5CPRB

The novel suv4-20 inhibitor a-196 verifies a role for epigenetics in genomic integrity
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
263
structure length
232
Chain Sequence
b'MSAKELCENDDLATSLVLDPYLGFQTHKMNRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SUV420H1
publication title The SUV4-20 inhibitor A-196 verifies a role for epigenetics in genomic integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 232
sequence length 263
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5cprB01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5cprB02
3VV0A 3M59A 3MEKA 4E47A 5KJNA 5TH7A 3S7BA 1MVXA 3RU0A 2W5YA 5ARGA 3KMTA 5CCLA 2BQZA 4O6FA 3QWWA 3QWPA 2F69A 3OOIA 3OXFA 5JIYA 5EG2A 3KMJA 3M58A 5JHNA 3RAYA 1N3JA 5LSXA 1N6CA 5T5GA 4I51A 2R3AA 4Z4PA 4RZ0A 4J8OA 3RIBA 5TTFA 3CBOA 3MO5A 5AYFA 4NVQA 5EX0A 4NJ5A 3DB5A 3M55A 1PEGA 4YNMA 4JDSA 2O8JA 1O9SA 4QENA 3M56A 3S7JA 5ARFA 3S7FA 1XQHA 2QPWA 3OXGA 3VUZA 4YPUA 5HI7A 3SWCA 1MVHA 4YPEA 3M57A 3MO2A 2W5ZA 3RQ4A 3F9ZA 3CBMA 3CBPA 4J7IA 3S7DA 4LDGA 3MO0A 3QWVA 1MT6A 3EP0A 4YNDA 5F6LA 4IJ8A 3OPEA 2RFIA 3RJWA 5T0KA 3F9WA 3KMAA 5F59A 5JINA 1ZKKA 5F6KC 4YNPA 4YPAA 4WUYA 4AU7A 4JLGA 3TG5A 4QEOA 3K5KA 5TEGA 2IGQA 3DALA 4BUPA 3TG4A 4MI5A 3F9YA 1ML9A 3HNAA 4O30A 1H3IA 5EX3A 2G46A 4H12A 4J7FA 5T0MA 5KJMA 3SW9A 3M54A 1N6AA 5LSZA 5HQ8A 3FPDA 4FMUA 3N71A 5CPRB 3M5AA 5F5EA 5KJLA 3IHXA 4IJDA 3M53A 4C1QA 2JV0A 3OS5A 3OXLA 4J83A 3F9XA 1MUFA 3PDNA 3S8PA 5JJ0A 5CCMA 4MI0A 4QEPA 5KJKA 3BO5A
chains in the Genus database with same CATH superfamily
1FSEA 4MGRA 3RYRA 2CMPA 2X6YA 2LKXA 2EV6A 3KEQA 2KZVA 3U9GA 4OMYA 4QPOA 3FXLA 3WU0A 3QP5A 3GLLA 2A6EF 2EFPA 4GRIA 1ZAOA 2EFOA 5JHUA 1FOWA 4BY1J 1F43A 1J5YA 2X1EA 2YUSA 4R8HA 1ZR2A 3RPUA 2ID6A 3L00A 1GUUA 3V7RA 2X9DA 2M2EA 3IRQA 1ULYA 2IBDA 5LSXA 4IQ4A 5H6RA 1L0OC 3I3LA 3LOCA 2KISA 2ZJ2A 2CGPA 1JI8A 1MSFC 4XKVA 1B6AA 4Y3OA 4Y4RA 5FD5A 5BNGA 3OMYA 3HB9A 4XK4A 2OJED 3DU6A 4L9TA 1MH3A 3K2AA 5J4YA 3H3VK 1S7EA 1YJNI 3CMAI 2XASA 3PSIA 3DCFA 2RREA 5JFRA 3VSKA 5EGOA 1D1AA 2F5FA 4UUSA 1LE8B 1QA6A 2Y69H 4N0BA 2ZJRF 4PSWA 1OQYA 4HV5A 5HDKA 2M8GX 3KP6A 1T98A 5F0CA 4B43A 2OTLI 2VQGA 4U88A 3TL4X 1X19A 5L3FA 3BR5A 3JRBA 2X48A 1U0JA 3HEFA 3VODA 3CBMA 5FFZA 5FLMJ 5J8CA 2VJIA 2LVSA 3TW7A 4BQQA 3D1NI 2W48A 2ICWG 4F7ZA 1W7PA 2P5KA 3G1MA 2VBZA 1ZGAA 4IOAF 2VI6A 2OV7A 4MFEA 1H8AC 1SD5A 2XV4S 2DA5A 3HPHA 4JLGA 1YW8A 1U5TB 4CXFA 1K78A 2ZJQF 1EKEA 1K4SA 5F64A 2CWEA 2HOAA 2M34A 2MC4A 2B63J 2VBXA 5CVRA 3PL8A 2QLZA 5DEQA 1IDYA 3QPTA 2GIVA 2GWRA 2VOPA 1XCBA 2E7XA 3BZ6A 3IH4A 4IPAA 5BOXA 4BL0B 5HLIA 1I5ZA 3COAC 3N97A 2HGCA 1RI7A 2OF7A 5JHFA 2JV0A 3D5RC 2DMUA 2E35A 3VEPA 2NS0A 1IRZA 2QVOA 1WFXA 3SZPA 3ZQIA 4B09A 4XIDA 2D5VA 2PMUA 5E18F 3K70D 2HS5A 2KRHA 4UNOA 3RPQA 3BY6A 2DOFA 1MBFA 4JP0A 4II2A 1XGNA 4CDGA 3A01A 2DFEA 2R5ZA 1T8IA 2NVQJ 2CJJA 4IX7A 1DUXC 2H94A 4ZJZA 1GVDA 3OWTA 3DTEA 3QWWA 4EM1A 3HGGA 1E3OC 1ZGWA 2QBYA 4XSXF 3SZGA 5FD6A 2PJRB 1R6RA 1IN8A 3S16J 3CDLA 3H5AA 1YITI 2LBFB 2R7TA 5JHNA 2AQEA 5FKLA 1JTYA 2FUG2 4CCLA 2JA8J 3RTRA 1LPQA 5D8KB 5AIQA 1HA8A 4RGSA 5HS9A 3ZQHA 2KL4A 2EB7A 2HU9A 1QNTA 2Z16A 1QQIA 2L4MA 2ZBKA 3R60A 3HKZA 3RJPA 1S9HA 2F5CA 5E1WA 3FXOA 5F0FA 3LAJA 2DW4A 2NOGA 2XHKA 1WJDA 1Z6RA 4J01A 3CD6I 3CUQC 5EEHA 3C18A 3QOPA 5C44J 2M5WA 4ZDOA 1EH8A 3BCBA 1JUMA 2LYCA 4M9SA 1KGSA 4L9VA 2W57A 4H0EA 2DA1A 2B9SA 1XSDA 3MQ0A 3BC8A 4NNJA 2F2EA 1Z05A 3LMMA 5H20A 2ZXWH 3S2HJ 2RVCA 1PP7U 2DO7A 3TBIA 2ADUA 3E0JB 1O7FA 1TWGJ 5M5XJ 4DNCA 2H8WA 3NARA 3QQAA 3F8FA 1ODDA 2XGXA 1G3TA 2MGQA 4AU7A 1UAAA 3DKXA 4PZJA 4E6KG 3M1CA 2IGQA 3TEDA 1YO5C 2L9RA 3QPHA 1X1AA 2PFBA 3BPVA 3U2RA 4UUTA 3QP6A 1IV8A 5EX3A 4J7FA 5LGUA 3ISPA 1H9TA 3P7NA 1WZ2A 1MGTA 4RGRA 3BOQA 2OPTA 3N71A 4F93B 1W36D 2VKEA 3MKYB 1ENHA 4UVCA 4IVNA 3V4GA 1ITYA 1TWHJ 2VKDA 1FY7A 3E6BA 1SFEA 3KP3A 3I58A 1XSXA 5FKKA 1Y6IA 4I0BA 5CQGA 3DQVC 1JGGA 1ETWA 3F8MA 1PDNC 3OYMA 5JLWA 3WTTC 5C4JJ 2HTJA 3BG9A 3HRSA 2HR3A 2L01A 4EM0B 1B9MA 3N05A 5ARGA 2MD0A 5CVIA 4ZC3A 1H88C 1RKWA 1TP4A 5M3FJ 5DD4A 1OR7A 2AHQA 3S1NJ 2IS4A 2ELJA 4DQ2A 1TC3C 1T2KA 3H0DA 2P5LC 4M6XA 4PFOA 2FMLA 2Y31A 1GV5A 1KQ9A 4JQFA 5J47A 3ABUA 1DU0A 3RAYA 5L3BA 3SXYA 4EATA 3H5RA 5ILUA 4XRMA 2E2IJ 3PQJA 4XONA 3BDDA 3QWLA 2M1BA 2XB5A 4IF4A 3KFWX 5GPCA 4AVPA 1V3FA 4FASD 2NVXJ 4M3FA 1BR4A 2XF7A 3S1RJ 2P81A 4KICA 2QENA 3FISA 4G7ZF 2F6CA 3KCCA 1G59A 2KQRA 5E17F 1BM9A 4KN4X 1FNNA 2PQ8A 3W2WA 1MVHA 2DK5A 4V2FA 4A0YA 1S3JA 1LFPA 1OCRH 2JA5J 4IKFA 2XAGA 3E5XA 4D7MA 2ZFWA 2ZFUA 3FKJA 2R7XA 4JBAA 2P5VA 1LEBA 1PUEE 1ZELA 4IHSA 1OCCH 5FJ8J 3E7LA 2E1OA 3ERMA 5HLHA 1R1VA 2E71A 3RZOJ 1I1GA 3ZPLA 3A0HC 1GVJA 1QO0D 3KMAA 3L2UA 1MMNA 2R5YA 4M9XA 2IXSA 3JRCA 2JQ7A 3S3NA 4XKBA 4V19K 4NC6A 3K9TA 1I3QJ 1R1TA 1SFKA 4WX9A 3X2QH 3CO6C 4ZYHA 4KYWA 4OIPF 1HBXG 1GHCA 2BHYA 3HOVJ 4RB2C 4ENMA 3KYLA 3CDIA 1XMAA 4H12A 1KYZA 5IPAA 4EJOA 3CLOA 2NNYA 2Z33A 4DYRA 3JRGA 1ON1A 3CC7I 2A3SA 1U5TC 3CUQA 3Q0VA 3IHXA 1J09A 2OQRA 4HNVA 1RPWA 2X51A 4A3JJ 1T38A 2HEOA 3IAM2 1BJAA 2O9LA 2LLKA 1MMDA 2NVUB 4Y52J 2IP2A 5FLXK 2ZXHA 2OA4A 4LIUA 3OYLA 3BQZA 1AU7A 5TH7A 4I0AA 4Q4ZF 4LMYA 2OD5A 4L18B 2BOLA 4QLCU 5KJNA 3S17J 4EEFG 3IUOA 3BTCA 1YX3A 1JE8A 2XPUA 3S3MA 3JAMK 2FBKA 4QSHA 2COMA 1XMKA 5HS7A 2EJRA 3V7SA 1KU2A 2GAUA 4W1UA 3T8TA 3VYSB 3L7WA 1O7LA 1POGA 1TWFJ 4XBFA 3CO7C 4HPQA 3OXFA 4BQOA 4L0YB 2YPRA 2HFHA 3TOBA 3F0CA 2BVMA 4EJVA 3FBNB 3PQKA 1Y56A 3REOA 2EIJH 1MZBA 5FLXZ 2V9KA 2DI3A 1FBQA 5IYDJ 3KYDB 2RAEA 2R7DA 2FNAA 2GQQA 3CCUI 3O8HA 4CYCA 2FU4A 5KK1A 5K5RA 1WQ2A 5ERIA 4B1RA 2FRHA 3QU3A 2KRFA 1X1PA 1BOAA 3ZN0A 4D5CA 2STWA 3JAMZ 4AYBN 4WK8F 1X3WB 2IA1A 3WHBA 2E7WA 4BGDA 2MLKA 4IHXA 3GWZA 3OL3A 4KIBA 4L0ZB 3PNVA 4HRIA 3RQ4A 2V6CA 4G94A 2KT0A 3H3ZA 3BP8A 5CYVA 3MN2A 4LD5A 4HLYA 2IPQX 1TBXA 4D0PA 3CBPA 3CCEI 4CZZA 2K85A 3MO0A 5HVQC 4EVIA 3ZMZA 1R49A 4XL9A 3OYAA 3HC7A 4R79A 2RFIA 3RJWA 5IT3A 1Z6TA 3H0GJ 5JINA 1Z77A 2M8EA 3K6GA 3O6BB 1EH7A 3E97A 3FMSA 4D9JA 4WUYA 3ABLH 3CCRI 5HLTA 2FD5A 4HYEA 1BI3A 1A6QA 1FTTA 1IZ1A 1A04A 4I01A 4NC7A 5K1YA 1LDJA 4AWXB 3K5KA 2GOMA 2V9VA 3LWFA 3GVAA 1GV2A 4NQWA 4ZDPA 3GTJJ 4ITVA 4RBOA 1I1SA 2WBMA 5KJMA 3OYBA 1ETOA 3F72A 5D5VB 3K4BA 1FWZA 3CTAA 4F92B 2E1CA 3CCJI 1XDUA 3G6EI 2DMQA 2PMZN 3FXRA 2OBPA 2JWTA 2F5DA 2F5EA 4FX0A 2E5ZA 3OS5A 1LKXA 4J83A 4CCKA 2D2WA 1OYYA 3MEXA 2LG4A 1W5CC 3WTYC 5B3SH 4LG0A 2HDWA 4QEPA 1BN5A 5LEJA 3I55I 3TKYA 4XOPA 4UUVA 3K7AJ 1QRYA 3H35A 3IKTA 3JRFA 3I59B 1HOMA 4XLAA 3LNQA 4A3BJ 3WTWC 5CCLA 2BQZA 2B7EA 1YIOA 2DLLA 3GO5A 4C9YA 4F52A 2CH0A 2F69A 3PFYA 3HOYJ 3B02A 1QZYA 2BW3A 4ZTJA 5LRRA 1QVUA 1D5YA 4XLPF 1QHHD 3TDUC 5DDGA 1FBSA 3DXJF 4BAYA 2P8TA 4ON0A 2W82A 1LDDA 1FYMA 2H09A 4PUSA 1G4DA 3OIQA 2BHZA 2WY8Q 1FIPA 1FOXA 3BLYA 2LFBA 1ETQA 3H92A 5E1ZB 1ZGJA 5K7ZA 3MO5A 2NS7A 3WG7H 2KJCA 3AG1H 2LY2A 5FGMA 2FEZA 3K4CA 1ETKA 1UELB 2VB6A 4W97A 3EPZA 1YLFA 2HKOA 2J5OA 1O9SA 2X0LA 5HNHA 4HDVA 5H2FC 5DCFA 3HUGA 1OYIA 1T95A 2DQLA 2HNHA 2HPMA 3G1LA 5D6EA 3LQQA 2XSDC 5IOYA 3CJQB 1JT6A 5FKNA 3M1EA 2N8GA 4RDUA 3OYCA 3Q5FA 2O8KA 1PUFB 2M4KA 4RB3C 3MWMA 4YNDA 2CUJA 3OSFA 1IN4A 1MBKA 2DMPA 2OCEA 2EFWA 1SVMA 1X1BA 1Z0XA 2XRNA 3NWTA 5J40A 3RKQA 2H1KA 3GZNB 3VOEA 4YPAA 2ESHA 1CF7A 4C3IJ 3JSPA 4N9IA 3ZQ7A 3EYIA 1RETA 2WY7Q 3V8KA 3HSRA 1H0MA 1X4PA 6PAXA 1R5HA 3MZ8A 1E3HA 5FKMA 2CO5A 2EZLA 3H5NA 4XM3A 1J59A 5T0MA 2JZYA 4QPQA 3ZMVA 3SW9A 3S15J 2EFNA 3CZ6A 2XAQA 4JX5A 4UB6C 3MMYB 1MW7A 3RSNA 2KIQA 4IJDA 2VJ4A 1WWXA 5GAGJ 1DU6A 3F22A 3K69A 3ZCOA 2M0MA 2L9SA 2DOAA 2CUFA 2W4SA 3GTGJ 3C3WA 1XS9A 4A3GJ 1U9OA 1A35A 2OCCH 2RQPA 3BR0A 1IG7A 5CCMA 5AIPA 2DDBA 4P96A 1IXSB 3EDPA 2Q1ZB 2OTJI 1R22A 4BBSJ 4GFBA 4Q47A 3S7BA 3HOXJ 3L2CA 2UXNA 4JYKA 4OIQF 2LTPA 3OL4A 2QSGX 4Z2YA 3E1SA 3D0SA 3QU6A 5EF6A 3TGNA 4FX4A 4N4NB 1J0RA 3G1OA 2Z9OA 2JSCA 4KISA 2L9VA 1T0FC 2Y0SN 2F5VA 2PN6A 4KT5C 3R4KA 5F1JA 4QTRA 4S04A 5ICGA 3GMEA 4ZYEA 4UVBA 1FZPB 3K2ZA 1K6YA 5T5GA 2XVCA 3OYDA 1HSJA 1OYWA 2Y75A 5ICEA 3CMYA 4C2MJ 2K3FA 1PVEA 2EH3A 3ZQQA 3CCQI 1KYWA 3DF8A 4EGZA 1GXQA 1ZH5A 4YFNF 3A03A 2QSHX 1UJ8A 2FE3A 3J7YJ 2Y9ZA 4L9NA 3M55A 3IL2A 1OISA 4RB1A 1MBJA 2ISZA 2QPWA 4A6EA 4LK0F 2GZWA 5B5EC 1MNEA 4UV8A 2P6TA 3ABTA 5HI7A 4RLFA 2LF7A 3CCLI 1XGOA 3ZGKA 2ZSHB 3R61A 3BTIA 2M0CA 1L3LA 3K1MA 2MD5A 