5CQEA

2.1 angstrom resolution crystal structure of matrix protein 1 (m1; residues 1-164) from influenza a virus (a/puerto rico/8/34(h1n1))
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
159
structure length
158
Chain Sequence
b'AMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSEGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein 1
publication title 2.1 Angstrom resolution crystal structure of matrix protein 1 (M1; residues 1-164) from Influenza A virus (A/Puerto Rico/8/34(H1N1))
rcsb
source organism Influenza a virus (strain a/puerto rico/8/1934 h1n1)
molecule tags Viral protein
total genus 57
structure length 158
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00598 Flu_M1 Influenza Matrix protein (M1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.180 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5cqeA02
1.20.91.10 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Influenza Virus Matrix Protein; Chain A, domain 1 5cqeA01
1AA7A 4ITVA 3MD2A 1EA3A 3VDXA 2Z16A 4PUSA 5CQEA 4D9JA 4IQ4A
chains in the Genus database with same CATH superfamily
4OIRF 2V6CA 5BNGA 5B3SH 1J59A 2YX4A 3KLNA 3G1OA 3QOEA 4CXFA 2D2WA 2YS9A 1G4DA 2D1VA 4MQVA 2Y31A 4BYYA 5J4YA 5CYVA 2VN2A 2ZJ2A 4B44A 2FMYA 4P55A 5TGTA 3S2DJ 4A0XA 3QU6A 3ZRGA 3J7ZI 4NBQA 2LFBA 1ODDA 2LC2A 3BWGA 1A35A 2P6TA 3H3ZA 5CVJA 4A3BJ 2FNPA 1VFCA 1Z21A 2ZKZA 5EZHA 3QPLA 1WQ2A 4F3QA 3CCRI 2LREA 2HDWA 2DFFA 2HYFA 3EETA 2TDXA 1WH7A 1XB4A 3SFIA 3T5XA 4P5OA 2CUEA 5KAFC 1BM9A 3GW2A 3F22A 5FKMA 2YU3A 3HRMA 3OMYA 3C3WA 3NEUA 3V8JA 4UV9A 1ETOA 3DLAA 3IAM2 1Z77A 5L3GA 1J2XA 2DMTA 1G3TA 1Y56A 2R5YA 4CUGA 2HYJA 4MEYF 3CP2A 2Z33A 1VQKI 3TMOA 5LD2C 3MN2A 3MVPA 3GTGJ 1N75A 2M0CA 3MKYB 2QKMB 4GYGA 2L9NA 1Z91A 2OCEA 3LSJA 2WA0A 4E7HA 2IEKA 4IOAF 1ZRCA 2AXTC 3H0GJ 2L02A 2MLKA 3IWFA 3K9TA 3KP3A 2RQPA 1EKEA 2ID3A 4BY7J 4FX4A 3L2UA 1X1BA 1J75A 3I58A 3ZMVA 3AL0C 3QQAA 3KZYA 1WI9A 4BBSJ 3LL7A 2W82A 2LVSA 4M3DA 