCO H;  3IL2 A;  5FO5 A;  2LVS A;  4YPA A;  1LEA A;  2RAE A;  1WPK A;  5FKM A;  1WJE A;  1IRZ A;  1UST A;  4UB8 C;  1BJA A;  2K4B A;  2WAQ A;  1J59 A;  2V1N A;  5E79 C;  1UG0 A;  4WCG A;  3FMS A;  1DP3 A;  3EPZ A;  1FOW A;  4II2 A;  5FB2 A;  1R1V A;  3BWG A;  4S0H B;  2DBB A;  1LPQ A;  4L5J A;  2DT6 A;  4RA2 A;  4A3E J;  2JT1 A;  3DLL F;  2Z16 A;  1R7J A;  3K7A J;  4HZF A;  5C4J J;  3WHC A;  3G4S I;  1K4T A;  4UV9 A;  3JAM Z;  2AXT C;  4XLC A;  1IN6 A;  3A1Y A;  4BYY A;  2VKD A;  4ZYG A;  1YIJ I;  2E2H J;  3M8F A;  2WAE A;  3S7F A;  1MUF A;  2ZBK A;  4N0B A;  4Y33 A;  5EF6 A;  2LP0 A;  4EMS A;  5KK1 A;  5ERI A;  5AIQ A;  5DD8 A;  2UZK A;  4XN0 A;  3EUA A;  4HDU A;  1AOY A;  1M1E B;  1F36 A;  3SYT A;  3LSH A;  3FDY A;  2R7X A;  3FF5 A;  2R7V A;  2DO7 A;  3K4L A;  3JRC A;  2QYO A;  1JHF A;  4MLO A;  3P7N A;  2IAI A;  2P5V A;  2H09 A;  1TWA J;  3TP3 A;  2EIJ H;  5LFA A;  3F3X A;  4WXC A;  5M3M J;  2JZY A;  2L7M P;  1XG1 A;  4PJ0 C;  3WGH A;  2PX9 A;  2DQL A;  3FXJ A;  4CCN A;  1XSD A;  3S15 J;  3ABL H;  4XRS A;  3O2P E;  1FLI A;  3J81 K;  1GDT A;  2FA5 A;  4YG2 F;  1FMV A;  2VT3 A;  1V54 H;  3ZMU A;  5F0H A;  4FCY A;  2ZJ2 A;  5DEQ A;  4GDF A;  2DXI A;  4A93 J;  2UXN A;  2OQG A;  1Z05 A;  4TV7 A;  4JP0 A;  1SEU A;  1OQY A;  3SXY A;  3HUG B;  4Y13 A;  3BRO A;  2CW7 A;  4HRI A;  1L3L A;  1IXR C;  3VSK A;  1TZL A;  1QVU A;  2KIQ A;  3F72 A;  5LGU A;  2E5N A;  2Y69 H;  5KNL A;  3OS1 A;  1SAN A;  4QEP A;  2YX7 A;  3M3Y J;  2JVH A;  2TCT A;  3FXL A;  1I1S A;  3S3M A;  3FXQ A;  4HF1 A;  1UHS A;  1DUX C;  2DA6 A;  1Q1H A;  1RET A;  3NRV A;  3D1N I;  3MEK A;  3RZO J;  3CCE I;  2XAF A;  2DJN A;  3ZP5 A;  2M4K A;  4D7N A;  2RFI A;  2YSR A;  1DGW Y;  4LG3 A;  5FRM A;  2XAG A;  4RLQ A;  4FT8 A;  4EM0 B;  2MAB A;  3OIQ A;  3TED A;  1T6S A;  2JMW A;  4AUX A;  2K9S A;  1SFE A;  3H9J A;  3IRQ A;  1ETY A;  5ED4 A;  4LG0 B;  1IN8 A;  2YU3 A;  3D0S A;  3DEW A;  2G46 A;  1QA6 A;  1A04 A;  4ENM A;  3LL7 A;  1ZEL A;  1JE8 A;  3PO2 J;  2RRE A;  3ULQ B;  4YPE A;  5HS8 A;  4L0Y B;  4RAG A;  2R7Q A;  2FF4 A;  5DV5 A;  3W3C A;  2DA2 A;  3OYC A;  5JHN A;  4IOC F;  4PJN A;  2QM3 A;  1U78 A;  1D3Y A;  2EFN A;  2BE5 F;  4HSR A;  5LRR A;  3E5X A;  3SZP A;  1VFC A;  3SDG A;  2QVO A;  2MD0 A;  4DZP A;  4Q4Z F;  4KMU X;  1L0O C;  1G3T A;  2X1E A;  2ZJR F;  4MTE A;  3S1M J;  4IKF A;  3ECH A;  2FQ4 A;  2FNA A;  2XRO A;  1XMX A;  2AHQ A;  4LOC A;  1E3H A;  1WGX A;  1OCC H;  3DTK A;  3FWE A;  2IXS A;  2ISY A;  4GFB A;  3LFU A;  4LLN A;  2CYY A;  1TLH B;  3DU6 A;  4G7Z F;  1ENH A;  4RDU A;  3BG7 A;  4I99 C;  2OAZ A;  1BR2 A;  2NS0 A;  3KIO A;  3OYH A;  1W1W E;  1PUF B;  1QO0 D;  4W1U A;  3OYF A;  3TGN A;  1J2X A;  3HOT A;  4G6T B;  2HZD A;  4J7F A;  3HZJ A;  4E7Z A;  4MIM A;  1FP1 D;  3ASO H;  3F9K A;  4IRG A;  3HUG A;  1KYZ A;  3FKJ A;  3H9Q A;  4PGG A;  4UV8 A;  1HA8 A;  4HV6 A;  4MFD A;  2BY2 A;  2EK5 A;  5CLS A;  3A01 A;  1FIP A;  5KCM A;  4GYI A;  2E1C A;  2E1M B;  1SVM A;  5CPR B;  4UUS A;  3HKZ A;  5T0K A;  3K9T A;  2L54 A;  3IH4 A;  1AKH B;  1WWX A;  2F69 A;  3BY6 A;  1K79 A;  3CTA A;  1QGP A;  2OF7 A;  4IOA F;  4WF2 A;  5JIY A;  1MMN A;  3DLA A;  1V55 H;  4A3L J;  4RB0 A;  2X1D A;  5F5E A;  5J4Y A;  2JWT A;  3GZN B;  2CUF A;  2DCE A;  1G4D A;  5BS6 A;  2GIZ A;  4RB1 A;  4L9V A;  4UUS B;  3L2C A;  1XSV A;  1ZRD A;  1IN5 A;  4EGZ A;  2BXZ A;  2K85 A;  1ZR2 A;  2MH9 A;  1ITY A;  3OYL A;  2L7Z A;  2PG4 A;  2EIL H;  5IOY A;  1PDN C;  3I71 A;  3L09 A;  1V3F A;  4I6Z A;  1G59 A;  3OXL A;  1I27 A;  1G6N A;  5D5U B;  1T95 A;  2OTL I;  3H1C A;  2DPU A;  3TW6 A;  4IVN A;  4I51 A;  1F4K A;  4XOT A;  3LWF A;  4RAZ A;  1B8I A;  1R58 A;  1T0F A;  2X48 A;  4FTH A;  2XKP A;  4XR6 A;  5A2Q Z;  5K5R A;  1YW8 A;  1H9G A;  1MJB A;  1LQ1 A;  1VQL I;  4EJW A;  2EIM H;  4BQO A;  1OIS A;  2K4J A;  4YNM A;  1OYY A;  3PUF A;  3J7A Y;  5D5V B;  2O3F A;  1NK3 P;  5CVI A;  3ZMS A;  4YFK F;  1EH6 A;  5E3L A;  4UUV A;  4ASN A;  2V79 A;  3VDX A;  5FFZ A;  3HRS A;  1IZ1 A;  3OOP A;  3ZOB A;  2DOF A;  4UB6 C;  4BDY A;  3E6C C;  1N78 A;  2Y0M A;  1ONV A;  2LSO A;  1CF7 B;  3RAY A;  3T1B A;  2COM A;  3D5S C;  2JA8 J;  2RNJ A;  3IH2 A;  2JA6 J;  2V26 A;  4FMU A;  1UFM A;  2EV6 A;  1FYL A;  4LK0 F;  2WV0 A;  2JRM A;  1OYI A;  3PFY A;  4R8H A;  5ILS A;  1Z77 A;  3ONQ A;  1HOM A;  4HX8 A;  4BBR J;  4FE7 A;  1BOA A;  2G7H A;  3TP0 A;  3GYH X;  2XPU A;  1Z3X