5CPRB

The novel suv4-20 inhibitor a-196 verifies a role for epigenetics in genomic integrity
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
263
structure length
232
Chain Sequence
MSAKELCENDDLATSLVLDPYLGFQTHKMNRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The SUV4-20 inhibitor A-196 verifies a role for epigenetics in genomic integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SUV420H1
total genus 67
structure length 232
sequence length 263
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1700 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5cprB01
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5cprB02
3OXGA 5JJ0A 3VV0A 3RU0A 3TG4A 3MO0A 4FMUA 3M53A 3RQ4A 4I51A 1ML9A 5AYFA 2IGQA 4YPEA 3DALA 5ARGA 1MVHA 2QPWA 4YNPA 5KJLA 3KMTA 3MEKA 5EX3A 3RIBA 5ARFA 4H12A 1MT6A 4IJDA 5HI7A 3K5KA 5CCLA 1ZKKA 3MO5A 5F6LA 4YNMA 5LSXA 3S8PA 5KJMA 3FPDA 5T0KA 4J8OA 3QWVA 3KMJA 4Z4PA 2O8JA 5TH7A 4YPUA 2R3AA 3F9WA 5F5EA 4J7IA 1H3IA 5CPRB 5LSZA 1XQHA 4QEOA 3F9ZA 3S7JA 5KJKA 4BUPA 1MVXA 4YNDA 3HNAA 5TTFA 3CBPA 3OS5A 4MI5A 4NJ5A 4QEPA 3OOIA 5EX0A 4C1QA 2RFIA 3BO5A 1N6CA 4JDSA 3OPEA 1N3JA 3DB5A 2G46A 3S7BA 3S7DA 2W5ZA 2JV0A 3OXLA 3RJWA 5JHNA 3M57A 4J7FA 5T0MA 5F6KC 4AU7A 3M54A 4O30A 3F9XA 3M5AA 4J83A 4MI0A 3M59A 4YPAA 4JLGA 2BQZA 3IHXA 2F69A 3SW9A 5JINA 3CBOA 3OXFA 4O6FA 5EG2A 3M55A 1PEGA 3MO2A 4WUYA 5F59A 3RAYA 4LDGA 5JIYA 3QWWA 3QWPA 3VUZA 5T5GA 3F9YA 3M56A 5HQ8A 4QENA 3N71A 3M58A 3EP0A 2W5YA 5CCMA 3TG5A 1MUFA 5TEGA 1N6AA 4IJ8A 5KJNA 4NVQA 3KMAA 4RZ0A 3CBMA 3SWCA 4E47A 1O9SA 3S7FA 3PDNA
chains in the Genus database with same CATH superfamily
2ZFWA 4OIOF 1X2NA 3E6MA 3OOPA 1GT0C 1IN8A 2XRLA 1LDKB 3BTLA 1LFPA 1QBJA 2HQ5A 4FMUA 3S3MA 3E7LA 2ZXJA 4LB5A 1SFKA 3I59A 5GAHJ 2F5FA 4DZPA 4YPEA 1B1BA 2QPWA 5KJLA 2L9VA 2MC3A 2M7BA 5ARFA 1ZRDA 4H12A 5M3FJ 2XGXA 2VBZA 4CUGA 2KLOA 4UXNA 2STWA 1M1EB 4GDFA 4A0XA 2KIFA 5FGMA 3LQQA 4A3KJ 4NC8A 2VQGA 1RZ4A 3JRIA 1JKPC 2HQAA 3RSNA 2DA6A 5KVRA 2VODA 3V7CA 2MD5A 2O0YA 5EZHA 1XB4A 3EUHC 2MFZA 3ZQGA 2CU7A 4IRGA 4OIRF 3LAPA 3F9WA 4HNVA 2OU2A 4NBQA 5DCFA 1YHQI 2MABA 5J1RA 5J1UA 3CCLI 3S7JA 3V42A 2E36A 3OYIA 6PAXA 3ZQCA 1MVXA 1D1CA 2RQPA 4MFEA 4ZYEA 4XRSA 5BPIA 4IF4A 2JSPA 5KK1A 1ON2A 4RMNA 3H36A 4CGZA 2NOGA 1MIJA 2HQNA 2MG4A 1QZYA 2V26A 4XLAA 2EBIA 1R36A 2NVYJ 2AQEA 1I27A 2JRMA 2VLAA 2DOFA 5L3FA 3ABKH 2DT7B 3GEZA 3K70D 4OINF 3QP5A 2EH3A 1B72A 1K83J 4IEJA 2VB6A 4EJOA 2XVCA 1SVMA 1B59A 2FQ4A 3L09A 2VN2A 9ANTA 2BQZA 5E3OA 5DV5A 3K0LA 3S1NJ 4HA8A 3V7RA 4U7DA 2YR2A 3GBGA 2V79A 4JP0A 4FTHA 3L00A 2HTJA 3TOBA 1FBSA 3QYFA 4HAMA 3V8KA 2A07F 3TL4X 4A6EA 3KZZA 1H0MA 3S3OA 4KN7X 3VUZA 4EM2A 1ZELA 2HU9A 2HVSA 1XPXA 3FF5A 2ZFUA 3VODA 1QZZA 1XX5A 1YOVB 1YE9A 1VZ0A 3ZPLA 3RI4A 1FTZA 1DUXC 1L3LA 5A2QK 1LE8A 1N6AA 3J80Z 1X1AA 4XBFA 3N4MA 1XD7A 5JR3A 3BY6A 1TQPA 4AC0A 1K4TA 5H6QA 3OYLA 1W1WE 2XRNA 3F6OA 3EYYA 4LJZF 2BBYA 1R49A 3MO0A 1Z3YA 2OTLI 3TG4A 2VASA 4TV7A 2P7CB 1FBQA 3VOEA 3E0JB 3CZ6A 5F1JA 2HDWA 3F23A 3GTQJ 3I56I 1A04A 3I9V2 1IN4A 1X1BA 1I39A 3ZQ7A 1ZR4A 3KMTA 1KYZA 5EX3A 3TGNA 1G3TA 3D5SC 5HI7A 2DA2A 3S1RJ 2LD5A 4IPAA 5DCMB 2EFOA 4YNMA 3LMMA 2CQKA 3FPDA 1ENHA 1GXQA 2MD0A 4KMUX 2BY2A 4KYWA 1Y1WJ 2IA0A 2HS5A 3BR3A 4YPUA 1QZEA 3JSPA 4M71A 1RETA 2Z99A 2EZKA 2BY1A 1IW7F 1P4XA 2FD5A 3I53A 1X1DA 3CCRI 4HDVA 5BOXA 3KE2A 2A61A 2OV7A 2Y9ZA 1W36C 2IW5A 2LP0A 2PLYA 5D8KB 5EX0A 2GXBA 4A3DJ 1B9MA 2HZDA 1UHSA 2JK3A 1S5LC 5BS6A 4JDSA 1IXCA 2RQQA 3K2ZA 4AIHA 5E3MA 2KDOA 1D3YA 2CUJA 1IUYA 1IXSB 2DFFA 1IAWA 4GGGA 4ENMA 3U1DA 4E7JA 2BVMA 2HI3A 2K9MA 3KPHA 5HS9A 5DEQA 1G4DA 3JAMK 3BR0A 3DCFA 3QP6A 5LRRA 4ZH4F 1NK2P 5B1BH 4EGYA 1G6NA 3FX3A 2QQAA 3LSPA 1ON1A 3H5NA 3F9KA 1BW5A 4YPAA 3C2BA 3NRVA 1HC8A 3JREA 3QODA 2DO7A 1GHCA 3T5XA 4XN0A 4KT5C 1S7EA 3VWBA 2E1MB 1I3AA 1BW6A 2OPTA 5E8IA 2I5UA 1O7FA 1WI9A 2FA5A 3PO2J 1GUUA 1FTTA 1YW9A 1RPWA 4G7OF 5EG0B 2R7RA 3DPTA 3K4NA 3M4OJ 2JA7J 1U6GA 4IVNA 3HB9A 4HSTA 4XRSG 4ESJA 3K1MA 1OISA 1Z05A 4PUSA 4C30A 1ETVA 1VQ8I 4MTEA 2E2JJ 2YSRA 4IRIA 1W5SA 2GXAA 4W1UA 4RGRA 2R7DA 2H1LA 5B66C 4BDZA 1P4AA 3DF8A 2G7UA 1SVOA 1ZG1A 1JUPA 1JUSA 1S29A 5GPAA 1HW1A 1MMSA 2R4GA 1R9TJ 2DMTA 3PDNA 3S17J 2X1DA 4P9FA 5E1XA 5M5YJ 1H89C 4ZDOA 5HOOA 1RI7A 2OC6A 2IRFG 3IKTA 2QF7A 5DM7F 4OMYA 1FPQA 1T6SA 2HXIA 1WWXA 2PMUA 2Q2EB 2ADUA 3CMMA 4PJJA 4B47A 5LGTA 5GTIC 1F5TA 2W82A 2Z2SB 3DPLC 4CYCA 1DGWY 2M2EA 1JKOC 1ETKA 1WVRA 3HOZJ 5GPCA 3CO7C 1Y0NA 2M87A 2CQXA 1K78B 2QBYB 2YS9A 2ZC2A 2QA4I 2IGOA 3VEPA 1Z77A 2X4HA 2ZSIB 1HW5A 5EGOB 4KIBA 3BR6A 2XSDC 2CW0F 2DYRH 2QEXI 4P55A 3KP6A 2EA4A 1QVUA 2K4JA 1A31A 2BW3B 5BMZA 4RM2A 1XQHA 2E60A 4CZCA 5KJKA 1BI2A 4HV5A 4KT6A 1GVDA 1BC8C 3SFIA 2B9SA 2RGVA 4G7ZF 2QQBA 3FXLA 2IA1A 2YX4A 4DYQA 5IYDJ 2V9KA 5CVRA 5CVIA 2FX0A 4PJNA 1Z91A 2QKLB 3LL7A 1MJAA 3V8LA 3JTHA 1VNDA 1IUFA 4B3AA 3M57A 2DAOA 5JVTA 2E19A 2XB5A 2HWVA 1BI0A 3M9AA 3LSGA 2E7XA 2LYCA 3K69A 4RB2C 1C0WA 1ONVA 1ZRFA 3KYLA 2K9SA 3K1PA 3CDIA 4MI0A 4Q5SF 2JMWA 2K86A 1IJWC 4NDLA 2HOTA 3ABLH 4D7NA 1NK3P 1XSXA 5E1ZB 1VQ9I 3R0AA 1PEGA 3HKZA 2FJ1A 4G6TB 5D6EA 4NHJA 1RC9A 2Z16A 4MEYF 4A0YA 3JRCA 2M4KA 2D45A 2LKXA 5F27A 1SFXA 3QWPA 5T5GA 3CESA 4NC7A 3CMYA 2WB1N 4UNOA 1TC3C 2WAEA 1I3QJ 5KAFC 3QU3A 1R22A 1OKRA 3GMEA 3TG5A 2LFBA 3ZN1A 1ZQ3P 4A3EJ 5KJNA 1DQUA 1TWHJ 3GZNB 4U7BA 3AL0C 3BG3A 3JR9A 4YIRX 4AM3A 2D1VA 5FRNA 2ICWG 5K5QA 1R5HA 2W4SA 2OQGA 1RNLA 1AKHB 5BPDA 1G8XA 2FU4A 3B6CA 2ZBKA 1U8BA 2LF7A 4LLLA 5GP9A 2E34A 3N05A 4CICA 1USTA 3FBIB 3G2BA 2KL4A 1H9GA 1FSEA 1VF9A 3CDLA 4BQOA 2X6XA 4K2EA 2ZNYA 1QVTA 2O8XA 3K9TA 4JK1X 4HPQA 2JTVA 4YEJA 1ETYA 3RPQA 3CLOA 3FZVA 3TO9A 3L2CA 1X4OA 2OZ6A 4A93J 1KU7A 1X3ZB 5LSXA 2E7WA 1FT9A 1IRXA 4PK4A 1VI0A 4ZJZA 4Z4PA 3PQKA 4LG0A 2A5YB 4NUBA 4IHSA 2CS3A 1LKXA 3HZJA 4LK0F 4A5NA 1JHHA 1W7PA 5ICEA 3CUQC 1MJBA 2CV0A 3DP7A 1SMYF 1NG7A 2KIMA 1J59A 1V5GA 1Z0XA 4OAZA 5J8CA 4BUPA 2R93J 4FE7A 5AIQA 2ZXHA 4HLXA 4F55A 2XKOA 4E7LA 3MWMA 4ENJA 5BQTA 3OYFA 1WRJA 3SJMA 1RR8C 1HSTA 2VJIA 1MBKA 2HEOA 2DDBA 5FD6A 3SEZA 4EMSA 5E8GA 4HV6A 3J7AO 1JGGA 3EUKL 4E7SA 4PSWA 1D0YA 1ZGAA 2KJBA 5ILSA 3WU2C 1MBHA 3RTRA 1SD7A 2D1HA 4NNJA 2ME6A 1X1CA 1USSA 2Y31A 3I0TA 4Y17A 1I6XA 1MH4A 4MFDA 1D8KA 3K4KA 1X3WB 3W2AA 2VPLA 1OCCH 1XMKA 1V54H 4CZZA 2OCCH 2VT3A 2XROA 2V6CA 1TNSA 3DV8A 4XLHA 3RAYA 4RS8A 2O5RA 2UZKA 1R1VA 1OCRH 2XAQA 3BT9A 4YG2F 4RAGA 2B7EA 5E1WA 2DMPA 5EF6A 2HYFA 3B02A 3DQVC 3S3NA 5CQGA 3MQ0A 1DGRM 1R00A 1FMWA 4BNCA 2LC2A 2JWTA 3HUGB 4LIVA 3CBMA 4KISA 2Y0SA 5HDKA 3OYDA 1QQIA 2J5OA 3F6VA 4UUVA 2L2OA 1WJDA 1S7AA 1PJRA 3H9QA 3F8FA 2VUMJ 3OYGA 2LNBA 5A2QZ 3B73A 4YFNF 4XICA 2BXYA 3Q3SA 3RYRA 4II3A 3PIPF 1SC7A 2NVUB 1ML9A 1U0JA 1TT5B 4DIQA 3AAFA 1G3YA 4IQJA 1D8JA 4LD5A 4UV9A 1Y1VJ 3MVPA 5CKTA 1FJLA 2DT5A 4GO1A 1WJAA 2VONA 4BY7J 3W6KB 5TRDA 3GFIA 3MO5A 4IHVA 3PSFA 3WG7H 1A35A 3CLQA 1S72I 3TQNA 3RDIA 4D1QA 2EIMH 3T8RA 1FNNA 1R23A 3I4NJ 3QWVA 1P7JA 3MEXA 2TDXA 5CVVA 4A5MA 4F7ZA 1OR7A 2DCEA 4C9YA 4BHCA 2UV1A 4YIIA 4DJAA 3M8EA 2GIVA 3DBRB 3F72A 3IRRA 2KIQA 1W7PD 4HYEA 3QQAA 3HKZN 2DLLA 1EH7A 3EETA 4GYIA 4BJ5C 3JRHA 1E3HA 3MKWB 4WXDA 3TP3A 1ETXA 1XCVA 1T98A 4F52A 4IHWA 1YS6A 4CCMA 2OJED 5EZGA 4LGWA 1BI1A 3OPEA 2G46A 2ZJPF 3E6CC 2V1UA 1I5ZA 3ZMUA 3S7BA 3M1CA 1P4WA 4CYCB 2IS6A 3VFZA 2V4JC 4BU2A 4F92B 1B8IB 1J75A 3M3YJ 1YIOA 4G6DA 3KZYA 3GW2A 2FRHA 2F4MB 1HOMA 1FX7A 1WCMJ 2ESHA 4DBQA 1O7LA 3JRGA 1J7KA 2VXDA 3G71I 3VDXA 4M6YA 3S1MJ 3HIFA 5TGTA 1J0RA 3DEWA 4PJ0C 3A2KA 3CBOA 2CUFA 4E7ZA 3C3WA 2PMHA 1O3QA 1T0FA 3M55A 1GXPA 4CYDA 2L7KA 4JQFA 1U3EM 2R7VA 4A6DA 1W4MA 5J3LA 3IWFA 2F48A 4RA2A 4PFPA 1MGTA 2E1NA 1ZARA 2WBMA 4ZDPA 3O8GA 1KQ9A 1FSHA 2AXLA 3VPRA 3FDYA 4G6QA 3EYIA 2VC0A 1XN7A 2DDAA 3BOQA 2FQ3A 1OLTA 4DW6A 2DPDA 2W85A 3RPUD 2QM3A 5M3MJ 1T56A 4M73A 3S2WA 1OCZH 4AYBN 2PJRB 1LB2A 2LREA 1P92A 1LFBA 3BDDA 2L9SA 2F2EA 1PUEE 2GM4A 2O03A 4Q4ZF 3H92A 4E7KA 1NHAA 4H0EA 2VE8A 5JJ0A 1G59A 1DU0A 2K7LA 2DOEA 3BCBA 1IN6A 2AXTC 2M7AA 3RQ4A 3SDBA 2VXZA 3GTPJ 5TJJA 2X48A 2IGQA 3P5JA 3BR5A 3FIWA 2R92J 3BG7A 3L9FA 1X4PA 3CJRB 5B3SH 5L3GA 3W6VA 1EH8A 2L9RA 2V1DA 3MEKA 2QKMB 2HVQA 5M5WJ 5F6LA 3VYRB 1HBXG 2ELJA 4LLGF 4BL0B 1XMAA 4WXHA 3VYSB 1PUFB 1RESA 1YW8A 1ZGJA 3G73A 3OYMA 4QPQA 3LNQA 4N9IA 2DBBA 1WJ5A 4JX5A 1IXRC 4KUMA 1QNTA 1FZPB 