4FE4A 1DGWY 4BDZA 3WU0A 3C7JA 3OV8A 2EJRA 2HPMA 2A05A 4Q4ZF 4ZDPA 3U21A 3ZN1A 1IAWA 2LTPA 2EPFA 3LAPA 2GZWA 3VYUB 2WY7Q 1PUEE 1R4NB 4E70A 1YJWI 1MJBA 3ECHA 3FHZA 1W1WE 4ENNA 1RKWA 3ZQIA 4M3EA 4I0AA 1SD5A 4HV5A 5E1WA 2ETHA 4YEJA 1V3FA 2ZCWA 2X85A 3DWLE 3HJEA 5CVIA 5KVRA 2QQ8A 1D3YA 1Z67A 3E5QA 3EUHC 2JRTA 2OPTA 2ZMEA 2KISA 3A01B 4U0YA 2WB1N 3OYNA 2QCOA 3M1EA 4LMYA 4CCJA 3ZQFA 1K7AA 2XAGA 1NG7A 2JMWA 3BG9A 1ETXA 2HVSA 1ZELA 3CUOA 1SD7A 3NRVA 4A2UA 1XS9A 1RRJA 1VQ5I 2CQ7A 3SZTA 3BJOA 5IP9J 4NUBA 3H3VK 2VKVA 2E35A 3HHGA 4HQMA 2YPRA 2I10A 4C2UA 4EJWA 1OCRH 4HQEA 5BS6A 5D8LB 3QPTA 4GGGA 2CSOA 2IT0A 3VYTB 1AU7A 1YS6A 2A6HF 3BQZA 2VE8A 2XUBA 1IG7A 1D8JA 2OTLI 3DKYA 2V79A 3K4JA 3H9JA 4M9SA 2ME6A 5H2FC 1R36A 5GTIC 4V2GA 5KCMA 2XF7A 2A6EF 2ELJA 2PMHA 4IRIA 1SFKA 2X1EA 2V9VA 4C3IJ 2PN6A 2Y9YA 3TDZC 4Y7NJ 4I09A 4UVAA 1OCCH 2M0MA 2YSRA 3OY9A 1K4TA 3FF5A 1RPWA 3RKQA 4RAGA 1S72I 1G3YA 2HOEA 2M9HA 4OMYA 4PJJA 2EZHA 3P9KA 4PFOA 2CV1A 2W84A 2IP2A 4LG3A 5E79C 4L5JA 4MO7A 3FXKA 4R8HA 2LR8A 5F1RA 2NS0A 4HAMA 1YO5C 2NYXA 1WJDA 1B72A 1FMVA 4HSRA 3TP3A 3HSFA 1PP7U 1ZARA 2JSPA 2DK8A 2IA2A 4F7ZA 1BA5A 4XKWA 2MD0A 3OR1C 4JBAA 3ZQCA 4XONA 1T0FC 4IEJA 4XRSG 2CW8A 3HPGA 2BBYA 1JE8A 3S8PA 2CG4A 4P96A 3QAHA 2VXZA 3RIRA 1IDYA 4XRSA 2O8XA 1XDUA 2M87A 3A0HC 2LH9A 2LMDA 3FM3A 4E7ZA 3MCZA 1KU3A 2VOOA 2NS7A 4IL6C 2XASA 2HTJA 2RGVA 1D1CA 1RI7A 1H88C 1SVOA 5D6EA 4IHYA 2Y0SN 1JTXA 1Y1WJ 1MJAA 4OOIA 4NC6A 2FOKA 4NDLA 4HW0A 1GDTA 3A4CA 4I76A 3TOAA 5FROA 5B1AH 5HS7A 3OYIA 2L2OA 2ZXHA 4B3AA 1Z9CA 3CF2A 3KP4A 2LY9A 3GUDA 2M4GA 4WXDA 3M3YJ 4OIQF 1Y6IA 4HSTA 1H9GA 4X6AJ 2FD5A 1GXPA 2KFDA 1IXCA 2FMLA 4WXCA 5CKTA 3GTMJ 2RREA 5DS9A 1HW5A 2K9SA 1YHQI 3CCYA 2K4JA 2HQNA 1IZ1A 1PUFA 3EDPA 3P9IA 2GA1A 2HXOA 2DOAA 4UV8A 4I6ZA 1IF1A 5E3OA 3H3UA 4BE1A 1RIOH 3EQLF 5D5VB 4CA0A 4LFUA 2KQRA 1JUSA 3ZQHA 5HDNA 3K70D 5BPIA 4FQGA 3VEPA 1K78B 3WU1B 4OIOF 2QYOA 2W1OA 5KNLA 4ZZDA 1ETVA 4W1UA 3H5RA 3VSKA 3F23A 2EV0A 2VODA 3KLSA 2QGUA 2F6CA 1K83J 3KFWX 1P9QC 2DMQA 5LHIA 1PYVA 1UG2A 2PEXA 5ICEA 1FYMA 3BPVA 1KGSA 4B48A 4DW6A 5E3NA 4P3BA 2DOEA 3DP7A 4G7OF 4AUXA 3R6SA 3HEFA 4GXOA 4RGUA 5E18F 1MH4A 3F8NA 3FZVA 3LNQA 2CFXA 4PJLA 2P5LC 4E7IA 1KJSA 4CCOA 1JT0A 2WY8Q 3F0CA 2H27A 2M5WA 3OOPA 3PFIA 4JOMA 2VQGA 1SEUA 3PJRA 4EJTA 3W6JB 3JW4A 3ZMDA 1FSHA 5C44J 3A02A 5EF6A 4KNYA 2KT0A 5K7HA 1FPQA 3HHHA 3B6AA 5FB2A 3WE2A 4FASD 1VQMI 2JVGA 4IZZA 2HTSA 4F55A 3IC7A 3K4KA 4CCLA 4ZYDA 3JSOA 2AO9A 4G94A 3I54A 3CDHA 2E60A 2R7DA 3ROUA 1ZGWA 2H1KA 2YU9J 3TO9A 4GRIA 3BC8A 3TBIA 3L7WA 4DGWB 3K4BA 4IRGA 1ZRDA 2IGKA 3MWMA 3M07A 1A36A 2WC2A 2X1CA 3HRSA 1YRNA 4XQFA 4IOCF 3S32A 1R7JA 3IH4A 2BGCA 3MQ0A 4HNUA 3VWBA 2UV1A 4DZJA 2JN6A 1H0MA 4I02A 5KK1A 2L54A 4HDUA 4F52A 5J47A 2E7WA 2ZFUA 4M72A 2XHKA 4HRIA 2BHZA 3BPXA 4M74A 1BC7C 1AOYA 3MZYA 2VBWA 3BCBA 3IKTA 2LBFA 4DJAA 3CC7I 3H5AA 4ESJA 1PDNC 4YIFA 2XB5A 5CPRB 5LGUA 3OYHA 4LG0B 1UHWA 3SHFA 3FBNB 5L3CA 2O0YA 4XKCA 5GAGJ 3CCMI 1YYVA 4A3EJ 2LNBA 1GXQA 3A1YA 3BQYA 5HLGA 1D0XA 1I39A 2EIMH 3E5UA 1XGNA 2VLAA 1R58A 1K6YA 1MSEC 3J7YJ 1I6HJ 4EEFG 3CCSI 5GP9A 4A3LJ 5HVQC 3Q5FA 1T98A 4PSXA 3FBIB 4ANJA 3LFKA 1KQ8A 1HQCA 4RGSA 1HSTA 4U0VA 3GFLA 4CICA 2F5EA 1ZRFA 2CQQA 3TOBA 2O5RA 3G1MA 4BKXA 2LLKA 2GBYA 1GVDA 3BR6A 3L2CA 1BR1A 1X4OA 3K1MA 2VONA 1XMAA 1JJ6C 4QLCU 2M2EA 1B1BA 2VL8A 4NB5A 3WODF 3AG4H 2CW0F 5FLVA 4IPAA 1O7LA 2FE3A 1I5ZA 4IHWA 4C2TA 1MBEA 1O57A 2MW8A 4G7HF 2WB1A 3CMEI 4A3CJ 2DMNA 1HOMA 2MABA 2V4JC 1Y0NA 2JZYA 1RR7A 2IS6A 2EK5A 4IVNA 2Z1DA 5TJJA 2XAQA 5FKKA 1T56A 2EFNA 1U6GA 3H92A 4LGWA 1UG0A 3OL3A 1CQTA 5HOOA 3DEWA 1IRXA 3E6MA 4A3KJ 1U8BA 4EJOA 4HF1A 4A5NA 2O03A 1FX7A 3O8GA 2AXLA 4BQAA 4A3MJ 1F4KA 4QSHA 2M34A 2QENA 2LDUA 1K79A 5EYRA 1JTYA 2R7WA 2IGOA 3COAC 3W6VA 2Q0OA 1FIAA 4KN7X 4BXXJ 2JPCA 4MLOA 2QBYA 2GM4A 1VQNI 3PNYA 3BR5A 4ZYHA 1KYZA 2P7VB 1OQYA 1NG6A 3FXUA 5B1BH 1SAUA 4A69C 2R7VA 4D7NA 3CD6I 2YUSA 3DEEA 2VB6A 1XGSA 5IYBJ 2M7AA 5K1YA 2HPIA 2DPDA 2L9SA 1FC3A 1ZYRF 4A5MA 1OISA 