5JVTA 3HGYA 3AG4H 2JN6A 2Y9YA 2DOEA 3TOAA 3CCYA 5LRSA 5EDNA 5DCMA 2KMUA 4J7IA 1SD7A 1FX7A 5E3MA 1MMSA 5EG0A 2Q2EA 1IXCA 2XAHA 2I10A 3VYTB 1N25A 4CCNA 1P7IA 4PJ0C 1FPQA 3S1QJ 4DZPA 4N9HA 4O3MA 3H3UA 1IW7F 3K0LA 3E6CC 2IRFG 5D8LB 2R7FA 2EV0A 1YJ9I 2OU2A 4RS8A 4B4CA 2NVYJ 5L3GA 1KA8A 4NUBA 5DUIA 3V8JA 1QU3A 1H9GA 5KNLA 3DALA 4CO8A 4G6TB 1R23A 4EJUA 1CQTA 1SAUA 3NAUA 3I71A 4U0VA 4MIMA 3TP0A 2L2OA 4ESFA 1BC8C 3M54A 4LG0B 2X6WA 2K9QA 1DQUA 2HQNA 2YSRA 1PYVA 2V1XA 3BZKA 4AD9A 5LLQA 3AAFA 3VSLA 2HVRA 2XB0X 2IT0A 2CU7A 1X2MA 1D5VA 4KDPA 1MUFA 2X6OA 2YS9A 2H1LA 2PMHA 2BY3A 2Z5UA 3S3OA 2ZSIB 5JJ0A 1ZLKA 1EH6A 3ML6A 2BXZA 3LSPA 3WGIA 2CW7A 1B72A 4BEHB 4DW6A 5DM6F 2HZDA 1SD4A 1W5SA 1V5EA 3IC7A 2DJIA 4P1WA 5CJ9A 1E2XA 4BQNA 5B66C 3LAPA 3ZQFA 1SMTA 1VNDA 2ETHA 2X6XA 1W36C 1U6GA 5IP9J 3LSRA 3VYRB 4XLFA 5E1XA 3JCUC 4ZYGA 4S0HB 2G7UA 2KZGA 4XR6A 3RI4A 1SMYF 2V7FA 1SEUA 2QCOA 4L5EA 1ETXA 1MBEA 2DMTA 1YRNB 2VXDA 1AKHA 3BJOA 4HZFA 3CCVI 1YW7A 2DA7A 3BG5A 5E3NA 2PBIA 3HOSA 4M3BA 2CG4A 1E17A 5TTFA 1HXDA 5DUKA 3FMRA 4OAYA 4EM2A 1RUOA 1YHQI 3QYEA 3FIWA 1LVAA 3ONQA 2HOEA 4DJAA 3RQIA 2A6TA 2DT5A 2ZMEB 4CSWA 2PX9A 5IP6A 3CCMI 1MDMB 2V26A 3S7JA 3S7FA 4C3HJ 2OQGA 3FM3A 2D1VA 3SWCA 1MJ9A 3M9AA 2NYXA 1R7JA 1X4OA 3RDIA 1HW1A 3OYEA 2JSPA 2W5ZA 2L7FP 2R7OA 2RV8A 3MAJA 4G8XA 2ME6A 4A3LJ 2QKLB 5B1AH 3DPUA 4KFCA 3HKZN 2TDXA 3BR6A 1P4XA 4PCQA 2W24A 3GUDA 3J7AO 1ZTRA 1MIJA 4C30A 4B3AA 3SQNA 3W2AA 1D8JA 2XAFA 4JK1X 1P92A 4L9JA 1TQIA 5E3OA 1XD7A 3PSFA 1KZHA 2D1HA 1JTXA 1TL8A 1GLNA 1ZHFA 3OYKA 5IP7J 1G3SA 2LC2A 4BNCA 3MZHA 3HOUJ 5TEGA 2GLOA 2WADA 2C6YA 1ZLJA 1DGRM 3F9YA 4K2EA 1BOBA 3D5SC 1VZ0A 1X1CA 2IA2A 4RA2A 4Y15A 1H3IA 3K4NA 2G46A 4AIDA 4G12A 3T0YA 2KFDA 3UR3C 3WU1B 3TMOA 1FYLA 1I50J 2GA1A 3CP2A 4KJZA 4WXHA 1J7KA 3GFJA 2VBYA 2HOSA 1HQCA 1ZRDA 3M53A 4RMNA 2EIMH 1P4WA 4LOCA 3ASNH 1MNDA 2TCTA 3F9XA 1STZA 4NC8A 5LGTA 1Z3YA 4HSTA 3SFIA 4UV9A 2XRLA 2OZ6A 5KJKA 4WXDA 3LSKA 4PJJA 3BO5A 3CC2I 1JUPA 3MEKA 4QIWN 4ZDLA 3M4OJ 3JRAA 3F3XA 4E7ZA 1FP2A 3JRIA 1GT0C 1MVXA 1XB4A 3HTUA 1VI0A 2HZTA 5LHGA 1K79A 5GP9A 4HLXA 3MVPA 4X1EA 5IYBJ 2WB1N 5F27A 5LFAA 4XMYA 4F91B 2ZNZA 1Z7UA 3BROA 2L7MP 3M3YJ 5D5UB 4X0GA 1JHHA 1N75A 4WXCA 1OLTA 1XMXA 2X4HA 1HKSA 3ECHA 3I4MJ 2CQKA 2W7NA 2BVLA 1XGSA 4HOBA 4P9FA 3OYNA 4ENJA 2M3AA 2CS3A 1MJAA 4A0ZA 4HF2A 3HOTA 1Q1VA 1VQMI 1D1BA 4MQVA 4XICA 4GXOA 1ZRCA 2E5NA 2V1NA 3C7JA 2MH2A 2QZ8A 3DKWA 1SFUA 1T6SA 4KN7X 3M56A 1V5FA 3WU2C 2CQNA 2O0YA 2QQ9A 2W1OA 4GCVA 2A07F 2RNJA 4BBRJ 2HTSA 3DEWA 5EG0B 2EPFA 3KEYA 1GDTA 2HOTA 4HW0A 1ZR4A 4PFPA 4BDZA 2HVSA 3C2HA 2ESNA 3S7DA 5EGOB 5CQEA 3ABKH 4UUSB 2E34A 3GTQJ 2LP0A 2LR8A 3EP0A 3HTSB 1RC9A 1YFHA 5T0KA 1LDKB 3QOEA 1K61A 3KLNA 2Y0MA 4I09A 2VPLA 2UXXA 2A6HF 2X1DA 4BYYA 2KLOA 3B6AA 3BJAA 3WGHA 5BMZA 2CV0A 2BY1A 4Z6YA 4KNYA 3DLAA 3BR2A 4UB8C 4FHTA 4BHCA 2XF6A 2XC7A 2VPRA 3UNGC 3FXKA 4MHGA 5FLVA 1W7PB 3BZCA 3NRVA 2XKOA 5BPIA 3DBRB 3H9JA 2KIFA 3MKLA 3KP7A 2Z2SB 2P6SA 1ZK8A 2K5CA 3IRRA 2NRAC 4M6VA 2WA0A 5F0HA 4XOTA 1JHFA 2CRGA 4HDUA 4FMUA 1SFXA 3LFKA 1K78B 2NVTJ 4HV6A 3Q0UA 1TTYA 1UFMA 4M3GA 2R7ZJ 2CV1A 2AO9A 4EJWA 3HDDA 2EILH 2HI3A 3HL2A 1JT0A 2VIXA 4JOMA 2GOXB 1USSA 5DYMA 2Y2ZA 5CVVA 1JKRC 1X3ZB 4DYCA 5LGNA 1UCRA 4XKCA 4E7JA 2F4MB 3GZ6A 2W5YA 2ZB9A 4PJLA 3EYYA 1U9NA 3GZ5A 5EEAA 3JSOA 4IOCF 1BI2A 2JTVA 1WI9A 4XQFA 3L2WA 4D1QA 1IRXA 2M9HA 1RKTA 3HXLA 3A01B 2R5ZB 2DA2A 1VQOI 2FQ4A 2B0LA 4CH7A 1U78A 1BW6A 4ASNA 2K27A 5D4RA 4IZZA 3DEEA 3VWBA 2PG4A 4I51A 1MNMC 4PK4A 2F48A 3TQNA 1V54H 2QBYB 3HRTA 2BY2A 2O7OA 3J80K 3Q0WA 2E2JJ 1XC5A 5BS6A 1DPRA 1VTNC 2AQFA 4EQQA 2G9WA 1A6IA 2WAFA 4M71A 5IOZA 1T33A 1YS6A 2H8RA 3AG2H 1KONA 1PP8F 2UWMA 4BHPA 1K4TA 3FWEA 3W2VA 1XQHA 2VL8A 4II3A 1WHUA 1N77A 1Y39A 2BE5F 5J1RA 5M5YJ 4YPEA 3EUHC 1WPKA 1YG2A 3K1PA 3I0TA 3HRUA 4M72A 3CP8A 3FM5A 5TJJA 2WAQN 5TGTA 1WJ5A 2ZMEC 3DBHB 1VFCA 1ZRFA 2EFQA 2L54A 1JKOC 5DD8A 4CGZA 4EV0A 5K5OA 2K86A 1D0XA 2CW0F 4CZCA 1LNWA 2BY0A 3J80Z 1USTA 4A5NA 2YU3A 3K4JA 4I76A 5DV5A 3T1BA 3OS2A 3JRHA 2ZC2A 4LGWA 1R4MB 2FSWA 1YTYA 1Z67A 2DFIA 1WGXA 4HQMA 3ZXSA 3OYGA 2R0QC 2JUCA 4BS9A 2CV2A 4CYDA 2XPVA 4L5IA 3JRDA 5M3MJ 3H9GA 3B6CA 2KPMA 1JUSA 3M8FA 1AHDP 1ON2A 1UB9A 1WJEA 3T5XA 2V79A 4RAFA 2EZHA 3PJRA 3BR3A 2I5UA 9ANTA 4BY7J 5ICCA 4ANJA 1VQ9I 1DPUA 3VDXA 4O30A 3PO3J 2W84A 3FK6A 3ZN1A 2LSOA 5D6FA 4E7IA 2DXIA 3R0AA 2R7QA 3BG7A 4M6YA 3PUBA 4A3CJ 1N6AA 3GTMJ 2VC1A 2LOOA 4NBQA 4OWRB 4AUXA 4A69C 1E3PA 3WODF 5LHIA 4BXUA 2E60A 1BW5A 2R92J 4LB6B 3G2BA 1QPIA 4PJMA 3SHFA 3F6OA 2KHMA 3WE3A 1UHMA 4E47A 5HOOA 1E0EA 1ZG1A 3TO6A 4XKWA 1SVOA 2EA2A 4KT6A 4LB5A 3KP4A 1B9NA 3LSHA 4H4KC 2O6GE 3V7CA 2QQ8A 4B47A 3PFIA 5D5WB 1XDSA 2QKMB 1BC7C 2EBIA 1FEXA 3GXOA 1UHSA 4G6QA 2PEXA 2XKPA 3QWPA 2LF8A 4IRIA 1T39A 2M45A 4RM2A 4IHWA 2ID3A 2HXIA 4YIRX 2YX7A 4CICA 3VB2A 4ESJA 4DGWB 2DQRA 3BQYA 1KU3A 2NOJB 3HJEA 4V2GA 4PGGA 1YE9A 3RYPA 4Z4PA 1W4MA 1LE8A 2LY1A 4NDLA 3S32A 4X6AJ 3CBOA 4C2TA 2DT7B 4OINF 2R7RA 3TO7A 4BDYA 4IJAA 3E5UA 3DB5A 2K4BA 3HSEA 1R4NB 1X3UA 2HYGD 3AFHA 1TLHB 2DBBA 1ZYRF 2E1MB 4I2OA 2BZTA 3JTGA 3KE2A 3ELKA 5ARFA 2DA6A 1QHGA 1W5TA 3GTPJ 5L3CA 4IEJA 4HF0A 1R58A 4A3IJ 1TW3A 1HC8A 2BGCA 2OC6A 3ESWB 1FSHA 2QSFX 3FHNA 3GF2A 1BIBA 3KX2A 3DPTA 3MZYA 4FTHA 1I39A 1MMAA 3DTKA 1O3SA 1O3RA 1Y0UA 1KQ8A 3FXMA 1U5TA 5E8GA 4XLEA 4CA0A 3CMMA 2HXOA 3OPEA 2W85A 1V4RA 3OS1A 2VT3A 5C3EJ 1ZKKA 2E1NA 4C3JJ 2HQAA 4YNPA 1HDDC 1KU9A 1WJFA 1Y1VJ 3GYHX 4U7BA 2NS8A 3LSJA 3ZOBA 2VJJA 4HBLA 1ZN2A 1XG1A 4RM3A 4RGUA 1HW5A 3K4KA 2L4AA 3ERED 1MSEC 2R5YB 2Q8KA 2I8DA 4L5JA 3PM1A 3NWSA 2MA3A 5EZHA 4RGXA 4CHUA 1B8IA 4PDKA 1WCMJ 4PJNA 4EJTA 2LREA 1IN5A 1X1DA 3RKWA 3F23A 1D8KA 4A3KJ 3I53A 2ZXJA 3AL0B 3DFGA 3M8EA 1IRFA 3CJTB 3LSIA 3C2BA 5E8IA 4MTDA 2WV0A 3H9QA 2RQQA 3NEUA 3BCAA 1P6RA 5IY5H 1IO2A 3KP2A 3OS0A 2XPWA 1FP1D 3GEZA 3DP7A 2CQ7A 3VV0A 1MH4A 2PJRA 1HSTA 1SVLA 3CLQA 4M3DA 3CUQB 4F3QA 1S29A 2A61A 1YI2I 3E5QA 2LBFA 2QUFA 2GXAA 2XDVA 2DYRH 1Q1HA 1B1BA 3CESA 3MD2A 5LD2C 3E6MA 2FQ3A 4O6FA 2Z1DA 1XSVA 1S72I 2DK8A 2VXZA 3BJ6A 2DTZA 3BG3A 2L9NA 2R4GA 3GFLA 4XRFA 1OKRA 3GW2A 3DBLB 2ECBA 3ZMDA 3IP4B 2R3AA 1OMIA 3FHZA 4YELA 2O61A 2A05A 3R0JA 2ELHA 2VKVA 1EF4A 5EJCA 1IN7A 5FRMA 2EA4A 4CCJA 2IGMA 1NK2P 4RAYA 2ZCWA 3O2PE 1D3YA 2XSJC 4D7NA 1YOVB 2IS2A 2WTEA 4MNUA 5HODA 2O8JA 1R36A 2IA0A 2WAEA 3N4MA 5JR3A 3SDGA 4BJ6C 4HNUA 4NB5A 3PIOF 4CYCB 4WWCA 4YPUA 3RPUD 4ZTFA 5GTIC 4A3DJ 3IWFA 1YIJI 3CC4I 3MO2A 1NH3A 3K1NA 5DTDA 5HS8A 2PI0A 2GA2A 5L3DA 4HQEA 3S14J 1J9IA 5IYCJ 1JJ8C 3WTVC 1A36A 1MT6A 3A2KA 2W00A 3FDYA 3P5JA 5HDGA 4M3EA 1LFUP 3F8CA 3OIOA 2CUEA 3NQOA 2LNBA 1HCRA 4BJ5C 2QQBA 2G7HA 4O6JA 4U0WA 2XROA 3WTSC 1Z9CA 1OJLA 3LA7A 4A93J 2R7UA 3G73A 1FTZA 3ULQB 3BT9A 3QRFF 3FZVA 1TW2A 2LRDA 3L9FA 4FETA 1SAXA 1R9TJ 1VQNI 2CSOA 4B3XA 2QGUA 1RNLA 1IRGA 3B73A 2FBIA 2ZXIA 3CDHA 3FXQA 3HSFA 1AOYA 4HEA2 1QVTA 1FOKA 1MD0A 2VQCA 2VUMJ 2CFOA 4DBRA 5HQ8A 3OY9A 3HHHA 5CPRB 1ZQ3P 3OOPA 1D1CA 4NQWB 3A4CA 5TISC 3T8RA 1W7PD 3RZDJ 4G6DA 2KIMA 1REPC 4PSXA 2BBYA 2Y48A 2MG4A 5J8FA 2NNNA 4AM3A 1IAWA 1R71A 2OZUA 3P9KA 2Y30A 3M59A 3L09A 2LH9A 2K40A 3C1DA 4I6ZA 1BJZA 4J19A 1AWCA 3I4PA 2MFZA 2IGOA 5CKTA 1O3TA 2FXAA 4Y17A 2G0EA 4AC0A 1F9NA 4I98B 1VQ5I 5IT9K 3FXJA 3FF5A 1FYKA 4G7OF 5EG2A 3M8JA 4PGHA 5A2QK 1JKQC 3KMJA 2MBFA 4ENKA 3M07A 1Z21A 5GADJ 1PJRA 2RKHA 1Z3XA 1JKPC 4HAMA 1VQ6I 1R5ID 2DYSH 3IV5A 4IHYA 2M7BA 2K9NA 4YEJA 1ONVA 3RIBA 1SFOJ 3W6VA 4D5FA 4JX6A 2BW3B 2L02A 3Q3SA 3QODA 4NJ5A 2M30A 4HA8A 4XLCA 4YIIA 5IT9Z 4P55A 1OR7C 1OFCX 2L7ZA 3OXGA 4KIFA 4Q5SF 1IGNA 4MEXF 2GBYA 4BH9A 5A2QZ 1MBHA 2ISYA 2RN7A 3W3CA 2JUGA 4FCYA 4A0XA 1W0TA 1TQMA 1O3QA 4KIGA 4A5MA 5E3LA 3S2WA 2E1MC 5DS9A 4IO9F 2JA6J 4WCGA 4DZJA 3IH3A 3PUFA 3HUGB 3CF2A 3QWVA 3RKYA 1LQ1A 1G3YA 2OUMA 1MKMA 1QZEA 3DTIA 3LSTA 1WH7A 3F6VA 1OPCA 2KDOA 2RNGA 4OMZA 5F6KC 2MSYA 2VLAA 1Z7LA 5FROA 2AXTC 4E7SA 4E7LA 3F8NA 1B8IB 4ZZLA 2LMDA 4QEOA 2VBWA 4XRSA 3GTKJ 2K9LA 2YX4A 3MCZA 5J4VA 1FBUA 4Q48A 4BJTA 3RKXA 3U1KA 2M87A 4YFKF 4BU2A 4GO1A 1CF7B 2Z99A 2E19A 3HHGA 3RCOA 1T0FA 2FNPA 1ETYA 2NXNB 3M5AA 1P2FA 1SD6A 1F1ZA 3EUKL 3A1YA 3L2RA 2LK2A 4QWQA 4IXAA 4BXXJ 4UY8I 2DJNA 3OXLA 3KZZA 4ZZDA 4MFDA 1I6HJ 1R00A 4LLLA 1WKMA 4IL6C 1P9QC 4LLGF 3OYJA 2XAJA 4EGYA 4HX7A 2HKXA 5HDNA 1U8RA 2P7VB 3KPHA 3AL0C 