4BEHA 5EYRA 3OYKA 3ZOBA 4XN3A 2H27A 3HGYA 4I76A 3ABTA 3OYHA 1FLIA 3KEQA 3VYUB 1N77A 1F9NA 4ZYHA 1HW2A 2IPQX 1OJLA 1KQ0A 2RFIA 3BO5A 1TWCJ 3MD2A 5M5XJ 2YUSA 5IOZA 2JVGA 2Q8KA 2VC1A 4FX0A 3NEUA 2CJJA 2X0LA 3KP4A 3CCJI 1SANA 1FP1D 3HHGA 5CYVA 4ON0A 1T08B 5FLXZ 2EK5A 3HHHA 2ZJ2A 4CH7A 2ZJRF 3IL2A 2G0EA 3FXJA 4ETSA 4EV0A 3L7WA 5IPAA 2BOLA 1EF4A 3M59A 3S15J 3F3XA 2LG4A 5J8FA 1EV7A 1WSUA 4A12A 2JA8J 3AG3H 2XSJC 2DOAA 4Y3OA 3Q0UA 3WTZA 3HC7A 4BEHB 4QPOA 3CCQI 2QGUA 1VQLI 2KDZA 5JLXA 2E5ZA 2FUG2 4D7MA 4OMZA 2GIZA 3QPTA 3G6EI 3F8MA 1MDMA 5EEGA 1SAUA 2JA5J 2Y9YA 3COAC 2Q2EA 5LFAA 4PSXA 3H1CA 1X1PA 2I10A 3S1QJ 3GXOA 5D5UB 5E17F 3RPUA 4IHTA 2R7UA 4XIDA 1ZYRF 2R7FA 2XPVA 1A6IA 3IHUA 2WAQN 5KCMA 1MW7A 4DOZA 1SFOJ 4IOAF 1T39A 1STZA 1QRYA 3JRAA 4AIKA 2CG4A 4QTRA 5FJ8J 4I02A 3LA2A 3ZN0A 3F21A 3BJ6A 4BDYA 3RZOJ 1KQ8A 3HRMA 5F04A 3QOEA 4N0BA 5LRSA 3ZMDA 3UNGC 5JI6A 4LLNA 4M3GA 2Z33A 2FBHA 3SHFA 4ASNA 1D0ZA 1BR1A 3A01B 4HSRA 3LAJA 3KCCA 3M8JA 3PL8A 3ASNH 3KP7A 1MVHA 2WV0A 4HX4A 1SMTA 4FCYA 4ZDLA 2MH2A 1U5TB 4HF0A 2NS7A 4KIGA 1JJ8C 5DDGA 1ODDA 4IOCF 3D5RC 2Y0MA 3EUHA 5JVGF 3FM3A 2UUZA 2XGCA 3KP3A 2LBFA 5LGNA 2NVQJ 3PIOF 2STTA 3IC7A 4RGUA 1R58A 5AONA 3CD6I 4UUSB 2Z3YA 1LEBA 1V5EA 3H35A 1MMGA 2EZIA 3S16J 1HKSA 1MBJA 2VPRA 3M1EA 2O6GE 2RV8A 1BR2A 3IKVA 4A3LJ 3C7JA 3HNAA 4BACA 3CJNA 4F91B 4XKWA 2K3FA 2NXNB 5F08A 2HKOA 1R4NB 1UHWA 5L3DA 2D2WA 3S7DA 2EIJH 2W5ZA 3RKXA 3MZHA 3ZQHA 4ZYAA 2QWWA 4PCQA 3V7SA 1CF7B 1HDDC 4HOBA 2MH9A 2W48A 2WWYA 1UB9A 2AO9A 5J1YA 1UG2A 2KFDA 1ZLJA 2Z1DA 1UELB 4EJTA 2M1BA 5KNLA 1Y8QB 3FWEA 1K78A 1OPCA 3HOYJ 3HJEA 2LY2A 4IRHA 2F69A 2K85A 1JKQC 1XGSA 2Y2ZA 3CDHA 1BJZA 2CMPA 4UHTA 2M30A 3I64A 1TQIA 2A5WA 1JHFA 4RDUA 1LUJB 4G8XA 2ZKZA 1NH3A 3HTUA 3MCZA 1GLNA 3DKYA 2EWNA 3E5XA 1KU9A 2V1NA 1WI3A 1MKMA 1PVEA 4WXCA 2CV2A 4Q48A 1HQCA 2EZHA 1LDJA 3N71A 3KETA 3M58A 4CCJA 4HX7A 3JRFA 3HBLA 3D0SA 1JTYA 3K10A 1S8NA 3E1SA 3MKYB 5LHGA 1NG6A 1K79A 2CQNA 2RAEA 1NTCA 1MMDA 4IXAA 3I3LA 4RB1A 1DPRA 1RUNA 2PFBA 2EB7A 4BY1J 3L2VA 2XAHA 1APLC 1YRNA 1HXDA 3AG4H 3GFMA 2IT0A 3K6GA 3HSEA 1JT0A 3VV0A 2PMZN 3RU0A 1UMQA 2VT2A 2R7WA 3HYIA 3LSMA 1JJ6C 1BI3A 3WU0A 3GF2A 1SAXA 4L9VA 3BZKA 4Z6YA 1Y0UA 1TP4A 4ZZDA 1AWCA 1YLFA 3RJPA 3TO6A 1UG0A 3EQLF 3ZXSA 4G7HF 3IP4B 2LF8A 1WJCA 2M5WA 2HPMA 4HF2A 3FBNB 1T38A 3K5KA 4NQWA 2VJJA 2MBFA 2RNGA 5K7ZA 2QSHX 1R5ID 2TRTA 5GAEJ 2VKDA 2LLKA 3QAHA 4MHGA 2DI3A 2CWEA 2DT6A 4C3HJ 2FOWA 4L0ZB 5HLGA 4DGWB 1XSVA 2NS8A 5ILUA 1MNMC 1RR7A 5D4RA 2YU9J 3GO5A 3BQZA 5LBQA 2GWRA 4FASD 1W0UA 3GCMA 4OIQF 1PDNC 4JX6A 3LOCA 3SZPA 1V3FA 2KPMA 5HLHA 3VB2A 3OS5A 1VQ5I 3GYHX 2JPCA 3OYJA 1J5YA 1EH6A 2F5CA 1WH5A 5F0HA 1UZCA 2JA2A 3M7GA 4D5FA 2DA5A 2Y75A 1O4XA 3RJWA 5J47A 1MNEA 1S6LA 3H0DA 4EEFG 1GV5A 1E3PA 1IRFA 4BQAA 2G7HA 2ETHA 2DJIA 2JJ7A 2VQLA 3PO3J 5F0FA 2IS4A 2LOOA 3RKYA 2FBKA 2CUEA 2JVHA 2KISA 3OS2A 1YX3A 2PJRA 2BEOA 1FYMA 2QQ9A 1WFXA 2LY1A 3FKIJ 3H9JA 3UKGA 4B43A 1ERDA 1E3OC 1AA7A 3FXKA 3IH3A 3OIPA 1H88C 4KICA 2OBPA 4IX7A 2HDCA 3A02A 3GTKJ 2QSGX 3FXMA 4OU0A 3S32A 1VTNC 2K27A 2ZXIA 3J7YJ 2CH0A 2LY9A 3HGGA 1IV6A 4F3QA 4YELA 2GLOA 3L1PA 4BHBA 3P9CA 2AS5F 1BA5A 3OR1C 5HNFA 2HNHA 5GTHC 3T1BA 3HPHA 3CUOA 2W1OA 2DA3A 2JPBA 3CCUI 5KHDA 2X6YA 4XL9A 4B3XA 3WODF 5J4VA 3LSHA 3R0JA 2M0CA 1O57A 3FXRA 5FLMJ 1JE8A 3CJTB 2GBYA 2ZB9A 1T95A 5ICFA 1ZH5A 1IRZA 3S7FA 1U9OA 5CJ9A 4ESBA 3ROUA 4XKCA 3U9GA 5JHUA 1MMAA 4PZJA 5DUIA 2HOAA 4QSHA 2BW3A 2FXAA 5K5OA 3N97A 4GCVA 1KZHA 1FOXA 4KDPA 2TCTA 1IDYA 2RREA 3HEFA 3E5QA 5K1YA 3DEUA 5LD2C 3DEEA 1P9QC 3ZR8X 3K4MA 3PJRA 2R3SA 4NC6A 1E2XA 1QPMA 1CF7A 2EINH 2BVLA 4IJDA 1ZRCA 4A69C 3K4LA 3CJQB 3GVAA 3GTMJ 3G1OA 4AIDA 2HOEA 5KJMA 1QHGA 1KGSA 4ABZA 5E79C 2HVRA 4YFKF 2XIGA 4DYCA 1FIAA 5D5WB 4ZTFA 1XS9A 4X6AJ 4LG0B 1DP3A 2CW8A 3OIOA 1P7IA 2ZMEA 3K1NA 1BOBA 4C3IJ 3FHZA 4UVAA 3H3UA 2GQQA 3BG9A 4XMYA 4P5OA 1FBUA 1U2WA 5EDNA 1TW2A 4L9JA 4CCNA 3TDZC 4DNCA 2IS2A 2EV0A 3OOIA 1YFHA 4I0BA 4XLNF 2ZXWH 4HZFA 3WTSC 5E3NA 2DA1A 4EJWA 1QPIA 3WTXC 2KMUA 3Q0WA 2VJ4A 1V4RA 4RGXA 5JHNA 4C2TA 2FOKA 2C6YA 5T0MA 5JHFA 2NRAC 3M54A 3FM5A 2A6HF 1CQTA 1OCPA 2W00A 4DQ2A 2R5ZA 4L5IA 4M6VA 3D1NI 3GTGJ 1MNDA 3F9XA 2EV5A 1MD0A 2PJPA 3M5AA 3E6BA 3CQZJ 1VQOI 3DU5A 2ELKA 3LFUA 5ILVA 1WJBA 2YX7A 4CCKA 1E0EA 1YW7A 3BC8A 1HDPA 5H2FC 1YJNI 5B5EC 2M34A 3KIOA 3I59B 3LA3A 4AD9A 2XAJA 4LIUA 4XKBA 3I71A 4E6KG 3OYEA 4GYGA 5DM6F 5L3BA 2O8KA 1W0TA 3AG2H 5EGOA 4Y4RA 2RC4A 3LSJA 2O7OA 3SFZA 3M56A 5HQ8A 4QENA 3ZRGA 5DCMA 4MQ9F 4RAYA 3F8CA 4XONA 1EA3A 3M8FA 5IY5H 2FNAA 2P5KA 1BM9A 4J00A 1YTYA 1AU7A 2DTRA 4NVQA 4HX8A 3A4CA 4M9XA 5FLXK 5EEAA 3FXOA 1SFEA 5F64A 1I1GA 2OUMA 4M72A 3O6BB 4XNFA 2GXGA 1D5YA 1CGPA 1JT6A 1G3SA 3BLYA 3HOXJ 1ACIA 3DFGA 2DU9A 2OF7A 4J19A 2EFNA 4BE1A 2JQ7A 1XDSA 3BTCA 3CO6C 4IQ4A 3OSGA 4ZZLA 3TDUC 2ELHA 4B48A 2PBIA 4KNYA 2ZJQF 1XCBA 5K5RA 5LGUA 3RIBA 1Y8RB 2HYJA 5LHIA 3R60A 4KJZA 1ZKKA 2P7VB 2M3AA 2F4IA 3S8PA 1V55H 1AHDP 1TZLA 5EG0A 1VQMI 4W97A 3KMJA 1EKEA 2BY3A 4L9NA 3CC7I 2GA1A 5EEHA 1WPKA 2EJRA 3KEOA 1A5JA 2ISYA 4KN4X 2E1OA 1TWAJ 4HG2A 3DKXA 1IN5A 2NS0A 5E3LA 1Y56A 2L54A 1TWFJ 5K7FA 3HL2A 2L7FP 3ZMZA 5BNGA 2FF4A 1XGNA 4HNUA 4HLYA 2Y69H 3S14J 1T33A 4XORA 5TTFA 4XR6A 2A6TA 1FMVA 4C1QA 1WJEA 4G94A 2ISZA 3ZCOA 4A3IJ 4JOMA 5J4YA 2HFHA 1KYWA 1F36A 3IWZA 1AKHA 2ECCA 3OXLA 1N25A 2VKEA 5H20A 3J81Z 2WAQA 2QCOA 5GADJ 2GOMA 3HOTA 3RYPA 1K61A 2EQRA 2QLZA 5DD4A 3WGHA 4BE2A 2V6EA 3F8BA 4ZC3A 5AIPA 3E3VA 4B09A 1XGMA 2EIKH 2PEXA 2IA2A 3IHXA 5DTDA 4BYYA 2R7ZJ 2E5NA 5KAIC 5D4SA 4BKXA 1TWGJ 2LVSA 1U8RA 3OXFA 5IP9J 5J6XA 4OIPF 4P1WA 2QENA 1WH7A 4L5JA 4WUYA 5ICGA 3V8JA 4JX4A 4XLPF 2L3DA 1Z1DA 2DK8A 5IT9K 4LDGA 5HDGA 4HW0A 1OCOH 4O6JA 3RCOA 3G1MA 1J2XA 1SD6A 2BV6A 5FO5A 5FFXA 1U9NA 3WHCA 4QLCU 4YFXF 3R61A 2GOXB 4QIWN 1YIJI 1QO0D 1Z67A 3DWLE 3PNYA 3SWCA 3H9GA 4HNTA 4X0GA 2FE3A 1DPUA 2CQ7A 3CP2A 3V4GA 3GTJJ 3NAUA 3JSOA 3E5UA 2R5YB 1FYKA 2QUFA 4R8HA 3WHBA 2P4WA 4IZZA 4MIMA 2PX9A 3TOAA 1W36D 1ZK8A 4UY8I 3OOUA 1W5TA 1H9TA 2DMNA 4WCGA 2CRGA 4XLCA 1D5VA 1RIOH 1ZGWA 5ICCA 2RKHA 1IZ1A 3CCMI 1XC5A 2VIXA 3DALA 2JZYA 1W7PB 5C44J 2VE9A 2FSWA 4A0ZA 4RLFA 3BROA 3MZ8A 2VBWA 2MLGA 5FKLA 2Y0SN 5LEKA 4UVBA 4ZTJA 2ACJA 3HRSA 3OWTA 2R7XA 1OR7C 2WADA 3FMSA 3FK6A 3PUFA 1Z7UA 2WTEA 4PDKA 4YIFA 3LQRA 2A6EF 3AL0B 1Z21A 1IV8A 2HTSA 4WF2A 2JUCA 1ZKGA 2DMUA 5IYCJ 5F5EA 4J7IA 1Z7LA 5F1RA 5ED4A 1VFCA 2KIUA 2O3FA 4G12A 5HLTA 1XTAA 3QRFF 1R6RA 2X1EA 3G1LA 4E4HA 3JCUC 2WAFA 3SQNA 4L18B 1WHUA 3ELKA 4BBRJ 4YNDA 3S2DJ 2ID6A 4HRIA 1MH3A 4CDGA 3GZ6A 2IGMA 2W25A 4QEPA 4V2GA 2OTJI 3L2QA 4DZJA 2DA7A 4M3DA 4BXXJ 1S9HA 3HUGA 2VL8A 2KRFA 3BQYA 2JV0A 3ABMH 1QGPA 2Q0OA 5HDNA 5EJCA 3GLLA 2R5YA 4CHUA 4J7FA 1UFMA 2ESNA 4M3EA 1XSDA 3H3ZA 2D5VA 1JUMA 1OCTC 1LE8B 5IP7J 2QVOA 1ULYA 2M8EA 3ESWB 2ZMEC 4PFOA 2IEKA 2EA2A 2RDPA 4XK4A 3WU1B 2HPIA 1WQ2A 5CVUA 3TBIA 1R71A 4B4CA 2KQRA 3PSIA 2OA4A 3O8HA 3F0CA 2EV6A 2H6CA 4FETA 4BHPA 2E71A 5JLWA 3F9YA 2G9WA 1DDNA 3ECHA 4IHXA 5FKNA 2X1CA 1VQPI 1I6HJ 4A3FJ 4I7HA 5K7HA 3HOSA 2V9PA 3J81K 5TEGA 4HQEA 2HYGD 4M9SA 2FBIA 3P7NA 3I5UA 4EVIA 4U87A 4IHYA 3OIQA 2KJCA 4AUXA 4PGGA 5C4XJ 2RVCA 3OXGA 4WWCA 2EFWA 2XKPA 2DN0A 3HSRA 2K9NA 4ESFA 1X19A 2BE5F 4EM0B 1ZTRA 5FKOA 4I51A 5AYFA 5FD5A 1MSEC 1LJ9A 3SEQA 2H09A 4MNUA 3CCVI 1SD4A 1WGXA 3LSKA 1JI8A 3OR2C 1MT6A 3BPXA 2MGQA 4CSWA 1VQKI 1QU3A 2VBYA 2DFHA 1R1UA 2P8TA 1TBXA 1D0XA 3P9IA 3F22A 3ERED 2PMZA 4RM3A 2IVMA 2VQHA 4A3CJ 3SDGA 4S0HB 5C3EJ 2COBA 5CQEA 2O8JA 5TH7A 2F5VA 1LQ1A 3U2RA 1OFCX 2Y48A 5CPRB 1IC8A 3QPSA 2WV1A 3RQIA 1GVJA 2KHMA 1Q1HA 3OMYA 1FEXA 4D9JA 1LPQA 2IJLA 1EJ9A 1SVLA 3WTTC 3KYDB 4BS9A 2EFPA 1FOKA 4NJ5A 3MAJA 1JXSA 2ZO4A 1P6RA 4D0PA 3BG5A 3DB5A 2UXNA 4O5VA 2P6SA 2P5VA 3BR1A 4I0AA 3TP0A 4ANJA 1BBYA 2XDVA 2XUBA 1OYYA 2EPFA 3ISPA 3DTEA 2BY0A 5ERIA 1BIBA 1HLVA 1BC7C 3CCSI 4HQMA 2E2HJ 3RKWA 1D1BA 2BYVE 3Q0VA 5F0CA 1S3JA 2Q1ZB 2CYYA 4EATA 1O3RA 5FB2A 2K3PA 2O61A 3FHNA 4O6FA 2PQ8A 1LVAA 4JYKA 3B6AA 3ZQIA 3A03A 1FP2A 1LEAA 2COMA 2EILH 2F5EA 1WKMA 4UUSA 2MC4A 1REPC 3PM1A 1Q1VA 3BZCA 4LB6B 2E2IJ 3J7AY 4ITVA 2NNYA 4LMYA 2R7QA 3Q5FA 4QWQA 3BP8A 2QZ8A 5D5VB 2VKVA 4CCOA 3JRDA 3QOPA 5IP6A 5IYBJ 2DYSH 3KYCB 4R79A 2LKPA 5DD8A 5D6FA 1LFUP 3PNVA 2DTZA 3HOUJ 5LEJA 4RBOA 2R7TA 1O3TA 2HXOA 1I50J 3C2GA 2XF7A 3CCEI 1LNWA 3H0GJ 1IN7A 