A;  1IRX A;  2P81 A;  1TT0 A;  2O5R A;  1Y0N A;  2VN2 A;  4G6Q A;  4U7D A;  2XUB A;  3VWB A;  5H2F C;  2MC4 A;  2MFZ A;  1ORK A;  1SD7 A;  3FXR A;  1EH7 A;  4YIR X;  1BI1 A;  5LBQ A;  1OR7 C;  1YOV B;  1TC3 C;  1R5G A;  2KRH A;  5DM6 F;  2XV4 S;  1G8X A;  3ZCO A;  3V8L A;  3Q5F A;  1GV2 A;  2NNN A;  9ANT A;  3TG5 A;  2M8G X;  5FLX K;  4KN4 X;  2M0M A;  1N6C A;  2Q2E A;  2VLA A;  3BZ6 A;  4E7L A;  3C3W A;  2O7O A;  3HHH A;  1S8N A;  5LRS A;  3KEY A;  2ZNZ A;  2HOS A;  3LSI A;  3CDI A;  4MI5 A;  1EA3 A;  3F23 A;  3A02 A;  5KJN A;  2HTS A;  1UJ8 A;  4KT5 C;  3RYR A;  4KJZ A;  2CWE A;  1XDS A;  2KIM A;  2V1D A;  2ZO4 A;  4BXF A;  1HDD C;  3OYM A;  2OTJ I;  2K9M A;  1JKR C;  4PGH A;  2L01 A;  2K9Q A;  2V1X A;  2W84 A;  3F9Y A;  3MO2 A;  3V4G A;  4AD9 A;  3K1N A;  5IY5 H;  2CQK A;  2LFB A;  2CV0 A;  2OZ6 A;  1AWC A;  3BTJ A;  1X19 A;  1OCP A;  1RUO A;  3K5K A;  3U2R A;  2OV7 A;  4GCV A;  1OYW A;  4YPU A;  3MWM A;  4ENN A;  3W6V A;  4BJ5 C;  2OZU A;  3F22 A;  4I98 B;  1CQT A;  3K70 C;  3DEU A;  3QWV A;  5ICG A;  2CG4 A;  1VTN C;  1KQ8 A;  3RJW A;  4CYD A;  3I4P A;  3PNT A;  4U0W A;  4C3H J;  1LJ9 A;  4BUP A;  1B9M A;  3MZY A;  5J1Y A;  1FSH A;  2EQR A;  1POG A;  4IPA A;  1P4A A;  2DMQ A;  2ZXW H;  3GTL J;  4ESB A;  1RNL A;  3WTV C;  4OIP F;  2DQR A;  1IJW C;  5EYR A;  2M8E A;  2E71 A;  2V6C A;  2HDD A;  3T8T A;  4O3M A;  2IA1 A;  2MD5 A;  2ID6 A;  4EVI A;  3TO7 A;  3BO5 A;  3E0J B;  3ECO A;  3BLY A;  2IA0 A;  2PMU A;  1STZ A;  2MSY A;  2YX4 A;  1ETO A;  2IP2 A;  3CDL A;  3OYJ A;  4PJJ A;  5B66 C;  4CSW A;  3N97 A;  2EFW A;  3V8K A;  5GAD J;  3RZD J;  1F43 A;  5JLW A;  4NBQ A;  2JN6 A;  3TOA A;  3GEZ A;  1GXP A;  4MEX F;  3GLL A;  3JRA A;  3X2Q H;  2JSP A;  1SVL A;  2D5V A;  1AA7 A;  1OJL A;  4F52 A;  1X1A A;  2RNG A;  3ZQF A;  2KP6 A;  2WAF A;  2VL8 A;  2GM4 A;  4IHV A;  4A5M A;  1MZB A;  5DM7 F;  4XKW A;  2DMT A;  4GO1 A;  2WBM A;  2A6T A;  3FMQ A;  4LLG F;  1D0Z A;  1Y8R B;  3BOQ A;  4KIC A;  2X4H A;  3KP7 A;  3MO0 A;  2W25 A;  3JTG A;  2A3S A;  3RYP A;  4M9S A;  5E17 F;  2QQ8 A;  1LE8 B;  1OKR A;  3L2Q A;  1XQH A;  4KUM A;  5IT3 A;  1ON2 A;  5ICE A;  2HS5 A;  1U5T B;  2VQC A;  4HQE A;  4A12 A;  5E3N A;  3ERE D;  2KT0 A;  4D0P A;  4QSH A;  5DUK A;  2JA5 J;  4EJT A;  4E7S A;  3E5Q A;  3ZMV A;  4B43 A;  3H0D A;  1B4A A;  2WB1 N;  4JX4 A;  5FFX A;  3GW2 A;  4QIW N;  3H5N A;  4AC0 A;  3BJO A;  2BZT A;  3EET A;  4HLY A;  3G1M A;  5ARF A;  3U9G A;  4KFC A;  2O8K A;  1OCR H;  5LSZ A;  2JJ7 A;  2O61 A;  3S1Q J;  3F0C A;  3O8H A;  1JUP A;  5D6F A;  3H3Z A;  1PUE E;  1DQU A;  3GLX A;  4G9Y A;  3P9C A;  4C2T A;  5IYD J;  2XAS A;  3F8N A;  3RDI A;  2NVX J;  4XRF A;  2ZJQ F;  2KRC A;  2X1C A;  4WUY A;  1X4O A;  4B4C A;  1W36 C;  5EJC A;  2HQA A;  1B8I B;  3S7B A;  3RCO A;  4M9Z A;  2F5D A;  2WWY A;  3WU0 A;  3WTX C;  2XAU A;  3VFZ A;  4NHJ A;  3QWP A;  2R93 J;  2ETH A;  2XSJ C;  4Q47 A;  2HFH A;  1UZC A;  3G3Z A;  4B8X A;  5E8I A;  3CUQ C;  4A3C J;  4JLG A;  2NNY A;  4CH7 A;  1PVE A;  4YII A;  1P7I A;  2DMN A;  3CC4 I;  5HQ8 A;  3E1S A;  2I5U A;  2KPM A;  1WSU A;  2STT A;  1ZYR F;  5JR3 A;  2EIN H;  2ZME B;  2QGU A;  2O0Y A;  2XRN A;  3FBN B;  2X6Y A;  1MBF A;  2KFD A;  3GZ6 A;  2RKH A;  3OIP A;  3OWT A;  2HOE A;  1U9N A;  3JRH A;  1N75 A;  3LA3 A;  4PSX A;  2LRE A;  2KHM A;  4DGW B;  1YRN B;  5TJJ A;  3KMA A;  5CVJ A;  5DTD A;  4HF0 A;  3A01 B;  1IRF A;  4A6E A;  2H6B A;  2ICW G;  4LIU A;  3M55 A;  3ZXS A;  4CCJ A;  1SFK A;  3BR1 A;  3VPR A;  3C2B A;  1WJF A;  4XM3 A;  3HNA A;  3ABK H;  4O30 A;  2XF7 A;  3F21 A;  3OSG A;  5CJ9 A;  4A6D A;  4Y4R A;  1TTY A;  3MKL A;  3RKX A;  4EQQ A;  4A5N A;  3RQI A;  1XCB A;  3C2G A;  4OIO F;  1WH7 A;  4JX6 A;  2HI3 A;  4A3B J;  2GAU A;  1A6Q A;  1FWZ A;  2QBY A;  1K7A A;  2WTE A;  2MC3 A;  3EYI A;  4A3F J;  4IHX A;  4L9J A;  2HPI A;  2OC6 A;  2DYS H;  2O03 A;  3GFM A;  2IW5 A;  4O6J A;  2VOD A;  4LDG A;  1PUF A;  2V7F A;  4I2O A;  3QYE A;  2HDW A;  2MLK A;  4HNU A;  2GLO A;  3P9I A;  4HG2 A;  3H3U A;  3GFI A;  3GME A;  1UG2 A;  3DKY A;  1DPR A;  4V19 K;  4RBO A;  3JCU C;  3LSG A;  2R5Y B;  3R6S A;  4KDP A;  5HS9 A;  3MEX A;  3SDB A;  2XDV A;  3LA2 A;  2PI0 A;  2Y0S N;  1XS9 A;  3CCR I;  2VBX A;  1R5H A;  1JJ8 C;  3VOD A;  2KKO A;  1MNE A;  1W7P A;  3S7D A;  4PUS A;  2FUG 2;  2Z99 A;  5BPD A;  1QU3 A;  5KJM A;  3W6K B;  2CU7 A;  1BR1 A;  1SMY F;  1YIO A;  2XF5 