3S93A 3ZQGA 4LFUA 2HPIA 4YFXF 1XGMA 5EYRA 1XN7A 3KMTA 2DTRA 1G8XA 5FRNA 4DIQA 4M73A 4MQ9F 4G7HF 1HKQA 3VYUB 2KP6A 3D5LA 3OR1C 5CVUA 5EZGA 3U1DA 5JIYA 3WTXC 2IEKA 1LFBA 3HRMA 3IWZA 5B1BH 1JJ6C 4C2UA 2KRCA 2K7LA 1C0WA 5J1UA 5GTHC 2WV1A 1DDNA 4TV7A 3ROUA 1S5LC 4FT8A 3GFIA 5K5QA 4MLOA 2F4OB 5AONA 4J8OA 4HF1A 1I6XA 2QWWA 2AXLA 4G9YA 2L5QA 3I54A 4YRVA 4RAGA 4O5VA 1TWCJ 1OCTC 4AIHA 2VODA 5E20A 1VF9A 4NVQA 1PEGA 2ELKA 4BHBA 2WWYA 2XAUA 3CUOA 4J00A 1NK3P 2H6BA 4QENA 3WG9A 1F5TA 3CF5F 1V55H 1BL0A 4EMSA 4IRHA 1WSUA 3ZMSA 1TNTA 2A5WA 4FE7A 5BQTA 1I3AA 1WJAA 1ZKGA 2KKOA 4P5OA 3F9ZA 5H6QA 5JVGF 1NG6A 2JRMA 4HX4A 3AKZA 4E7KA 3GTOJ 2Q0OA 2EWNA 4LDGA 3QYFA 5GAHJ 2ZJPF 4B48A 2QYOA 2IGNA 1WVRA 3J7ZI 1V5GA 1ZARA 4U87A 4LJZF 1FC3A 2A68F 2QEXI 1K6OA 3OIPA 3DPLC 2WB1A 2VT2A 3PNTA 3BWGA 3OV8A 2K9MA 3MKZA 5CVJA 5DCMB 3VFZA 4CUGA 3LFUA 2WC2A 5K7HA 3TG5A 1WRJA 3IKVA 1BI1A 1QGPA 1O4XA 3W6JB 3I64A 1G2HA 2UZKA 2Q2EB 3G4SI 1ML9A 4I7HA 4AIKA 2AS5F 2HYFA 4N4OB 4WF2A 3ABMH 2HDDA 4CCMA 2JMWA 2DFHA 4UVAA 3ZMTA 5C4XJ 4RAZA 1EA3A 3O3KA 1DP3A 5LSZA 3L1PA 2DA3A 3WTUC 3BG6A 5KJLA 4XLHA 5KAIC 2K4JA 4OIOF 5GPAA 3I56I 1LJ9A 4ZYDA 2GXBA 1FIAA 3I59A 4ESBA 4KMFA 5TRDA 4BXFA 3GTLJ 2DDAA 4LITA 2E36A 1BR1A 1SC7A 2VOOA 5ED4A 2V9PA 4YIFA 4GDFA 3HG9A 3L2QA 5EEGA 2DFFA 2DMNA 3F21A 2DT6A 2QA4I 1VQKI 2XGEA 1TT0A 1X2NA 2KJBA 3RU0A 1P4AA 3H1CA 5KHDA 3WTZA 3GCMA 3WE2A 2V6EA 4RB0A 3QYBA 4M74A 1ETVA 5FFXA 2PLYA 1NTCA 1B72B 4XRSG 1EV7A 1WJCA 3ZQCA 2GIZA 4E7HA 3HOZJ 4YG2F 3ZQLA 1BR2A 2MABA 4HX8A 2CUZA 5KVRA 3QAHA 2R7SA 1I27A 4U7DA 1APLC 3LSMA 1RZ4A 2MW8A 3TP3A 3KETA 1TNSA 2ZO4A 1XTAA 2BEOA 1MMGA 1X58A 4BE0A 2JPBA 4Y7NJ 1FMWA 3I5UA 4LG3A 1ZG5A 5AYFA 2L3DA 1RUNA 2VKHA 4MEYF 1LEAA 2FOWA 3ASOH 4FISA 1AKHB 1HKTA 3EQLF 4S05A 3V8LA 5F6FA 4BACA 1PUFA 3GLXA 3VUZA 3HPGA 3SFZA 1IC8A 2EV5A 2DCEA 3PNYA 5HNFA 1HLVA 3EUAA 1OCOH 1Y8RB 3GX4X 4E4HA 4UHTA 1IN6A 2QM3A 2VQHA 3DV8A 4B44A 3OSGA 1ZREA 1ACIA 4GYGA 1TQPA 2W25A 1Z1DA 2DODA 5FKOA 2KIUA 2LY9A 2ECCA 2A5YB 1BIAA 2F4IA 4BE2A 5D5XB 3KP5A 4IJ8A 2JVGA 1S6LA 5F59A 5JLXA 1FT9A 3J7AY 1MJBA 1RESA 3SYTA 1TZLA 1HDPA 1RIOH 1K7AA 2CQQA 2ACJA 1D0YA 3F8BA 3OYFA 4ETSA 2BXYA 3CJNA 3TO9A 3A02A 4LK1F 3L2VA 4BUPA 3TG4A 4MI5A 3IH2A 2JK3A 2R7VA 3ECOA 2J5PA 4FQGA 4LLNA 3UKGA 2IAIA 2PJPA 3JW4A 1RRJA 1FOYA 5GAEJ 2JA2A 3FX3A 1IUFA 4CCOA 3HM5A 3DLLF 3KYCB 3PIPF 1IXRC 4DBQA 3KIOA 4GYIA 3PO2J 1YX5A 2EIKH 1G3WA 1YW9A 3M7GA 1DGWY 1LUJB 1VQ8I 1D0ZA 1GXPA 1IUYA 2JRTA 2CW8A 1ERDA 4IQJA 3Q9SA 2V1DA 3F9KA 1BI0A 1SANA 1BA5A 4FE4A 4KMUX 3MKWB 3IAS2 3LQRA 1YYVA 3LL7A 1OCPA 4JX4A 5LHHA 3FK7A 5FO5A 2WAQA 5E79C 4KITB 2VE9A 3AG3H 5M5WJ 3OR2C 3W6KB 1DP7P 2L0KA 4M9ZA 1IF1A 1J2XA 2BYVE 3R6SA 4HG2A 4AYBA 2P4WA 3WHCA 1XPXA 4UXNA 1KQ0A 3SJMA 2EINH 2HQRA 3QPLA 1OCZH 2LDUA 3FXUA 4BKXA 2JVHA 5LBQA 3CQZJ 1IJWC 4GGGA 2FA5A 1N6CA 1YS7A 1Y8QB 3SZTA 3DWLE 2JA7J 2ZNYA 1B59A 3BTJA 2NAZA 2VN2A 3CMEI 2DPDA 2O8XA 1HW2A 1UG2A 2EZIA 2MH9A 2V1UA 3BR1A 3Q9VA 2MYSA 1NG7A 2IJLA 5D4SA 4YNMA 1J75A 2GM4A 4LIVA 2LD5A 2HQ5A 4Y33A 4F55A 3VPRA 3EETA 3SEZA 3ZRGA 2CFXA 4P9UA 1VQ7I 1Y0NA 3GFMA 5F08A 3SEQA 1LB2A 2STTA 2LKSA 2VE8A 1O57A 2XGCA 3I9V2 4A2UA 5J6XA 1R5GA 1S8NA 4XNFA 3LA2A 3JREA 1R1UA 5F04A 2HVQA 3BTLA 3U21A 1XX5A 3H36A 3LSGA 2BV6A 1WH5A 5KAFC 2K9SA 3BPXA 4IHTA 2XF5A 3F9WA 2CQXA 4MO7A 2PMZA 1WI3A 1G6NA 3KZYA 2X85A 5J3LA 5CLSA 3TW6A 2EQRA 4OU0A 4A3MJ 2HDCA 3S1MJ 1FJLA 1W1WE 2M7AA 1S7AA 4A3FJ 2VASA 3G71I 3HOWJ 2EZKA 3HYIA 2IS6A 2M4GA 2UV1A 2DPUA 2R93J 4A12A 2RGVA 5ILSA 4DYQA 3HNAA 1VQPI 2P7CB 1EJ9A 4A3EJ 1Y1WJ 2ZKZA 2DAOA 2LKPA 2XGDA 1VQ4I 2IVMA 1QPMA 1W0UA 4RLQA 3I4NJ 3HIFA 4BEHA 4DOZA 2FMYA 5F5EA 1WJBA 5KCMA 2MLGA 2IS1A 1M1EB 4XN3A 2V4JC 3OYHA 5DM7F 4OOIA 4XN0A 4XORA 5ILVA 2DU9A 2R7WA 3PDNA 2K02A 1NHAA 3S8PA 2COBA 4XSZF 1A5JA 4Y13A 3TDZC 3K10A 2EK5A 2JJ7A 3OOUA 4HSRA 2RC4A 1S7OA 2HYJA 2FOKA 5K7FA 3KZIC 3E6DA 5BPDA 2HWVA 2XUBA 2O3FA 3IHUA 1JGSA 1VQLI 1YRNA 1U8BA 1FMVA 3HBLA 3GBGA 2FBHA 2O5RA 1FLIA 3ZMUA 3P9IA 1TT5B 2ME0A 4R1HA 3P9CA 3OOIA 4I99C 2K3PA 3SDBA 3M58A 2VONA 3EUHA 1U2WA 3FMQA 2D45A 1B4AA 1LVKA 1Z91A 1N3JA 2GXGA 4ZH4F 2VQLA 2ZMEA 3WGGA 2VJ5A 3DEUA 3ZP5A 3FBIB 4KUMA 1MDMA 3S2DJ 3QPSA 4RZ0A 1KU7A 3DKYA 2XIGA 1UG0A 1T56A 1F36A 3J81K 2YU9J 5EX0A 3C2GA 1H89C 1CGPA 3A0BC 3FKIJ 2FX0A 4JDSA 4BQAA 2DN0A 1RR8C 2DA4A 3OYIA 3O8GA 2KDZA 3KLOA 5J1YA 1N78A 1XCVA 4HNTA 2JT1A 3M57A 3JTHA 4B8XA 2R3SA 2O03A 3KEOA 5FB2A 1U3EM 4IHVA 2CYYA 3V42A 2A69F 4I02A 4A6DA 1A31A 2YR2A 3K4LA 1ORKA 4OAZA 4E70A 3HZJA 2E2HJ 1P7JA 4ABZA 1QBJA 4OIRF 4MTEA 5L3EA 4IRGA 1QZZA 2IW5A 1UZCA 3K4MA 5F6LA 3CJRB 4BE1A 3J81Z 4U0YA 1YQAA 5F1RA 2OAZA 1IDZA 1F4KA 1AA7A 2X1CA 3E3VA 2P0WA 5ICFA 5HLGA 3RIRA 1HF0A 1K83J 1RR7A 3MFKA 1T08B 1ZG3A 5LEKA 2UUZA 2H27A 3LA3A 4XLNF 1UHWA 4NHJA 4KA4A 1TWAJ 4ENNA 5JI6A 2Z3YA 4ZYAA 1BBYA 2H6CA 2L7KA 2TRTA 1YJWI 3FPDA 3DU5A 2FF4A 2VC0A 2JPCA 2IGKA 3ZR8X 2QF7A 4C1QA 2FJ1A 2QQAA 2MC3A 4AVZA 2RDPA 3JR9A 2Y0SA 1IV6A 4AIJA 3K70C 3G3ZA 4MI0A 1MBGA 1JXSA 3CCSI 1UMQA
chains in the Genus database with same CATH topology
2CMPA 2X6YA 4XKCA 3H35A 3AL0C 3S93A 2KZVA 4E7JA 4QPOA 4XLAA 2W5YA 2HPIA 3KMTA 4GRIA 2BQZA 4PJLA 5CCLA 1G8XA 5FRNA 4DIQA 2X1EA 4C9YA 4F52A 2CH0A 3VYUB 2KP6A 2F69A 3D5LA 3OR1C 3PFYA 3L2WA 4XQFA 5JIYA 4D1QA 1IRXA 3HXLA 4C2UA 2BW3A 4ZTJA 2KRCA 4CH7A 1QHHD 5LSXA 2W82A 4IQ4A 4IZZA 3DEEA 3I3LA 3VWBA 4PUSA 4MLOA 4I51A 1JI8A 3OIQA 2WY8Q 4XKVA 4PK4A 4Y3OA 4Y4RA 4J8OA 3BLYA 2L5QA 3OMYA 4YRVA 3DU6A 3MO5A 2LY2A 4NVQA 3K4CA 1UELB 2VB6A 2AQFA 1PEGA 2WAFA 3EPZA 4J00A 2XAUA 3PSIA 2UWMA 1KONA 2RREA 1O9SA 4QENA 5HNHA 3W2VA 3VSKA 1XQHA 2VL8A 1D1AA 4II3A 1N77A 1T95A 2HNHA 2HPMA 4YPEA 2A5WA 4PSWA 3EUHC 1WJAA 4B43A 3CJQB 2VQGA 3CP8A 1X19A 4P5OA 3TL4X 3F9ZA 5TGTA 1NG6A 1WJ5A 1U0JA 3AKZA 4E7KA 3CBMA 2VJIA 3OYCA 1D0XA 4LDGA 3QYFA 2M4KA 4CZCA 4BQQA 4B48A 3OS2A 3K4JA 2IGNA 4YNDA 2CUJA 1V5GA 4U87A 3ZXSA 3OYGA 4BS9A 3OIPA 1X1BA 3DPLC 2CV2A 2WB1A 2OV7A 3NWTA 3PNTA 2K9MA 3H9GA 4YPAA 3MKZA 2KPMA 1WJEA 3HPHA 4CUGA 3LFUA 4JLGA 3TG5A 3PJRA 2WY7Q 1X4PA 2Q2EB 4ANJA 1ML9A 3VDXA 2MC4A 4O30A 3PL8A 3H5NA 4N4OB 4XM3A 4E7IA 2DXIA 4CCMA 5T0MA 2R7QA 3BG7A 4QPQA 3PUBA 3SW9A 1EA3A 1DP3A 1N6AA 3CZ6A 5LSZA 2LOOA 3BG6A 3MMYB 1MW7A 3RSNA 4OWRB 4XLHA 5KJLA 4IJDA 2VJ4A 4BL0B 2E60A 3ZCOA 2M0MA 2L9SA 2DOAA 5JHFA 2JV0A 4BXFA 2W4SA 3D5RC 4LITA 1BR1A 1WFXA 5CCMA 3G2BA 4PJMA 3K70D 2KHMA 3HG9A 3L2QA 2KRHA 2Q1ZB 5HOOA 2DT6A 4E47A 1E0EA 4XKWA 4II2A 4KT6A 1TT0A 3S7BA 4IX7A 3RU0A 4ZJZA 3LSHA 4H4KC 3OL4A 5KHDA 4B47A 3OWTA 2QKMB 3E1SA 3DTEA 2V6EA 3QWWA 4N4NB 3QYBA 3QWPA 4KISA 3SZGA 2PJRB 1R6RA 1T0FC 1WJCA 2F5VA 4RM2A 3H5AA 4E7HA 2LBFB 2R7TA 1BR2A 5JHNA 4DGWB 2MABA 2AQEA 2NOJB 2CUZA 1K6YA 2R7SA 1YE9A 2FUG2 5T5GA 4CCLA 3RTRA 3LSMA 3OYDA 4Z4PA 1HA8A 2LY1A 3S32A 3ZQQA 2KL4A 3CBOA 4C2TA 2DT7B 1MMGA 4BE0A 2HU9A 2R7RA 1FMWA 2Z16A 4LG3A 5AYFA 3HKZA 4BDYA 2VKHA 3DB5A 3M55A 1S9HA 3AFHA 2E1MB 5ARFA 1WJDA 4J01A 2QPWA 1QHGA 4BACA 3VUZA 3HPGA 1MNEA 5HI7A 4RLFA 3PNYA 2DCEA 5HNFA 4ZDOA 3BCBA 2LYCA 2OC6A 3ZGKA 3EUAA 2ZSHB 3FHNA 4E4HA 2VQHA 3KX2A 4B44A 3DPTA 3BC8A 1MMAA 2KMUA 3DTKA 4J7IA 4NNJA 3LMMA 2F4IA 4BE2A 4CA0A 4XLEA 3TBIA 4IJ8A 3CMMA 2JVGA 3E0JB 3OPEA 3VYTB 4CCNA 3OS1A 5F59A 1ZKKA 3J7AY 3SYTA 4YNPA 2HQAA 1TZLA 4AU7A 1WJFA 1UAAA 3DKXA 1D0YA 3OYFA 4E6KG 4U7BA 2VJJA 3M1CA 3L2VA 4BUPA 2IGQA 4NUBA 4RM3A 1QU3A 3DALA 5KNLA 4MI5A 3TG4A 4G6TB 3K4KA 1X1AA 2R7VA 5EX3A 1SAUA 2I8DA 4J7FA 3NWSA 2L2OA 3M54A 4PJNA 2X6WA 1DQUA 2LREA 1X1DA 1PYVA 2JA2A 3N71A 4F93B 1W36D 4CCOA 3MKYB 3AL0B 3VSLA 2HVRA 4DBQA 3LSIA 1YX5A 3H9QA 1DGWY 2RQQA 3BCAA 1D0ZA 1ERDA 1MUFA 2VKDA 2CW8A 4IQJA 3OS0A 3S3OA 2ZSIB 5JJ0A 3F9KA 3MKWB 1Y6IA 3IAS2 5CQGA 3DQVC 2CW7A 3VV0A 3OYMA 4BEHB 2PJRA 2HZDA 3LL7A 4F3QA 1V5EA 2LBFA 2DJIA 2WAQA 4KITB 4P1WA 2XDVA 4BQNA 3CESA 3MD2A 3N05A 5LD2C 3OR2C 5ARGA 2MD0A 4ZC3A 4O6FA 2X6XA 1W36C 4HG2A 3VYRB 4XLFA 2Z1DA 4AYBA 2IS4A 2ELJA 2VXZA 3H0DA 4XR6A 4PFOA 2L9NA 2R4GA 4JQFA 2V7FA 2JVHA 3RAYA 4EATA 3H5RA 2VXDA 1N6CA 3IP4B 3DWLE 4XONA 2R3AA 4YELA 3HOSA 5TTFA 5FRMA 4OAYA 4CCJA 2IGMA 3QYEA 2MYSA 1NG7A 3ONQA 2XSJC 4DJAA 2IS2A 4YNMA 4FASD 4LIVA 2A6TA 4Y33A 4F55A 1BR4A 2XF7A 4CSWA 2WAEA 2O8JA 3SEZA 2V26A 3ZRGA 3S7JA 3S7FA 4BJ6C 4HNUA 3SEQA 2F6CA 1G59A 4YPUA 2KQRA 3RPUD 4ZTFA 