3I55I 2VBXA 2KP6A 2KKOA 4ENNA 2MLKA 2HDDA 1JTXA 2CFOA 4FT8A 5IOYA 3U1KA 3REOA 2XC7A 4II2A 2RNJA 3KEYA 1N75A 2XV4S 1R7JA 5DS9A 4Z2YA 2IS1A 2LH9A 3LWFA 1MBEA 3WTVC 3T0YA 3H5RA 4ZYDA 4AVPA 2NYXA 3WE2A 1Z9CA 2PN6A 2FMLA 4IL6C 4PGHA 3IH4A 1FY7A 4UV8A 1G3WA 4O3MA 2Z9OA 2X9DA 2IGNA 1T8IA 3S93A 2HOSA 4FQGA 2ZCWA 4Q47A 2LR8A 3NQOA 4BE0A 1Y39A 3U21A 1F4KA 5LLQA 3SXYA 1ZG3A 1HSJA 3HG9A 3CC2I 3HTSB 3K4BA 2H94A 3AFHA 3G4SI 4IJAA 3O2PE 1DU6A 4IKFA 2FMYA 3VYTB 1R4MB 3OS1A 2XAUA 4E70A 3KX2A 4OWRB 1JGSA 4XLEA 4BH9A 2DODA 4Y52J 2QBYA 3A0HC 2A69F 1ZR2A 4L0YB 2LDUA 1IO2A 1TQMA 4B1RA 1MJ9A 1ZAOA 4AU7A 1S7OA 2M8GX 1RKWA 3GFJA 3RKQA 1LVKA 2EZLA 3OL4A 1B6AA 3ZMTA 5L3CA 4A3JJ 2QYOA 4S04A 1Z3XA 2UWMA 2EFQA 5J40A 1YITI 3LFKA 4KA4A 3I4PA 5EG2A 3MKLA 3L2UA 2XPWA 1RKTA 4V19K 1HKQA 4PJMA 3MO2A 2K4BA 3MFKA 2R0QC 1YJ9I 1AOYA 2K9QA 2KT0A 4XRFA 4P9UA 3SYTA 1PUFA 2WC2A 4BQNA 3AKZA 2XGEA 3JW4A 2IGKA 1T2KA 2HZTA 3GTLJ 1VQ6I 2F6CA 1YO5C 2R7SA 1BIAA 4J01A 2F4OB 2ZNZA 2Y30A 3LSIA 2P81A 3ZQQA 3JRBA 2MA3A 2XAGA 4Y15A 1X3UA 4AWXB 1MUFA 3HRUA 4RZ0A 2XPUA 3VSKA 3KP2A 2B63J 1BOAA 5HS8A 1O9SA 3ASOH 1MMNA 4X1EA 3BPVA 4RAZA 2E1CA 4LK1F 3T8TA 2M0MA 2VJ5A 1K6YA 2I8DA 3ZMSA 3J80K 4N4NB 5HLIA 4CA0A 1TNTA 2LKSA 2KZVA 3BG6A 2XASA 4BJ6C 1TTYA 3FK7A 4UB8C 5GAGJ 3DU6A 3FMQA 3GTOJ 3DTKA 3KZIC 1MBFA 1F1ZA 1UHMA 2ZMEB 2GAUA 5ARGA 4BJTA 3JTGA 3VSLA 5B1AH 4G9YA 3MKZA 2X6WA 3IUOA 3NWTA 4ENKA 2HGCA 4BGDA 4C2UA 3D5LA 2N8GA 3GX4X 4E7IA 3OYNA 3HRTA 2OCEA 3O3KA 1IGNA 5F6FA 3DTIA 3HXLA 1B4AA 2CGPA 2CQQA 3I4MJ 3ECOA 2A68F 2AHQA 3KFWX 4IO9F 3QPLA 4GXOA 3PFYA 3NWSA 2KRHA 1H3IA 3WG9A 3QPHA 4M6XA 5CVJA 4A3BJ 4QEOA 2R7OA 4RGSA 2CW7A 4U88A 1R5GA 1ITYA 3CF5F 3QYBA 3OYCA 3CBPA 2X85A 2HR3A 5FROA 5E18F 4LFUA 1N6CA 4EQQA 2LK2A 2VOOA 1HKTA 4XSXF 1D1AA 3TO7A 4HBLA 3W6JB 4RB3C 1W5CC 1YG2A 3CCYA 3L2RA 3ERMA 1SEUA 3K4JA 3C1DA 4YRVA 4AIJA 1Z6RA 2OZUA 2XGDA 5F6KC 3DPUA 3LSRA 4HDUA 2UXXA 3I54A 4E7HA 4EJVA 3KLOA 3A0BC 4H4KC 3IV5A 4BBSJ 1T0FC 4KIFA 2LSOA 1FC3A 2AQFA 3DBLB 3IAM2 4M3FA 5JINA 1E17A 2DQRA 1UJ8A 1MBGA 3CTAA 4MGRA 1V5FA 2L02A 2B0LA 2V7FA 4LG3A 3OSFA 2BHYA 2VI6A 1TT0A 1IF1A 3R6SA 1VQ7I 2DJNA 4OOIA 4MTDA 2L4AA 1YQAA 1ETWA 2ECBA 3QWWA 1R1TA 2CV1A 1B8IA 4R1HA 3HOVJ 3GUDA 4RB0A 4CXFA 1ZLKA 2WA0A 1FWZA 3I58A 1OQYA 3HOWJ 4LOCA 2XB0X 1A6QA 3RZDJ 3FXUA 3OYAA 3HM5A 3GLXA 2H1KA 3BJAA 3QYEA 2Z5UA 3KMAA 1GDTA 1G2HA 3HDDA 4XRMA 3ZQFA 4KITB 1ZN2A 5D5XB 4XKVA 1B9NA 3MZYA 2LRDA 2CFXA 3BJOA 4N4OB 4NQWB 5HS7A 4AYBA 2IP2A 4B44A 1KU2A 4I99C 5FFZA 1XG1A 4GRIA 2L5QA 2L9NA 4ZYGA 1RUOA 3BR2A 4A2UA 4M9ZA 3BZ6A 2DFIA 1XGOA 3TKYA 4FISA 4WK8F 5DYMA 1BJAA 3C2HA 2FNPA 4UB6C 4EGZA 4YNPA 2CSOA 2L01A 3IAS2 4PJLA 2PI0A 2DQLA 2DK5A 5HVQC 2RN7A 2YPRA 4M74A 2K02A 3H5AA 4EJUA 3WTWC 5TISC 3P9KA 2L7MP 4NB5A 1TL8A 1IG7A 2W24A 5T0KA 4S05A 4J8OA 2YU3A 3OL3A 1DP7P 4I09A 3QU6A 2MYSA 2L0KA 2W7NA 1QA6A 2HQRA 2MW8A 3LSTA 2IBDA 3Q9SA 3TEDA 1Z6TA 3F9ZA 1MZBA 1FIPA 2CUZA 5L3EA 1U78A 2OQRA 3X2QH 2E35A 4A3GJ 4BAYA 2OAZA 2E1MC 4FHTA 2XAFA 4BXFA 3FISA 2V1XA 3G3ZA 3OS0A 4I6ZA 1OYWA 1YJWI 1P2FA 3FMRA 1YRNB 2WY8Q 2A05A 3W3CA 4KFCA 3JAMZ 4C3JJ 4RLQA 3RIRA 3E6DA 4A3MJ 1TLHB 3W2WA 3UR3C 4I2OA 1PP8F 4BXUA 1PP7U 2JRTA 3WTUC 2NNNA 1UCRA 1YI2I 2K5CA 4XOPA 2H8RA 3KP5A 2M9HA 2VKHA 2W57A 4I98B 4O30A 3GZ5A 3KLNA 2WB1A 3EUAA 3CF2A 4MO7A 3PFIA 1K6OA 1UAAA 4MQVA 3M07A 4U0WA 1QHHD 1HCRA 5H6RA 5FKKA 2DFEA 3CMEI 3ZQLA 5JFRA 1PYVA 3CUQA 3K2AA 2K40A 5FLVA 4UVCA 1ZG5A 1XMXA 3DBHB 3HSFA 2W84A 4LITA 1X58A 3QWLA 5JIYA 2V9VA 2DMQA 2NOJB 4RAFA 4FX4A 2ID3A 2JSCA 3HPGA 4B8XA 1XDUA 1HA8A 2GZWA 5HODA 3ZP5A 3EP0A 2WY7Q 5CCMA 3W2VA 3TW6A 1K4SA 1WZ2A 3LA7A 3NARA 2BGCA 4Y33A 1WJFA 2LBFB 5DUKA 5FRMA 2J5PA 4OAYA 4E47A 1L0OC 1U5TC 2M4GA 2F5DA 5LHHA 3WE3A 3DLAA 2GA2A 4U0YA 3WGGA 2PG4A 3H3VK 4L9TA 3ONQA 5FKMA 5E20A 3K4CA 3ZMVA 4WX9A 3L2WA 1U5TA 2IAIA 3DKWA 3MN2A 3M53A 2FEZA 4MLOA 1ZHFA 3F8NA 3A01A 1GV2A 3ULQB 4C2MJ 3IRQA 1I1SA 5CCLA 1YS7A 4D5CA 2P5LC 1O3SA 3K70C 2LMDA 2H6BA 2H8WA 3OY9A 3A1YA 3OYBA 2QQ8A 1YYVA 4AVZA 2X6OA 1BR4A 4XQFA 2P6TA 3WGIA 3OV8A 3WTYC 3ZGKA 1MSFC 4MEXF 3BTJA 2QSFX 2L7ZA 3BCAA 2X51A 3C18A 1Y6IA 4F93B 1JKRC 5IT9Z 4Y13A 3CP8A 5C4JJ 2R3AA 5HNHA 1H8AC 1SD5A 2O9LA 1B72B 3EPZA 5CLSA 5LSZA 3EDPA 2R5ZB 2BHZA 4DBRA 1VQNI 1OYIA 1KONA 3S2HJ 4M3BA 3BWGA 2DA4A 1BN5A 4XLFA 2BXZA 1K7AA 1POGA 1A36A 4CO8A 4MI5A 2L4MA 2DPUA 3DLLF 1OMIA 4L5EA 5D8LB 2NVXJ 1N3JA 4FE4A 1N78A 1ORKA 2A3SA 1RRJA 4XSZF 1FOWA 3FXQA 4XOTA 4DYRA 2MSYA 2NAZA 4UUTA 3IH2A 3BTIA 4HF1A 2JA6J 2HKXA 2JT1A 3GWZA 4JBAA 2M45A 3DXJF 3TW7A 1IDZA 2JUGA 2OD5A 1YX5A 1X2MA 3SZGA 3CMAI 2DW4A 3ML6A 1MDMB 2BZTA 4HEA2 4J83A 4KMFA 4JLGA 1KA8A 4P96A 1FOYA 1F43A 3SW9A 2XHKA 3PUBA 1BL0A 3FKJA 2LTPA 3Q9VA 1LDDA 4I01A 3ABUA 4U0VA 3J7ZI 1FYLA 5F59A 2XF5A 5IT3A 2CO5A 3E97A 2ZSHB 1HF0A 2K9LA 4BQQA 4V2FA 3PQJA 3GFLA 1TW3A 4GFBA 3CC4I 3PNTA 3SZTA 3K7AJ 1J9IA 2VQCA 1ETQA 4Y7NJ 2KRCA 2ME0A 3AG1H 1KU3A 2W5YA 2P0WA 3MMYB 2DXIA 3TMOA 1SFUA 2XF6A 2KZGA 2IXSA 1ETOA 2VOPA 1IRGA 4N9HA 4EM1A 4IJ8A 4CCLA 2JN6A 2NVTJ 1J09A 1ZREA 1VQ4I 3CUQB 3R4KA 4XM3A
chains in the Genus database with same CATH topology
3H9QA 1MMAA 2KP6A 2BW3A 3OYGA 2CFOA 1LDKB 1LFPA 4FMUA 3S3MA 2RREA 4II3A 2XC7A 1SFKA 4II2A 1ML9A 1U0JA 4DIQA 5LD2C 3KEYA 1N75A 3DEEA 4IQJA 2IS1A 4YPEA 1P9QC 5CKTA 2LH9A 3ZR8X 3K4MA 3PJRA 2QPWA 5KJLA 3H5RA 1WJAA 2BVLA 2M7BA 5ARFA 4H12A 4IJDA 3MO5A 3K4LA 4CUGA 2KLOA 3CJQB 3PSFA 4D1QA 5KJMA 1QHGA 2IGNA 2VQGA 4NC8A 3S93A 2HVRA 2HQAA 3RSNA 3QWVA 4ZTFA 2DCEA 3EUHC 2MFZA 4BE0A 4C9YA 1DP3A 3U21A 2CW8A 3F9WA 2UV1A 4DJAA 3HG9A 1BOBA 2MABA 3K4BA 3S7JA 3AFHA 3V42A 4BJ5C 3OYIA 4XMYA 4P5OA 3MKWB 4IKFA 1MVXA 1D1CA 4CCNA 3VYTB 2IS2A 4F52A 2JSPA 4CCMA 3OS1A 3OOIA 2XAUA 4RMNA 3KX2A 3OPEA 4OWRB 4XLEA 2G46A 3S7BA 2KMUA 2V26A 3M1CA 2IS6A 2VJ4A 5JHNA 4XLAA 2V4JC 2AQEA 4BU2A 4F92B 4C2TA 2VLAA 5T0MA 5JHFA 2DT7B 3K70D 4AU7A 3M54A 1LVKA 2W00A 3OL4A 1MNDA 3F9XA 4DBQA 3M5AA 2VB6A 2VXDA 1Z3XA 3VDXA 2UWMA 3DU5A 3LFUA 5TGTA 2BQZA 1WJBA 4CCKA 1E0EA 3BC8A 3A2KA 3CBOA 3GBGA 4E7ZA 5EG2A 3M55A 3L2UA 4XKCA 4PJMA 2L7KA 4JQFA 2R7VA 3MO2A 4LIUA 4XKBA 3QYFA 3OYEA 4E6KG 4PFPA 3TL4X 2WBMA 4ZDPA 3SYTA 4Y4RA 4BQNA 3AKZA 3S3OA 3FDYA 3VUZA 3M56A 2IGKA 5HQ8A 4QENA 1ZELA 3ZRGA 2HU9A 2HVSA 2F6CA 1OLTA 2ZFUA 2R7SA 3RPUD 4J01A 1YE9A 1VZ0A 3LSIA 3ZQQA 2PJRB 4XONA 1EA3A 4J00A 2LREA 1MUFA 1N6AA 1X1AA 4NVQA 3A4CA 4RZ0A 2L9SA 3VSKA 2OUMA 1O9SA 4E7KA 1MMNA 4XNFA 4XM3A 2M0MA 2VJ5A 1K6YA 3BLYA 2I8DA 5JJ0A 3OYLA 1G59A 3BCBA 4N4NB 3TG4A 3MO0A 1Z3YA 4CA0A 2VASA 2M7AA 2KZVA 3BG6A 3CZ6A 3E0JB 3RQ4A 3SDBA 4BJ6C 2VXZA 4BE1A 3DU6A 2IGQA 3DTKA 4IQ4A 5ARGA 2HDWA 4BJTA 4B48A 3I9V2 1X1BA 3BG7A 3KMTA 3VSLA 1X4PA 3CJRB 3MKZA 3MEKA 5EX3A 2X6WA 3IUOA 3RIBA 2QKMB 3NWTA 2HVQA 3D5SC 5HI7A 4BGDA 4KJZA 4C2UA 3D5LA 1ZKKA 5F6LA 2M3AA 3VYRB 4E7IA 3OYNA 2ELJA 4BL0B 4YNMA 3LMMA 2F4IA 3S8PA 3FPDA 1TZLA 3DTIA 3HXLA 3VYSB 2MD0A 3KMJA 3OYMA 4QPQA 1WJ5A 4YPUA 4BEHA 3PFYA 3NWSA 2KRHA 4HG2A 3OYKA 1H3IA 3DKXA 4XN3A 4QEOA 1Y56A 3OYHA 1X1DA 2R7OA 3HL2A 2CW7A 4HNUA 2OV7A 3VYUB 4XORA 1N77A 3QYBA 3OYCA 1W36C 3CBPA 5TTFA 4XR6A 2A6TA 2X85A 1FMVA 5EX0A 4C1QA 1WJEA 5FROA 2RFIA 3BO5A 2HZDA 3MD2A 3ZCOA 1N6CA 4JDSA 4JOMA 2RQQA 1D1AA 2JVGA 2KDOA 2CUJA 3OXLA 3L2RA 3K4JA 4YRVA 2WAQA 4E7JA 2GOMA 3HOTA 2BVMA 2K9MA 5F6KC 3DPUA 4CH7A 4BE2A 2V6EA 4E7HA 4ZC3A 4H4KC 1T0FC 3F9KA 3H5NA 2BOLA 3M59A 4YPAA 2LG4A 3IHXA 2AQFA 3IAM2 3QODA 5JINA 2E5NA 3OXFA 4XN0A 1V5FA 3VWBA 2V7FA 4LG3A 2XSJC 2DOAA 4Y3OA 4P1WA 2E1MB 4WUYA 5TH7A 1TT0A 3HC7A 4BEHB 4QPOA 4LDGA 2E5ZA 2FUG2 3QWWA 2R7RA 2CV1A 3DPTA 3RCOA 3K4NA 2WA0A 4HSTA 1SAUA 4PUSA 4C30A 5LFAA 4PSXA 3OYAA 2GOXB 2R7UA 3QYEA 4BDZA 5KCMA 3DWLE 3KMAA 1MW7A 3PNYA 4DOZA 3SWCA 4KITB 3H9GA 4HNTA 4X0GA 3CP2A 4XKVA 2R4GA 4BDYA 2LRDA 4N4OB 3PDNA 4NQWB 4AYBA 4IZZA 2X1DA 3QOEA 4ZDOA 4B44A 5HOOA 1W36D 2OC6A 4GRIA 2L5QA 3OOUA 2L9NA 3UNGC 4XLCA 1D0ZA 2Q2EB 1BR1A 3CMMA 1WJDA 4HSRA 3M8JA 3PL8A 4PJJA 4B47A 2VIXA 3DALA 3C2HA 2W82A 1MVHA 2Z2SB 4RLFA 4YNPA 3DPLC 4ZDLA 3IAS2 1DGWY 4PJLA 4ZTJA 5HVQC 3D5RC 3OWTA 2R7XA 1OR7C 2IGOA 2WADA 3H5AA 2UUZA 2ZSIB 5T0KA 2LBFA 4J8OA 3OL3A 3AL0B 1Z21A 2MYSA 2W7NA 5F5EA 4J7IA 1Z7LA 2BW3B 5HLTA 1V5EA 4RM2A 1XQHA 3F9ZA 3H35A 1MMGA 2E60A 4CZCA 5KJKA 1R6RA 2X1EA 4E4HA 2CUZA 1BR2A 4KT6A 2WAFA 4YNDA 3HNAA 