A;  3BDD A;  1VQ5 I;  3HOV J;  2Q8K A;  2P8T A;  3SFZ A;  4BY7 J;  1YIT I;  3HJE A;  4L5I A;  3GTP J;  5E20 A;  2NVT J;  3OV8 A;  1H8A C;  1YYV A;  2R7T A;  1T56 A;  1ZLJ A;  2Q1Z B;  3R61 A;  5ILV A;  3FMR A;  4DBQ A;  2IPQ X;  1QRY A;  1IUY A;  1A36 A;  5IOZ A;  4Z4P A;  4ON0 A;  4AVP A;  3MKY B;  1QHH D;  3CF2 A;  4B48 A;  1R4M B;  5D8L B;  2EFP A;  2Y48 A;  2LC2 A;  3IKT A;  1N6A A;  2F48 A;  3BZK A;  1RI7 A;  4OOI A;  1XTA A;  5HVQ C;  3MFK A;  4M6X A;  1VZ0 A;  1MBG A;  5JLX A;  1HKQ A;  5HLH A;  1QZE A;  3CJN A;  2HOA A;  5EEH A;  2FNP A;  1LDK B;  4A3J J;  2BHZ A;  2ZME A;  1IDZ A;  1DDN A;  1K78 A;  2BBY A;  3S16 J;  2BHY A;  2VKE A;  4HOB A;  5CCL A;  2E1M C;  2YS9 A;  1B72 B;  5HOD A;  1PP8 F;  2EZL A;  4R79 A;  1HLV A;  4NC6 A;  4K2E A;  3HKZ N;  3ZQ7 A;  4HX4 A;  5H6Q A;  1FSE A;  2B9S A;  3VEP A;  3UR3 C;  4RAY A;  1LFB A;  1ODD A;  2GA2 A;  2R7Z J;  4U0Y A;  1QNT A;  3DF8 A;  2DDB A;  3M07 A;  2F5F A;  4Q5S F;  3QAH A;  4KYW A;  1P7J A;  1TQI A;  4OAY A;  1J9I A;  5EX3 A;  1WRJ A;  5D5W B;  2NRA C;  1D1C A;  1W5C C;  3EYY A;  1YX5 A;  4QPQ A;  2FML A;  5K7F A;  2DI3 A;  2PEX A;  4C9Y A;  1R49 A;  1D0Y A;  5E3M A;  1BJZ A;  1IW7 F;  3AG4 H;  1YG2 A;  2IGO A;  3LQR A;  3WOD F;  3CJQ B;  4UNO A;  1KGS A;  2CSO A;  3L7W A;  1VQM I;  5HLG A;  2K3F A;  4IL6 C;  2FU4 A;  2XF6 A;  4RB3 C;  4BQQ A;  1LEB A;  2V9P A;  3HOU J;  1W4M A;  4NUB A;  3V42 A;  2H1K A;  4OWR B;  2K9N A;  4V2F A;  1C0W A;  1LE8 A;  2LG4 A;  1FBS A;  3FK7 A;  1FOK A;  4CYC B;  2E2I J;  4IO9 F;  4WK8 F;  2IT0 A;  1YQA A;  3SHF A;  3G73 A;  2NYX A;  5EG0 B;  1MW7 A;  2QKL B;  1ML9 A;  2R3A A;  4JOM A;  1R9T J;  1A35 A;  4OIQ F;  2XPV A;  3HEF A;  2V4J C;  1U8B A;  1RRJ A;  1JKQ C;  3R0J A;  3S1N J;  2PQ8 A;  4UHT A;  4BAY A;  3I59 B;  5JJ0 A;  2VC0 A;  1YW7 A;  3S1R J;  1WH5 A;  3CUQ A;  1MT6 A;  2DYR H;  1MH4 A;  1WJC A;  5DDG A;  1Z3Y A;  4HST A;  5GAG J;  1BW6 A;  5T0M A;  2EIK H;  1HC8 A;  4CIC A;  4BXU A;  1X1C A;  2JK3 A;  4F3Q A;  4D7M A;  5D5X B;  1TBX A;  2LOO A;  2AS5 F;  2BV6 A;  3SEQ A;  2Q0O A;  3GUD A;  1W0T A;  1D1A A;  4LB6 B;  1IXS B;  5JI6 A;  2E19 A;  1TWF J;  4Y15 A;  3PO3 J;  2VKV A;  3NAU A;  1TW3 A;  1D5V A;  4MGR A;  3ZQG A;  3BG6 A;  4XBF A;  3U1D A;  2VBY A;  1F9N A;  4NDL A;  3LSK A;  3M56 A;  1BA5 A;  2DA3 A;  2DA5 A;  4HEA 2;  5J3L A;  4FIS A;  2V9K A;  3BC8 A;  1FC3 A;  3HB9 A;  4O6F A;  2LF7 A;  3ABU A;  4C3I J;  2LY2 A;  2E7X A;  2LLK A;  4IX7 A;  1N25 A;  1ZRF A;  4CO8 A;  3DKX A;  3MKZ A;  3SJM A;  4EJU A;  1KU2 A;  4M71 A;  1HF0 A;  4J7I A;  4I7H A;  1Z6R A;  1ACI A;  2QQA A;  2F4O B;  2F2E A;  1E17 A;  1EV7 A;  2RC4 A;  4RM2 A;  1ZLK A;  5IPA A;  2MBF A;  2WB1 A;  4KA4 A;  5HS7 A;  1WJB A;  3CLQ A;  4DJA A;  3H5A A;  4FAS D;  2X6W A;  1MDM B;  1VI0 A;  2R7R A;  1AU7 A;  1J09 A;  3E5U A;  2HGC A;  4Y52 J;  1S7A A;  4AU7 A;  4XRS G;  4D5C A;  2EJR A;  2VAS A;  4FQG A;  1RES A;  3BTI A;  1MSE C;  4C2U A;  4IRH A;  2JTV A;  4F55 A;  2FJ1 A;  3M1C A;  4RGX A;  4ZYE A;  2QA4 I;  5J4V A;  4UVC A;  3FBI B;  4BE2 A;  4HF2 A;  4AM3 A;  1P4X A;  3JTH A;  3QU6 A;  1S3J A;  2M7B A;  3TL4 X;  2F5C A;  3S2H J;  3L2R A;  3FX3 A;  1JGS A;  2R0Q C;  4I0B A;  2OBP A;  1VQN I;  1YLF A;  1YJ9 I;  3HGY A;  5HLT A;  3O3K A;  1MJ9 A;  1U9O A;  2K27 A;  1IN4 A;  2VXD A;  4L5E A;  4PJM A;  1R4N B;  3KFW X;  2VOO A;  3RKQ A;  3BT9 A;  4Y7N J;  1HXD A;  3CUO A;  1S72 I;  1O9S A;  2F4I A;  2D2W A;  1KZH A;  3I56 I;  3K2Z A;  3KMT A;  3HG9 A;  4ZTJ A;  2PBI A;  5TEG A;  1SD6 A;  2DFF A;  2M0C A;  3IWF A;  1W5T A;  3L9F A;  1LKX A;  3MVP A;  5CVV A;  4BBS J;  2BQZ A;  4M6V A;  2FD5 A;  2LKX A;  3DWL E;  3WG7 H;  2CQ7 A;  1I5Z A;  2ESH A;  4G7H F;  3F8M A;  3MQ0 A;  3FXK A;  3CC2 I;  1N77 A;  1BI0 A;  3OYI A;  3LAP A;  5CVR A;  3G1O A;  3ROU A;  2TRT A;  1G2H A;  4XOR A;  3RPQ A;  1QPI A;  1REP C;  1SVO A;  4BEH A;  2HKO A;  2VPR A;  1YHQ I;  4W97 A;  2F5V A;  2Z3Y A;  3OYA A;  1MBK A;  2JUG A;  2LH9 A;  3ZPL A;  1Y56 A;  2Q2E B;  1U6G A;  4YRV A;  2W48 A;  1KYW A;  3GTM J;  1ZAO A;  2LNB A;  5HNF A;  3QQA A;  3AG1 H;  3LSP A;  4WX9 A;  3LOC A;  3PNV A;  5A2Q K;  5LLQ A;  2CV2 A;  5BOX A;  2LR8 A;  3AG3 H;  4UUT A;  5FKK A;  1VQ8 I;  3M4O J;  3JRE A;  2RN7 A;  2L7F P;  2A6E F;  5FGM A;  4RGU A;  1BC7 C;  3LFK A;  1BW5 A;  1W7P B;  4I09 A;  2M3A A;  3CMA I;  4E7I A;  1JGG A;  2VKH A;  1DU6 A;  4IZZ A;  3K4B A;  3TQN A;  4E4H A;  2D1H A;  1IC8 A;  2XKO A;  2ISZ A;  1UMQ A;  2DW4 A;  2DOA A;  2W1O A;  3RI4 A;  3C1D A;  1MGT A;  3SQN A;  5F64 A;  4HV5 A;  4AVZ A;  1PP7 U;  4IHS A;  2YPR A;  4A3I J;  5FKL A;  3MKW B;  4I76 A;  2MLG A;  3I5U A;  4E7K A;  3CC7 I;  5DCF A;  2NOG A;  1LFP A;  1T33 A;  2A68 F;  5J6X A;  4KIF A;  3ABM H;  3HYI A;  1XSX A;  2VXZ A;  3GTK J;  3OSF A;  2CUZ A;  5L3G A;  3BG5 A;  4Y3O A;  4XLF A;  5TTF A;  1ETX A;  1FMW A;  3WGI A;  2A5Y B;  2FBH A;  2V1U A;  3AL0 C;  3RJP A;  3CJT B;  2QEX I;  1Z67 A;  4BHB A;  1ZQ3 P;  1EH8 A;  4QPO A;  2HPM A;  1APL C;  5L3B A;  1F1Z A;  3PJR A;  2XIG A;  3BQZ A;  2MA3 A;  4CA0 A;  1MVH A;  1T39 A;  4N9I A;  1J7K A;  4XKB A;  2ZJP F;  1HW2 A;  3L2U A;  4L0Z B;  2EV5 A;  3S32 A;  4PFP A;  4HAM A;  3VB2 A;  3GTJ J;  4XKV A;  3CCU I;  3MZH A;  1P2F A;  1Y1W J;  4RZ0 A;  3HHG A;  2VBZ A;  5CQG A;  2MYS A;  3D5L A;  2H8R A;  4E47 A;  3K4M A;  4P1W A;  3PM1 A;  2KZV A;  5FD6 A;  3DXJ F;  2LKP A;  3LA7 A;  2IGN A;  3TG4 A;  2ECC A;  3FKI J;  4HA8 A;  5D4S A;  1YRN A;  2L4M A;  4DW6 A;  1I6H J;  1JTX A;  5IP7 J;  2R5Z B;  1S7O A;  1ZG5 A;  4XOP A;  5BQT A;  1V4R A;  4KIG A;  3GWZ A;  3CMM A;  3BTL A;  2QCO A;  2ZXH A;  2EFO A;  4HNT A;  2ZC2 A;  2XRL A;  5FLV A;  2VE8 A;  2DK8 A;  3K6G A;  1SD5 A;  5E18 F;  4QLC U;  2PMH A;  4M3G A;  4RM3 A;  3NWT A;  1FBU A;  1RC9 A;  4IF4 A;  3OL4 A;  2L5Q A;  3BR2 A;  3QOE A;  2PJP A;  5JVT A;  3K69 A;  1WKM A;  2YU9 J;  3I4M J;  4M3D A;  1MDM A;  1LNW A;  1IO2 A;  3QPL A;  5IYB J;  3QYB A;  3F6V A;  2F6C A;  1TWC J;  2HYJ A;  3WTY C;  2GXA A;  3K4K A;  5K5O A;  1O4X A;  3KPH A;  2R5Z A;  3NEU A;  3OYK A;  2CGP A;  1NH3 A;  3RQ4 A;  2DMP A;  1BM9 A;  2E2J J;  4H12 A;  3GBG A;  3QWW A;  3HOX J;  4O5V A;  2JSC A;  2VBW A;  5D8K B;  1FPQ A;  3S14 J;  5E3O A;  5LSX A;  1SAU A;  1ZGA A;  5JVG F;  4LD5 A;  5LHH A;  1D1B A;  1NHA A;  2FRH A;  2W00 A;  3GXO A;  3KLN A;  3Q0W A;  2EFQ A;  1SFO J;  3HXL A;  1ZG1 A;  1XCV A;  5JHF A;  2E60 A;  3H36 A;  3S3N A;  1ZGJ A;  1RKT A;  5KJK A;  3ZR8 X;  1J5Y A;  2E7W A;  4ZDO A;  1BC8 C;  4LK1 F;  1ETQ A;  2BVM A;  3G6E I;  1HQC A;  2COB A;  5FD5 A;  2VJ4 A;  3B6C A;  2H8W A;  3HGG A;  2O9L A;  2HZT A;  2TDX A;  5B5E C;  4EJO A;  3TW7 A;  3CCS I;  4ZZD A;  2VJ5 A;  4XSX F;  1DP7 P;  3DAL A;  2GWR A;  3JRB A;  2RGV A;  2RVC A;  4YFX F;  3GTQ J;  1I3Q J;  2AO9 A;  2F5E A;  2BOL A;  1XX5 A;  4U7B A;  1OLT A;  3RIB A;  1IUF A;  2A61 A;  3PL8 A;  3TDZ C;  1ZH5 A;  4HX7 A;  4Z6Y A;  2AQF A;  1OR7 A;  1GV5 A;  3FHN A;  3FXU A;  4BHC A;  4BS9 A;  1IG7 A;  4IJ8 A;  5KJL A;  2ZSI B;  3WTW C;  4XK4 A;  1DU0 A;  3HDD A;  3WU1 B;  4DNC A;  1KU3 A;  5BMZ A;  2ZME C;  4RGS A;  5F27 A;  1ZK8 A;  3OYE A;  1HW1 A;  3ZMZ A;  3K4N A;  3S3O A;  2F4M B;  2HYF A;  2GZW A;  3QOP A;  2JA7 J;  3HRM A;  2BGC A;  3C18 A;  1MNM C;  3WE3 A;  3HOY J;  2DU9 A;  1RKW A;  4BE1 A;  3GX4 X;  1Z1D A;  1MMD A;  3GF2 A;  3K4J A;  2MG4 A;  2P6T A;  3N05 A;  4CCL A;  4U88 A;  4QWQ A;  3FPD A;  2GBY A;  2ZKZ A;  3BR5 A;  4M6Y A;  2WA0 A;  3ZQQ A;  4EEF G;  1QPM A;  3K1M A;  2X9D A;  2K5C A;  4H4K C;  4AIH A;  3J7Y J;  2LY1 A;  3ZN1 A;  2VOP A;  5LD2 C;  2NVY J;  2HXO A;  1T98 A;  3V7R A;  3S17 J;  4PSW A;  1KU9 A;  5HOO A;  5EX0 A;  3E7L A;  4ZYH A;  4NVQ A;  5CYV A;  1VF9 A;  1WZ2 A;  2EA4 A;  2R3S A;  4UY8 I;  5F6F A;  1IV8 A;  1ZG3 A;  1T8I A;  5JIN A;  1Y8Q B;  2P7C B;  4BKX A;  4BXX J;  4YND A;  1BI3 A;  5IYC J;  4DOZ A;  1VQ9 I;  4NNJ A;  2O6G E;  1XGN A;  2JV0 A;  5C4X J;  1WCM J;  3KP2 A;  2LBF A;  1UHW A;  4HLX A;  2RV8 A;  4IHT A;  4PJL A;  3SEZ A;  1XB4 A;  2DN0 A;  4CHU A;  3TO9 A;  2QUF A;  3KEO A;  3LST A;  1N3J A;  4YEJ A;  3QYF A;  5KHD A;  5K1Y A;  2P5L C;  2GA1 A;  2R4G A;  3ZQC A;  3HTS B;  3PDN A;  3BTC A;  4QEO A;  3E97 A;  1ETK A;  2K86 A;  4A0X A;  1ULY A;  4IEJ A;  2G9W A;  1Z21 A;  5JHU A;  1K78 B;  2XAH A;  2XSD C;  3NWS A;  1YTY A;  1RR7 A;  1UHM A;  2JPB A;  1DGR M;  3CCQ I;  2KL4 A;  2X6X A;  2R7D A;  1Z7L A;  2L2O A;  3M8E A;  3U21 A;  2OD5 A;  5GPC A;  3ELK A;  2X6O A;  1RZ4 A;  4MTD A;  3PUB A;  4CUG A;  3FIS A;  4I0A A;  5DYM A;  3J81 Z;  4F92 B;  1X58 A;  2M7A A;  4PCQ A;  4R1H A;  1JHH A;  2ZNY A;  5F08 A;  3CCM I;  2CV1 A;  1LUJ B;  4DZJ A;  5E1Z B;  4X0G A;  4G6D A;  4BY1 J;  3QPH A;  1KA8 A;  1B6A A;  4XL9 A;  4DQ2 A;  3F8F A;  4J01 A;  1FOX A;  1Z6T A;  4RS8 A;  