4B09A 3OIPA 1HLVA 2DTRA 2A73B 3Q0UA 5DCMB 3GTOJ 3C1DA 1KYWA 3M7GA 3X2QH 1O7FA 1QRYA 4Q47A 1UCRA 2W4SA 1IXSB 3DV8A 4Z2YA 5EEAA 3JRBA 5CVRA 1RNLA 4IJAA 3KEOA 1FP1D 1T2KA 4B47A 1R71A 5HLIA 1ENHA 1GT0C 2O9LA 2DK5A 2ZSHB 1TZLA 2LY2A 1IDZA 2Z5UA 2NNYA 1P2FA 2VBYA 1XMXA 2MYSA 3T1BA 2R7XA 2ZXJA 2CFOA 3U9GA 5D8KB 4BGDA 4M6VA 1EJ9A 3GTLJ 2Q1ZB 2Y0SA 5M5WJ 3NQOA 4DQ2A 2HU9A 2B0LA 3HOSA 1LEBA 2KIUA 2A3SA 1U8RA 3RZDJ 2JQ7A 5CQEA 1MBKA 1S9HA 1GV5A 3DXJF 4UUSA 2E5ZA 1KU9A 2R5ZB 4E7SA 1JUMA 2BE5F 1DDNA 2BZTA 1B4AA 4DIQA 2G9WA 2OQGA 5LLQA 3EYIA 3HTSB 3T8RA 2XRLA 4GFBA 1MGTA 2RKHA 1C0WA 5K5OA 1MMAA 2R7FA 1EH6A 2DT6A 4D7MA 4XM3A 3RQ4A 4BHCA 3FIWA 4J00A 5K5QA 2WV1A 4R79A 4JX4A 9ANTA 2F5FA 4XLEA 1CFAA 4XLPF 3WTUC 5ILUA 3ABLH 4MNUA 4XORA 4BNCA 1AKHB 2DTZA 3HM5A 4JX5A 3R0JA 3ZQGA 1VQ6I 3CDLA 1Z3YA 2KHMA 1XPXA 4Y17A 5CVVA 2K86A 2AQEA 1D1AA 4E7KA 3MZHA 4H0EA 5JPMB 1CGPA 3J7AO 4BAYA 2L7KA 2VI6A 3ULQB 2Y69H 2QUFA 5LRSA 1WHUA 3T8TA 4XKVA 1FBQA 1WVRA 2CWEA 4WWCA 2CQXA 1BW6A 2H1LA 3ZMTA 2STWA 1O3RA 1YLFA 3GBGA 1W36C 4XKBA 1W5CC 1EH7A 1MBGA 2DOFA 1K6OA 3KZZA 2E1CA 2QF7A 1QGPA 2X6OA 4LB6B 4D0PA 2IW5A 1IUFA 2ZC2A 3M8EA 3CC2I 3HOVJ 4YIRX 1J0RA 3LSIA 2F4OB 5C4JJ 2KDZA 3LSGA 4KT5C 3BZ6A 2DAOA 4FXKB 2UXXA 1FWZA 4PK4A 2PJPA 3FXMA 3Q9SA 5K7FA 1KONA 2EFPA 3KX2A 1ZH5A 2OCCH 2EBIA 1W0TA 3VFZA 4FE7A 4XMYA 3MMYB 3V8LA 1FIPA 3FKIJ 4BL0B 4BQOA 4ETSA 3CMAI 5IT9K 2I5UA 3IWZA 1Z7UA 3M9AA 5EG0A 1V54H 3FXQA 5F64A 1X1DA 1LFBA 1S5LC 2E1MC 4FCYA 1TTYA 3IHUA 5FKOA 4BQNA 3RKYA 4PGGA 3RDIA 2IRFG 3DFGA 2CS3A 5JHFA 4TV7A 2MA3A 1ON1A 1FZPB 5H6RA 1YJ9I 1GVJA 2LP0A 3GLLA 4A0ZA 1W4MA 4RBOA 4HX4A 1VTNC 4MFDA 2XVCA 1KQ0A 3H36A 2CRGA 1HC8A 2WAEA 3DBRB 5D4SA 1PP8F 2E1NA 1MNEA 1E2XA 4CZCA 2FRHA 1RZ4A 1ZLJA 3PIPF 4RAZA 2MH2A 1K4SA 3V8KA 3ZPLA 3BZKA 2L7FP 4GDFA 5LRRA 2VOPA 3CO6C 3S15J 1HKTA 1NH3A 3QP5A 1NK3P 2DT7B 2ZNYA 4L9VA 2ADUA 1FOYA 1T8IA 1B9MA 2JUCA 3QU3A 4NHJA 4P9FA 3M8JA 1HW1A 2KIFA 3MKWB 2EFQA 4DYQA 3HSEA 4LIUA 1GHCA 