2E1MC 4HRIA 4BACA 4F91B 4BXFA 4QEPA 2IGMA 4XKWA 3OS0A 2V9KA 3L2QA 2WY8Q 3W3CA 4PJNA 2QKLB 4RLQA 3LL7A 1S9HA 3S7DA 2W5ZA 2VL8A 2JV0A 4ZYAA 3UR3C 3W2WA 3M57A 4J7FA 2K5CA 4XOPA 2Z1DA 1UELB 2VKHA 4O30A 3LSGA 2LYCA 2WB1A 5KNLA 3KYLA 3EUAA 4MI0A 3CF2A 1UAAA 2LY2A 2F69A 1QHHD 2CMPA 1PYVA 4PFOA 2A5WA 1PEGA 3HKZA 2HPIA 4G6TB 3TBIA 4LITA 2Z16A 3DKYA 1GLNA 5JIYA 2M4KA 2V1NA 2KQRA 3PSIA 3QWPA 5T5GA 3F9YA 2NOJB 3CESA 4FETA 4NC7A 2CV2A 3HPGA 2WAEA 3N71A 3M58A 4CCJA 1HA8A 2X1CA 3EP0A 2WY7Q 3K10A 3HOSA 3TG5A 3W2VA 5CCMA 3E1SA 3MKYB 1NG6A 5TEGA 5KJNA 1DQUA 4U7BA 3AL0C 4Y33A 4U87A 1MMDA 3I3LA 1WJFA 2LBFB 5FRMA 4OAYA 4E47A 2M4GA 3L2VA 3OIQA 3DLAA 5FRNA 3K6GA 2W4SA 3ONQA 3OXGA 3K4CA 3VV0A 3L2WA 3RU0A 2R7WA 1X19A 1G8XA 3LSMA 3M53A 4I51A 4MLOA 3N05A 5AYFA 3FBIB 3G2BA 2KL4A 3SEQA 4BQOA 1UG0A 2X6XA 3ZXSA 3IP4B 1WJCA 3LSKA 4HPQA 2HPMA 1JI8A 3OR2C 1MT6A 3K5KA 3FBNB 3K70C 4YEJA 5CCLA 4CSWA 2VJJA 3OY9A 1QU3A 3A1YA 3OYBA 1X4OA 2RNGA 1D0XA 5LSXA 2VKDA 4AVZA 1BR4A 1IRXA 4XQFA 2PMZA 4RM3A 4PK4A 2DT6A 3ZGKA 4ZJZA 2VQHA 4Z4PA 4DGWB 5CQEA 2O8JA 3BCAA 2X51A 4NUBA 1Y6IA 2F5VA 4F93B 2CS3A 2R3AA 1LKXA 3CP8A 5HNHA 5CPRB 3EPZA 5LSZA 2CV0A 4FASD 1NG7A 4DBRA 2KHMA 1KONA 3OMYA 4D9JA 1V5GA 4XLFA 4OAZA 4BUPA 2KPMA 2ZXHA 4F55A 4E7LA 3OS5A 4MI5A 3OYFA 4BS9A 4NJ5A 3OYJA 2VJIA 1N3JA 2JA2A 1N78A 3DB5A 4XOTA 3RJWA 4ANJA 3EUKL 4E7SA 4PSWA 1D0YA 1MNEA 2XDVA 3H0DA 3RTRA 4NNJA 1X1CA 3DTEA 2DJIA 2JUGA 1YX5A 2VQLA 3SZGA 2IS4A 2LOOA 3K4KA 4HEA2 4J83A 3OS2A 3W2AA 2JVHA 2VPLA 1D1BA 1YX3A 2PJRA 1WFXA 2LY1A 4JLGA 3H9JA 3SW9A 4B43A 2Q1ZB 3PUBA 1ERDA 3FKJA 4EATA 1AA7A 2K3PA 3FHNA 4O6FA 3OIPA 4IX7A 4XLHA 5F59A 2XF5A 3RAYA 3S32A 2O5RA 2ZSHB 2MC4A 2K9LA 2ZXIA 4BQQA 2CH0A 4F3QA 3PNTA 4YELA 3J7AY 4ITVA 2R7QA 2VQCA 3OR1C 3DQVC 2KRCA 2HNHA 5HNFA 3HPHA 4CCOA 5CQGA 3S3NA 2W1OA 2W5YA 2P0WA 5KHDA 3MMYB 2DXIA 2X6YA 3TMOA 4R79A 2XF6A 4XL9A 4B3XA 2IXSA 1DGRM 1FMWA 3LSHA 3PNVA 4IJ8A 4CCLA 2LC2A 3HUGB 4LIVA 3CBMA 1J09A 2R7TA 4KISA 2Y0SA 1T95A 3S7FA 3C2GA 3OYDA 2XF7A 2L2OA 3SEZA 1PJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXG A;  5JJ0 A;  3VV0 A;  3RU0 A;  3TG4 A;  3MO0 A;  4FMU A;  3M53 A;  3RQ4 A;  4I51 A;  1ML9 A;  5AYF A;  2IGQ A;  4YPE A;  3DAL A;  5ARG A;  1MVH A;  2QPW A;  4YNP A;  5KJL A;  3KMT A;  3MEK A;  5EX3 A;  3RIB A;  5ARF A;  4H12 A;  1MT6 A;  4IJD A;  5HI7 A;  3K5K A;  5CCL A;  1ZKK A;  3MO5 A;  5F6L A;  4YNM A;  5LSX A;  3S8P A;  5KJM A;  3FPD A;  5T0K A;  4J8O A;  3QWV A;  3KMJ A;  4Z4P A;  2O8J A;  5TH7 A;  4YPU A;  2R3A A;  3F9W A;  5F5E A;  4J7I A;  1H3I A;  5CPR B;  5LSZ A;  1XQH A;  4QEO A;  3F9Z A;  3S7J A;  5KJK A;  4BUP A;  1MVX A;  4YND A;  3HNA A;  5TTF A;  3CBP A;  3OS5 A;  4MI5 A;  4NJ5 A;  4QEP A;  3OOI A;  5EX0 A;  4C1Q A;  2RFI A;  3BO5 A;  1N6C A;  4JDS A;  3OPE A;  1N3J A;  3DB5 A;  2G46 A;  3S7B A;  3S7D A;  2W5Z A;  2JV0 A;  3OXL A;  3RJW A;  5JHN A;  3M57 A;  4J7F A;  5T0M A;  5F6K C;  4AU7 A;  3M54 A;  4O30 A;  3F9X A;  3M5A A;  4J83 A;  4MI0 A;  3M59 A;  4YPA A;  4JLG A;  2BQZ A;  3IHX A;  2F69 A;  3SW9 A;  5JIN A;  3CBO A;  3OXF A;  4O6F A;  5EG2 A;  3M55 A;  1PEG A;  3MO2 A;  4WUY A;  5F59 A;  3RAY A;  4LDG A;  5JIY A;  3QWW A;  3QWP A;  3VUZ A;  5T5G A;  3F9Y A;  3M56 A;  5HQ8 A;  4QEN A;  3N71 A;  3M58 A;  3EP0 A;  2W5Y A;  5CCM A;  3TG5 A;  1MUF A;  5TEG A;  1N6A A;  4IJ8 A;  5KJN A;  4NVQ A;  3KMA A;  4RZ0 A;  3CBM A;  3SWC A;  4E47 A;  1O9S A;  3S7F A;  3PDN A; 
#chains in the Genus database with same CATH topology
 2ZFW A;  4OIO F;  1X2N A;  3E6M A;  3OOP A;  1GT0 C;  1IN8 A;  2XRL A;  1LDK B;  3BTL A;  1LFP A;  1QBJ A;  2HQ5 A;  4FMU A;  3S3M A;  3E7L A;  2ZXJ A;  4LB5 A;  1SFK A;  3I59 A;  5GAH J;  2F5F A;  4DZP A;  4YPE A;  1B1B A;  2QPW A;  5KJL A;  2L9V A;  2MC3 A;  2M7B A;  5ARF A;  1ZRD A;  4H12 A;  5M3F J;  2XGX A;  2VBZ A;  4CUG A;  2KLO A;  4UXN A;  2STW A;  1M1E B;  4GDF A;  4A0X A;  2KIF A;  5FGM A;  3LQQ A;  4A3K J;  4NC8 A;  2VQG A;  1RZ4 A;  3JRI A;  1JKP C;  2HQA A;  3RSN A;  2DA6 A;  5KVR A;  2VOD A;  3V7C A;  2MD5 A;  2O0Y A;  5EZH A;  1XB4 A;  3EUH C;  2MFZ A;  3ZQG A;  2CU7 A;  4IRG A;  4OIR F;  3LAP A;  3F9W A;  4HNV A;  2OU2 A;  4NBQ A;  5DCF A;  1YHQ I;  2MAB A;  5J1R A;  5J1U A;  3CCL I;  3S7J A;  3V42 A;  2E36 A;  3OYI A;  6PAX A;  3ZQC A;  1MVX A;  1D1C A;  2RQP A;  4MFE A;  4ZYE A;  4XRS A;  5BPI A;  4IF4 A;  2JSP A;  5KK1 A;  1ON2 A;  4RMN A;  3H36 A;  4CGZ A;  2NOG A;  1MIJ A;  2HQN A;  2MG4 A;  1QZY A;  2V26 A;  4XLA A;  2EBI A;  1R36 A;  2NVY J;  2AQE A;  1I27 A;  2JRM A;  2VLA A;  2DOF A;  5L3F A;  3ABK H;  2DT7 B;  3GEZ A;  3K70 D;  4OIN F;  3QP5 A;  2EH3 A;  1B72 A;  1K83 J;  4IEJ A;  2VB6 A;  4EJO A;  2XVC A;  1SVM A;  1B59 A;  2FQ4 A;  3L09 A;  2VN2 A;  9ANT A;  2BQZ A;  5E3O A;  5DV5 A;  3K0L A;  3S1N J;  4HA8 A;  3V7R A;  4U7D A;  2YR2 A;  3GBG A;  2V79 A;  4JP0 A;  4FTH A;  3L00 A;  2HTJ A;  3TOB A;  1FBS A;  3QYF A;  4HAM A;  3V8K A;  2A07 F;  3TL4 X;  4A6E A;  3KZZ A;  1H0M A;  3S3O A;  4KN7 X;  3VUZ A;  4EM2 A;  1ZEL A;  2HU9 A;  2HVS A;  1XPX A;  3FF5 A;  2ZFU A;  3VOD A;  1QZZ A;  1XX5 A;  1YOV B;  1YE9 A;  1VZ0 A;  3ZPL A;  3RI4 A;  1FTZ A;  1DUX C;  1L3L A;  5A2Q K;  1LE8 A;  1N6A A;  3J80 Z;  1X1A A;  4XBF A;  3N4M A;  1XD7 A;  5JR3 A;  3BY6 A;  1TQP A;  4AC0 A;  1K4T A;  5H6Q A;  3OYL A;  1W1W E;  2XRN A;  3F6O A;  3EYY A;  4LJZ F;  2BBY A;  1R49 A;  3MO0 A;  1Z3Y A;  2OTL I;  3TG4 A;  2VAS A;  4TV7 A;  2P7C B;  1FBQ A;  3VOE A;  3E0J B;  3CZ6 A;  5F1J A;  2HDW A;  3F23 A;  3GTQ J;  3I56 I;  1A04 A;  3I9V 2;  1IN4 A;  1X1B A;  1I39 A;  3ZQ7 A;  1ZR4 A;  3KMT A;  1KYZ A;  5EX3 A;  3TGN A;  1G3T A;  3D5S C;  5HI7 A;  2DA2 A;  3S1R J;  2LD5 A;  4IPA A;  5DCM B;  2EFO A;  4YNM A;  3LMM A;  2CQK A;  3FPD A;  1ENH A;  1GXQ A;  2MD0 A;  4KMU X;  2BY2 A;  4KYW A;  1Y1W J;  2IA0 A;  2HS5 A;  3BR3 A;  4YPU A;  1QZE A;  3JSP A;  4M71 A;  1RET A;  2Z99 A;  2EZK A;  2BY1 A;  1IW7 F;  1P4X A;  2FD5 A;  3I53 A;  1X1D A;  3CCR I;  4HDV A;  5BOX A;  3KE2 A;  2A61 A;  2OV7 A;  2Y9Z A;  1W36 C;  2IW5 A;  2LP0 A;  2PLY A;  5D8K B;  5EX0 A;  2GXB A;  4A3D J;  1B9M A;  2HZD A;  1UHS A;  2JK3 A;  1S5L C;  5BS6 A;  4JDS A;  1IXC A;  2RQQ A;  3K2Z A;  4AIH A;  5E3M A;  2KDO A;  1D3Y A;  2CUJ A;  1IUY A;  1IXS B;  2DFF A;  1IAW A;  4GGG A;  4ENM A;  3U1D A;  4E7J A;  2BVM A;  2HI3 A;  2K9M A;  3KPH A;  5HS9 A;  5DEQ A;  1G4D A;  3JAM K;  3BR0 A;  3DCF A;  3QP6 A;  5LRR A;  4ZH4 F;  1NK2 P;  5B1B H;  4EGY A;  1G6N A;  3FX3 A;  2QQA A;  3LSP A;  1ON1 A;  3H5N A;  3F9K A;  1BW5 A;  4YPA A;  3C2B A;  3NRV A;  1HC8 A;  3JRE A;  3QOD A;  2DO7 A;  1GHC A;  3T5X A;  4XN0 A;  4KT5 C;  1S7E A;  3VWB A;  2E1M B;  1I3A A;  1BW6 A;  2OPT A;  5E8I A;  2I5U A;  1O7F A;  1WI9 A;  2FA5 A;  3PO2 J;  1GUU A;  1FTT A;  1YW9 A;  1RPW A;  4G7O F;  5EG0 B;  2R7R A;  3DPT A;  3K4N A;  3M4O J;  2JA7 J;  1U6G A;  4IVN A;  3HB9 A;  4HST A;  4XRS G;  4ESJ A;  3K1M A;  1OIS A;  1Z05 A;  4PUS A;  4C30 A;  1ETV A;  1VQ8 I;  4MTE A;  2E2J J;  2YSR A;  4IRI A;  1W5S A;  2GXA A;  4W1U A;  4RGR A;  2R7D A;  2H1L A;  5B66 C;  4BDZ A;  1P4A A;  3DF8 A;  2G7U A;  1SVO A;  1ZG1 A;  1JUP A;  1JUS A;  1S29 A;  5GPA A;  1HW1 A;  1MMS A;  2R4G A;  1R9T J;  2DMT A;  3PDN A;  3S17 J;  2X1D A;  4P9F A;  5E1X A;  5M5Y J;  1H89 C;  4ZDO A;  5HOO A;  1RI7 A;  2OC6 A;  2IRF G;  3IKT A;  2QF7 A;  5DM7 F;  4OMY A;  1FPQ A;  1T6S A;  2HXI A;  1WWX A;  2PMU A;  2Q2E B;  2ADU A;  3CMM A;  4PJJ A;  4B47 A;  5LGT A;  5GTI C;  1F5T A;  2W82 A;  2Z2S B;  3DPL C;  4CYC A;  1DGW Y;  2M2E A;  1JKO C;  1ETK A;  1WVR A;  3HOZ J;  5GPC A;  3CO7 C;  1Y0N A;  2M87 A;  2CQX A;  1K78 B;  2QBY B;  2YS9 A;  2ZC2 A;  2QA4 I;  2IGO A;  3VEP A;  1Z77 A;  2X4H A;  2ZSI B;  1HW5 A;  5EGO B;  4KIB A;  3BR6 A;  2XSD C;  2CW0 F;  2DYR H;  2QEX I;  4P55 A;  3KP6 A;  2EA4 A;  1QVU A;  2K4J A;  1A31 A;  2BW3 B;  5BMZ A;  4RM2 A;  1XQH A;  2E60 A;  4CZC A;  5KJK A;  1BI2 A;  4HV5 A;  4KT6 A;  1GVD A;  1BC8 C;  3SFI A;  2B9S A;  2RGV A;  4G7Z F;  2QQB A;  3FXL A;  2IA1 A;  2YX4 A;  4DYQ A;  5IYD J;  2V9K A;  5CVR A;  5CVI A;  2FX0 A;  4PJN A;  1Z91 A;  2QKL B;  3LL7 A;  1MJA