3SWCA 1MVHA 3W2WA 3I9V2 1X4OA 3MO2A 3OYEA 4XNFA 2JSPA 2W5ZA 4IKFA 1LFPA 2R7OA 2HVQA 2QKLB 2ZFUA 3U21A 3FKJA 2R7XA 3DPUA 3LSGA 1ZELA 4C30A 3W2AA 1MT6A 2XF5A 3A2KA 2W00A 3FDYA 3F9WA 3KMAA 2PMZA 3L2UA 1MMNA 2X85A 4BJ5C 3PSFA 2IXSA 3S3NA 4XKBA 2R7UA 1GLNA 3OYKA 2M7AA 1SFKA 2IS6A 2VASA 2LC2A 5TEGA 2WADA 2M4GA 2UV1A 2LRDA 3F9YA 1DGRM 4FETA 4B3XA 3KYLA 3HNAA 1BOBA 1VZ0A 1X1CA 3D5SC 1H3IA 3K4NA 2G46A 4H12A 2ZXIA 4HEA2 3UR3C 2VQCA 3TMOA 4RLQA 2CFOA 3CP2A 4KJZA 4BEHA 4DBRA 3OY9A 5HQ8A 4DOZA 5CPRB 5F5EA 1WJBA 5KCMA 1J09A 3IHXA 2IS1A 2X51A 4RMNA 1D1CA 4NQWB 3M53A 4XN3A 2V4JC 1MNDA 3A4CA 3IAM2 3OYHA 3F9XA 4XN0A 1MMDA 4XORA 4NC8A 2R7WA 3PDNA 3S8PA 2ZXHA 1Z3YA 4HSTA 3OYLA 4LIUA 4PSXA 5KJKA 3K10A 3LSKA 4PJJA 3BO5A 5TH7A 3OOUA 3M59A 3MEKA 4HSRA 2BOLA 2LH9A 4ZDLA 5KJNA 4E7ZA 3IUOA 1YX3A 1MVXA 3S3MA 2MFZA 2IGOA 5CKTA 1FMVA 3GBGA 2O5RA 3VYSB 4HPQA 5LFAA 3OOIA 4XMYA 4BQOA 3OXFA 5EG2A 2K3PA 3M8JA 4F91B 3SDBA 3KMJA 3M58A 2BVMA 4X0GA 3FBNB 1Z21A 1N75A 1Y56A 1OLTA 1PJRA 1LVKA 1Z3XA 1N3JA 2V9KA 2VQLA 2VJ5A 2W7NA 2M7BA 2BVLA 3FBIB 4YEJA 4RZ0A 3OYNA 3RIBA 2M3AA 2CS3A 3DKYA 3HOTA 1D1BA 1UG0A 2BW3B 3QODA 5EX0A 2E5NA 4NJ5A 3C2GA 2V1NA 4XLCA 4JDSA 4BGDA 1OR7C 3M56A 1V5FA 3OYIA 3OXGA 3OL3A 2W1OA 1N78A 3W3CA 3PNVA 4HNTA 2JUGA 4HRIA 3M57A 3RQ4A 3V42A 3KEYA 4OAZA 3K4LA 4PFPA 2E1MC 4BDZA 2HVSA 3C2HA 3CBPA 3S7DA 5CQEA 3MO0A 5HVQC 3HUGB 3CF2A 3QWVA 3K4MA 3EP0A 4XL9A 5F6LA 2OUMA 3CJRB 3OYAA 3HC7A 4R79A 3DTIA 4BE1A 2RFIA 5T0KA 3RJWA 1LDKB 3QOEA 5JINA 2VPLA 3K6GA 2RNGA 2KDOA 2X1DA 5F6KC 1AA7A 2X1CA 2KLOA 2P0WA 4D9JA 4WUYA 2VLAA 2CV0A 1Z7LA 3DLAA 5FROA 5HLTA 4E7SA 4E7LA 4NC7A 2XF6A 2XC7A 2UUZA 3UNGC 4QEOA 3K5KA 2GOMA 2K9LA 4ZDPA 3H9JA 4ITVA 4BJTA 2WBMA 4ZYAA 4BU2A 2Z2SB 5KJMA 2K5CA 3OYBA 2L7KA 3K4BA 4F92B 2WA0A 3RCOA 3FPDA 4XOTA 4FMUA 3DU5A 3M5AA 3EUKL 3A1YA 3L2RA 2IGKA 3ZR8X 4C1QA 2E5ZA 4AVZA 3OS5A 3OXLA 1LKXA 2CV1A 4CCKA 4J83A 2Y0SA 2LG4A 3HL2A 1P9QC 2HDWA 2VIXA 3K70C 4MI0A 4JOMA 3OYJA 4QEPA 2GOXB 4XOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VV0 A;  3M59 A;  3MEK A;  4E47 A;  5KJN A;  5TH7 A;  3S7B A;  1MVX A;  3RU0 A;  2W5Y A;  5ARG A;  3KMT A;  5CCL A;  2BQZ A;  4O6F A;  3QWW A;  3QWP A;  2F69 A;  3OOI A;  3OXF A;  5JIY A;  5EG2 A;  3KMJ A;  3M58 A;  5JHN A;  3RAY A;  1N3J A;  5LSX A;  1N6C A;  5T5G A;  4I51 A;  2R3A A;  4Z4P A;  4RZ0 A;  4J8O A;  3RIB A;  5TTF A;  3CBO A;  3MO5 A;  5AYF A;  4NVQ A;  5EX0 A;  4NJ5 A;  3DB5 A;  3M55 A;  1PEG A;  4YNM A;  4JDS A;  2O8J A;  1O9S A;  4QEN A;  3M56 A;  3S7J A;  5ARF A;  3S7F A;  1XQH A;  2QPW A;  3OXG A;  3VUZ A;  4YPU A;  5HI7 A;  3SWC A;  1MVH A;  4YPE A;  3M57 A;  3MO2 A;  2W5Z A;  3RQ4 A;  3F9Z A;  3CBM A;  3CBP A;  4J7I A;  3S7D A;  4LDG A;  3MO0 A;  3QWV A;  1MT6 A;  3EP0 A;  4YND A;  5F6L A;  4IJ8 A;  3OPE A;  2RFI A;  3RJW A;  5T0K A;  3F9W A;  3KMA A;  5F59 A;  5JIN A;  1ZKK A;  5F6K C;  4YNP A;  4YPA A;  4WUY A;  4AU7 A;  4JLG A;  3TG5 A;  4QEO A;  3K5K A;  5TEG A;  2IGQ A;  3DAL A;  4BUP A;  3TG4 A;  4MI5 A;  3F9Y A;  1ML9 A;  3HNA A;  4O30 A;  1H3I A;  5EX3 A;  2G46 A;  4H12 A;  4J7F A;  5T0M A;  5KJM A;  3SW9 A;  3M54 A;  1N6A A;  5LSZ A;  5HQ8 A;  3FPD A;  4FMU A;  3N71 A;  5CPR B;  3M5A A;  5F5E A;  5KJL A;  3IHX A;  4IJD A;  3M53 A;  4C1Q A;  2JV0 A;  3OS5 A;  3OXL A;  4J83 A;  3F9X A;  1MUF A;  3PDN A;  3S8P A;  5JJ0 A;  5CCM A;  4MI0 A;  4QEP A;  5KJK A;  3BO5 A; 
#chains in the Genus database with same CATH topology
 1FSE A;  4MGR A;  3RYR A;  2CMP A;  2X6Y A;  2LKX A;  2EV6 A;  3KEQ A;  2KZV A;  3U9G A;  4OMY A;  4QPO A;  3FXL A;  3WU0 A;  3QP5 A;  3GLL A;  2A6E F;  2EFP A;  4GRI A;  1ZAO A;  2EFO A;  5JHU A;  1FOW A;  4BY1 J;  1F43 A;  1J5Y A;  2X1E A;  2YUS A;  4R8H A;  1ZR2 A;  3RPU A;  2ID6 A;  3L00 A;  1GUU A;  3V7R A;  2X9D A;  2M2E A;  3IRQ A;  1ULY A;  2IBD A;  5LSX A;  4IQ4 A;  5H6R A;  1L0O C;  3I3L A;  3LOC A;  2KIS A;  2ZJ2 A;  2CGP A;  1JI8 A;  1MSF C;  4XKV A;  1B6A A;  4Y3O A;  4Y4R A;  5FD5 A;  5BNG A;  3OMY A;  3HB9 A;  4XK4 A;  2OJE D;  3DU6 A;  4L9T A;  1MH3 A;  3K2A A;  5J4Y A;  3H3V K;  1S7E A;  1YJN I;  3CMA I;  2XAS A;  3PSI A;  3DCF A;  2RRE A;  5JFR A;  3VSK A;  5EGO A;  1D1A A;  2F5F A;  4UUS A;  1LE8 B;  1QA6 A;  2Y69 H;  4N0B A;  2ZJR F;  4PSW A;  1OQY A;  4HV5 A;  5HDK A;  2M8G X;  3KP6 A;  1T98 A;  5F0C A;  4B43 A;  2OTL I;  2VQG A;  4U88 A;  3TL4 X;  1X19 A;  5L3F A;  3BR5 A;  3JRB A;  2X48 A;  1U0J A;  3HEF A;  3VOD A;  3CBM A;  5FFZ A;  5FLM J;  5J8C A;  2VJI A;  2LVS A;  3TW7 A;  4BQQ A;  3D1N I;  2W48 A;  2ICW G;  4F7Z A;  1W7P A;  2P5K A;  3G1M A;  2VBZ A;  1ZGA A;  4IOA F;  2VI6 A;  2OV7 A;  4MFE A;  1H8A C;  1SD5 A;  2XV4 S;  2DA5 A;  3HPH A;  4JLG A;  1YW8 A;  1U5T B;  4CXF A;  1K78 A;  2ZJQ F;  1EKE A;  1K4S A;  5F64 A;  2CWE A;  2HOA A;  2M34 A;  2MC4 A;  2B63 J;  2VBX A;  5CVR A;  3PL8 A;  2QLZ A;  5DEQ A;  1IDY A;  3QPT A;  2GIV A;  2GWR A;  2VOP A;  1XCB A;  2E7X A;  3BZ6 A;  3IH4 A;  4IPA A;  5BOX A;  4BL0 B;  5HLI A;  1I5Z A;  3COA C;  3N97 A;  2HGC A;  1RI7 A;  2OF7 A;  5JHF A;  2JV0 A;  3D5R C;  2DMU A;  2E35 A;  3VEP A;  2NS0 A;  1IRZ A;  2QVO A;  1WFX A;  3SZP A;  3ZQI A;  4B09 A;  4XID A;  2D5V A;  2PMU A;  5E18 F;  3K70 D;  2HS5 A;  2KRH A;  4UNO A;  3RPQ A;  3BY6 A;  2DOF A;  1MBF A;  4JP0 A;  4II2 A;  1XGN A;  4CDG A;  3A01 A;  2DFE A;  2R5Z A;  1T8I A;  2NVQ J;  2CJJ A;  4IX7 A;  1DUX C;  2H94 A;  4ZJZ A;  1GVD A;  3OWT A;  3DTE A;  3QWW A;  4EM1 A;  3HGG A;  1E3O C;  1ZGW A;  2QBY A;  4XSX F;  3SZG A;  5FD6 A;  2PJR B;  1R6R A;  1IN8 A;  3S16 J;  3CDL A;  3H5A A;  1YIT I;  2LBF B;  2R7T A;  5JHN A;  2AQE A;  5FKL A;  1JTY A;  2FUG 2;  4CCL A;  2JA8 J;  3RTR A;  1LPQ A;  5D8K B;  5AIQ A;  1HA8 A;  4RGS A;  5HS9 A;  3ZQH A;  2KL4 A;  2EB7 A;  2HU9 A;  1QNT A;  2Z16 A;  1QQI A;  2L4M A;  2ZBK A;  3R60 A;  3HKZ A;  3RJP A;  1S9H A;  2F5C A;  5E1W A;  3FXO A;  5F0F A;  3LAJ A;  2DW4 A;  2NOG A;  2XHK A;  1WJD A;  1Z6R A;  4J01 A;  3CD6 I;  3CUQ C;  5EEH A;  3C18 A;  3QOP A;  5C44 J;  2M5W A;  4ZDO A;  1EH8 A;  3BCB A;  1JUM A;  2LYC A;  4M9S A;  1KGS A;  4L9V A;  2W57 A;  4H0E A;  2DA1 A;  2B9S A;  1XSD A;  3MQ0 A;  3BC8 A;  4NNJ A;  2F2E A;  1Z05 A;  3LMM A;  5H20 A;  2ZXW H;  3S2H J;  2RVC A;  1PP7 U;  2DO7 A;  3TBI A;  2ADU A;  3E0J B;  1O7F A;  1TWG J;  5M5X J;  4DNC A;  2H8W A;  3NAR A;  3QQA A;  3F8F A;  1ODD A;  2XGX A;  1G3T A;  2MGQ A;  4AU7 A;  1UAA A;  3DKX A;  4PZJ A;  4E6K G;  3M1C A;  2IGQ A;  3TED A;  1YO5 C;  2L9R A;  3QPH A;  1X1A A;  2PFB A;  3BPV A;  3U2R A;  4UUT A;  3QP6 A;  1IV8 A;  5EX3 A;  4J7F A;  5LGU A;  3ISP A;  1H9T A;  3P7N A;  1WZ2 A;  1MGT A;  4RGR A;  3BOQ A;  2OPT A;  3N71 A;  4F93 B;  1W36 D;  2VKE A;  3MKY B;  1ENH A;  4UVC A;  4IVN A;  3V4G A;  1ITY A;  1TWH J;  2VKD A;  1FY7 A;  3E6B A;  1SFE A;  3KP3 A;  3I58 A;  1XSX A;  5FKK A;  1Y6I A;  4I0B A;  5CQG A;  3DQV C;  1JGG A;  1ETW A;  3F8M A;  1PDN C;  3OYM A;  5JLW A;  3WTT C;  5C4J J;  2HTJ A;  3BG9 A;  3HRS A;  2HR3 A;  2L01 A;  4EM0 B;  1B9M A;  3N05 A;  5ARG A;  2MD0 A;  5CVI A;  4ZC3 A;  1H88 C;  1RKW A;  1TP4 A;  5M3F J;  5DD4 A;  1OR7 A;  2AHQ A;  3S1N J;  2IS4 A;  2ELJ A;  4DQ2 A;  1TC3 C;  1T2K A;  3H0D A;  2P5L C;  4M6X A;  4PFO A;  2FML A;  2Y31 A;  1GV5 A;  1KQ9 A;  4JQF A;  5J47 A;  3ABU A;  1DU0 A;  3RAY A;  5L3B A;  3SXY A;  4EAT A;  3H5R A;  5ILU A;  4XRM A;  2E2I J;  3PQJ A;  4XON A;  3BDD A;  3QWL A;  2M1B A;  2XB5 A;  4IF4 A;  3KFW X;  5GPC A;  4AVP A;  1V3F A;  4FAS D;  2NVX J;  4M3F A;  1BR4 A;  2XF7 A;  3S1R J;  2P81 A;  4KIC A;  2QEN A;  3FIS A;  4G7Z F;  2F6C A;  3KCC A;  1G59 A;  2KQR A;  5E17 F;  1BM9 A;  4KN4 X;  1FNN A;  2PQ8 A;  3W2W A;  1MVH A;  2DK5 A;  4V2F A;  4A0Y A;  1S3J A;  1LFP A;  1OCR H;  2JA5 J;  4IKF A;  2XAG A;  3E5X A;  4D7M A;  2ZFW A;  2ZFU A;  3FKJ A;  2R7X A;  4JBA A;  2P5V A;  1LEB A;  1PUE E;  1ZEL A;  4IHS A;  1OCC H;  5FJ8 J;  3E7L A;  2E1O A;  3ERM A;  5HLH A;  1R1V A;  2E71 A;  3RZO J;  1I1G A;  3ZPL A;  3A0H C;  1GVJ A;  1QO0 D;  3KMA A;  3L2U A;  1MMN A;  2R5Y A;  4M9X A;  2IXS A;  3JRC A;  2JQ7 A;  3S3N A;  4XKB A;  4V19 K;  4NC6 A;  3K9T A;  1I3Q J;  