1MJA A;  2XHK A;  3OMY A;  4DBR A;  1BBY A;  3DPT A;  1K4S A;  3GZ5 A;  4EV0 A;  3J7Z I;  3Q9S A;  3VYT B;  1D0X A;  3QWL A;  4CZC A;  4HW0 A;  5ICC A;  1E2X A;  3I3L A;  1FYM A;  3F9X A;  3DBH B;  3WTT C;  4HNV A;  2ZB9 A;  3KZY A;  2JVG A;  2K9L A;  4ESJ A;  3QU3 A;  3WTU C;  3QP6 A;  3GFL A;  4ESF A;  3CCV I;  1V5F A;  2L02 A;  1WHU A;  3ISP A;  3CD6 I;  3BP8 A;  1JJ6 C;  4JDS A;  3F9Z A;  4HPQ A;  1E3O C;  1BL0 A;  1YS6 A;  3W2V A;  4AID A;  5D4R A;  1Y1V J;  5IT9 K;  3OYD A;  3TMO A;  2ZXI A;  1A31 A;  4XON A;  3OYB A;  2E1N A;  3L2W A;  3BR3 A;  2W85 A;  4IHY A;  4QEN A;  5K7Z A;  4EAT A;  1TNS A;  5ILU A;  1XGM A;  3IAS 2;  2X0L A;  3E6B A;  4WXH A;  3BG3 A;  2DA1 A;  2NAZ A;  1U2W A;  3J80 Z;  3HRU A;  2H27 A;  3JW4 A;  3CES A;  2BXY A;  4F91 B;  4IRI A;  4Q48 A;  4G12 A;  3IP4 B;  4RAF A;  2VJI A;  1GT0 C;  2DAO A;  3I0T A;  2DFI A;  1UEL B;  3MCZ A;  3RTR A;  3M1E A;  3JRF A;  4E7H A;  3M8J A;  2XGX A;  2R7F A;  1S7E A;  1MKM A;  2YUS A;  2DMU A;  1W7P D;  5IP9 J;  1YFH A;  2WAQ N;  4D9J A;  1FZP B;  3J7A O;  5LGN A;  4XN3 A;  3DCF A;  4A2U A;  1O3R A;  2EWN A;  4FX0 A;  4WXD A;  2A69 F;  2KRF A;  3CCL I;  1LVK A;  2MH2 A;  2FBK A;  3F8B A;  2HOT A;  1HKT A;  3RSN A;  2HYG D;  4PZJ A;  1O3S A;  1KQ9 A;  3ZMD A;  2AQE A;  2NVU B;  2L9V A;  2V9V A;  4GYG A;  2NXN B;  1RIO H;  3RKW A;  3EUH C;  2BW3 B;  4MFE A;  5C3E J;  2BVL A;  1LDD A;  3ZN0 A;  4XLA A;  4B3A A;  1MD0 A;  3GVA A;  1YS7 A;  2K02 A;  2EV0 A;  3D5R C;  1WJD A;  2W4S A;  3M7G A;  3MD2 A;  3V8J A;  1GVD A;  4H0E A;  2Y30 A;  3CCY A;  3VOE A;  1B9N A;  4XQF A;  3HL2 A;  1SAX A;  4GXO A;  4BH9 A;  4XRM A;  5L3C A;  2W5Z A;  1R00 A;  4J00 A;  4ABZ A;  2DDA A;  2OPT A;  4OU0 A;  1Y39 A;  1YX3 A;  2KQR A;  4AYB A;  3O8G A;  1XD7 A;  3ZGK A;  2R92 J;  1QBJ A;  3RKY A;  5EZG A;  3I58 A;  4UVA A;  1BIA A;  2FX0 A;  2ELH A;  3PIO F;  1Z91 A;  2UXX A;  1PEG A;  2IS4 A;  1PJR A;  5FRO A;  3S2D J;  5GAE J;  1O3Q A;  1XDU A;  1WQ2 A;  3N4M A;  2UWM A;  3EP0 A;  1JUM A;  2IJL A;  3H0G J;  3TO6 A;  5LHI A;  1ZTR A;  4B3X A;  4LB5 A;  4G7O F;  3H5R A;  4BHP A;  4A3M J;  5E1W A;  2CUE A;  5GTH C;  2LY9 A;  1TP4 A;  2D1V A;  1B59 A;  4P5O A;  3M54 A;  2OUM A;  3MAJ A;  2M1B A;  3CBO A;  4A0Y A;  1R1U A;  1FNN A;  2WV1 A;  4ZTF A;  2OA4 A;  2W82 A;  2R7U A;  2HKX A;  1QZY A;  2A6H F;  2AXL A;  2BY0 A;  2ESN A;  3BPX A;  2HQR A;  3K4C A;  5ARG A;  3HC7 A;  1IV6 A;  3CBM A;  1TL8 A;  5F59 A;  5LGT A;  3JRI A;  3E3V A;  3LQQ A;  4BDZ A;  2K7L A;  3IHU A;  4CGZ A;  3I4N J;  4LIV A;  5CCM A;  4B47 A;  1FIA A;  1IXC A;  2FBI A;  3RPU D;  2A05 A;  2L3D A;  5CQE A;  1R1T A;  3FHZ A;  3H9G A;  4CCO A;  3JRD A;  3H35 A;  4MQ9 F;  4JQF A;  2R5Y A;  3ABT A;  4PK4 A;  2M87 A;  3A0H C;  4HBL A;  2E5Z A;  3VYS B;  4E70 A;  4AIJ A;  4ZDL A;  3DTI A;  2XB5 A;  3MMY B;  4ZZL A;  5HLI A;  1Y6I A;  3HIF A;  1E0E A;  1YW9 A;  1S5L C;  4A69 C;  4ZYA A;  1GUU A;  2B0L A;  3BJA A;  5DUI A;  3CBP A;  5TH7 A;  4KIS A;  1D5Y A;  3L2V A;  4G94 A;  1LFU P;  1R36 A;  5J40 A;  4P9U A;  3OS0 A;  2ADU A;  5HDK A;  5JFR A;  2Z2S B;  4KN7 X;  4ENK A;  1T0F C;  4ZJZ A;  1ETW A;  2PFB A;  5TGT A;  3A4C A;  3K10 A;  3RU0 A;  2JPC A;  4OIR F;  3R0A A;  2CS3 A;  2DFE A;  4BU2 A;  3BCB A;  1ZAR A;  3JRG A;  4N4N B;  1TQM A;  3NQO A;  1Z9C A;  1SFU A;  2Y9Z A;  4NC7 A;  4M3B A;  1JXS A;  1K6O A;  2QSG X;  3DKW A;  4U87 A;  1F5T A;  1VQ7 I;  1HDP A;  3ZRG A;  2IS6 A;  1S29 A;  4BE0 A;  3K0L A;  3W6J B;  4WWC A;  2LKS A;  3IHX A;  2P4W A;  4S05 A;  3GFJ A;  5EG2 A;  2OJE D;  1MMA A;  4X6A J;  2C6Y A;  4P55 A;  3I54 A;  3ZQH A;  5AYF A;  2ZCW A;  2XGD A;  2O8J A;  2P6S A;  2XAQ A;  3CO6 C;  3L00 A;  1CGP A;  1ZRE A;  4BQN A;  5FLM J;  2CFO A;  5GTI C;  4KIB A;  2QPW A;  1MBJ A;  3IUO A;  4C3J J;  3OS2 A;  2ZXJ A;  1ON1 A;  5HNH A;  3K1P A;  3W2A A;  1X2N A;  3TBI A;  4BAC A;  5FLX Z;  5B1A H;  3PSF A;  2EBI A;  1FTT A;  3Q3S A;  1X2M A;  1MMS A;  4JX5 A;  1R5I D;  2G7U A;  1D8J A;  2IGK A;  3ESW B;  3HRT A;  1Q1V A;  3PIP F;  1JTY A;  2KIF A;  2HQN A;  2NOJ B;  3KP6 A;  3GCM A;  1XGO A;  3IAM 2;  5FJ8 J;  4M9X A;  3GTG J;  4RMN A;  2YR2 A;  5AIP A;  1IRG A;  2LRD A;  2Y9Y A;  1GXQ A;  1TWH J;  5LEK A;  2A07 F;  3JSP A;  3SW9 A;  4BL0 B;  2PN6 A;  1JI8 A;  2IEK A;  2J5P A;  2VON A;  3S7J A;  2MW8 A;  2L9R A;  2CFX A;  2E35 A;  5CKT A;  3ML6 A;  2DA7 A;  1R22 A;  1AHD P;  