A;  3V8L A;  3JTH A;  1VND A;  1IUF A;  4B3A A;  3M57 A;  2DAO A;  5JVT A;  2E19 A;  2XB5 A;  2HWV A;  1BI0 A;  3M9A A;  3LSG A;  2E7X A;  2LYC A;  3K69 A;  4RB2 C;  1C0W A;  1ONV A;  1ZRF A;  3KYL A;  2K9S A;  3K1P A;  3CDI A;  4MI0 A;  4Q5S F;  2JMW A;  2K86 A;  1IJW C;  4NDL A;  2HOT A;  3ABL H;  4D7N A;  1NK3 P;  1XSX A;  5E1Z B;  1VQ9 I;  3R0A A;  1PEG A;  3HKZ A;  2FJ1 A;  4G6T B;  5D6E A;  4NHJ A;  1RC9 A;  2Z16 A;  4MEY F;  4A0Y A;  3JRC A;  2M4K A;  2D45 A;  2LKX A;  5F27 A;  1SFX A;  3QWP A;  5T5G A;  3CES A;  4NC7 A;  3CMY A;  2WB1 N;  4UNO A;  1TC3 C;  2WAE A;  1I3Q J;  5KAF C;  3QU3 A;  1R22 A;  1OKR A;  3GME A;  3TG5 A;  2LFB A;  3ZN1 A;  1ZQ3 P;  4A3E J;  5KJN A;  1DQU A;  1TWH J;  3GZN B;  4U7B A;  3AL0 C;  3BG3 A;  3JR9 A;  4YIR X;  4AM3 A;  2D1V A;  5FRN A;  2ICW G;  5K5Q A;  1R5H A;  2W4S A;  2OQG A;  1RNL A;  1AKH B;  5BPD A;  1G8X A;  2FU4 A;  3B6C A;  2ZBK A;  1U8B A;  2LF7 A;  4LLL A;  5GP9 A;  2E34 A;  3N05 A;  4CIC A;  1UST A;  3FBI B;  3G2B A;  2KL4 A;  1H9G A;  1FSE A;  1VF9 A;  3CDL A;  4BQO A;  2X6X A;  4K2E A;  2ZNY A;  1QVT A;  2O8X A;  3K9T A;  4JK1 X;  4HPQ A;  2JTV A;  4YEJ A;  1ETY A;  3RPQ A;  3CLO A;  3FZV A;  3TO9 A;  3L2C A;  1X4O A;  2OZ6 A;  4A93 J;  1KU7 A;  1X3Z B;  5LSX A;  2E7W A;  1FT9 A;  1IRX A;  4PK4 A;  1VI0 A;  4ZJZ A;  4Z4P A;  3PQK A;  4LG0 A;  2A5Y B;  4NUB A;  4IHS A;  2CS3 A;  1LKX A;  3HZJ A;  4LK0 F;  4A5N A;  1JHH A;  1W7P A;  5ICE A;  3CUQ C;  1MJB A;  2CV0 A;  3DP7 A;  1SMY F;  1NG7 A;  2KIM A;  1J59 A;  1V5G A;  1Z0X A;  4OAZ A;  5J8C A;  4BUP A;  2R93 J;  4FE7 A;  5AIQ A;  2ZXH A;  4HLX A;  4F55 A;  2XKO A;  4E7L A;  3MWM A;  4ENJ A;  5BQT A;  3OYF A;  1WRJ A;  3SJM A;  1RR8 C;  1HST A;  2VJI A;  1MBK A;  2HEO A;  2DDB A;  5FD6 A;  3SEZ A;  4EMS A;  5E8G A;  4HV6 A;  3J7A O;  1JGG A;  3EUK L;  4E7S A;  4PSW A;  1D0Y A;  1ZGA A;  2KJB A;  5ILS A;  3WU2 C;  1MBH A;  3RTR A;  1SD7 A;  2D1H A;  4NNJ A;  2ME6 A;  1X1C A;  1USS A;  2Y31 A;  3I0T A;  4Y17 A;  1I6X A;  1MH4 A;  4MFD A;  1D8K A;  3K4K A;  1X3W B;  3W2A A;  2VPL A;  1OCC H;  1XMK A;  1V54 H;  4CZZ A;  2OCC H;  2VT3 A;  2XRO A;  2V6C A;  1TNS A;  3DV8 A;  4XLH A;  3RAY A;  4RS8 A;  2O5R A;  2UZK A;  1R1V A;  1OCR H;  2XAQ A;  3BT9 A;  4YG2 F;  4RAG A;  2B7E A;  5E1W A;  2DMP A;  5EF6 A;  2HYF A;  3B02 A;  3DQV C;  3S3N A;  5CQG A;  3MQ0 A;  1DGR M;  1R00 A;  1FMW A;  4BNC A;  2LC2 A;  2JWT A;  3HUG B;  4LIV A;  3CBM A;  4KIS A;  2Y0S A;  5HDK A;  3OYD A;  1QQI A;  2J5O A;  3F6V A;  4UUV A;  2L2O A;  1WJD A;  1S7A A;  1PJR A;  3H9Q A;  3F8F A;  2VUM J;  3OYG A;  2LNB A;  5A2Q Z;  3B73 A;  4YFN F;  4XIC A;  2BXY A;  3Q3S A;  3RYR A;  4II3 A;  3PIP F;  1SC7 A;  2NVU B;  1ML9 A;  1U0J A;  1TT5 B;  4DIQ A;  3AAF A;  1G3Y A;  4IQJ A;  1D8J A;  4LD5 A;  4UV9 A;  1Y1V J;  3MVP A;  5CKT A;  1FJL A;  2DT5 A;  4GO1 A;  1WJA A;  2VON A;  4BY7 J;  3W6K B;  5TRD A;  3GFI A;  3MO5 A;  4IHV A;  3PSF A;  3WG7 H;  1A35 A;  3CLQ A;  1S72 I;  3TQN A;  3RDI A;  4D1Q A;  2EIM H;  3T8R A;  1FNN A;  1R23 A;  3I4N J;  3QWV A;  1P7J A;  3MEX A;  2TDX A;  5CVV A;  4A5M A;  4F7Z A;  1OR7 A;  2DCE A;  4C9Y A;  4BHC A;  2UV1 A;  4YII A;  4DJA A;  3M8E A;  2GIV A;  3DBR B;  3F72 A;  3IRR A;  2KIQ A;  1W7P D;  4HYE A;  3QQA A;  3HKZ N;  2DLL A;  1EH7 A;  3EET A;  4GYI A;  4BJ5 C;  3JRH A;  1E3H A;  3MKW B;  4WXD A;  3TP3 A;  1ETX A;  1XCV A;  1T98 A;  4F52 A;  4IHW A;  1YS6 A;  4CCM A;  2OJE D;  5EZG A;  4LGW A;  1BI1 A;  3OPE A;  2G46 A;  2ZJP F;  3E6C C;  2V1U A;  1I5Z A;  3ZMU A;  3S7B A;  3M1C A;  1P4W A;  4CYC B;  2IS6 A;  3VFZ A;  2V4J C;  4BU2 A;  4F92 B;  1B8I B;  1J75 A;  3M3Y J;  1YIO A;  4G6D A;  3KZY A;  3GW2 A;  2FRH A;  2F4M B;  1HOM A;  1FX7 A;  1WCM J;  2ESH A;  4DBQ A;  1O7L A;  3JRG A;  1J7K A;  2VXD A;  3G71 I;  3VDX A;  4M6Y A;  3S1M J;  3HIF A;  5TGT A;  1J0R A;  3DEW A;  4PJ0 C;  3A2K A;  3CBO A;  2CUF A;  4E7Z A;  3C3W A;  2PMH A;  1O3Q A;  1T0F A;  3M55 A;  1GXP A;  4CYD A;  2L7K A;  4JQF A;  1U3E M;  2R7V A;  4A6D A;  1W4M A;  5J3L A;  3IWF A;  2F48 A;  4RA2 A;  4PFP A;  1MGT A;  2E1N A;  1ZAR A;  2WBM A;  4ZDP A;  3O8G A;  1KQ9 A;  1FSH A;  2AXL A;  3VPR A;  3FDY A;  4G6Q A;  3EYI A;  2VC0 A;  1XN7 A;  2DDA A;  3BOQ A;  2FQ3 A;  1OLT A;  4DW6 A;  2DPD A;  2W85 A;  3RPU D;  2QM3 A;  5M3M J;  1T56 A;  4M73 A;  3S2W A;  1OCZ H;  4AYB N;  2PJR B;  1LB2 A;  2LRE A;  1P92 A;  1LFB A;  3BDD A;  2L9S A;  2F2E A;  1PUE E;  2GM4 A;  2O03 A;  4Q4Z F;  3H92 A;  4E7K A;  1NHA A;  4H0E A;  2VE8 A;  5JJ0 A;  1G59 A;  1DU0 A;  2K7L A;  2DOE A;  3BCB A;  1IN6 A;  2AXT C;  2M7A A;  3RQ4 A;  3SDB A;  2VXZ A;  3GTP J;  5TJJ A;  2X48 A;  2IGQ A;  3P5J A;  3BR5 A;  3FIW A;  2R92 J;  3BG7 A;  3L9F A;  1X4P A;  3CJR B;  5B3S H;  5L3G A;  3W6V A;  1EH8 A;  2L9R A;  2V1D A;  3MEK A;  2QKM B;  2HVQ A;  5M5W J;  5F6L A;  3VYR B;  1HBX G;  2ELJ A;  4LLG F;  4BL0 B;  1XMA A;  4WXH A;  3VYS B;  1PUF B;  1RES A;  1YW8 A;  1ZGJ A;  3G73 A;  3OYM A;  4QPQ A;  3LNQ A;  4N9I A;  2DBB A;  1WJ5 A;  4JX5 A;  1IXR C;  4KUM A;  1QNT A;  1FZP B;  4BEH A;  5EYR A;  3OYK A;  3ZOB A;  4XN3 A;  2H27 A;  3HGY A;  4I76 A;  3ABT A;  3OYH A;  1FLI A;  3KEQ A;  3VYU B;  1N77 A;  1F9N A;  4ZYH A;  1HW2 A;  2IPQ X;  1OJL A;  1KQ0 A;  2RFI A;  3BO5 A;  1TWC J;  3MD2 A;  5M5X J;  2YUS A;  5IOZ A;  2JVG A;  2Q8K A;  2VC1 A;  4FX0 A;  3NEU A;  2CJJ A;  2X0L A;  3KP4 A;  3CCJ I;  1SAN A;  1FP1 D;  3HHG A;  5CYV A;  4ON0 A;  1T08 B;  5FLX Z;  2EK5 A;  3HHH A;  2ZJ2 A;  4CH7 A;  2ZJR F;  3IL2 A;  2G0E A;  3FXJ A;  4ETS A;  4EV0 A;  3L7W A;  5IPA A;  2BOL A;  1EF4 A;  3M59 A;  3S15 J;  3F3X A;  2LG4 A;  5J8F A;  1EV7 A;  1WSU A;  4A12 A;  2JA8 J;  3AG3 H;  2XSJ C;  2DOA A;  4Y3O A;  3Q0U A;  3WTZ A;  3HC7 A;  4BEH B;  4QPO A;  3CCQ I;  2QGU A;  1VQL I;  2KDZ A;  5JLX A;  2E5Z A;  2FUG 2;  4D7M A;  4OMZ A;  2GIZ A;  3QPT A;  3G6E I;  3F8M A;  1MDM A;  5EEG A;  1SAU A;  2JA5 J;  2Y9Y A;  3COA C;  2Q2E A;  5LFA A;  4PSX A;  3H1C A;  1X1P A;  2I10 A;  3S1Q J;  3GXO A;  5D5U B;  5E17 F;  3RPU A;  4IHT A;  2R7U A;  4XID A;  1ZYR F;  2R7F A;  2XPV A;  1A6I A;  3IHU A;  2WAQ N;  5KCM A;  1MW7 A;  4DOZ A;  1SFO J;  4IOA F;  1T39 A;  1STZ A;  1QRY A;  3JRA A;  4AIK A;  2CG4 A;  4QTR A;  5FJ8 J;  4I02 A;  3LA2 A;  3ZN0 A;  3F21 A;  3BJ6 A;  4BDY A;  3RZO J;  1KQ8 A;  3HRM A;  5F04 A;  3QOE A;  4N0B A;  5LRS A;  3ZMD A;  3UNG C;  5JI6 A;  4LLN A;  4M3G A;  2Z33 A;  2FBH A;  3SHF A;  4ASN A;  1D0Z A;  1BR1 A;  3A01 B;  4HSR A;  3LAJ A;  3KCC A;  3M8J A;  3PL8 A;  3ASN H;  3KP7 A;  1MVH A;  2WV0 A;  4HX4 A;  1SMT A;  4FCY A;  4ZDL A;  2MH2 A;  1U5T B;  4HF0 A;  2NS7 A;  4KIG A;  1JJ8 C;  5DDG A;  1ODD A;  4IOC F;  3D5R C;  2Y0M A;  3EUH A;  5JVG F;  3FM3 A;  2UUZ A;  2XGC A;  3KP3 A;  2LBF A;  5LGN A;  2NVQ J;  3PIO F;  2STT A;  3IC7 A;  4RGU A;  1R58 A;  5AON A;  3CD6 I;  4UUS B;  2Z3Y A;  1LEB A;  1V5E A;  3H35 A;  1MMG A;  2EZI A;  3S16 J;  1HKS A;  1MBJ A;  2VPR A;  3M1E A;  2O6G E;  2RV8 A;  1BR2 A;  3IKV A;  4A3L J;  3C7J A;  3HNA A;  4BAC A;  3CJN A;  4F91 B;  4XKW A;  2K3F A;  2NXN B;  5F08 A;  2HKO A;  1R4N B;  1UHW A;  5L3D A;  2D2W A;  3S7D A;  2EIJ H;  2W5Z A;  3RKX A;  3MZH A;  3ZQH A;  4ZYA A;  2QWW A;  4PCQ A;  3V7S A;  1CF7 B;  1HDD C;  4HOB A;  2MH9 A;  2W48 A;  2WWY A;  1UB9 A;  2AO9 A;  5J1Y A;  1UG2 A;  2KFD A;  1ZLJ A;  2Z1D A;  1UEL B;  4EJT A;  2M1B A;  5KNL A;  1Y8Q B;  3FWE A;  1K78 A;  1OPC A;  3HOY J;  3HJE A;  2LY2 A;  4IRH A;  2F69 A;  2K85 A;  1JKQ C;  1XGS A;  2Y2Z A;  3CDH A;  1BJZ A;  2CMP A;  4UHT A;  2M30 A;  3I64 A;  1TQI A;  2A5W A;  1JHF A;  4RDU A;  1LUJ B;  4G8X A;  2ZKZ A;  1NH3 A;  3HTU A;  3MCZ A;  1GLN A;  3DKY A;  2EWN A;  3E5X A;  1KU9 A;  2V1N A;  1WI3 A;  1MKM A;  1PVE A;  4WXC A;  2CV2 A;  4Q48 A;  1HQC A;  2EZH A;  1LDJ A;  3N71 A;  3KET A;  3M58 A;  4CCJ A;  4HX7 A;  3JRF A;  3HBL A;  3D0S A;  1JTY A;  3K10 A;  1S8N A;  3E1S A;  3MKY B;  5LHG A;  1NG6 A;  1K79 A;  2CQN A;  2RAE A;  1NTC A;  1MMD A;  4IXA A;  3I3L A;  4RB1 A;  1DPR A;  1RUN A;  2PFB A;  2EB7 A;  4BY1 J;  3L2V A;  2XAH A;  1APL C;  1YRN