1X3ZB 2BVLA 2LOOA 4FXGB 2BW3A 2V9KA 4G9YA 3DCFA 2WBMA 3F8MA 1J9IA 4CSWA 3GTJJ 3V4GA 1H89C 1JHFA 2JSCA 3SZPA 3I59A 4EJUA 2E1MB 1MD0A 2HKXA 1MZBA 2QZ8A 1V5FA 1OPCA 1LPQA 2BHYA 3ABKH 3JR9A 3BZCA 4HPQA 3ZQLA 5ERIA 2K9NA 5IT9Z 3LSMA 3WTVC 3K2ZA 1WJ5A 3ISPA 4MIMA 2K9LA 4XLHA 4YIIA 3BY6A 3S2HJ 1Q1HA 1Y1VJ 2DW4A 1JHHA 1WJEA 2ELHA 3CCJI 2ZJRF 4EQQA 5HLTA 3S1RJ 4FISA 4LK1F 4FX0A 4QPQA 1R9TJ 1V4RA 2XIGA 3ASNH 2HQRA 4B8XA 2ZXIA 3VSLA 1X3WB 2VBXA 3PUBA 2A68F 3A0BC 3S1QJ 4L18B 3L00A 2H09A 2MFZA 2PMZA 4UVCA 2DA4A 5AIQA 3VYSB 4S05A 4U7DA 1D1BA 4L0ZB 4HLXA 3M4OJ 2EFWA 3HQAA 4HG2A 2DFHA 2DJNA 4ENKA 2F5VA 4KDPA 4KA4A 4I98B 1QNTA 3L9FA 1YIOA 1XMKA 1ONVA 2V1DA 3PM1A 3MFKA 2CUFA 1TWHJ 3EYYA 5FFXA 2XGXA 2IBDA 3ZN0A 2JWTA 1BOBA 3HYIA 1OYWA 3VPRA 1V5EA 3SZGA 1TT0A 3F21A 2VKEA 2DJIA 1HW2A 2ZO4A 3IH3A 1ETKA 2A5YB 2NVQJ 2ECBA 3AFHA 2M8EA 3KIOA 3HZJA 5IYDJ 1T39A 2BY3A 2GLOA 2HEOA 3FKJA 3OR2C 2PFBA 2GA2A 2JA2A 2ACJA 3PFYA 1MW7A 3CO7C 3NARA 1LE8B 4NQWA 3PSFA 1YW7A 4ZZLA 3OYBA 1YITI 3HRUA 4XBFA 2AS5F 5HS9A 3G4SI 2FJ1A 3AL0B 1SFOJ 2H8WA 3LMMA 5DD4A 3DBHB 4MTDA 4CCKA 4N9IA 4RA2A 4AC0A 4BEHB 1IXRC 3CJTB 5LGNA 1W7PD 3M1CA 3QP6A 4WF2A 1MBFA 3PSIA 4BXFA 4XLAA 3LA3A 4N4NB 3ZCOA 4A6DA 3WE3A 3O3KA 5FJ8J 4XLFA 3HQBA 4N9HA 1LQ1A 2JA5J 2HZDA 1MBHA 5EEGA 2XDVA 1X2MA 2CYYA 4BJ6C 1UJ8A 3IUOA 1FTTA 5EGOA 5ED4A 2P81A 1MSFC 1LFPA 5GAEJ 4CYCA 3FXRA 3ERED 1WWXA 4RMNA 1QPIA 2QVOA 2FOWA 3B02A 2PG4A 4C9YA 1BI0A 3J7AY 1QU3A 2IJLA 4M71A 3C18A 4ZTFA 1LEAA 1ETQA 3AG3H 3WTSC 4M73A 1MMNA 3KP2A 1WRJA 3JRAA 3JRFA 4UU9C 3GF2A 2A6TA 4ESFA 4Z6YA 5GPAA 3JAMK 2K02A 2FSWA 2R0QC 3IP4B 5J1YA 2LG4A 3HUGB 1N78A 3CJNA 3G1LA 1MDMB 2EIKH 1YX5A 2BY0A 2P5KA 5DTDA 2ZSIB 2FQ4A 2X0LA 2BV6A 4IRHA 5IY5H 3IL2A 2BOLA 1Z7LA 2RVCA 2V1NA 1PJRA 2F4IA 1BI1A 1MMDA 5ICCA 1P4XA 2VASA 5JFRA 3PNTA 1X19A 3KEYA 1OCZH 1YTYA 3CESA 5DYMA 2P6SA 4F91B 1O3QA 2Y9ZA 1FT9A 5JLWA 2IGMA 4XRMA 4EM1A 4D1QA 2CMPA 4IHTA 4BU2A 2QM3A 1G3WA 1XN7A 4KIFA 3ABMH 3S2WA 3K4MA 2R7TA 