3I64 A;  1JKP C;  1H3I A;  4ITV A;  5M3F J;  5FKO A;  1V5G A;  4NQW A;  3IKV A;  3EUK L;  4KMF A;  1O3T A;  1MH3 A;  2PJR A;  4D1Q A;  3HSF A;  2OCE A;  1HW5 A;  1T2K A;  3HTU A;  1WI9 A;  3TDU C;  2K3P A;  1QZZ A;  1ZN2 A;  3HSE A;  3SZG A;  2NS8 A;  3CUQ B;  1X1P A;  2JQ7 A;  3CZ6 A;  1VND A;  2W57 A;  5DCM B;  1BN5 A;  1FEX A;  2VB6 A;  3ASN H;  5DCM A;  2ELJ A;  4CYC A;  2O8X A;  3QPT A;  2VE9 A;  3M58 A;  1OPC A;  2DA4 A;  1U5T A;  4U0V A;  5H20 A;  3AAF A;  1YI2 I;  1U8R A;  1P92 A;  3I59 A;  1KON A;  2FE3 A;  1YJW I;  4CCM A;  2HVQ A;  5EG0 A;  3I53 A;  3DB5 A;  3B6A A;  5FKN A;  1IDY A;  5EEA A;  4NC8 A;  3IRR A;  3JR9 A;  1OCZ H;  2Y0S A;  4BQA A;  3GTO J;  4J83 A;  2MGQ A;  4ANJ A;  1ERD A;  5E1X A;  3OXG A;  2CQQ A;  2ME6 A;  3Q0U A;  5L3E A;  3P9K A;  1X4P A;  2EPF A;  3UKG A;  2CO5 A;  2DJI A;  2M2E A;  5DS9 A;  2VC1 A;  1G3S A;  2JUC A;  4PFO A;  1IN7 A;  2JA2 A;  3KZI C;  3OIO A;  2I10 A;  2RQQ A;  3HPH A;  5EGO A;  2ZFW A;  2QSF X;  3QP5 A;  1HSJ A;  3DFG A;  3SZT A;  3WHB A;  2CW0 F;  2L9S A;  2QQB A;  3KYL A;  1XMA A;  1WVR A;  2NS7 A;  3QPS A;  4F93 B;  2WAD A;  2HU9 A;  3HBL A;  3BR0 A;  3HPG A;  3WG9 A;  3B02 A;  1FBQ A;  5HDN A;  1S6L A;  3BZC A;  1B72 A;  1BOB A;  1A5J A;  3DU5 A;  2BY1 A;  3BR6 A;  3MO5 A;  3B73 A;  1XC5 A;  2QEN A;  2K40 A;  3T8R A;  2A5W A;  3SFI A;  1TT5 B;  4C2M J;  1OMI A;  1YJN I;  3HOW J;  4XLP F;  2EA2 A;  1LVA A;  3M5A A;  3DV8 A;  2VUM J;  3U1K A;  1AKH A;  5B3S H;  1MMG A;  3LAJ A;  4IHW A;  4BNC A;  4HYE A;  4XSZ F;  4A3K J;  2IGQ A;  3FM3 A;  2HVS A;  2QWW A;  2N8G A;  1RUN A;  4YNP A;  2WC2 A;  2Z33 A;  1J0R A;  3CO7 C;  5F0C A;  1LDJ A;  2DOD A;  5J8C A;  1X1D A;  2LMD A;  2QLZ A;  1R6R A;  2IBD A;  2Z1D A;  2DK5 A;  4JBA A;  3IV5 A;  1FJL A;  2H1L A;  1JT6 A;  1JT0 A;  3PQJ A;  3PFI A;  2VIX A;  5H6R A;  5J1R A;  3LSJ A;  2STW A;  3M9A A;  5EGO B;  3OS5 A;  2QQ9 A;  1IGN A;  3I55 I;  1HKS A;  3S93 A;  1QQI A;  2HNH A;  4S04 A;  2HQ5 A;  3S2W A;  2DLL A;  1SMT A;  3CQZ J;  3MN2 A;  1I39 A;  1EKE A;  4CDG A;  2Y75 A;  5M5X J;  1ZR4 A;  3OR2 C;  5GPA A;  1IAW A;  1VQ4 I;  1FY7 A;  2RQP A;  2EH3 A;  5M5Y J;  4Y17 A;  3LNQ A;  3HM5 A;  1FTZ A;  3C7J A;  1K83 J;  1X3Z B;  5K7H A;  3WTS C;  4LIT A;  2OCC H;  2P7V B;  1FX7 A;  3R4K A;  2KIU A;  1IF1 A;  2R7S A;  2M45 A;  2L7K A;  3KET A;  3F8C A;  5GP9 A;  2XGE A;  3G1L A;  3CP2 A;  2CQX A;  4M72 A;  1H89 C;  4MI0 A;  2KJB A;  2EZH A;  1GVJ A;  2E36 A;  1SC7 A;  1NK2 P;  1QHG A;  1HST A;  2CRG A;  3IWZ A;  1XMK A;  4B44 A;  2IRF G;  2QSH X;  2LYC A;  1O7F A;  3E6M A;  4DIQ A;  1YO5 C;  2IA2 A;  4XIC A;  2HEO A;  2FQ3 A;  3VUZ A;  2KMU A;  1K6Y A;  5B1B H;  4UVB A;  2J5O A;  1WI3 A;  3E6D A;  1S9H A;  1EJ9 A;  2E1O A;  2GQQ A;  4MEY F;  3LSM A;  4IJD A;  2WY7 Q;  1NTC A;  4LMY A;  2CJJ A;  2HXI A;  4PDK A;  1P4W A;  4F7Z A;  3LSR A;  2LF8 A;  1OFC X;  3R60 A;  3OY9 A;  1R23 A;  3K70 D;  3AFH A;  1VQK I;  3M59 A;  1P6R A;  1GLN A;  2UV1 A;  2OQR A;  2UUZ A;  1JUS A;  4EJV A;  3V7S A;  1VQ6 I;  3OYN A;  1H88 C;  1D8K A;  3EUH A;  2ELK A;  4NQW B;  2KIS A;  3DBL B;  3HOZ J;  4MHG A;  3OPE A;  4CXF A;  3VSL A;  4B09 A;  3LMM A;  4J8O A;  1I6X A;  2I8D A;  3RPU A;  1ZHF A;  1MBE A;  1R71 A;  1B1B A;  2KZG A;  3PNY A;  2M9H A;  1DPU A;  3DQV C;  1MBH A;  2XGC A;  1NG7 A;  1MND A;  5TRD A;  4RGR A;  4LGW A;  2QKM B;  1T08 B;  5E8G A;  1X3U A;  5BPI A;  2LK2 A;  5F6L A;  1XGS A;  2PMZ N;  1X3W B;  3I9V 2;  4L9N A;  1TNT A;  4AIK A;  1O57 A;  1G3Y A;  2VQL A;  4P9F A;  3G2B A;  3CLO A;  1BI2 A;  3TKY A;  4NJ5 A;  1KU7 A;  2VPL A;  2VQH A;  4LJZ F;  4L9T A;  3BPV A;  3AG2 H;  3BQY A;  3CF5 F;  3A2K A;  3OOI A;  1J75 A;  3G71 I;  2VI6 A;  4N9H A;  4IQJ A;  2GXB A;  2L4A A;  2CW8 A;  2DFH A;  4I02 A;  4YFN F;  2BY3 A;  4YIF A;  2R7O A;  2PLY A;  1WJ5 A;  1YE9 A;  3F6O A;  3L1P A;  1LB2 A;  1Z0X A;  4M74 A;  3S8P A;  3DPU A;  1U5T C;  4G8X A;  2W5Y A;  4CZZ A;  1H9T A;  3A03 A;  3CP8 A;  2M30 A;  3COA C;  1BR4 A;  1U3E M;  2EB7 A;  3ERM A;  3QOD A;  3T5X A;  4II3 A;  4V2G A;  1P9Q C;  1RR8 C;  3KYC B;  3GO5 A;  4D5F A;  3VYR B;  2FMY A;  3AL0 B;  4LFU A;  1MVX A;  5IT9 Z;  5KVR A;  4IJA A;  4ZDP A;  4A3G J;  3O6B B;  1XPX A;  1WFX A;  1FT9 A;  2QF7 A;  4OIN F;  3RIR A;  4BGD A;  2XVC A;  5J1U A;  1T38 A;  2W7N A;  2CH0 A;  4UXN A;  1UB9 A;  1USS A;  2HVR A;  2B63 J;  4M3E A;  3CMY A;  1XN7 A;  4MQV