A;  1HXD A;  3AG4 H;  3GFM A;  2IT0 A;  3K6G A;  3HSE A;  1JT0 A;  3VV0 A;  2PMZ N;  3RU0 A;  1UMQ A;  2VT2 A;  2R7W A;  3HYI A;  3LSM A;  1JJ6 C;  1BI3 A;  3WU0 A;  3GF2 A;  1SAX A;  4L9V A;  3BZK A;  4Z6Y A;  1Y0U A;  1TP4 A;  4ZZD A;  1AWC A;  1YLF A;  3RJP A;  3TO6 A;  1UG0 A;  3EQL F;  3ZXS A;  4G7H F;  3IP4 B;  2LF8 A;  1WJC A;  2M5W A;  2HPM A;  4HF2 A;  3FBN B;  1T38 A;  3K5K A;  4NQW A;  2VJJ A;  2MBF A;  2RNG A;  5K7Z A;  2QSH X;  1R5I D;  2TRT A;  5GAE J;  2VKD A;  2LLK A;  3QAH A;  4MHG A;  2DI3 A;  2CWE A;  2DT6 A;  4C3H J;  2FOW A;  4L0Z B;  5HLG A;  4DGW B;  1XSV A;  2NS8 A;  5ILU A;  1MNM C;  1RR7 A;  5D4R A;  2YU9 J;  3GO5 A;  3BQZ A;  5LBQ A;  2GWR A;  4FAS D;  1W0U A;  3GCM A;  4OIQ F;  1PDN C;  4JX6 A;  3LOC A;  3SZP A;  1V3F A;  2KPM A;  5HLH A;  3VB2 A;  3OS5 A;  1VQ5 I;  3GYH X;  2JPC A;  3OYJ A;  1J5Y A;  1EH6 A;  2F5C A;  1WH5 A;  5F0H A;  1UZC A;  2JA2 A;  3M7G A;  4D5F A;  2DA5 A;  2Y75 A;  1O4X A;  3RJW A;  5J47 A;  1MNE A;  1S6L A;  3H0D A;  4EEF G;  1GV5 A;  1E3P A;  1IRF A;  4BQA A;  2G7H A;  2ETH A;  2DJI A;  2JJ7 A;  2VQL A;  3PO3 J;  5F0F A;  2IS4 A;  2LOO A;  3RKY A;  2FBK A;  2CUE A;  2JVH A;  2KIS A;  3OS2 A;  1YX3 A;  2PJR A;  2BEO A;  1FYM A;  2QQ9 A;  1WFX A;  2LY1 A;  3FKI J;  3H9J A;  3UKG A;  4B43 A;  1ERD A;  1E3O C;  1AA7 A;  3FXK A;  3IH3 A;  3OIP A;  1H88 C;  4KIC A;  2OBP A;  4IX7 A;  2HDC A;  3A02 A;  3GTK J;  2QSG X;  3FXM A;  4OU0 A;  3S32 A;  1VTN C;  2K27 A;  2ZXI A;  3J7Y J;  2CH0 A;  2LY9 A;  3HGG A;  1IV6 A;  4F3Q A;  4YEL A;  2GLO A;  3L1P A;  4BHB A;  3P9C A;  2AS5 F;  1BA5 A;  3OR1 C;  5HNF A;  2HNH A;  5GTH C;  3T1B A;  3HPH A;  3CUO A;  2W1O A;  2DA3 A;  2JPB A;  3CCU I;  5KHD A;  2X6Y A;  4XL9 A;  4B3X A;  3WOD F;  5J4V A;  3LSH A;  3R0J A;  2M0C A;  1O57 A;  3FXR A;  5FLM J;  1JE8 A;  3CJT B;  2GBY A;  2ZB9 A;  1T95 A;  5ICF A;  1ZH5 A;  1IRZ A;  3S7F A;  1U9O A;  5CJ9 A;  4ESB A;  3ROU A;  4XKC A;  3U9G A;  5JHU A;  1MMA A;  4PZJ A;  5DUI A;  2HOA A;  4QSH A;  2BW3 A;  2FXA A;  5K5O A;  3N97 A;  4GCV A;  1KZH A;  1FOX A;  4KDP A;  2TCT A;  1IDY A;  2RRE A;  3HEF A;  3E5Q A;  5K1Y A;  3DEU A;  5LD2 C;  3DEE A;  1P9Q C;  3ZR8 X;  3K4M A;  3PJR A;  2R3S A;  4NC6 A;  1E2X A;  1QPM A;  1CF7 A;  2EIN H;  2BVL A;  4IJD A;  1ZRC A;  4A69 C;  3K4L A;  3CJQ B;  3GVA A;  3GTM J;  3G1O A;  4AID A;  2HOE A;  5KJM A;  1QHG A;  1KGS A;  4ABZ A;  5E79 C;  2HVR A;  4YFK F;  2XIG A;  4DYC A;  1FIA A;  5D5W B;  4ZTF A;  1XS9 A;  4X6A J;  4LG0 B;  1DP3 A;  2CW8 A;  3OIO A;  1P7I A;  2ZME A;  3K1N A;  1BOB A;  4C3I J;  3FHZ A;  4UVA A;  3H3U A;  2GQQ A;  3BG9 A;  4XMY A;  4P5O A;  1FBU A;  1U2W A;  5EDN A;  1TW2 A;  4L9J A;  4CCN A;  3TDZ C;  4DNC A;  2IS2 A;  2EV0 A;  3OOI A;  1YFH A;  4I0B A;  4XLN F;  2ZXW H;  4HZF A;  3WTS C;  5E3N A;  2DA1 A;  4EJW A;  1QPI A;  3WTX C;  2KMU A;  3Q0W A;  2VJ4 A;  1V4R A;  4RGX A;  5JHN A;  4C2T A;  2FOK A;  2C6Y A;  5T0M A;  5JHF A;  2NRA C;  3M54 A;  3FM5 A;  2A6H F;  1CQT A;  1OCP A;  2W00 A;  4DQ2 A;  2R5Z A;  4L5I A;  4M6V A;  3D1N I;  3GTG J;  1MND A;  3F9X A;  2EV5 A;  1MD0 A;  2PJP A;  3M5A A;  3E6B A;  3CQZ J;  1VQO I;  3DU5 A;  2ELK A;  3LFU A;  5ILV A;  1WJB A;  2YX7 A;  4CCK A;  1E0E A;  1YW7 A;  3BC8 A;  1HDP A;  5H2F C;  1YJN I;  5B5E C;  2M34 A;  3KIO A;  3I59 B;  3LA3 A;  4AD9 A;  2XAJ A;  4LIU A;  4XKB A;  3I71 A;  4E6K G;  3OYE A;  4GYG A;  5DM6 F;  5L3B A;  2O8K A;  1W0T A;  3AG2 H;  5EGO A;  4Y4R A;  2RC4 A;  3LSJ A;  2O7O A;  3SFZ A;  3M56 A;  5HQ8 A;  4QEN A;  3ZRG A;  5DCM A;  4MQ9 F;  4RAY A;  3F8C A;  4XON A;  1EA3 A;  3M8F A;  5IY5 H;  2FNA A;  2P5K A;  1BM9 A;  4J00 A;  1YTY A;  1AU7 A;  2DTR A;  4NVQ A;  4HX8 A;  3A4C A;  4M9X A;  5FLX K;  5EEA A;  3FXO A;  1SFE A;  5F64 A;  1I1G A;  2OUM A;  4M72 A;  3O6B B;  4XNF A;  2GXG A;  1D5Y A;  1CGP A;  1JT6 A;  1G3S A;  3BLY A;  3HOX J;  1ACI A;  3DFG A;  2DU9 A;  2OF7 A;  4J19 A;  2EFN A;  4BE1 A;  2JQ7 A;  1XDS A;  3BTC A;  3CO6 C;  4IQ4 A;  3OSG A;  4ZZL A;  3TDU C;  2ELH A;  4B48 A;  2PBI A;  4KNY A;  2ZJQ F;  1XCB A;  5K5R A;  5LGU A;  3RIB A;  1Y8R B;  2HYJ A;  5LHI A;  3R60 A;  4KJZ A;  1ZKK A;  2P7V B;  2M3A A;  2F4I A;  3S8P A;  1V55 H;  1AHD P;  1TZL A;  5EG0 A;  1VQM I;  4W97 A;  3KMJ A;  1EKE A;  2BY3 A;  4L9N A;  3CC7 I;  2GA1 A;  5EEH A;  1WPK A;  2EJR A;  3KEO A;  1A5J A;  2ISY A;  4KN4 X;  2E1O A;  1TWA J;  4HG2 A;  3DKX A;  1IN5 A;  2NS0 A;  5E3L A;  1Y56 A;  2L54 A;  1TWF J;  5K7F A;  3HL2 A;  2L7F P;  3ZMZ A;  5BNG A;  2FF4 A;  1XGN A;  4HNU A;  4HLY A;  2Y69 H;  3S14 J;  1T33 A;  4XOR A;  5TTF A;  4XR6 A;  2A6T A;  1FMV A;  4C1Q A;  1WJE A;  4G94 A;  2ISZ A;  3ZCO A;  4A3I J;  4JOM A;  5J4Y A;  2HFH A;  1KYW A;  1F36 A;  3IWZ A;  1AKH A;  2ECC A;  3OXL A;  1N25 A;  2VKE A;  5H20 A;  3J81 Z;  2WAQ A;  2QCO A;  5GAD J;  2GOM A;  3HOT A;  3RYP A;  1K61 A;  2EQR A;  2QLZ A;  5DD4 A;  3WGH A;  4BE2 A;  2V6E A;  3F8B A;  4ZC3 A;  5AIP A;  3E3V A;  4B09 A;  1XGM A;  2EIK H;  2PEX A;  2IA2 A;  3IHX A;  5DTD A;  4BYY A;  2R7Z J;  2E5N A;  5KAI C;  5D4S A;  4BKX A;  1TWG J;  2LVS A;  1U8R A;  3OXF A;  5IP9 J;  5J6X A;  4OIP F;  4P1W A;  2QEN A;  1WH7 A;  4L5J A;  4WUY A;  5ICG A;  3V8J A;  4JX4 A;  4XLP F;  2L3D A;  1Z1D A;  2DK8 A;  5IT9 K;  4LDG A;  5HDG A;  4HW0 A;  1OCO H;  4O6J A;  3RCO A;  3G1M A;  1J2X A;  1SD6 A;  2BV6 A;  5FO5 A;  5FFX A;  1U9N A;  3WHC A;  4QLC U;  4YFX F;  3R61 A;  2GOX B;  4QIW N;  1YIJ I;  1QO0 D;  1Z67 A;  3DWL E;  3PNY A;  3SWC A;  3H9G A;  4HNT A;  4X0G A;  2FE3 A;  1DPU A;  2CQ7 A;  3CP2 A;  3V4G A;  3GTJ J;  3NAU A;  3JSO A;  3E5U A;  2R5Y B;  1FYK A;  2QUF A;  4R8H A;  3WHB A;  2P4W A;  4IZZ A;  4MIM A;  2PX9 A;  3TOA A;  1W36 D;  1ZK8 A;  4UY8 I;  3OOU A;  1W5T A;  1H9T A;  2DMN A;  4WCG A;  2CRG A;  4XLC A;  1D5V A;  1RIO H;  1ZGW A;  5ICC A;  2RKH A;  1IZ1 A;  3CCM I;  1XC5 A;  2VIX A;  3DAL A;  2JZY A;  1W7P B;  5C44 J;  2VE9 A;  2FSW A;  4A0Z A;  4RLF A;  3BRO A;  3MZ8 A;  2VBW A;  2MLG A;  5FKL A;  2Y0S N;  5LEK A;  4UVB A;  4ZTJ A;  2ACJ A;  3HRS A;  3OWT A;  2R7X A;  1OR7 C;  2WAD A;  3FMS A;  3FK6 A;  3PUF A;  1Z7U A;  2WTE A;  4PDK A;  4YIF A;  3LQR A;  2A6E F;  3AL0 B;  1Z21 A;  1IV8 A;  2HTS A;  4WF2 A;  2JUC A;  1ZKG A;  2DMU A;  5IYC J;  5F5E A;  4J7I A;  1Z7L A;  5F1R A;  5ED4 A;  1VFC A;  2KIU A;  2O3F A;  4G12 A;  5HLT A;  1XTA A;  3QRF F;  1R6R A;  2X1E A;  3G1L A;  4E4H A;  3JCU C;  2WAF A;  3SQN A;  4L18 B;  1WHU A;  3ELK A;  4BBR J;  4YND A;  3S2D J;  2ID6 A;  4HRI A;  1MH3 A;  4CDG A;  3GZ6 A;  2IGM A;  2W25 A;  4QEP A;  4V2G A;  2OTJ I;  3L2Q A;  4DZJ A;  2DA7 A;  4M3D A;  4BXX J;  1S9H A;  3HUG A;  2VL8 A;  2KRF A;  3BQY A;  2JV0 A;  3ABM H;  1QGP A;  2Q0O A;  5HDN A;  5EJC A;  3GLL A;  2R5Y A;  4CHU A;  4J7F A;  1UFM A;  2ESN A;  4M3E A;  1XSD A;  3H3Z A;  2D5V A;  1JUM A;  1OCT C;  1LE8 B;  5IP7 J;  2QVO A;  1ULY A;  2M8E A;  3ESW B;  2ZME C;  4PFO A;  2IEK A;  2EA2 A;  2RDP A;  4XK4 A;  3WU1 B;  2HPI A;  1WQ2 A;  5CVU A;  3TBI A;  1R71 A;  4B4C A;  2KQR A;  3PSI A;  2OA4 A;  3O8H A;  3F0C A;  2EV6 A;  2H6C A;  4FET A;  4BHP A;  2E71 A;  5JLW A;  3F9Y A;  2G9W A;  1DDN A;  3ECH A;  4IHX A;  5FKN A;  2X1C A;  1VQP I;  1I6H J;  4A3F J;  4I7H A;  5K7H A;  3HOS A;  2V9P A;  3J81 K;  5TEG A;  4HQE A;  2HYG D;  4M9S A;  2FBI A;  3P7N A;  3I5U A;  4EVI A;  4U87 A;  4IHY A;  3OIQ A;  2KJC A;  4AUX A;  4PGG A;  5C4X J;  2RVC A;  3OXG A;  4WWC A;  2EFW A;  2XKP A;  2DN0 A;  3HSR A;  2K9N A;  4ESF A;  1X19 A;  2BE5 F;  4EM0 B;  1ZTR A;  5FKO A;  4I51 A;  5AYF A;  5FD5 A;  1MSE C;  1LJ9 A;  3SEQ A;  2H09 A;  4MNU A;  3CCV I;  1SD4 A;  1WGX A;  3LSK A;  1JI8 A;  3OR2 C;  1MT6 A;  3BPX A;  2MGQ A;  4CSW A;  1VQK I;  1QU3 A;  2VBY A;  2DFH A;  1R1U A;  2P8T A;  1TBX A;  1D0X A;  3P9I A;  3F22 A;  3ERE D;  2PMZ A;  4RM3 A;  2IVM A;  2VQH A;  4A3C J;  3SDG A;  4S0H B;  5C3E J;  2COB A;  5CQE A;  2O8J A;  5TH7 A;  2F5V A;  1LQ1 A;  3U2R A;  1OFC X;  2Y48 A;  5CPR B;  1IC8 A;  3QPS A;  2WV1 A;  3RQI A;  1GVJ A;  2KHM A;  1Q1H A;  3OMY A;  1FEX A;  4D9J A;  1LPQ A;  2IJL A;  1EJ9 A;  1SVL