1R1T A;  1SFK A;  4WX9 A;  3X2Q H;  3CO6 C;  4ZYH A;  4KYW A;  4OIP F;  1HBX G;  1GHC A;  2BHY A;  3HOV J;  4RB2 C;  4ENM A;  3KYL A;  3CDI A;  1XMA A;  4H12 A;  1KYZ A;  5IPA A;  4EJO A;  3CLO A;  2NNY A;  2Z33 A;  4DYR A;  3JRG A;  1ON1 A;  3CC7 I;  2A3S A;  1U5T C;  3CUQ A;  3Q0V A;  3IHX A;  1J09 A;  2OQR A;  4HNV A;  1RPW A;  2X51 A;  4A3J J;  1T38 A;  2HEO A;  3IAM 2;  1BJA A;  2O9L A;  2LLK A;  1MMD A;  2NVU B;  4Y52 J;  2IP2 A;  5FLX K;  2ZXH A;  2OA4 A;  4LIU A;  3OYL A;  3BQZ A;  1AU7 A;  5TH7 A;  4I0A A;  4Q4Z F;  4LMY A;  2OD5 A;  4L18 B;  2BOL A;  4QLC U;  5KJN A;  3S17 J;  4EEF G;  3IUO A;  3BTC A;  1YX3 A;  1JE8 A;  2XPU A;  3S3M A;  3JAM K;  2FBK A;  4QSH A;  2COM A;  1XMK A;  5HS7 A;  2EJR A;  3V7S A;  1KU2 A;  2GAU A;  4W1U A;  3T8T A;  3VYS B;  3L7W A;  1O7L A;  1POG A;  1TWF J;  4XBF A;  3CO7 C;  4HPQ A;  3OXF A;  4BQO A;  4L0Y B;  2YPR A;  2HFH A;  3TOB A;  3F0C A;  2BVM A;  4EJV A;  3FBN B;  3PQK A;  1Y56 A;  3REO A;  2EIJ H;  1MZB A;  5FLX Z;  2V9K A;  2DI3 A;  1FBQ A;  5IYD J;  3KYD B;  2RAE A;  2R7D A;  2FNA A;  2GQQ A;  3CCU I;  3O8H A;  4CYC A;  2FU4 A;  5KK1 A;  5K5R A;  1WQ2 A;  5ERI A;  4B1R A;  2FRH A;  3QU3 A;  2KRF A;  1X1P A;  1BOA A;  3ZN0 A;  4D5C A;  2STW A;  3JAM Z;  4AYB N;  4WK8 F;  1X3W B;  2IA1 A;  3WHB A;  2E7W A;  4BGD A;  2MLK A;  4IHX A;  3GWZ A;  3OL3 A;  4KIB A;  4L0Z B;  3PNV A;  4HRI A;  3RQ4 A;  2V6C A;  4G94 A;  2KT0 A;  3H3Z A;  3BP8 A;  5CYV A;  3MN2 A;  4LD5 A;  4HLY A;  2IPQ X;  1TBX A;  4D0P A;  3CBP A;  3CCE I;  4CZZ A;  2K85 A;  3MO0 A;  5HVQ C;  4EVI A;  3ZMZ A;  1R49 A;  4XL9 A;  3OYA A;  3HC7 A;  4R79 A;  2RFI A;  3RJW A;  5IT3 A;  1Z6T A;  3H0G J;  5JIN A;  1Z77 A;  2M8E A;  3K6G A;  3O6B B;  1EH7 A;  3E97 A;  3FMS A;  4D9J A;  4WUY A;  3ABL H;  3CCR I;  5HLT A;  2FD5 A;  4HYE A;  1BI3 A;  1A6Q A;  1FTT A;  1IZ1 A;  1A04 A;  4I01 A;  4NC7 A;  5K1Y A;  1LDJ A;  4AWX B;  3K5K A;  2GOM A;  2V9V A;  3LWF A;  3GVA A;  1GV2 A;  4NQW A;  4ZDP A;  3GTJ J;  4ITV A;  4RBO A;  1I1S A;  2WBM A;  5KJM A;  3OYB A;  1ETO A;  3F72 A;  5D5V B;  3K4B A;  1FWZ A;  3CTA A;  4F92 B;  2E1C A;  3CCJ I;  1XDU A;  3G6E I;  2DMQ A;  2PMZ N;  3FXR A;  2OBP A;  2JWT A;  2F5D A;  2F5E A;  4FX0 A;  2E5Z A;  3OS5 A;  1LKX A;  4J83 A;  4CCK A;  2D2W A;  1OYY A;  3MEX A;  2LG4 A;  1W5C C;  3WTY C;  5B3S H;  4LG0 A;  2HDW A;  4QEP A;  1BN5 A;  5LEJ A;  3I55 I;  3TKY A;  4XOP A;  4UUV A;  3K7A J;  1QRY A;  3H35 A;  3IKT A;  3JRF A;  3I59 B;  1HOM A;  4XLA A;  3LNQ A;  4A3B J;  3WTW C;  5CCL A;  2BQZ A;  2B7E A;  1YIO A;  2DLL A;  3GO5 A;  4C9Y A;  4F52 A;  2CH0 A;  2F69 A;  3PFY A;  3HOY J;  3B02 A;  1QZY A;  2BW3 A;  4ZTJ A;  5LRR A;  1QVU A;  1D5Y A;  4XLP F;  1QHH D;  3TDU C;  5DDG A;  1FBS A;  3DXJ F;  4BAY A;  2P8T A;  4ON0 A;  2W82 A;  1LDD A;  1FYM A;  2H09 A;  4PUS A;  1G4D A;  3OIQ A;  2BHZ A;  2WY8 Q;  1FIP A;  1FOX A;  3BLY A;  2LFB A;  1ETQ A;  3H92 A;  5E1Z B;  1ZGJ A;  5K7Z A;  3MO5 A;  2NS7 A;  3WG7 H;  2KJC A;  3AG1 H;  2LY2 A;  5FGM A;  2FEZ A;  3K4C A;  1ETK A;  1UEL B;  2VB6 A;  4W97 A;  3EPZ A;  1YLF A;  2HKO A;  2J5O A;  1O9S A;  2X0L A;  5HNH A;  4HDV A;  5H2F C;  5DCF A;  3HUG A;  1OYI A;  1T95 A;  2DQL A;  2HNH A;  2HPM A;  3G1L A;  5D6E A;  3LQQ A;  2XSD C;  5IOY A;  3CJQ B;  1JT6 A;  5FKN A;  3M1E A;  2N8G A;  4RDU A;  3OYC A;  3Q5F A;  2O8K A;  1PUF B;  2M4K A;  4RB3 C;  3MWM A;  4YND A;  2CUJ A;  3OSF A;  1IN4 A;  1MBK A;  2DMP A;  2OCE A;  2EFW A;  1SVM A;  1X1B A;  1Z0X A;  2XRN A;  3NWT A;  5J40 A;  3RKQ A;  2H1K A;  3GZN B;  3VOE A;  4YPA A;  2ESH A;  1CF7 A;  4C3I J;  3JSP A;  4N9I A;  3ZQ7 A;  3EYI A;  1RET A;  2WY7 Q;  3V8K A;  3HSR A;  1H0M A;  1X4P A;  6PAX A;  1R5H A;  3MZ8 A;  1E3H A;  5FKM A;  2CO5 A;  2EZL A;  3H5N A;  4XM3 A;  1J59 A;  5T0M A;  2JZY A;  4QPQ A;  3ZMV A;  3SW9 A;  3S15 J;  2EFN A;  3CZ6 A;  2XAQ A;  4JX5 A;  4UB6 C;  3MMY B;  1MW7 A;  3RSN A;  2KIQ A;  4IJD A;  2VJ4 A;  1WWX A;  5GAG J;  1DU6 A;  3F22 A;  3K69 A;  3ZCO A;  2M0M A;  2L9S A;  2DOA A;  2CUF A;  2W4S A;  3GTG J;  3C3W A;  1XS9 A;  4A3G J;  1U9O A;  1A35 A;  2OCC H;  2RQP A;  3BR0 A;  1IG7 A;  5CCM A;  5AIP A;  2DDB A;  4P96 A;  1IXS B;  3EDP A;  2Q1Z B;  2OTJ I;  1R22 A;  4BBS J;  4GFB A;  4Q47 A;  3S7B A;  3HOX J;  3L2C A;  2UXN A;  4JYK A;  4OIQ F;  2LTP A;  3OL4 A;  2QSG X;  4Z2Y A;  3E1S A;  3D0S A;  3QU6 A;  5EF6 A;  3TGN A;  4FX4 A;  4N4N B;  1J0R A;  3G1O A;  2Z9O A;  2JSC A;  4KIS A;  2L9V A;  1T0F C;  2Y0S N;  2F5V A;  2PN6 A;  4KT5 C;  3R4K A;  5F1J A;  4QTR A;  4S04 A;  5ICG A;  3GME A;  4ZYE A;  4UVB A;  1FZP B;  3K2Z A;  1K6Y A;  5T5G A;  2XVC A;  3OYD A;  1HSJ A;  1OYW A;  2Y75 A;  5ICE A;  3CMY A;  4C2M J;  2K3F A;  1PVE A;  2EH3 A;  3ZQQ A;  3CCQ I;  1KYW A;  3DF8 A;  4EGZ A;  1GXQ A;  1ZH5 A;  4YFN F;  3A03 A;  2QSH X;  1UJ8 A;  2FE3 A;  3J7Y J;  2Y9Z A;  4L9N A;  3M55 A;  3IL2 A;  1OIS A;  4RB1 A;  1MBJ A;  2ISZ A;  2QPW A;  4A6E A;  4LK0 F;  2GZW A;  5B5E C;  1MNE A;  4UV8 A;  2P6T A;  3ABT A;  5HI7 A;  4RLF A;  2LF7 A;  3CCL I;  1XGO A;  3ZGK A;  2ZSH B;  3R61 A;  3BTI A;  2M0C A;  1L3L A;  3K1M A;  2MD5 A;  5JVT A;  3HGY A;  3AG4 H;  2JN6 A;  2Y9Y A;  2DOE A;  3TOA A;  3CCY A;  5LRS A;  5EDN A;  5DCM A;  2KMU A;  4J7I A;  1SD7 A;  1FX7 A;  5E3M A;  1MMS A;  5EG0 A;  2Q2E A;  1IXC A;  2XAH A;  2I10 A;  3VYT B;  1N25 A;  4CCN A;  1P7I A;  4PJ0 C;  1FPQ A;  3S1Q J;  4DZP A;  4N9H A;  4O3M A;  3H3U A;  1IW7 F;  3K0L A;  3E6C C;  2IRF G;  5D8L B;  2R7F A;  2EV0 A;  1YJ9 I;  2OU2 A;  4RS8 A;  4B4C A;  2NVY J;  5L3G A;  1KA8 A;  4NUB A;  5DUI A;  3V8J A;  1QU3 A;  1H9G A;  5KNL A;  3DAL A;  4CO8 A;  4G6T B;  1R23 A;  4EJU A;  1CQT A;  1SAU A;  3NAU A;  3I71 A;  4U0V A;  4MIM A;  3TP0 A;  2L2O A;  4ESF A;  1BC8 C;  3M54 A;  4LG0 B;  2X6W A;  2K9Q A;  1DQU A;  2HQN A;  2YSR A;  1PYV A;  2V1X A;  3BZK A;  4AD9 A;  5LLQ A;  3AAF A;  3VSL A;  2HVR A;  2XB0 X;  2IT0 A;  2CU7 A;  1X2M A;  1D5V A;  4KDP A;  1MUF A;  2X6O A;  2YS9 A;  2H1L A;  2PMH A;  2BY3 A;  2Z5U A;  3S3O A;  2ZSI B;  5JJ0 A;  1ZLK A;  1EH6 A;  3ML6 A;  2BXZ A;  3LSP A;  3WGI A;  2CW7 A;  1B72 A;  4BEH B;  4DW6 A;  5DM6 F;  2HZD A;  1SD4 A;  1W5S A;  1V5E A;  3IC7 A;  2DJI A;  4P1W A;  5CJ9 A;  1E2X A;  4BQN A;  5B66 C;  3LAP A;  3ZQF A;  1SMT A;  1VND A;  2ETH A;  2X6X A;  1W36 C;  1U6G A;  5IP9 J;  3LSR A;  3VYR B;  4XLF A;  5E1X A;  3JCU C;  4ZYG A;  4S0H B;  2G7U A;  2KZG A;  4XR6 A;  3RI4 A;  1SMY F;  2V7F A;  1SEU A;  2QCO A;  4L5E A;  1ETX A;  1MBE A;  2DMT A;  1YRN B;  2VXD A;  1AKH A;  3BJO A;  4HZF A;  3CCV I;  1YW7 A;  2DA7 A;  3BG5 A;  5E3N A;  2PBI A;  3HOS A;  4M3B A;  2CG4 A;  1E17 A;  5TTF A;  1HXD A;  5DUK A;  3FMR A;  4OAY A;  4EM2 A;  1RUO A;  1YHQ I;  3QYE A;  3FIW A;  1LVA A;  3ONQ A;  2HOE A;  4DJA A;  3RQI A;  2A6T A;  2DT5 A;  2ZME B;  4CSW A;  2PX9 A;  5IP6 A;  3CCM I;  1MDM B;  2V26 A;  3S7J A;  3S7F A;  4C3H J;  2OQG A;  3FM3 A;  2D1V A;  3SWC A;  1MJ9 A;  3M9A A;  2NYX A;  1R7J A;  1X4O A;  3RDI A;  1HW1 A;  3OYE A;  2JSP A;  2W5Z A;  2L7F P;  2R7O A;  2RV8 A;  3MAJ A;  4G8X A;  2ME6 A;  4A3L J;  2QKL B;  5B1A H;  3DPU A;  4KFC A;  3HKZ N;  2TDX A;  3BR6 A;  1P4X A;  4PCQ A;  2W24 A;  3GUD A;  3J7A O;  1ZTR A;  1MIJ A;  4C30 A;  4B3A A;  3SQN A;  3W2A A;  1D8J A;  2XAF A;  4JK1 X;  1P92 A;  4L9J A;  1TQI A;  5E3O A;  1XD7 A;  3PSF A;  1KZH A;  2D1H A;  1JTX A;  1TL8 A;  1GLN A;  1ZHF A;  3OYK A;  5IP7 J;  1G3S A;  2LC2 A;  4BNC A;  3MZH A;  3HOU J;  5TEG A;  2GLO A;  2WAD A;  2C6Y A;  1ZLJ A;  1DGR M;  3F9Y A;  4K2E A;  1BOB A;  3D5S C;  1VZ0 A;  1X1C A;  2IA2 A;  4RA2 A;  4Y15 A;  1H3I A;  3K4N A;  2G46 A;  4AID A;  4G12 A;  3T0Y A;  2KFD A;  3UR3 C;  3WU1 B;  3TMO A;  1FYL A;  1I50 J;  2GA1 A;  3CP2 A;  4KJZ A;  4WXH A;  1J7K A;  3GFJ A;  2VBY A;  2HOS A;  1HQC A;  1ZRD A;  3M53 A;  4RMN A;  2EIM H;  1P4W A;  4LOC A;  3ASN H;  1MND A;  2TCT A;  3F9X A;  1STZ A;  4NC8 A;  5LGT A;  1Z3Y A;  4HST A;  3SFI A;  4UV9 A;  2XRL A;  2OZ6 A;  5KJK A;  4WXD A;  3LSK A;  4PJJ A;  3BO5 A;  3CC2 I;  1JUP A;  3MEK A;  4QIW N;  4ZDL A;  3M4O J;  3JRA