A;  2P0W A;  2DTR A;  1SD4 A;  2EZI A;  3DBR B;  3KYD B;  5D6E A;  5EDN A;  3JAM K;  2FXA A;  3KLO A;  4P96 A;  1TQP A;  2LDU A;  3KE2 A;  3Q0V A;  1V5E A;  2DTZ A;  1O7L A;  4CCK A;  4ZH4 F;  2W24 A;  1UAA A;  5C44 J;  2KLO A;  1TWG J;  5DD4 A;  2H6C A;  1ETV A;  4KT6 A;  3A0B C;  2L0K A;  2ME0 A;  5KAF C;  4X1E A;  5F0F A;  3WTZ A;  2IS2 A;  5CVU A;  1ZRC A;  4KNY A;  2VJJ A;  4RLF A;  4B1R A;  1FYK A;  1H0M A;  2Z9O A;  1ZKG A;  5ICF A;  3BCA A;  1VQO I;  4GRI A;  2FEZ A;  1VQP I;  3REO A;  4LG0 A;  1OCT C;  3IC7 A;  2M4G A;  3OL3 A;  2XAJ A;  3FK6 A;  2HDC A;  2LTP A;  3CJR B;  2DT5 A;  4BEH B;  2IS1 A;  3HSR A;  3FIW A;  3J80 K;  1I50 J;  4JK1 X;  2HWV A;  4EM1 A;  1HCR A;  4L18 B;  2GOM A;  3Q9V A;  3FXO A;  2JRT A;  3QRF F;  3KZZ A;  2QBY B;  3KCC A;  5LHG A;  1NG6 A;  2Z5U A;  1FOY A;  2XPW A;  2M34 A;  3ZMT A;  2HTJ A;  4A3D J;  2P5K A;  2IVM A;  3UNG C;  4C30 A;  3TOB A;  4EGY A;  1MSF C;  1KQ0 A;  2X85 A;  3ZQI A;  3K2A A;  3M57 A;  1BIB A;  4HDV A;  4GGG A;  4M73 A;  4XLH A;  2DPD A;  3W2W A; 
#chains in the Genus database with same CATH homology
 4XNF A;  2DT7 B;  2Z2S B;  3E0J B;  3BO5 A;  3KMJ A;  1T0F C;  4ZJZ A;  3BLY A;  1U0J A;  5TGT A;  3A4C A;  3K10 A;  2M3A A;  2IGM A;  4E7I A;  2VKH A;  2CUJ A;  4IZZ A;  3RU0 A;  3OYJ A;  4PJJ A;  3K4B A;  1X1B A;  4E4H A;  5T5G A;  3PSI A;  2CS3 A;  2KDO A;  4BU2 A;  4CSW A;  3BCB A;  2PMZ A;  2DOA A;  2BW3 A;  2W1O A;  4N4N B;  3DTE A;  3AKZ A;  3DEE A;  4AVZ A;  1W36 D;  3MKW B;  2JSP A;  4NC7 A;  4XKC A;  1AA7 A;  4F52 A;  4E7K A;  1X1A A;  2RNG A;  1ZKK A;  2KP6 A;  2WAF A;  2VL8 A;  3OOU A;  4U87 A;  3HOS A;  3ZRG A;  4E7J A;  2IS6 A;  4E6K G;  1LFP A;  4BE0 A;  3IHX A;  1WJA A;  2WY8 Q;  4XKW A;  4BJ6 C;  2V6E A;  2VXZ A;  5EG2 A;  2ZFU A;  2CUZ A;  2LBF B;  1MMA A;  4Y3O A;  2WBM A;  2A6T A;  1FMW A;  4XLF A;  5TTF A;  5AYF A;  1D0Z A;  2O8J A;  1PYV A;  3AL0 C;  4OAZ A;  3MO0 A;  4QPO A;  2GOX B;  4BQN A;  2CFO A;  2HPM A;  3PJR A;  2QPW A;  3IUO A;  3OS2 A;  3L2Q A;  1XQH A;  4CA0 A;  5HNH A;  3W2A A;  1MVH A;  3TBI A;  4XKB A;  4BAC A;  2VQC A;  3L2U A;  5FRN A;  3S32 A;  4PFP A;  4C1Q A;  4XKV A;  3PSF A;  3M53 A;  4RZ0 A;  2R7W A;  3VV0 A;  3SWC A;  5CQG A;  2MYS A;  2IGK A;  4E7S A;  4N4O B;  3D5L A;  4E47 A;  2X51 A;  4KIT B;  2NOJ B;  3K4M A;  4P1W A;  4B43 A;  2KZV A;  3H0D A;  5F6K C;  3IAM 2;  2IGN A;  4RMN A;  3H5N A;  3TG4 A;  3OR1 C;  3KX2 A;  2LRD A;  5ARF A;  4ZC3 A;  5LSZ A;  4XOP A;  2L9N A;  3SW9 A;  4BL0 B;  3CMM A;  1JI8 A;  2ZXH A;  4IQ4 A;  4HNT A;  3S7J A;  4XLE A;  2XC7 A;  5CKT A;  3K6G A;  4FET A;  1DQU A;  4XMY A;  4C2T A;  4RM3 A;  3NWT A;  3OL4 A;  1H3I A;  3N71 A;  2L5Q A;  4ITV A;  2KRC A;  2ZSH B;  4BJT A;  1V5G A;  3VYU B;  3QOE A;  2X1C A;  4WUY A;  1X4O A;  3EUK L;  1W36 C;  2VQG A;  2PJR B;  2HQA A;  3F9W A;  3S7B A;  2PJR A;  4D1Q A;  3RCO A;  3C2H A;  3QYB A;  2F6C A;  2K3P A;  2XAU A;  3OYG A;  3QWP A;  3K4K A;  3SZG A;  3OXF A;  3OYK A;  2XSJ C;  4YEL A;  4JLG A;  3RQ4 A;  3CZ6 A;  3DPL C;  2CMP A;  4CH7 A;  5HI7 A;  4H12 A;  3GBG A;  3E1S A;  2KPM A;  3QWW A;  5HQ8 A;  4YPA A;  1WJE A;  2VB6 A;  2WAQ A;  2V1N A;  2ELJ A;  1UG0 A;  5LSX A;  1SAU A;  1DP3 A;  3FBN B;  1D1B A;  2W00 A;  2X6Y A;  3M58 A;  3EPZ A;  4II2 A;  3HXL A;  3OIP A;  3OWT A;  5JHF A;  2E60 A;  3S3N A;  1N75 A;  4PSX A;  5KJK A;  2LRE A;  2DT6 A;  2KHM A;  3ZR8 X;  4DGW B;  3KMA A;  2Z16 A;  4ZDO A;  1KON A;  2BVM A;  4CCM A;  2HVQ A;  4LIU A;  3M55 A;  2VJ4 A;  3ZXS A;  4CCJ A;  3DB5 A;  4XLC A;  3A1Y A;  1SFK A;  2VKD A;  4NC8 A;  1WJF A;  4XM3 A;  2WAE A;  3HNA A;  3S7F A;  1MUF A;  2VJ5 A;  2XF7 A;  2Y0S A;  4Y33 A;  3DAL A;  4O30 A;  4Y4R A;  4J83 A;  2BOL A;  4ANJ A;  4XN0 A;  4U7B A;  3EUA A;  1ERD A;  3OXG A;  3C2G A;  1OLT A;  3RIB A;  3SYT A;  3PL8 A;  3LSH A;  3FDY A;  2R7X A;  2R7V A;  2AQF A;  1X4P A;  3FHN A;  4BS9 A;  5KJL A;  4IJ8 A;  2DJI A;  2ZSI B;  3K4L A;  4MLO A;  2HPI A;  2OC6 A;  4PFO A;  2JA2 A;  3OYE A;  3K4N A;  5LFA A;  3S3O A;  2RQQ A;  3HPH A;  4LDG A;  2V7F A;  3QYE A;  2HDW A;  4HNU A;  4CCN A;  2L9S A;  4HG2 A;  3KYL A;  4BE1 A;  3DKY A;  1MMD A;  3K4J A;  4F93 B;  2WAD A;  2HU9 A;  1FMV A;  3N05 A;  3HPG A;  4CCL A;  3LSG A;  3FPD A;  2DXI A;  2WA0 A;  3ZQQ A;  3SDB A;  2XDV A;  2K5C A;  4H4K C;  1BOB A;  3DU5 A;  3MO5 A;  3HUG B;  2CW7 A;  2LY1 A;  4HRI A;  2A5W A;  5LD2 