A;  3WTT C;  3KYD B;  4BS9 A;  2EFP A;  1FOK A;  4NJ5 A;  3MAJ A;  1JXS A;  2ZO4 A;  1P6R A;  4D0P A;  3BG5 A;  3DB5 A;  2UXN A;  4O5V A;  2P6S A;  2P5V A;  3BR1 A;  4I0A A;  3TP0 A;  4ANJ A;  1BBY A;  2XDV A;  2XUB A;  1OYY A;  2EPF A;  3ISP A;  3DTE A;  2BY0 A;  5ERI A;  1BIB A;  1HLV A;  1BC7 C;  3CCS I;  4HQM A;  2E2H J;  3RKW A;  1D1B A;  2BYV E;  3Q0V A;  5F0C A;  1S3J A;  2Q1Z B;  2CYY A;  4EAT A;  1O3R A;  5FB2 A;  2K3P A;  2O61 A;  3FHN A;  4O6F A;  2PQ8 A;  1LVA A;  4JYK A;  3B6A A;  3ZQI A;  3A03 A;  1FP2 A;  1LEA A;  2COM A;  2EIL H;  2F5E A;  1WKM A;  4UUS A;  2MC4 A;  1REP C;  3PM1 A;  1Q1V A;  3BZC A;  4LB6 B;  2E2I J;  3J7A Y;  4ITV A;  2NNY A;  4LMY A;  2R7Q A;  3Q5F A;  4QWQ A;  3BP8 A;  2QZ8 A;  5D5V B;  2VKV A;  4CCO A;  3JRD A;  3QOP A;  5IP6 A;  5IYB J;  2DYS H;  3KYC B;  4R79 A;  2LKP A;  5DD8 A;  5D6F A;  1LFU P;  3PNV A;  2DTZ A;  3HOU J;  5LEJ A;  4RBO A;  2R7T A;  1O3T A;  2HXO A;  1I50 J;  3C2G A;  2XF7 A;  3CCE I;  1LNW A;  3H0G J;  1IN7 A;  3I55 I;  2VBX A;  2KP6 A;  2KKO A;  4ENN A;  2MLK A;  2HDD A;  1JTX A;  2CFO A;  4FT8 A;  5IOY A;  3U1K A;  3REO A;  2XC7 A;  4II2 A;  2RNJ A;  3KEY A;  1N75 A;  2XV4 S;  1R7J A;  5DS9 A;  4Z2Y A;  2IS1 A;  2LH9 A;  3LWF A;  1MBE A;  3WTV C;  3T0Y A;  3H5R A;  4ZYD A;  4AVP A;  2NYX A;  3WE2 A;  1Z9C A;  2PN6 A;  2FML A;  4IL6 C;  4PGH A;  3IH4 A;  1FY7 A;  4UV8 A;  1G3W A;  4O3M A;  2Z9O A;  2X9D A;  2IGN A;  1T8I A;  3S93 A;  2HOS A;  4FQG A;  2ZCW A;  4Q47 A;  2LR8 A;  3NQO A;  4BE0 A;  1Y39 A;  3U21 A;  1F4K A;  5LLQ A;  3SXY A;  1ZG3 A;  1HSJ A;  3HG9 A;  3CC2 I;  3HTS B;  3K4B A;  2H94 A;  3AFH A;  3G4S I;  4IJA A;  3O2P E;  1DU6 A;  4IKF A;  2FMY A;  3VYT B;  1R4M B;  3OS1 A;  2XAU A;  4E70 A;  3KX2 A;  4OWR B;  1JGS A;  4XLE A;  4BH9 A;  2DOD A;  4Y52 J;  2QBY A;  3A0H C;  2A69 F;  1ZR2 A;  4L0Y B;  2LDU A;  1IO2 A;  1TQM A;  4B1R A;  1MJ9 A;  1ZAO A;  4AU7 A;  1S7O A;  2M8G X;  1RKW A;  3GFJ A;  3RKQ A;  1LVK A;  2EZL A;  3OL4 A;  1B6A A;  3ZMT A;  5L3C A;  4A3J J;  2QYO A;  4S04 A;  1Z3X A;  2UWM A;  2EFQ A;  5J40 A;  1YIT I;  3LFK A;  4KA4 A;  3I4P A;  5EG2 A;  3MKL A;  3L2U A;  2XPW A;  1RKT A;  4V19 K;  1HKQ A;  4PJM A;  3MO2 A;  2K4B A;  3MFK A;  2R0Q C;  1YJ9 I;  1AOY A;  2K9Q A;  2KT0 A;  4XRF A;  4P9U A;  3SYT A;  1PUF A;  2WC2 A;  4BQN A;  3AKZ A;  2XGE A;  3JW4 A;  2IGK A;  1T2K A;  2HZT A;  3GTL J;  1VQ6 I;  2F6C A;  1YO5 C;  2R7S A;  1BIA A;  4J01 A;  2F4O B;  2ZNZ A;  2Y30 A;  3LSI A;  2P81 A;  3ZQQ A;  3JRB A;  2MA3 A;  2XAG A;  4Y15 A;  1X3U A;  4AWX B;  1MUF A;  3HRU A;  4RZ0 A;  2XPU A;  3VSK A;  3KP2 A;  2B63 J;  1BOA A;  5HS8 A;  1O9S A;  3ASO H;  1MMN A;  4X1E A;  3BPV A;  4RAZ A;  2E1C A;  4LK1 F;  3T8T A;  2M0M A;  2VJ5 A;  1K6Y A;  2I8D A;  3ZMS A;  3J80 K;  4N4N B;  5HLI A;  4CA0 A;  1TNT A;  2LKS A;  2KZV A;  3BG6 A;  2XAS A;  4BJ6 C;  1TTY A;  3FK7 A;  4UB8 C;  5GAG J;  3DU6 A;  3FMQ A;  3GTO J;  3DTK A;  3KZI C;  1MBF A;  1F1Z A;  1UHM A;  2ZME B;  2GAU A;  5ARG A;  4BJT A;  3JTG A;  3VSL A;  5B1A H;  4G9Y A;  3MKZ A;  2X6W A;  3IUO A;  3NWT A;  4ENK A;  2HGC A;  4BGD A;  4C2U A;  3D5L A;  2N8G A;  3GX4 X;  4E7I A;  3OYN A;  3HRT A;  2OCE A;  3O3K A;  1IGN A;  5F6F A;  3DTI A;  3HXL A;  1B4A A;  2CGP A;  2CQQ A;  3I4M J;  3ECO A;  2A68 F;  2AHQ A;  3KFW X;  4IO9 F;  3QPL A;  4GXO A;  3PFY A;  3NWS A;  2KRH A;  1H3I A;  3WG9 A;  3QPH A;  4M6X A;  5CVJ A;  4A3B J;  4QEO A;  2R7O A;  4RGS A;  2CW7 A;  4U88 A;  1R5G A;  1ITY A;  3CF5 F;  3QYB A;  3OYC A;  3CBP A;  2X85 A;  2HR3 A;  5FRO A;  5E18 F;  4LFU A;  1N6C A;  4EQQ A;  2LK2 A;  2VOO A;  1HKT A;  4XSX F;  1D1A A;  3TO7 A;  4HBL A;  3W6J B;  4RB3 C;  1W5C C;  1YG2 A;  3CCY A;  3L2R A;  3ERM A;  1SEU A;  3K4J A;  3C1D A;  4YRV A;  4AIJ A;  1Z6R A;  2OZU A;  2XGD A;  5F6K C;  3DPU A;  3LSR A;  4HDU A;  2UXX A;  3I54 A;  4E7H A;  4EJV A;  3KLO A;  3A0B C;  4H4K C;  3IV5 A;  4BBS J;  1T0F C;  4KIF A;  2LSO A;  1FC3 A;  2AQF A;  3DBL B;  3IAM 2;  4M3F A;  5JIN A;  1E17 A;  2DQR A;  1UJ8 A;  1MBG A;  3CTA A;  4MGR A;  1V5F A;  2L02 A;  2B0L A;  2V7F A;  4LG3 A;  3OSF A;  2BHY A;  2VI6 A;  1TT0 A;  1IF1 A;  3R6S A;  1VQ7 I;  2DJN A;  4OOI A;  4MTD A;  2L4A A;  1YQA A;  1ETW A;  2ECB A;  3QWW A;  1R1T A;  2CV1 A;  1B8I A;  4R1H A;  3HOV J;  3GUD A;  4RB0 A;  4CXF A;  1ZLK A;  2WA0 A;  1FWZ A;  3I58 A;  1OQY A;  3HOW J;  4LOC A;  2XB0 X;  1A6Q A;  3RZD J;  3FXU A;  3OYA A;  3HM5 A;  3GLX A;  2H1K A;  3BJA A;  3QYE A;  2Z5U A;  3KMA A;  1GDT A;  1G2H A;  3HDD A;  4XRM A;  3ZQF A;  4KIT B;  1ZN2 A;  5D5X B;  4XKV A;  1B9N A;  3MZY A;  2LRD A;  2CFX A;  3BJO A;  4N4O B;  4NQW B;  5HS7 A;  4AYB A;  2IP2 A;  4B44 A;  1KU2 A;  4I99 C;  5FFZ A;  1XG1 A;  4GRI A;  2L5Q A;  2L9N A;  4ZYG A;  1RUO A;  3BR2 A;  4A2U A;  4M9Z A;  3BZ6 A;  2DFI A;  1XGO A;  3TKY A;  4FIS A;  4WK8 F;  5DYM A;  1BJA A;  3C2H A;  2FNP A;  4UB6 C;  4EGZ A;  4YNP A;  2CSO A;  2L01 A;  3IAS 2;  4PJL A;  2PI0 A;  2DQL A;  2DK5 A;  5HVQ C;  2RN7 A;  2YPR A;  4M74 A;  2K02 A;  3H5A A;  4EJU A;  3WTW C;  5TIS C;  3P9K A;  2L7M P;  4NB5 A;  1TL8 A;  1IG7 A;  2W24 A;  5T0K A;  4S05 A;  4J8O A;  2YU3 A;  3OL3 A;  1DP7 P;  4I09 A;  3QU6 A;  2MYS A;  2L0K A;  2W7N A;  1QA6 A;  2HQR A;  2MW8 A;  3LST A;  2IBD A;  3Q9S A;  3TED A;  1Z6T A;  3F9Z A;  1MZB A;  1FIP A;  2CUZ A;  5L3E A;  1U78 A;  2OQR A;  3X2Q H;  2E35 A;  4A3G J;  4BAY A;  2OAZ A;  2E1M C;  4FHT A;  2XAF A;  4BXF A;  3FIS A;  2V1X A;  3G3Z A;  3OS0 A;  4I6Z A;  1OYW A;  1YJW I;  1P2F A;  3FMR A;  1YRN B;  2WY8 Q;  2A05 A;  3W3C A;  4KFC A;  3JAM Z;  4C3J J;  4RLQ A;  3RIR A;  3E6D A;  4A3M J;  1TLH B;  3W2W A;  3UR3 C;  4I2O A;  1PP8 F;  4BXU A;  1PP7 U;  2JRT A;  3WTU C;  2NNN A;  1UCR A;  1YI2 I;  2K5C A;  4XOP A;  2H8R A;  3KP5 A;  2M9H A;  2VKH A;  2W57 A;  4I98 B;  4O30 A;  3GZ5 A;  3KLN A;  2WB1 A;  3EUA A;  3CF2 A;  4MO7 A;  3PFI A;  1K6O A;  1UAA A;  4MQV A;  3M07 A;  4U0W A;  1QHH D;  1HCR A;  5H6R A;  5FKK A;  2DFE A;  3CME I;  3ZQL A;  5JFR A;  1PYV A;  3CUQ A;  3K2A A;  2K40 A;  5FLV A;  4UVC A;  1ZG5 A;  1XMX A;  3DBH B;  3HSF A;  2W84 A;  4LIT A;  1X58 A;  3QWL A;  5JIY A;  2V9V A;  2DMQ A;  2NOJ B;  4RAF A;  4FX4 A;  2ID3 A;  2JSC A;  3HPG A;  4B8X A;  1XDU A;  1HA8 A;  2GZW A;  5HOD A;  3ZP5 A;  3EP0 A;  2WY7 Q;  5CCM A;  3W2V A;  3TW6 A;  1K4S A;  1WZ2 A;  3LA7 A;  3NAR A;  2BGC A;  4Y33 A;  1WJF A;  2LBF B;  5DUK A;  5FRM A;  2J5P A;  4OAY A;  4E47 A;  1L0O C;  1U5T C;  2M4G A;  2F5D A;  5LHH A;  3WE3 A;  3DLA A;  2GA2 A;  4U0Y A;  3WGG A;  2PG4 A;  3H3V K;  4L9T A;  3ONQ A;  5FKM A;  5E20 A;  3K4C A;  3ZMV A;  4WX9 A;  3L2W A;  1U5T A;  2IAI A;  3DKW A;  3MN2 A;  3M53 A;  2FEZ A;  4MLO A;  1ZHF A;  3F8N A;  3A01 A;  1GV2 A;  3ULQ B;  4C2M J;  3IRQ A;  1I1S A;  5CCL A;  1YS7 A;  4D5C A;  2P5L C;  1O3S A;  3K70 C;  2LMD A;  2H6B A;  2H8W A;  3OY9 A;  3A1Y A;  3OYB A;  2QQ8 A;  1YYV A;  4AVZ A;  2X6O A;  1BR4 A;  4XQF A;  2P6T A;  3WGI A;  3OV8 A;  3WTY C;  3ZGK A;  1MSF C;  4MEX F;  3BTJ A;  2QSF X;  2L7Z A;  3BCA A;  2X51 A;  3C18 A;  1Y6I A;  4F93 B;  1JKR C;  5IT9 Z;  4Y13 A;  3CP8 A;  5C4J J;  2R3A A;  5HNH A;  1H8A C;  1SD5 A;  2O9L A;  1B72 B;  3EPZ A;  5CLS A;  5LSZ A;  3EDP A;  2R5Z B;  2BHZ A;  4DBR A;  1VQN I;  1OYI A;  1KON A;  3S2H J;  4M3B A;  3BWG A;  2DA4 A;  1BN5 A;  4XLF A;  2BXZ A;  1K7A A;  1POG A;  1A36 A;  4CO8 A;  4MI5 A;  2L4M A;  2DPU A;  3DLL F;  1OMI A;  4L5E A;  5D8L B;  2NVX J;  1N3J A;  4FE4 A;  1N78 A;  1ORK A;  2A3S A;  1RRJ A;  4XSZ F;  1FOW A;  3FXQ A;  4XOT A;  4DYR A;  2MSY A;  2NAZ A;  4UUT A;  3IH2 A;  3BTI A;  4HF1 A;  2JA6 J;  2HKX A;  2JT1 A;  3GWZ A;  4JBA A;  2M45 A;  3DXJ F;  3TW7 A;  1IDZ A;  2JUG A;  2OD5 A;  1YX5 A;  1X2M A;  3SZG A;  3CMA I;  2DW4 A;  3ML6 A;  1MDM B;  2BZT A;  4HEA 2;  4J83 A;  4KMF A;  4JLG A;  1KA8 A;  4P96 A;  1FOY A;  1F43 A;  3SW9 A;  2XHK A;  3PUB A;  1BL0 A;  3FKJ A;  2LTP A;  3Q9V A;  1LDD A;  4I01 A;  3ABU A;  4U0V A;  3J7Z I;  1FYL A;  5F59 A;  2XF5 A;  5IT3 A;  2CO5 A;  3E97 A;  2ZSH B;  1HF0 A;  2K9L A;  4BQQ A;  4V2F A;  3PQJ A;  3GFL A;  1TW3 A;  4GFB A;  3CC4 I;  3PNT A;  3SZT A;  3K7A J;  1J9I A;  2VQC A;  1ETQ A;  4Y7N J;  2KRC A;  2ME0 A;  3AG1 H;  1KU3 A;  2W5Y A;  2P0W A;  3MMY B;  2DXI A;  3TMO A;  1SFU A;  2XF6 A;  2KZG A;  2IXS A;  1ETO A;  2VOP A;  1IRG A;  4N9H A;  4EM1 A;  4IJ8 A;  4CCL A;  2JN6 A;  2NVT J;  1J09 A;  1ZRE A;  1VQ4 I;  3CUQ B;  3R4K A;  4XM3 A; 