A;  3F3X A;  4E7Z A;  1FP2 A;  3JRI A;  1GT0 C;  1MVX A;  1XB4 A;  3HTU A;  1VI0 A;  2HZT A;  5LHG A;  1K79 A;  5GP9 A;  4HLX A;  3MVP A;  4X1E A;  5IYB J;  2WB1 N;  5F27 A;  5LFA A;  4XMY A;  4F91 B;  2ZNZ A;  1Z7U A;  3BRO A;  2L7M P;  3M3Y J;  5D5U B;  4X0G A;  1JHH A;  1N75 A;  4WXC A;  1OLT A;  1XMX A;  2X4H A;  1HKS A;  3ECH A;  3I4M J;  2CQK A;  2W7N A;  2BVL A;  1XGS A;  4HOB A;  4P9F A;  3OYN A;  4ENJ A;  2M3A A;  2CS3 A;  1MJA A;  4A0Z A;  4HF2 A;  3HOT A;  1Q1V A;  1VQM I;  1D1B A;  4MQV A;  4XIC A;  4GXO A;  1ZRC A;  2E5N A;  2V1N A;  3C7J A;  2MH2 A;  2QZ8 A;  3DKW A;  1SFU A;  1T6S A;  4KN7 X;  3M56 A;  1V5F A;  3WU2 C;  2CQN A;  2O0Y A;  2QQ9 A;  2W1O A;  4GCV A;  2A07 F;  2RNJ A;  4BBR J;  2HTS A;  3DEW A;  5EG0 B;  2EPF A;  3KEY A;  1GDT A;  2HOT A;  4HW0 A;  1ZR4 A;  4PFP A;  4BDZ A;  2HVS A;  3C2H A;  2ESN A;  3S7D A;  5EGO B;  5CQE A;  3ABK H;  4UUS B;  2E34 A;  3GTQ J;  2LP0 A;  2LR8 A;  3EP0 A;  3HTS B;  1RC9 A;  1YFH A;  5T0K A;  1LDK B;  3QOE A;  1K61 A;  3KLN A;  2Y0M A;  4I09 A;  2VPL A;  2UXX A;  2A6H F;  2X1D A;  4BYY A;  2KLO A;  3B6A A;  3BJA A;  3WGH A;  5BMZ A;  2CV0 A;  2BY1 A;  4Z6Y A;  4KNY A;  3DLA A;  3BR2 A;  4UB8 C;  4FHT A;  4BHC A;  2XF6 A;  2XC7 A;  2VPR A;  3UNG C;  3FXK A;  4MHG A;  5FLV A;  1W7P B;  3BZC A;  3NRV A;  2XKO A;  5BPI A;  3DBR B;  3H9J A;  2KIF A;  3MKL A;  3KP7 A;  2Z2S B;  2P6S A;  1ZK8 A;  2K5C A;  3IRR A;  2NRA C;  4M6V A;  2WA0 A;  5F0H A;  4XOT A;  1JHF A;  2CRG A;  4HDU A;  4FMU A;  1SFX A;  3LFK A;  1K78 B;  2NVT J;  4HV6 A;  3Q0U A;  1TTY A;  1UFM A;  4M3G A;  2R7Z J;  2CV1 A;  2AO9 A;  4EJW A;  3HDD A;  2EIL H;  2HI3 A;  3HL2 A;  1JT0 A;  2VIX A;  4JOM A;  2GOX B;  1USS A;  5DYM A;  2Y2Z A;  5CVV A;  1JKR C;  1X3Z B;  4DYC A;  5LGN A;  1UCR A;  4XKC A;  4E7J A;  2F4M B;  3GZ6 A;  2W5Y A;  2ZB9 A;  4PJL A;  3EYY A;  1U9N A;  3GZ5 A;  5EEA A;  3JSO A;  4IOC F;  1BI2 A;  2JTV A;  1WI9 A;  4XQF A;  3L2W A;  4D1Q A;  1IRX A;  2M9H A;  1RKT A;  3HXL A;  3A01 B;  2R5Z B;  2DA2 A;  1VQO I;  2FQ4 A;  2B0L A;  4CH7 A;  1U78 A;  1BW6 A;  4ASN A;  2K27 A;  5D4R A;  4IZZ A;  3DEE A;  3VWB A;  2PG4 A;  4I51 A;  1MNM C;  4PK4 A;  2F48 A;  3TQN A;  1V54 H;  2QBY B;  3HRT A;  2BY2 A;  2O7O A;  3J80 K;  3Q0W A;  2E2J J;  1XC5 A;  5BS6 A;  1DPR A;  1VTN C;  2AQF A;  4EQQ A;  2G9W A;  1A6I A;  2WAF A;  4M71 A;  5IOZ A;  1T33 A;  1YS6 A;  2H8R A;  3AG2 H;  1KON A;  1PP8 F;  2UWM A;  4BHP A;  1K4T A;  3FWE A;  3W2V A;  1XQH A;  2VL8 A;  4II3 A;  1WHU A;  1N77 A;  1Y39 A;  2BE5 F;  5J1R A;  5M5Y J;  4YPE A;  3EUH C;  1WPK A;  1YG2 A;  3K1P A;  3I0T A;  3HRU A;  4M72 A;  3CP8 A;  3FM5 A;  5TJJ A;  2WAQ N;  5TGT A;  1WJ5 A;  2ZME C;  3DBH B;  1VFC A;  1ZRF A;  2EFQ A;  2L54 A;  1JKO C;  5DD8 A;  4CGZ A;  4EV0 A;  5K5O A;  2K86 A;  1D0X A;  2CW0 F;  4CZC A;  1LNW A;  2BY0 A;  3J80 Z;  1UST A;  4A5N A;  2YU3 A;  3K4J A;  4I76 A;  5DV5 A;  3T1B A;  3OS2 A;  3JRH A;  2ZC2 A;  4LGW A;  1R4M B;  2FSW A;  1YTY A;  1Z67 A;  2DFI A;  1WGX A;  4HQM A;  3ZXS A;  3OYG A;  2R0Q C;  2JUC A;  4BS9 A;  2CV2 A;  4CYD A;  2XPV A;  4L5I A;  3JRD A;  5M3M J;  3H9G A;  3B6C A;  2KPM A;  1JUS A;  3M8F A;  1AHD P;  1ON2 A;  1UB9 A;  1WJE A;  3T5X A;  2V79 A;  4RAF A;  2EZH A;  3PJR A;  3BR3 A;  2I5U A;  9ANT A;  4BY7 J;  5ICC A;  4ANJ A;  1VQ9 I;  1DPU A;  3VDX A;  4O30 A;  3PO3 J;  2W84 A;  3FK6 A;  3ZN1 A;  2LSO A;  5D6F A;  4E7I A;  2DXI A;  3R0A A;  2R7Q A;  3BG7 A;  4M6Y A;  3PUB A;  4A3C J;  1N6A A;  3GTM J;  2VC1 A;  2LOO A;  4NBQ A;  4OWR B;  4AUX A;  4A69 C;  1E3P A;  3WOD F;  5LHI A;  4BXU A;  2E60 A;  1BW5 A;  2R92 J;  4LB6 B;  3G2B A;  1QPI A;  4PJM A;  3SHF A;  3F6O A;  2KHM A;  3WE3 A;  1UHM A;  4E47 A;  5HOO A;  1E0E A;  1ZG1 A;  3TO6 A;  4XKW A;  1SVO A;  2EA2 A;  4KT6 A;  4LB5 A;  3KP4 A;  1B9N A;  3LSH A;  4H4K C;  2O6G E;  3V7C A;  2QQ8 A;  4B47 A;  3PFI A;  5D5W B;  1XDS A;  2QKM B;  1BC7 C;  2EBI A;  1FEX A;  3GXO A;  1UHS A;  4G6Q A;  2PEX A;  2XKP A;  3QWP A;  2LF8 A;  4IRI A;  1T39 A;  2M45 A;  4RM2 A;  4IHW A;  2ID3 A;  2HXI A;  4YIR X;  2YX7 A;  4CIC A;  3VB2 A;  4ESJ A;  4DGW B;  2DQR A;  3BQY A;  1KU3 A;  2NOJ B;  3HJE A;  4V2G A;  4PGG A;  1YE9 A;  3RYP A;  4Z4P A;  1W4M A;  1LE8 A;  2LY1 A;  4NDL A;  3S32 A;  4X6A J;  3CBO A;  4C2T A;  2DT7 B;  4OIN F;  2R7R A;  3TO7 A;  4BDY A;  4IJA A;  3E5U A;  3DB5 A;  2K4B A;  3HSE A;  1R4N B;  1X3U A;  2HYG D;  3AFH A;  1TLH B;  2DBB A;  1ZYR F;  2E1M B;  4I2O A;  2BZT A;  3JTG A;  3KE2 A;  3ELK A;  5ARF A;  2DA6 A;  1QHG A;  1W5T A;  3GTP J;  5L3C A;  4IEJ A;  4HF0 A;  1R58 A;  4A3I J;  1TW3 A;  1HC8 A;  2BGC A;  2OC6 A;  3ESW B;  1FSH A;  2QSF X;  3FHN A;  3GF2 A;  1BIB A;  3KX2 A;  3DPT A;  3MZY A;  4FTH A;  1I39 A;  1MMA A;  3DTK A;  1O3S A;  1O3R A;  1Y0U A;  1KQ8 A;  3FXM A;  1U5T A;  5E8G A;  4XLE A;  4CA0 A;  3CMM A;  2HXO A;  3OPE A;  2W85 A;  1V4R A;  3OS1 A;  2VT3 A;  5C3E J;  1ZKK A;  2E1N A;  4C3J J;  2HQA A;  4YNP A;  1HDD C;  1KU9 A;  1WJF A;  1Y1V J;  3GYH X;  4U7B A;  2NS8 A;  3LSJ A;  3ZOB A;  2VJJ A;  4HBL A;  1ZN2 A;  1XG1 A;  4RM3 A;  4RGU A;  1HW5 A;  3K4K A;  2L4A A;  3ERE D;  1MSE C;  2R5Y B;  2Q8K A;  2I8D A;  4L5J A;  3PM1 A;  3NWS A;  2MA3 A;  5EZH A;  4RGX A;  4CHU A;  1B8I A;  4PDK A;  1WCM J;  4PJN A;  4EJT A;  2LRE A;  1IN5 A;  1X1D A;  3RKW A;  3F23 A;  1D8K A;  4A3K J;  3I53 A;  2ZXJ A;  3AL0 B;  3DFG A;  3M8E A;  1IRF A;  3CJT B;  3LSI A;  3C2B A;  5E8I A;  4MTD A;  2WV0 A;  3H9Q A;  2RQQ A;  3NEU A;  3BCA A;  1P6R A;  5IY5 H;  1IO2 A;  3KP2 A;  3OS0 A;  2XPW A;  1FP1 D;  3GEZ A;  3DP7 A;  2CQ7 A;  3VV0 A;  1MH4 A;  2PJR A;  1HST A;  1SVL A;  3CLQ A;  4M3D A;  3CUQ B;  4F3Q A;  1S29 A;  2A61 A;  1YI2 I;  3E5Q A;  2LBF A;  2QUF A;  2GXA A;  2XDV A;  2DYR H;  1Q1H A;  1B1B A;  3CES A;  3MD2 A;  5LD2 C;  3E6M A;  2FQ3 A;  4O6F A;  2Z1D A;  1XSV A;  1S72 I;  2DK8 A;  2VXZ A;  3BJ6 A;  2DTZ A;  3BG3 A;  2L9N A;  2R4G A;  3GFL A;  4XRF A;  1OKR A;  3GW2 A;  3DBL B;  2ECB A;  3ZMD A;  3IP4 B;  2R3A A;  1OMI A;  3FHZ A;  4YEL A;  2O61 A;  2A05 A;  3R0J A;  2ELH A;  2VKV A;  1EF4 A;  5EJC A;  1IN7 A;  5FRM A;  2EA4 A;  4CCJ A;  2IGM A;  1NK2 P;  4RAY A;  2ZCW A;  3O2P E;  1D3Y A;  2XSJ C;  4D7N A;  1YOV B;  2IS2 A;  2WTE A;  4MNU A;  5HOD A;  2O8J A;  1R36 A;  2IA0 A;  2WAE A;  3N4M A;  5JR3 A;  3SDG A;  4BJ6 C;  4HNU A;  4NB5 A;  3PIO F;  4CYC B;  4WWC A;  4YPU A;  3RPU D;  4ZTF A;  5GTI C;  4A3D J;  3IWF A;  1YIJ I;  3CC4 I;  3MO2 A;  1NH3 A;  3K1N A;  5DTD A;  5HS8 A;  2PI0 A;  2GA2 A;  5L3D A;  4HQE A;  3S14 J;  1J9I A;  5IYC J;  1JJ8 C;  3WTV C;  1A36 A;  1MT6 A;  3A2K A;  2W00 A;  3FDY A;  3P5J A;  5HDG A;  4M3E A;  1LFU P;  3F8C A;  3OIO A;  2CUE A;  3NQO A;  2LNB A;  1HCR A;  4BJ5 C;  2QQB A;  2G7H A;  4O6J A;  4U0W A;  2XRO A;  3WTS C;  1Z9C A;  1OJL A;  3LA7 A;  4A93 J;  2R7U A;  3G73 A;  1FTZ A;  3ULQ B;  3BT9 A;  3QRF F;  3FZV A;  1TW2 A;  2LRD A;  3L9F A;  4FET A;  1SAX A;  1R9T J;  1VQN I;  2CSO A;  4B3X A;  2QGU A;  1RNL A;  1IRG A;  3B73 A;  2FBI A;  2ZXI A;  3CDH A;  3FXQ A;  3HSF A;  1AOY A;  4HEA 2;  1QVT A;  1FOK A;  1MD0 A;  2VQC A;  2VUM J;  2CFO A;  4DBR A;  5HQ8 A;  3OY9 A;  3HHH A;  5CPR B;  1ZQ3 P;  3OOP A;  1D1C A;  4NQW B;  3A4C A;  5TIS C;  3T8R A;  1W7P D;  3RZD J;  4G6D A;  2KIM A;  1REP C;  4PSX A;  2BBY A;  2Y48 A;  2MG4 A;  5J8F A;  2NNN A;  4AM3 A;  1IAW A;  1R71 A;  2OZU A;  3P9K A;  2Y30 A;  3M59 A;  3L09 A;  2LH9 A;  2K40 A;  3C1D A;  4I6Z A;  1BJZ A;  4J19 A;  1AWC A;  3I4P A;  2MFZ A;  2IGO A;  5CKT A;  1O3T A;  2FXA A;  4Y17 A;  2G0E A;  4AC0 A;  1F9N A;  4I98 B;  1VQ5 I;  5IT9 K;  3FXJ A;  3FF5 A;  1FYK A;  4G7O F;  5EG2 A;  3M8J A;  4PGH A;  5A2Q K;  1JKQ C;  3KMJ A;  2MBF A;  4ENK A;  3M07 A;  1Z21 A;  5GAD J;  1PJR A;  2RKH A;  1Z3X A;  1JKP C;  4HAM A;  1VQ6 I;  1R5I D;  2DYS H;  3IV5 A;  4IHY A;  2M7B A;  2K9N A;  4YEJ A;  1ONV A;  3RIB A;  1SFO J;  3W6V A;  4D5F A;  4JX6 A;  2BW3 B;  2L02 A;  3Q3S A;  3QOD A;  4NJ5 A;  2M30 A;  4HA8 A;  4XLC A;  4YII A;  5IT9 Z;  4P55 A;  1OR7 C;  1OFC X;  2L7Z A;  3OXG A;  4KIF A;  4Q5S