3DF8A 1HKQA 2Z9OA 4ZH4F 4I99C 3AG1H 4C2MJ 3U1DA 2ZBKA 3CDIA 2KDOA 4UXNA 2IA0A 3LOCA 3JSPA 1TW3A 4UUTA 4RGRA 2DMPA 5BOXA 4AVZA 2PJRB 2CUJA 1ZN2A 1DPUA 4AYBN 4E7JA 1YW9A 5JHUA 4BS9A 3PL8A 4XIDA 1YJNI 5IOYA 3GFIA 3G6EI 3E0JB 2UWMA 2DBBA 1BOAA 1RR8C 1V5GA 2MSYA 4KMUX 5E1ZB 3TKYA 3KE2A 2TRTA 1SMTA 3JAMZ 2CW7A 3EUKL 1CF7B 1TWFJ 5ICFA 1Q1VA 2R7OA 2OZ6A 3O8HA 3TGNA 2QQAA 5L3EA 2IPQX 5HDGA 3DPLC 2EWNA 3KEQA 3L2RA 1H8AC 5J4VA 2H8RA 2PX9A 3K6GA 2DPUA 5LGTA 2CQKA 5BMZA 5FGMA 4IO9F 2PI0A 5DM7F 3PIOF 2O61A 1IRZA 4U7BA 1BC8C 2L9VA 3RPUA 2ZB9A 3DPUA 5JVTA 1TC3C 3A01A 2KIQA 3R60A 2B63J 2ZJQF 3F3XA 4HWJA 1XGOA 2IXSA 3CUQC 4XLNF 2DA6A 2DA3A 4XK4A 1LVAA 3GCMA 4RB0A 1A5JA 1U78A 1OYYA 4B3XA 1QZZA 2CUZA 1TNSA 1W0UA 3ASOH 2R7UA 1GUUA 3E97A 2JT1A 1LUJB 1W7PB 2VC1A 2ESNA 3B73A 1LB2A 1I3QJ 1KQ9A 1JJ8C 2XGEA 2V6EA 3LQRA 4OWRB 4FTHA 3FXJA 2EIJH 3BDDA 2R92J 3BP8A 4FT8A 5DD8A 4HF2A 5ILSA 3UNGC 3VOEA 1BJZA 2GOMA 4LOCA 4RDUA 4KITB 3BJ6A 2PLYA 2OC6A 2HXIA 2JJ7A 1WH5A 1WJAA 2OU2A 1BW5A 3GTPJ 2EH3A 2VQCA 5FRNA 1EH8A 3HGYA 4U88A 1ORKA 1QPMA 1X2NA 3KYCB 1U9OA 2OV7A 4A0YA 2CO5A 4P9UA 4IF4A 1JKQC 1FY7A 4UHTA 1YX3A 1A6QA 4M6XA 3ELKA 3C2HA 3EUHA 1WI3A 2DI3A 1FMWA 1SD4A 3H9GA 1JKRC 3GO5A 2VE9A 4KICA 2RNJA 4RLQA 5F0FA 3W3CA 3RSNA 3CUQB 3R0AA 2A69F 2NOGA 1R1UA 1U5TC 4PJMA 3U1KA 2YX7A 2ME0A 1B59A 3KP7A 5DDGA 1HBXG 4L9NA 5E8GA 3FDYA 2NXNB 2JVHA 5TISC 3UR3C 4B4CA 1VQOI 2K40A 1OR7C 3JRGA 3LQQA 4JYKA 2FBKA 4PZJA 2FNAA 4C30A 1ULYA 5DUIA 1VQPI 3D0SA 4P1WA 4KJZA 1L3LA 4BQQA 2OUMA 1IRFA 2AQFA 3NWTA 2Q8KA 1R1TA 1ZLKA 2HQ5A 2XGCA 3HC7A 2OA4A 2NAZA 1A04A 3H5NA 1B8IB 2DU9A 1Z6TA 3ESWB 4ZTJA 4UB6C 2DT5A 1X1CA 1FOXA 1D8KA 3ZMSA 4BBRJ 2NVTJ 2K3FA 2EV6A 2QKLB 2XSJC 3HL2A 5F04A 1HF0A 2X9DA 4KMFA 2V1UA 1ITYA 2F4MB 1UHMA 4J19A 4L0YB 1JI8A 2KIMA 4P3AA 2MBFA 2VPRA 1N77A 2XPUA 2CGPA 3BG7A 2Q2EB 3F6VA 4XN3A 2JPBA 2K7LA 2J5PA 3WG7H 2BEOA 2NRAC 1S29A 4HYEA 1RKTA 1OFCX 5LFAA 1QQIA 4Y3OA 3WTZA 1U5TB 2AHQA 1JXSA 2P5VA 2DA2A 1G8XA 2VIXA 