#chains in the Genus database with same CATH homology
 3H9Q A;  1MMA A;  2KP6 A;  2BW3 A;  3OYG A;  2CFO A;  1LDK B;  1LFP A;  4FMU A;  3S3M A;  2RRE A;  4II3 A;  2XC7 A;  1SFK A;  4II2 A;  1ML9 A;  1U0J A;  4DIQ A;  5LD2 C;  3KEY A;  1N75 A;  3DEE A;  4IQJ A;  2IS1 A;  4YPE A;  1P9Q C;  5CKT A;  2LH9 A;  3ZR8 X;  3K4M A;  3PJR A;  2QPW A;  5KJL A;  3H5R A;  1WJA A;  2BVL A;  2M7B A;  5ARF A;  4H12 A;  4IJD A;  3MO5 A;  3K4L A;  4CUG A;  2KLO A;  3CJQ B;  3PSF A;  4D1Q A;  5KJM A;  1QHG A;  2IGN A;  2VQG A;  4NC8 A;  3S93 A;  2HVR A;  2HQA A;  3RSN A;  3QWV A;  4ZTF A;  2DCE A;  3EUH C;  2MFZ A;  4BE0 A;  4C9Y A;  1DP3 A;  3U21 A;  2CW8 A;  3F9W A;  2UV1 A;  4DJA A;  3HG9 A;  1BOB A;  2MAB A;  3K4B A;  3S7J A;  3AFH A;  3V42 A;  4BJ5 C;  3OYI A;  4XMY A;  4P5O A;  3MKW B;  4IKF A;  1MVX A;  1D1C A;  4CCN A;  3VYT B;  2IS2 A;  4F52 A;  2JSP A;  4CCM A;  3OS1 A;  3OOI A;  2XAU A;  4RMN A;  3KX2 A;  3OPE A;  4OWR B;  4XLE A;  2G46 A;  3S7B A;  2KMU A;  2V26 A;  3M1C A;  2IS6 A;  2VJ4 A;  5JHN A;  4XLA A;  2V4J C;  2AQE A;  4BU2 A;  4F92 B;  4C2T A;  2VLA A;  5T0M A;  5JHF A;  2DT7 B;  3K70 D;  4AU7 A;  3M54 A;  1LVK A;  2W00 A;  3OL4 A;  1MND A;  3F9X A;  4DBQ A;  3M5A A;  2VB6 A;  2VXD A;  1Z3X A;  3VDX A;  2UWM A;  3DU5 A;  3LFU A;  5TGT A;  2BQZ A;  1WJB A;  4CCK A;  1E0E A;  3BC8 A;  3A2K A;  3CBO A;  3GBG A;  4E7Z A;  5EG2 A;  3M55 A;  3L2U A;  4XKC A;  4PJM A;  2L7K A;  4JQF A;  2R7V A;  3MO2 A;  4LIU A;  4XKB A;  3QYF A;  3OYE A;  4E6K G;  4PFP A;  3TL4 X;  2WBM A;  4ZDP A;  3SYT A;  4Y4R A;  4BQN A;  3AKZ A;  3S3O A;  3FDY A;  3VUZ A;  3M56 A;  2IGK A;  5HQ8 A;  4QEN A;  1ZEL A;  3ZRG A;  2HU9 A;  2HVS A;  2F6C A;  1OLT A;  2ZFU A;  2R7S A;  3RPU D;  4J01 A;  1YE9 A;  1VZ0 A;  3LSI A;  3ZQQ A;  2PJR B;  4XON A;  1EA3 A;  4J00 A;  2LRE A;  1MUF A;  1N6A A;  1X1A A;  4NVQ A;  3A4C A;  4RZ0 A;  2L9S A;  3VSK A;  2OUM A;  1O9S A;  4E7K A;  1MMN A;  4XNF A;  4XM3 A;  2M0M A;  2VJ5 A;  1K6Y A;  3BLY A;  2I8D A;  5JJ0 A;  3OYL A;  1G59 A;  3BCB A;  4N4N B;  3TG4 A;  3MO0 A;  1Z3Y A;  4CA0 A;  2VAS A;  2M7A A;  2KZV A;  3BG6 A;  3CZ6 A;  3E0J B;  3RQ4 A;  3SDB A;  4BJ6 C;  2VXZ A;  4BE1 A;  3DU6 A;  2IGQ A;  3DTK A;  4IQ4 A;  5ARG A;  2HDW A;  4BJT A;  4B48 A;  3I9V 2;  1X1B A;  3BG7 A;  3KMT A;  3VSL A;  1X4P A;  3CJR B;  3MKZ A;  3MEK A;  5EX3 A;  2X6W A;  3IUO A;  3RIB A;  2QKM B;  3NWT A;  2HVQ A;  3D5S C;  5HI7 A;  4BGD A;  4KJZ A;  4C2U A;  3D5L A;  1ZKK A;  5F6L A;  2M3A A;  3VYR B;  4E7I A;  3OYN A;  2ELJ A;  4BL0 B;  4YNM A;  3LMM A;  2F4I A;  3S8P A;  3FPD A;  1TZL A;  3DTI A;  3HXL A;  3VYS B;  2MD0 A;  3KMJ A;  3OYM A;  4QPQ A;  1WJ5 A;  4YPU A;  4BEH A;  3PFY A;  3NWS A;  2KRH A;  4HG2 A;  3OYK A;  1H3I A;  3DKX A;  4XN3 A;  4QEO A;  1Y56 A;  3OYH A;  1X1D A;  2R7O A;  3HL2 A;  2CW7 A;  4HNU A;  2OV7 A;  3VYU B;  4XOR A;  1N77 A;  3QYB A;  3OYC A;  1W36 C;  3CBP A;  5TTF A;  4XR6 A;  2A6T A;  2X85 A;  1FMV A;  5EX0 A;  4C1Q A;  1WJE A;  5FRO A;  2RFI A;  3BO5 A;  2HZD A;  3MD2 A;  3ZCO A;  1N6C A;  4JDS A;  4JOM A;  2RQQ A;  1D1A A;  2JVG A;  2KDO A;  2CUJ A;  3OXL A;  3L2R A;  3K4J A;  4YRV A;  2WAQ A;  4E7J A;  2GOM A;  3HOT A;  2BVM A;  2K9M A;  5F6K C;  3DPU A;  4CH7 A;  4BE2 A;  2V6E A;  4E7H A;  4ZC3 A;  4H4K C;  1T0F C;  3F9K A;  3H5N A;  2BOL A;  3M59 A;  4YPA A;  2LG4 A;  3IHX A;  2AQF A;  3IAM 2;  3QOD A;  5JIN A;  2E5N A;  3OXF A;  4XN0 A;  1V5F A;  3VWB A;  2V7F A;  4LG3 A;  2XSJ C;  2DOA A;  4Y3O A;  4P1W A;  2E1M B;  4WUY A;  5TH7 A;  1TT0 A;  3HC7 A;  4BEH B;  4QPO A;  4LDG A;  2E5Z A;  2FUG 2;  3QWW A;  2R7R A;  2CV1 A;  3DPT A;  3RCO A;  3K4N A;  2WA0 A;  4HST A;  1SAU A;  4PUS A;  4C30 A;  5LFA A;  4PSX A;  3OYA A;  2GOX B;  2R7U A;  3QYE A;  4BDZ A;  5KCM A;  3DWL E;  3KMA A;  1MW7 A;  3PNY A;  4DOZ A;  3SWC A;  4KIT B;  3H9G A;  4HNT A;  4X0G A;  3CP2 A;  4XKV A;  2R4G A;  4BDY A;  2LRD A;  4N4O B;  3PDN A;  4NQW B;  4AYB A;  4IZZ A;  2X1D A;  3QOE A;  4ZDO A;  4B44 A;  5HOO A;  1W36 D;  2OC6 A;  4GRI A;  2L5Q A;  3OOU A;  2L9N A;  3UNG C;  4XLC A;  1D0Z A;  2Q2E B;  1BR1 A;  3CMM A;  1WJD A;  4HSR A;  3M8J A;  3PL8 A;  4PJJ A;  4B47 A;  2VIX A;  3DAL A;  3C2H A;  2W82 A;  1MVH A;  2Z2S B;  4RLF A;  4YNP A;  3DPL C;  4ZDL A;  3IAS 2;  1DGW Y;  4PJL A;  4ZTJ A;  5HVQ C;  3D5R C;  3OWT A;  2R7X A;  1OR7 C;  2IGO A;  2WAD A;  3H5A A;  2UUZ A;  2ZSI B;  5T0K A;  2LBF A;  4J8O A;  3OL3 A;  3AL0 B;  1Z21 A;  2MYS A;  2W7N A;  5F5E A;  4J7I A;  1Z7L A;  2BW3 B;  5HLT A;  1V5E A;  4RM2 A;  1XQH A;  3F9Z A;  3H35 A;  1MMG A;  2E60 A;  4CZC A;  5KJK A;  1R6R A;  2X1E A;  4E4H A;  2CUZ A;  1BR2 A;  4KT6 A;  2WAF A;  4YND A;  3HNA A;  2E1M C;  4HRI A;  4BAC A;  4F91 B;  4BXF A;  4QEP A;  2IGM A;  4XKW A;  3OS0 A;  2V9K A;  3L2Q A;  2WY8 Q;  3W3C A;  4PJN A;  2QKL B;  4RLQ A;  3LL7 A;  1S9H A;  3S7D A;  2W5Z A;  2VL8 A;  2JV0 A;  4ZYA A;  3UR3 C;  3W2W A;  3M57 A;  4J7F A;  2K5C A;  4XOP A;  2Z1D A;  1UEL B;  2VKH A;  4O30 A;  3LSG A;  2LYC A;  2WB1 A;  5KNL A;  3KYL A;  3EUA A;  4MI0 A;  3CF2 A;  1UAA A;  2LY2 A;  2F69 A;  1QHH D;  2CMP A;  1PYV A;  4PFO A;  2A5W A;  1PEG A;  3HKZ A;  2HPI A;  4G6T B;  3TBI A;  4LIT A;  2Z16 A;  3DKY A;  1GLN A;  5JIY A;  2M4K A;  2V1N A;  2KQR A;  3PSI A;  3QWP A;  5T5G A;  3F9Y A;  2NOJ B;  3CES A;  4FET A;  4NC7 A;  2CV2 A;  3HPG A;  2WAE A;  3N71 A;  3M58 A;  4CCJ A;  1HA8 A;  2X1C A;  3EP0 A;  2WY7 Q;  3K10 A;  3HOS A;  3TG5 A;  3W2V A;  5CCM A;  3E1S A;  3MKY B;  1NG6 A;  5TEG A;  5KJN A;  1DQU A;  4U7B A;  3AL0 C;  4Y33 A;  4U87 A;  1MMD A;  3I3L A;  1WJF A;  2LBF B;  5FRM A;  4OAY A;  4E47 A;  2M4G A;  3L2V A;  3OIQ A;  3DLA A;  5FRN A;  3K6G A;  2W4S A;  3ONQ A;  3OXG A;  3K4C A;  3VV0 A;  3L2W A;  3RU0 A;  2R7W A;  1X19 A;  1G8X A;  3LSM A;  3M53 A;  4I51 A;  4MLO A;  3N05 A;  5AYF A;  3FBI B;  3G2B A;  2KL4 A;  3SEQ A;  4BQO A;  1UG0 A;  2X6X A;  3ZXS A;  3IP4 B;  1WJC A;  3LSK A;  4HPQ A;  2HPM A;  1JI8 A;  3OR2 C;  1MT6 A;  3K5K A;  3FBN B;  3K70 C;  4YEJ A;  5CCL A;  4CSW A;  2VJJ A;  3OY9 A;  1QU3 A;  3A1Y A;  3OYB A;  1X4O A;  2RNG A;  1D0X A;  5LSX A;  2VKD A;  4AVZ A;  1BR4 A;  1IRX A;  4XQF A;  2PMZ A;  4RM3 A;  4PK4 A;  2DT6 A;  3ZGK A;  4ZJZ A;  2VQH A;  4Z4P A;  4DGW B;  5CQE A;  2O8J A;  3BCA A;  2X51 A;  4NUB A;  1Y6I A;  2F5V A;  4F93 B;  2CS3 A;  2R3A A;  1LKX A;  3CP8 A;  5HNH A;  5CPR B;  3EPZ A;  5LSZ A;  2CV0 A;  4FAS D;  1NG7 A;  4DBR A;  2KHM A;  1KON A;  3OMY A;  4D9J A;  1V5G A;  4XLF A;  4OAZ A;  4BUP A;  2KPM A;  2ZXH A;  4F55 A;  4E7L A;  3OS5 A;  4MI5 A;  3OYF A;  4BS9 A;  4NJ5 A;  3OYJ A;  2VJI A;  1N3J A;  2JA2 A;  1N78 A;  3DB5 A;  4XOT A;  3RJW A;  4ANJ A;  3EUK L;  4E7S A;  4PSW A;  1D0Y A;  1MNE A;  2XDV A;  3H0D A;  3RTR A;  4NNJ A;  1X1C A;  3DTE A;  2DJI A;  2JUG A;  1YX5 A;  2VQL A;  3SZG A;  2IS4 A;  2LOO A;  3K4K A;  4HEA 2;  4J83 A;  3OS2 A;  3W2A A;  2JVH A;  2VPL A;  1D1B A;  1YX3 A;  2PJR A;  1WFX A;  2LY1 A;  4JLG A;  3H9J A;  3SW9 A;  4B43 A;  2Q1Z B;  3PUB A;  1ERD A;  3FKJ A;  4EAT A;  1AA7 A;  2K3P A;  3FHN A;  4O6F A;  3OIP A;  4IX7 A;  4XLH A;  5F59 A;  2XF5 A;  3RAY A;  3S32 A;  2O5R A;  2ZSH B;  2MC4 A;  2K9L A;  2ZXI A;  4BQQ A;  2CH0 A;  4F3Q A;  3PNT A;  4YEL A;  3J7A Y;  4ITV A;  2R7Q A;  2VQC A;  3OR1 C;  3DQV C;  2KRC A;  2HNH A;  5HNF A;  3HPH A;  4CCO A;  5CQG A;  3S3N A;  2W1O A;  2W5Y A;  2P0W A;  5KHD A;  3MMY B;  2DXI A;  2X6Y A;  3TMO A;  4R79 A;  2XF6 A;  4XL9 A;  4B3X A;  2IXS A;  1DGR M;  1FMW A;  3LSH A;  3PNV A;  4IJ8 A;  4CCL A;  2LC2 A;  3HUG B;  4LIV A;  3CBM A;  1J09 A;  2R7T A;  4KIS A;  2Y0S A;  1T95 A;  3S7F A;  3C2G A;  3OYD A;  2XF7 A;  2L2O A;  3SEZ A;  1PJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...