F;  1IGN A;  4MEX F;  2GBY A;  4BH9 A;  5A2Q Z;  1MBH A;  2ISY A;  2RN7 A;  3W3C A;  2JUG A;  4FCY A;  4A0X A;  1W0T A;  1TQM A;  1O3Q A;  4KIG A;  4A5M A;  5E3L A;  3S2W A;  2E1M C;  5DS9 A;  4IO9 F;  2JA6 J;  4WCG A;  4DZJ A;  3IH3 A;  3PUF A;  3HUG B;  3CF2 A;  3QWV A;  3RKY A;  1LQ1 A;  1G3Y A;  2OUM A;  1MKM A;  1QZE A;  3DTI A;  3LST A;  1WH7 A;  3F6V A;  1OPC A;  2KDO A;  2RNG A;  4OMZ A;  5F6K C;  2MSY A;  2VLA A;  1Z7L A;  5FRO A;  2AXT C;  4E7S A;  4E7L A;  3F8N A;  1B8I B;  4ZZL A;  2LMD A;  4QEO A;  2VBW A;  4XRS A;  3GTK J;  2K9L A;  2YX4 A;  3MCZ A;  5J4V A;  1FBU A;  4Q48 A;  4BJT A;  3RKX A;  3U1K A;  2M87 A;  4YFK F;  4BU2 A;  4GO1 A;  1CF7 B;  2Z99 A;  2E19 A;  3HHG A;  3RCO A;  1T0F A;  2FNP A;  1ETY A;  2NXN B;  3M5A A;  1P2F A;  1SD6 A;  1F1Z A;  3EUK L;  3A1Y A;  3L2R A;  2LK2 A;  4QWQ A;  4IXA A;  4BXX J;  4UY8 I;  2DJN A;  3OXL A;  3KZZ A;  4ZZD A;  4MFD A;  1I6H J;  1R00 A;  4LLL A;  1WKM A;  4IL6 C;  1P9Q C;  4LLG F;  3OYJ A;  2XAJ A;  4EGY A;  4HX7 A;  2HKX A;  5HDN A;  1U8R A;  2P7V B;  3KPH A;  3AL0 C;  3S93 A;  3ZQG A;  4LFU A;  2HPI A;  4YFX F;  1XGM A;  5EYR A;  1XN7 A;  3KMT A;  2DTR A;  1G8X A;  5FRN A;  4DIQ A;  4M73 A;  4MQ9 F;  4G7H F;  1HKQ A;  3VYU B;  2KP6 A;  3D5L A;  3OR1 C;  5CVU A;  5EZG A;  3U1D A;  5JIY A;  3WTX C;  2IEK A;  1LFB A;  3HRM A;  3IWZ A;  5B1B H;  1JJ6 C;  4C2U A;  2KRC A;  2K7L A;  1C0W A;  5J1U A;  5GTH C;  2WV1 A;  1DDN A;  4TV7 A;  3ROU A;  1S5L C;  4FT8 A;  3GFI A;  5K5Q A;  4MLO A;  2F4O B;  5AON A;  4J8O A;  4HF1 A;  1I6X A;  2QWW A;  2AXL A;  4G9Y A;  2L5Q A;  3I54 A;  4YRV A;  4RAG A;  4O5V A;  1TWC J;  1OCT C;  4AIH A;  2VOD A;  5E20 A;  1VF9 A;  4NVQ A;  1PEG A;  2ELK A;  4BHB A;  2WWY A;  2XAU A;  3CUO A;  4J00 A;  1NK3 P;  2H6B A;  4QEN A;  3WG9 A;  1F5T A;  3CF5 F;  1V55 H;  1BL0 A;  4EMS A;  4IRH A;  1WSU A;  3ZMS A;  1TNT A;  2A5W A;  4FE7 A;  5BQT A;  1I3A A;  1WJA A;  1ZKG A;  2KKO A;  4P5O A;  3F9Z A;  5H6Q A;  5JVG F;  1NG6 A;  2JRM A;  4HX4 A;  3AKZ A;  4E7K A;  3GTO J;  2Q0O A;  2EWN A;  4LDG A;  3QYF A;  5GAH J;  2ZJP F;  4B48 A;  2QYO A;  2IGN A;  1WVR A;  3J7Z I;  1V5G A;  1ZAR A;  4U87 A;  4LJZ F;  1FC3 A;  2A68 F;  2QEX I;  1K6O A;  3OIP A;  3DPL C;  2WB1 A;  2VT2 A;  3PNT A;  3BWG A;  3OV8 A;  2K9M A;  3MKZ A;  5CVJ A;  5DCM B;  3VFZ A;  4CUG A;  3LFU A;  2WC2 A;  5K7H A;  3TG5 A;  1WRJ A;  3IKV A;  1BI1 A;  1QGP A;  1O4X A;  3W6J B;  3I64 A;  1G2H A;  2UZK A;  2Q2E B;  3G4S I;  1ML9 A;  4I7H A;  4AIK A;  2AS5 F;  2HYF A;  4N4O B;  4WF2 A;  3ABM H;  2HDD A;  4CCM A;  2JMW A;  2DFH A;  4UVA A;  3ZMT A;  5C4X J;  4RAZ A;  1EA3 A;  3O3K A;  1DP3 A;  5LSZ A;  3L1P A;  2DA3 A;  3WTU C;  3BG6 A;  5KJL A;  4XLH A;  5KAI C;  2K4J A;  4OIO F;  5GPA A;  3I56 I;  1LJ9 A;  4ZYD A;  2GXB A;  1FIA A;  3I59 A;  4ESB A;  4KMF A;  5TRD A;  4BXF A;  3GTL J;  2DDA A;  4LIT A;  2E36 A;  1BR1 A;  1SC7 A;  2VOO A;  5ED4 A;  2V9P A;  4YIF A;  4GDF A;  3HG9 A;  3L2Q A;  5EEG A;  2DFF A;  2DMN A;  3F21 A;  2DT6 A;  2QA4 I;  1VQK I;  2XGE A;  1TT0 A;  1X2N A;  2KJB A;  3RU0 A;  1P4A A;  3H1C A;  5KHD A;  3WTZ A;  3GCM A;  3WE2 A;  2V6E A;  4RB0 A;  3QYB A;  4M74 A;  1ETV A;  5FFX A;  2PLY A;  1NTC A;  1B72 B;  4XRS G;  1EV7 A;  1WJC A;  3ZQC A;  2GIZ A;  4E7H A;  3HOZ J;  4YG2 F;  3ZQL A;  1BR2 A;  2MAB A;  4HX8 A;  2CUZ A;  5KVR A;  3QAH A;  2R7S A;  1I27 A;  4U7D A;  1APL C;  3LSM A;  1RZ4 A;  2MW8 A;  3TP3 A;  3KET A;  1TNS A;  2ZO4 A;  1XTA A;  2BEO A;  1MMG A;  1X58 A;  4BE0 A;  2JPB A;  4Y7N J;  1FMW A;  3I5U A;  4LG3 A;  1ZG5 A;  5AYF A;  2L3D A;  1RUN A;  2VKH A;  4MEY F;  1LEA A;  2FOW A;  3ASO H;  4FIS A;  1AKH B;  1HKT A;  3EQL F;  4S05 A;  3V8L A;  5F6F A;  4BAC A;  1PUF A;  3GLX A;  3VUZ A;  3HPG A;  3SFZ A;  1IC8 A;  2EV5 A;  2DCE A;  3PNY A;  5HNF A;  1HLV A;  3EUA A;  1OCO H;  1Y8R B;  3GX4 X;  4E4H A;  4UHT A;  1IN6 A;  2QM3 A;  2VQH A;  3DV8 A;  4B44 A;  3OSG A;  1ZRE A;  1ACI A;  4GYG A;  1TQP A;  2W25 A;  1Z1D A;  2DOD A;  5FKO A;  2KIU A;  2LY9 A;  2ECC A;  2A5Y B;  1BIA A;  2F4I A;  4BE2 A;  5D5X B;  3KP5 A;  4IJ8 A;  2JVG A;  1S6L A;  5F59 A;  5JLX A;  1FT9 A;  3J7A Y;  1MJB A;  1RES A;  3SYT A;  1TZL A;  1HDP A;  1RIO H;  1K7A A;  2CQQ A;  2ACJ A;  1D0Y A;  3F8B A;  3OYF A;  4ETS A;  2BXY A;  3CJN A;  3TO9 A;  3A02 A;  4LK1 F;  3L2V A;  4BUP A;  3TG4 A;  4MI5 A;  3IH2 A;  2JK3 A;  2R7V A;  3ECO A;  2J5P A;  4FQG A;  4LLN A;  3UKG A;  2IAI A;  2PJP A;  3JW4 A;  1RRJ A;  1FOY A;  5GAE J;  2JA2 A;  3FX3 A;  1IUF A;  4CCO A;  3HM5 A;  3DLL F;  3KYC B;  3PIP F;  1IXR C;  4DBQ A;  3KIO A;  4GYI A;  3PO2 J;  1YX5 A;  2EIK H;  1G3W A;  1YW9 A;  3M7G A;  1DGW Y;  1LUJ B;  1VQ8 I;  1D0Z A;  1GXP A;  1IUY A;  2JRT A;  2CW8 A;  1ERD A;  4IQJ A;  3Q9S A;  2V1D A;  3F9K A;  1BI0 A;  1SAN A;  1BA5 A;  4FE4 A;  4KMU X;  3MKW B;  3IAS 2;  3LQR A;  1YYV A;  3LL7 A;  1OCP A;  4JX4 A;  5LHH A;  3FK7 A;  5FO5 A;  2WAQ A;  5E79 C;  4KIT B;  2VE9 A;  3AG3 H;  5M5W J;  3OR2 C;  3W6K B;  1DP7 P;  2L0K A;  4M9Z A;  1IF1 A;  1J2X A;  2BYV E;  3R6S A;  4HG2 A;  4AYB A;  2P4W A;  3WHC A;  1XPX A;  4UXN A;  1KQ0 A;  3SJM A;  2EIN H;  2HQR A;  3QPL A;  1OCZ H;  2LDU A;  3FXU A;  4BKX A;  2JVH A;  5LBQ A;  3CQZ J;  1IJW C;  4GGG A;  2FA5 A;  1N6C A;  1YS7 A;  1Y8Q B;  3SZT A;  3DWL E;  2JA7 J;  2ZNY A;  1B59 A;  3BTJ A;  2NAZ A;  2VN2 A;  3CME I;  2DPD A;  2O8X A;  1HW2 A;  1UG2 A;  2EZI A;  2MH9 A;  2V1U A;  3BR1 A;  3Q9V A;  2MYS A;  1NG7 A;  2IJL A;  5D4S A;  4YNM A;  1J75 A;  2GM4 A;  4LIV A;  2LD5 A;  2HQ5 A;  4Y33 A;  4F55 A;  3VPR A;  3EET A;  3SEZ A;  3ZRG A;  2CFX A;  4P9U A;  1VQ7 I;  1Y0N A;  3GFM A;  5F08 A;  3SEQ A;  1LB2 A;  2STT A;  2LKS A;  2VE8 A;  1O57 A;  2XGC A;  3I9V 2;  4A2U A;  5J6X A;  1R5G A;  1S8N A;  4XNF A;  3LA2 A;  3JRE A;  1R1U A;  5F04 A;  2HVQ A;  3BTL A;  3U21 A;  1XX5 A;  3H36 A;  3LSG A;  2BV6 A;  1WH5 A;  5KAF C;  2K9S A;  3BPX A;  4IHT A;  2XF5 A;  3F9W A;  2CQX A;  4MO7 A;  2PMZ A;  1WI3 A;  1G6N A;  3KZY A;  2X85 A;  5J3L A;  5CLS A;  3TW6 A;  2EQR A;  4OU0 A;  4A3M J;  2HDC A;  3S1M J;  1FJL A;  1W1W E;  2M7A A;  1S7A A;  4A3F J;  2VAS A;  3G71 I;  3HOW J;  2EZK A;  3HYI A;  2IS6 A;  2M4G A;  2UV1 A;  2DPU A;  2R93 J;  4A12 A;  2RGV A;  5ILS A;  4DYQ A;  3HNA A;  1VQP I;  2P7C B;  1EJ9 A;  4A3E J;  1Y1W J;  2ZKZ A;  2DAO A;  2LKP A;  2XGD A;  1VQ4 I;  2IVM A;  1QPM A;  1W0U A;  4RLQ A;  3I4N J;  3HIF A;  4BEH A;  4DOZ A;  2FMY A;  5F5E A;  1WJB A;  5KCM A;  2MLG A;  2IS1 A;  1M1E B;  4XN3 A;  2V4J C;  3OYH A;  5DM7 F;  4OOI A;  4XN0 A;  4XOR A;  5ILV A;  2DU9 A;  2R7W A;  3PDN A;  2K02 A;  1NHA A;  3S8P A;  2COB A;  4XSZ F;  1A5J A;  4Y13 A;  3TDZ C;  3K10 A;  2EK5 A;  2JJ7 A;  3OOU A;  4HSR A;  2RC4 A;  1S7O A;  2HYJ A;  2FOK A;  5K7F A;  3KZI C;  3E6D A;  5BPD A;  2HWV A;  2XUB A;  2O3F A;  3IHU A;  1JGS A;  1VQL I;  1YRN A;  1U8B A;  1FMV A;  3HBL A;  3GBG A;  2FBH A;  2O5R A;  1FLI A;  3ZMU A;  3P9I A;  1TT5 B;  2ME0 A;  4R1H A;  3P9C A;  3OOI A;  4I99 C;  2K3P A;  3SDB A;  3M58 A;  2VON A;  3EUH A;  1U2W A;  3FMQ A;  2D45 A;  1B4A A;  1LVK A;  1Z91 A;  1N3J A;  2GXG A;  4ZH4 F;  2VQL A;  2ZME A;  3WGG A;  2VJ5 A;  3DEU A;  3ZP5 A;  3FBI B;  4KUM A;  1MDM A;  3S2D J;  3QPS A;  4RZ0 A;  1KU7 A;  3DKY A;  2XIG A;  1UG0 A;  1T56 A;  1F36 A;  3J81 K;  2YU9 J;  5EX0 A;  3C2G A;  1H89 C;  1CGP A;  3A0B C;  3FKI J;  2FX0 A;  4JDS A;  4BQA A;  2DN0 A;  1RR8 C;  2DA4 A;  3OYI A;  3O8G A;  2KDZ A;  3KLO A;  5J1Y A;  1N78 A;  1XCV A;  4HNT A;  2JT1 A;  3M57 A;  3JTH A;  4B8X A;  2R3S A;  2O03 A;  3KEO A;  5FB2 A;  1U3E M;  4IHV A;  2CYY A;  3V42 A;  2A69 F;  4I02 A;  4A6D A;  1A31 A;  2YR2 A;  3K4L A;  1ORK A;  4OAZ A;  4E70 A;  3HZJ A;  2E2H J;  1P7J A;  4ABZ A;  1QBJ A;  4OIR F;  4MTE A;  5L3E A;  4IRG A;  1QZZ A;  2IW5 A;  1UZC A;  3K4M A;  5F6L A;  3CJR B;  4BE1 A;  3J81 Z;  4U0Y A;  1YQA A;  5F1R A;  2OAZ A;  1IDZ A;  1F4K A;  1AA7 A;  2X1C A;  3E3V A;  2P0W A;  5ICF A;  5HLG A;  3RIR A;  1HF0 A;  1K83 J;  1RR7 A;  3MFK A;  1T08 B;  1ZG3 A;  5LEK A;  2UUZ A;  2H27 A;  3LA3 A;  4XLN F;  1UHW A;  4NHJ A;  4KA4 A;  1TWA J;  4ENN A;  5JI6 A;  2Z3Y A;  4ZYA A;  1BBY A;  2H6C A;  2L7K A;  2TRT A;  1YJW I;  3FPD A;  3DU5 A;  2FF4 A;  2VC0 A;  2JPC A;  2IGK A;  3ZR8 X;  2QF7 A;  4C1Q A;  2FJ1 A;  2QQA A;  2MC3 A;  4AVZ A;  2RDP A;  3JR9 A;  2Y0S A;  1IV6 A;  4AIJ A;  3K70 C;  3G3Z A;  4MI0 A;  1MBG A;  1JXS A;  3CCS I;  1UMQ A; 