2XV4S 4RS8A 2E2JJ 1D5VA 2R93J 1UELB 3IRQA 1S6LA 1VZ0A 1T0FA 1QVUA 2XRNA 1SFUA 5JR3A 1K78A 2K27A 5E8IA 1ZR4A 2OQRA 5DV5A 3ZQQA 2WV0A 3JRHA 1MNMC 3ZMZA 4CHUA 3O6BB 2IVMA 3MD2A 1JKPC 1KU7A 2JA6J 1MBJA 3I4NJ 1FEXA 3OYJA 3SEQA 3S93A 3HB9A 5C4XJ 2DQRA 1SAXA 1K61A 3FMQA 1WJCA 2OBPA 4Y4RA 1WSUA 3OS2A 3FHNA 1OCTC 5D5XB 5M3FJ 1R5GA 2EB7A 1W36D 1R5HA 3GVAA 5IOZA 4G12A 3GTQJ 2RDPA 1P6RA 1WJFA 5FRMA 2OD5A 1M1EB 3RYPA 2M8GX 3QPHA 2FX0A 2GXBA 4ON0A 3LSHA 4FHTA 3I56I 4MEXF 3ZGKA 5EEHA 2I8DA 3OOUA 3SXYA 4S04A 2X6XA 3S3MA 4DZPA 4CGZA 1LVKA 1F1ZA 3HBLA 3WHBA 2KPMA 3S17J 4C3HJ 4WCGA 1E3HA 2W24A 4Y33A 4BUPA 4IHSA 1AA7A 3TW6A 3H0DA 5LEKA 2FXAA 5LHHA 2X6YA 2ISYA 2GQQA 3I0TA 1AWCA 4MFEA 1NK2P 4M3BA 4UNOA 4Q48A 1U9NA 2VBZA 1FSEA 3GYHX 1KU2A 4G6DA 2DO7A 3ZMUA 4G8XA 4HNVA 4OMZA 1HXDA 2DQLA 3PO2J 1XX5A 2EILH 4JP0A 5DEQA 3JREA 2R5YB 2GXGA 4F93B 3DU6A 2JTVA 2QLZA 2BVMA 3BTJA 5C3EJ 4I0BA 2C6YA 3S14J 1ZG1A 3GZ6A 2ZMEC 1XG1A 1PVEA 2X6WA 5F6FA 4IQ4A 4LG0A 3IAS2 3SYTA 1IRGA 1WCMJ 2V26A 4M9ZA 3LFUA 3UKGA 4WB3A 3L2VA 4X1EA 1BIBA 1OMIA 2EINH 3D5LA 4AYBA 4BE0A 4YG2F 2LKSA 1IN5A 3C2BA 1MNDA 3AKZA 4AM3A 1S3JA 1TQIA 3DPTA 3HOUJ 1XGMA 3K4NA 4LJZF 4PUSA 2R7ZJ 2IS2A 2V1XA 2B39A 3CCLI 1IN4A 5ICGA 3DTIA 2L4MA 1JT6A 4BE2A 5M5YJ 5E1XA 3K2AA 2W85A 2PQ8A 5FLXK 4OU0A 4AIHA 1A6IA 2EFOA 2Z2SB 3LWFA 1Z6RA 3TEDA 2Y75A 1IV6A 1WGXA 1H9TA 4AWXB 3CQZJ 2Y0MA 3HDDA 5B5EC 3CLOA 1G59A 3CCEI 1SFXA 5KHDA 1KA8A 3N4MA 4A3JJ 4PSWA 2ZJPF 3BCAA 2WAQN 2K85A 4MQ9F 5H20A 5HNFA 3J81K 4YFNF 4LD5A 3QPSA 4ZC3A 2KZGA 1LKXA 3CC4I 4PCQA 2LKPA 5J3LA 2W00A 2WADA 5CJ9A 1UB9A 2ZMEB 2IS1A 2DXIA 2BY1A 2BY2A 1MMGA 4LLLA 2E71A 3E3VA 4Y15A 2XAUA 3V7RA 1LDJA 3FM5A 1HSJA 5F1JA 3FK6A 3QYBA 3ML6A 3OYFA 5GTHC 1J7KA 3M8FA 3BR3A 2HZTA 1TP4A 5AONA 3WGIA 2UXNA 3WGHA 4G7ZF 1KZHA 3ZP5A 2OJED 1TL8A 4V19K 3K1PA 3QWLA 1IJWC 1F43A 1HKSA 3D5SC 1IW7F 3P5JA 3REOA 2M30A 1FBUA 3WTXC 1WPKA 3BROA 3RCOA 3TO7A 2WTEA 1FBSA 2QQBA 1ZR2A 3W2VA 3DKXA 3FXOA 1XC5A 1UFMA 2MH9A 1XSXA 