C;  3VSK A;  1TZL A;  3OS1 A;  4PSW A;  2E5N A;  1MNE A;  5HOO A;  5KNL A;  5EX0 A;  3S7D A;  4QEP A;  3M5A A;  4PUS A;  4NVQ A;  2FUG 2;  2JVH A;  1MMG A;  1QU3 A;  5KJM A;  3S3M A;  2IGQ A;  1BR1 A;  2HVS A;  2XF5 A;  5JIN A;  3MEK A;  4YNP A;  2M4K A;  2RFI A;  4YND A;  1X1D A;  1DGW Y;  2Z1D A;  4LG3 A;  1R6R A;  3OS0 A;  2Q1Z B;  4RLQ A;  5FRM A;  2R7T A;  4DOZ A;  4NNJ A;  2MAB A;  3OIQ A;  4DBQ A;  2JV0 A;  3H9J A;  2VIX A;  2LBF A;  4Z4P A;  3MKY B;  1QHH D;  3CF2 A;  4PJL A;  4B48 A;  3SEZ A;  2G46 A;  3OS5 A;  3LL7 A;  1ZEL A;  3S93 A;  1N3J A;  2LC2 A;  2HNH A;  3QYF A;  2RRE A;  4YEJ A;  5KHD A;  1N6A A;  2R4G A;  3PDN A;  4QEO A;  4YPE A;  2R7Q A;  5HVQ C;  3W3C A;  1Z21 A;  1VZ0 A;  3OYC A;  5JHN A;  3OR2 C;  4PJN A;  3NWS A;  1DGR M;  4HSR A;  2KL4 A;  2X6X A;  1LDK B;  1Z7L A;  2L2O A;  2MD0 A;  3U21 A;  4LIT A;  2X1E A;  4IKF A;  3PUB A;  4CUG A;  2R7S A;  2L7K A;  5CCL A;  3DTK A;  2E1M C;  3CP2 A;  4F92 B;  4MI0 A;  2IXS A;  2M7A A;  2CV1 A;  3LFU A;  4R79 A;  3DU6 A;  4X0G A;  1QHG A;  4B44 A;  3BG7 A;  4XL9 A;  2LYC A;  1BR2 A;  4DIQ A;  3OYH A;  4J01 A;  3UR3 C;  3OMY A;  4DBR A;  3DPT A;  3OYF A;  3HOT A;  3VUZ A;  4G6T B;  2HZD A;  2KMU A;  4J7F A;  3VYT B;  1K6Y A;  1D0X A;  4E7Z A;  4CZC A;  3F9K A;  3H9Q A;  3FKJ A;  1HA8 A;  1S9H A;  3I3L A;  3F9X A;  5KCM A;  3LSM A;  4IJD A;  2E1M B;  2WY7 Q;  2JVG A;  2K9L A;  4OAY A;  5CPR B;  5EX3 A;  1D1C A;  1YX5 A;  3HKZ A;  4QPQ A;  5T0K A;  3OY9 A;  3K70 D;  3M59 A;  3AFH A;  1V5F A;  2F69 A;  1GLN A;  4C9Y A;  2UV1 A;  1D0Y A;  2UUZ A;  4JDS A;  3F9Z A;  4HPQ A;  3W2V A;  5JIY A;  3OYN A;  3OYD A;  2IGO A;  4NQW B;  3TMO A;  1MMN A;  2ZXI A;  3DLA A;  3OPE A;  4J8O A;  3VSL A;  3LMM A;  4XON A;  3CJQ B;  2I8D A;  2X1D A;  3OYB A;  5F5E A;  3L2W A;  4QEN A;  3PNY A;  4EAT A;  2DCE A;  3IAS 2;  3DQV C;  2XF6 A;  4BQQ A;  1NG7 A;  1MND A;  2QKM B;  4NUB A;  3CES A;  3V42 A;  4OWR B;  4F91 B;  3OYL A;  5F6L A;  3I9V 2;  2LG4 A;  2VJI A;  3IP4 B;  1UEL B;  2VQL A;  3RTR A;  1ML9 A;  1MW7 A;  2QKL B;  4E7H A;  3G2B A;  3M8J A;  4JOM A;  2R3A A;  1G59 A;  3OXL A;  2V4J C;  1T95 A;  5JJ0 A;  4NJ5 A;  4D9J A;  2VPL A;  4I51 A;  2VQH A;  4XOT A;  4XN3 A;  1MT6 A;  3A2K A;  1WJC A;  3OOI A;  1Z3Y A;  4HST A;  4XR6 A;  1LVK A;  5T0M A;  3RSN A;  4IQJ A;  2CW8 A;  2AQE A;  1X1C A;  4BQO A;  4YNM A;  4F3Q A;  3J7A Y;  2R7O A;  2LOO A;  1WJ5 A;  1YE9 A;  3EUH C;  2BW3 B;  3SEQ A;  1D1A A;  2BVL A;  3S8P A;  3DPU A;  3VDX A;  4XLA A;  2W5Y A;  3CP8 A;  3BG6 A;  1BR4 A;  3QOD A;  3LSK A;  4BDY A;  3M56 A;  4HEA 2;  4II3 A;  2V9K A;  3BC8 A;  1P9Q C;  1N78 A;  3D5R C;  1WJD A;  2W4S A;  3MD2 A;  4O6F A;  2LY2 A;  3VYR B;  4XQF A;  3HL2 A;  3RAY A;  4IX7 A;  3AL0 B;  3D5S C;  3DKX A;  3MKZ A;  4J00 A;  1MVX A;  2W5Z A;  2V26 A;  4FMU A;  4J7I A;  1YX3 A;  2KQR A;  4AYB A;  4ZDP A;  3PFY A;  3ONQ A;  3ZGK A;  1WFX A;  4RM2 A;  2WB1 A;  4BGD A;  1Z3X A;  1IRX A;  2W7N A;  1TT0 A;  2CH0 A;  2O5R A;  2HVR A;  3VWB A;  1PEG A;  1WJB A;  1PJR A;  2MC4 A;  2MFZ A;  5FRO A;  3H5A A;  4DJA A;  2IS4 A;  4FAS D;  2X6W A;  2R7R A;  1OR7 C;  1J09 A;  2UWM A;  2P0W A;  3EP0 A;  2KRH A;  4AU7 A;  1G8X A;  3ZCO A;  2VAS A;  4B3X A;  1V5E A;  3TG5 A;  3H5R A;  2M0M A;  4C2U A;  1N6C A;  4CCK A;  1UAA A;  4F55 A;  2VLA A;  3M1C A;  4E7L A;  2KLO A;  4P5O A;  3M54 A;  2OUM A;  4KT6 A;  3CBO A;  3FBI B;  4BE2 A;  3KEY A;  3LSI A;  4MI5 A;  1EA3 A;  3TL4 X;  2M7B A;  4ZTF A;  2W82 A;  2R7U A;  2IS2 A;  5KJN A;  3L2R A;  4KJZ A;  2VJJ A;  4BXF A;  4RLF A;  3K4C A;  3OYM A;  5ARG A;  2K9M A;  3HC7 A;  5HLT A;  3CBM A;  3BCA A;  5F59 A;  2VXD A;  4GRI A;  4BDZ A;  4PJM A;  3F9Y A;  3MO2 A;  2M4G A;  4LIV A;  5CCM A;  4B47 A;  3OL3 A;  2CV0 A;  1O9S A;  2F4I A;  3RPU D;  1X19 A;  3KMT A;  3HG9 A;  4ZTJ A;  3CJR B;  5CQE A;  4BEH B;  2IS1 A;  5TEG A;  1LKX A;  2BQZ A;  3H9G A;  4CCO A;  3DWL E;  3H35 A;  3K5K A;  2OV7 A;  4JQF A;  4YPU A;  4PK4 A;  2GOM A;  4BJ5 C;  2E5Z A;  1N77 A;  3VYS B;  3OYI A;  3K70 C;  3QWV A;  4ZDL A;  3DTI A;  3RJW A;  3PNT A;  3MMY B;  1Y6I A;  1NG6 A;  4XOR A;  4BUP A;  1E0E A;  4BEH A;  4ZYA A;  2F5V A;  3UNG C;  4C30 A;  2JUG A;  2LH9 A;  3OYA A;  3CBP A;  5TH7 A;  1Y56 A;  2Q2E B;  4YRV A;  4KIS A;  5HNF A;  3L2V A;  2X85 A;  3PNV A;  2CV2 A;  3M57 A;  4XLH A;  3W2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...