#chains in the Genus database with same CATH homology
 2CMP A;  2X6Y A;  4XKC A;  3H35 A;  3AL0 C;  3S93 A;  2KZV A;  4E7J A;  4QPO A;  4XLA A;  2W5Y A;  2HPI A;  3KMT A;  4GRI A;  2BQZ A;  4PJL A;  5CCL A;  1G8X A;  5FRN A;  4DIQ A;  2X1E A;  4C9Y A;  4F52 A;  2CH0 A;  3VYU B;  2KP6 A;  2F69 A;  3D5L A;  3OR1 C;  3PFY A;  3L2W A;  4XQF A;  5JIY A;  4D1Q A;  1IRX A;  3HXL A;  4C2U A;  2BW3 A;  4ZTJ A;  2KRC A;  4CH7 A;  1QHH D;  5LSX A;  2W82 A;  4IQ4 A;  4IZZ A;  3DEE A;  3I3L A;  3VWB A;  4PUS A;  4MLO A;  4I51 A;  1JI8 A;  3OIQ A;  2WY8 Q;  4XKV A;  4PK4 A;  4Y3O A;  4Y4R A;  4J8O A;  3BLY A;  2L5Q A;  3OMY A;  4YRV A;  3DU6 A;  3MO5 A;  2LY2 A;  4NVQ A;  3K4C A;  1UEL B;  2VB6 A;  2AQF A;  1PEG A;  2WAF A;  3EPZ A;  4J00 A;  2XAU A;  3PSI A;  2UWM A;  1KON A;  2RRE A;  1O9S A;  4QEN A;  5HNH A;  3W2V A;  3VSK A;  1XQH A;  2VL8 A;  1D1A A;  4II3 A;  1N77 A;  1T95 A;  2HNH A;  2HPM A;  4YPE A;  2A5W A;  4PSW A;  3EUH C;  1WJA A;  4B43 A;  3CJQ B;  2VQG A;  3CP8 A;  1X19 A;  4P5O A;  3TL4 X;  3F9Z A;  5TGT A;  1NG6 A;  1WJ5 A;  1U0J A;  3AKZ A;  4E7K A;  3CBM A;  2VJI A;  3OYC A;  1D0X A;  4LDG A;  3QYF A;  2M4K A;  4CZC A;  4BQQ A;  4B48 A;  3OS2 A;  3K4J A;  2IGN A;  4YND A;  2CUJ A;  1V5G A;  4U87 A;  3ZXS A;  3OYG A;  4BS9 A;  3OIP A;  1X1B A;  3DPL C;  2CV2 A;  2WB1 A;  2OV7 A;  3NWT A;  3PNT A;  2K9M A;  3H9G A;  4YPA A;  3MKZ A;  2KPM A;  1WJE A;  3HPH A;  4CUG A;  3LFU A;  4JLG A;  3TG5 A;  3PJR A;  2WY7 Q;  1X4P A;  2Q2E B;  4ANJ A;  1ML9 A;  3VDX A;  2MC4 A;  4O30 A;  3PL8 A;  3H5N A;  4N4O B;  4XM3 A;  4E7I A;  2DXI A;  4CCM A;  5T0M A;  2R7Q A;  3BG7 A;  4QPQ A;  3PUB A;  3SW9 A;  1EA3 A;  1DP3 A;  1N6A A;  3CZ6 A;  5LSZ A;  2LOO A;  3BG6 A;  3MMY B;  1MW7 A;  3RSN A;  4OWR B;  4XLH A;  5KJL A;  4IJD A;  2VJ4 A;  4BL0 B;  2E60 A;  3ZCO A;  2M0M A;  2L9S A;  2DOA A;  5JHF A;  2JV0 A;  4BXF A;  2W4S A;  3D5R C;  4LIT A;  1BR1 A;  1WFX A;  5CCM A;  3G2B A;  4PJM A;  3K70 D;  2KHM A;  3HG9 A;  3L2Q A;  2KRH A;  2Q1Z B;  5HOO A;  2DT6 A;  4E47 A;  1E0E A;  4XKW A;  4II2 A;  4KT6 A;  1TT0 A;  3S7B A;  4IX7 A;  3RU0 A;  4ZJZ A;  3LSH A;  4H4K C;  3OL4 A;  5KHD A;  4B47 A;  3OWT A;  2QKM B;  3E1S A;  3DTE A;  2V6E A;  3QWW A;  4N4N B;  3QYB A;  3QWP A;  4KIS A;  3SZG A;  2PJR B;  1R6R A;  1T0F C;  1WJC A;  2F5V A;  4RM2 A;  3H5A A;  4E7H A;  2LBF B;  2R7T A;  1BR2 A;  5JHN A;  4DGW B;  2MAB A;  2AQE A;  2NOJ B;  2CUZ A;  1K6Y A;  2R7S A;  1YE9 A;  2FUG 2;  5T5G A;  4CCL A;  3RTR A;  3LSM A;  3OYD A;  4Z4P A;  1HA8 A;  2LY1 A;  3S32 A;  3ZQQ A;  2KL4 A;  3CBO A;  4C2T A;  2DT7 B;  1MMG A;  4BE0 A;  2HU9 A;  2R7R A;  1FMW A;  2Z16 A;  4LG3 A;  5AYF A;  3HKZ A;  4BDY A;  2VKH A;  3DB5 A;  3M55 A;  1S9H A;  3AFH A;  2E1M B;  5ARF A;  1WJD A;  4J01 A;  2QPW A;  1QHG A;  4BAC A;  3VUZ A;  3HPG A;  1MNE A;  5HI7 A;  4RLF A;  3PNY A;  2DCE A;  5HNF A;  4ZDO A;  3BCB A;  2LYC A;  2OC6 A;  3ZGK A;  3EUA A;  2ZSH B;  3FHN A;  4E4H A;  2VQH A;  3KX2 A;  4B44 A;  3DPT A;  3BC8 A;  1MMA A;  2KMU A;  3DTK A;  4J7I A;  4NNJ A;  3LMM A;  2F4I A;  4BE2 A;  4CA0 A;  4XLE A;  3TBI A;  4IJ8 A;  3CMM A;  2JVG A;  3E0J B;  3OPE A;  3VYT B;  4CCN A;  3OS1 A;  5F59 A;  1ZKK A;  3J7A Y;  3SYT A;  4YNP A;  2HQA A;  1TZL A;  4AU7 A;  1WJF A;  1UAA A;  3DKX A;  1D0Y A;  3OYF A;  4E6K G;  4U7B A;  2VJJ A;  3M1C A;  3L2V A;  4BUP A;  2IGQ A;  4NUB A;  4RM3 A;  1QU3 A;  3DAL A;  5KNL A;  4MI5 A;  3TG4 A;  4G6T B;  3K4K A;  1X1A A;  2R7V A;  5EX3 A;  1SAU A;  2I8D A;  4J7F A;  3NWS A;  2L2O A;  3M54 A;  4PJN A;  2X6W A;  1DQU A;  2LRE A;  1X1D A;  1PYV A;  2JA2 A;  3N71 A;  4F93 B;  1W36 D;  4CCO A;  3MKY B;  3AL0 B;  3VSL A;  2HVR A;  4DBQ A;  3LSI A;  1YX5 A;  3H9Q A;  1DGW Y;  2RQQ A;  3BCA A;  1D0Z A;  1ERD A;  1MUF A;  2VKD A;  2CW8 A;  4IQJ A;  3OS0 A;  3S3O A;  2ZSI B;  5JJ0 A;  3F9K A;  3MKW B;  1Y6I A;  3IAS 2;  5CQG A;  3DQV C;  2CW7 A;  3VV0 A;  3OYM A;  4BEH B;  2PJR A;  2HZD A;  3LL7 A;  4F3Q A;  1V5E A;  2LBF A;  2DJI A;  2WAQ A;  4KIT B;  4P1W A;  2XDV A;  4BQN A;  3CES A;  3MD2 A;  3N05 A;  5LD2 C;  3OR2 C;  5ARG A;  2MD0 A;  4ZC3 A;  4O6F A;  2X6X A;  1W36 C;  4HG2 A;  3VYR B;  4XLF A;  2Z1D A;  4AYB A;  2IS4 A;  2ELJ A;  2VXZ A;  3H0D A;  4XR6 A;  4PFO A;  2L9N A;  2R4G A;  4JQF A;  2V7F A;  2JVH A;  3RAY A;  4EAT A;  3H5R A;  2VXD A;  1N6C A;  3IP4 B;  3DWL E;  4XON A;  2R3A A;  4YEL A;  3HOS A;  5TTF A;  5FRM A;  4OAY A;  4CCJ A;  2IGM A;  3QYE A;  2MYS A;  1NG7 A;  3ONQ A;  2XSJ C;  4DJA A;  2IS2 A;  4YNM A;  4FAS D;  4LIV A;  2A6T A;  4Y33 A;  4F55 A;  1BR4 A;  2XF7 A;  4CSW A;  2WAE A;  2O8J A;  3SEZ A;  2V26 A;  3ZRG A;  3S7J A;  3S7F A;  4BJ6 C;  4HNU A;  3SEQ A;  2F6C A;  1G59 A;  4YPU A;  2KQR A;  3RPU D;  4ZTF A;  3SWC A;  1MVH A;  3W2W A;  3I9V 2;  1X4O A;  3MO2 A;  3OYE A;  4XNF A;  2JSP A;  2W5Z A;  4IKF A;  1LFP A;  2R7O A;  2HVQ A;  2QKL B;  2ZFU A;  3U21 A;  3FKJ A;  2R7X A;  3DPU A;  3LSG A;  1ZEL A;  4C30 A;  3W2A A;  1MT6 A;  2XF5 A;  3A2K A;  2W00 A;  3FDY A;  3F9W A;  3KMA A;  2PMZ A;  3L2U A;  1MMN A;  2X85 A;  4BJ5 C;  3PSF A;  2IXS A;  3S3N A;  4XKB A;  2R7U A;  1GLN A;  3OYK A;  2M7A A;  1SFK A;  2IS6 A;  2VAS A;  2LC2 A;  5TEG A;  2WAD A;  2M4G A;  2UV1 A;  2LRD A;  3F9Y A;  1DGR M;  4FET A;  4B3X A;  3KYL A;  3HNA A;  1BOB A;  1VZ0 A;  1X1C A;  3D5S C;  1H3I A;  3K4N A;  2G46 A;  4H12 A;  2ZXI A;  4HEA 2;  3UR3 C;  2VQC A;  3TMO A;  4RLQ A;  2CFO A;  3CP2 A;  4KJZ A;  4BEH A;  4DBR A;  3OY9 A;  5HQ8 A;  4DOZ A;  5CPR B;  5F5E A;  1WJB A;  5KCM A;  1J09 A;  3IHX A;  2IS1 A;  2X51 A;  4RMN A;  1D1C A;  4NQW B;  3M53 A;  4XN3 A;  2V4J C;  1MND A;  3A4C A;  3IAM 2;  3OYH A;  3F9X A;  4XN0 A;  1MMD A;  4XOR A;  4NC8 A;  2R7W A;  3PDN A;  3S8P A;  2ZXH A;  1Z3Y A;  4HST A;  3OYL A;  4LIU A;  4PSX A;  5KJK A;  3K10 A;  3LSK A;  4PJJ A;  3BO5 A;  5TH7 A;  3OOU A;  3M59 A;  3MEK A;  4HSR A;  2BOL A;  2LH9 A;  4ZDL A;  5KJN A;  4E7Z A;  3IUO A;  1YX3 A;  1MVX A;  3S3M A;  2MFZ A;  2IGO A;  5CKT A;  1FMV A;  3GBG A;  2O5R A;  3VYS B;  4HPQ A;  5LFA A;  3OOI A;  4XMY A;  4BQO A;  3OXF A;  5EG2 A;  2K3P A;  3M8J A;  4F91 B;  3SDB A;  3KMJ A;  3M58 A;  2BVM A;  4X0G A;  3FBN B;  1Z21 A;  1N75 A;  1Y56 A;  1OLT A;  1PJR A;  1LVK A;  1Z3X A;  1N3J A;  2V9K A;  2VQL A;  2VJ5 A;  2W7N A;  2M7B A;  2BVL A;  3FBI B;  4YEJ A;  4RZ0 A;  3OYN A;  3RIB A;  2M3A A;  2CS3 A;  3DKY A;  3HOT A;  1D1B A;  1UG0 A;  2BW3 B;  3QOD A;  5EX0 A;  2E5N A;  4NJ5 A;  3C2G A;  2V1N A;  4XLC A;  4JDS A;  4BGD A;  1OR7 C;  3M56 A;  1V5F A;  3OYI A;  3OXG A;  3OL3 A;  2W1O A;  1N78 A;  3W3C A;  3PNV A;  4HNT A;  2JUG A;  4HRI A;  3M57 A;  3RQ4 A;  3V42 A;  3KEY A;  4OAZ A;  3K4L A;  4PFP A;  2E1M C;  4BDZ A;  2HVS A;  3C2H A;  3CBP A;  3S7D A;  5CQE A;  3MO0 A;  5HVQ C;  3HUG B;  3CF2 A;  3QWV A;  3K4M A;  3EP0 A;  4XL9 A;  5F6L A;  2OUM A;  3CJR B;  3OYA A;  3HC7 A;  4R79 A;  3DTI A;  4BE1 A;  2RFI A;  5T0K A;  3RJW A;  1LDK B;  3QOE A;  5JIN A;  2VPL A;  3K6G A;  2RNG A;  2KDO A;  2X1D A;  5F6K C;  1AA7 A;  2X1C A;  2KLO A;  2P0W A;  4D9J A;  4WUY A;  2VLA A;  2CV0 A;  1Z7L A;  3DLA A;  5FRO A;  5HLT A;  4E7S A;  4E7L A;  4NC7 A;  2XF6 A;  2XC7 A;  2UUZ A;  3UNG C;  4QEO A;  3K5K A;  2GOM A;  2K9L A;  4ZDP A;  3H9J A;  4ITV A;  4BJT A;  2WBM A;  4ZYA A;  4BU2 A;  2Z2S B;  5KJM A;  2K5C A;  3OYB A;  2L7K A;  3K4B A;  4F92 B;  2WA0 A;  3RCO A;  3FPD A;  4XOT A;  4FMU A;  3DU5 A;  3M5A A;  3EUK L;  3A1Y A;  3L2R A;  2IGK A;  3ZR8 X;  4C1Q A;  2E5Z A;  4AVZ A;  3OS5 A;  3OXL A;  1LKX A;  2CV1 A;  4CCK A;  4J83 A;  2Y0S A;  2LG4 A;  3HL2 A;  1P9Q C;  2HDW A;  2VIX A;  3K70 C;  4MI0 A;  4JOM A;  3OYJ A;  4QEP A;  2GOX B;  4XOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...