1YW8A 3BG6A 3KYDB 5FLXZ 2IGNA 3HOTA 5F27A 1P7JA 3ABUA 3ZOBA 5J1UA 3KP5A 4GYIA 1XCVA 4QWQA 5DCMA 2XAHA 2RN7A 3HXLA 4B43A 1TW2A 2XF6A 5FD6A 2XGDA 1ETYA 2E34A 3ONQA 4YRVA 3T0YA 4CCNA 3TO6A 3CP8A 2HGCA 2VJIA 2HDCA 1IN8A 3DBLB 2XC7A 4O5VA 3OYMA 3E5XA 4MHGA 3LSPA 3K0LA 3J81Z 4I6OA 5J8FA 5FKNA 1B72B 1ZTRA 2W48A 4GCVA 3OIQA 1UHSA 2KP6A 3F9KA 4XRFA 4EVIA 5LEJA 1WZ2A 1XCBA 2X1DA 3RJPA 4A6EA 2CQNA 2VKDA 1LFUP 2A61A 3OYAA 2ZNZA 2MGQA 1YE9A 3JRCA 2ZXWH 4ENJA 4UY8I 2R4GA 2XSDC 1HCRA 2E19A 2IS4A 3ABTA 3IKVA 2R5ZA 2CU7A 1I3AA 1R49A 1IN6A 3LAJA 5E3MA 2VUMJ 3J80K 2H6CA 2DLLA 1N25A 3K4LA 5CVUA 4WX9A 4OAYA 5LBQA 1MH3A 3TW7A 2QEXI 4Q5SF 3AAFA 1OKRA 1R00A 2ELKA 2QSFX 3H1CA 1XSVA 4N4OB 4MTEA 1PUFB 4RAYA 2RNGA 1QA6A 5HODA 1Z0XA 5K5RA 2UZKA 3DEUA 4HX8A 2JRMA 3F8BA 4D9JA 2DCEA 2MD5A 3D1NI 3S3NA 1EF4A 1AKHA 3DKWA 3F6OA 4HA8A 4M3GA 2GXAA 2L9RA 2VJ5A 3N05A 4BY1J 1J09A 4IXAA 4EJVA 5JPNB 4BHBA 4OINF 4M6YA 2CH0A 2R7RA 3BT9A 4K2EA 1FLIA 5E3LA 4LITA 3HOXJ 5F0HA 4HEA2 1E17A 1JUPA 1YFHA 3OL4A 1YG2A 2JK3A 3L2QA 2D45A 3SQNA 1JGSA 2HWVA 2HNHA 3QYFA 5FO5A 1FOWA 1FJLA 1B6AA 4PJ0C 1ZGJA 3I64A 4EMSA 3V7SA 1ACIA 3OYEA 3MKLA 2M4KA 3BOQA 4NNJA 1E3OC 1XTAA 5J40A 3U2RA 2COBA 2NS8A 3JRIA 4KYWA 4IHVA 1G2HA 2KRCA 4E4HA 4L9TA 4DBRA 3GZNB 4UVBA 3OS0A 5B4PB 3FISA 4A3GJ 4J01A 1LDKB 4O6JA 3PQKA 2FBHA 3OYDA 2R7SA 2ECCA 4XSXF 4AU7A 2HI3A 5JLXA 3CCUI 1NHAA 3J80Z 3VDXA 2Y2ZA 2N8GA 2D5VA 2DA7A 3R4KA 1GLNA 4M9XA 4LLNA 3WTYC 1TNTA 2HKOA 1ZGAA 2EA4A 2VC0A 3SFZA 3HRTA 2VJ4A 3CU7A 2EZIA 2G7HA 1VQ9I 2JA7J 2DDAA 2XPWA 1FYKA 3S16J 1YRNB 3HOWJ 3I5UA 1AHDP 2GIVA 2W57A 4DOZA 4OAZA 3CTAA 1Y0UA 3K10A 1YIJI 5CLSA 3ECOA 1D5YA 1T95A 3LA7A 2ICWG 1VQ7I 2IAIA 1FTZA 5L3DA 1QZEA 3TDUC 2E36A 3L09A 5D5UB 3S1NJ 2G0EA 4E7LA 2K9MA 2LBFB 5IP6A 5ILVA 3F8FA 3LA2A 1G6NA 2M45A 4M3FA 4H4KC 3HGGA 3GXOA 4JK1X 1BN5A 4AD9A 2F48A 1F36A 3EPZA 4CH7A 1F5TA 4LLGF 4AVPA 2GIZA 2LF7A 4A93J 5HDKA 3TQNA 1I6XA 5KAIC 3W2AA 4LIVA 3BR0A 1W5TA 3BR1A 4KIBA 5TRDA 1DU0A 1YS7A 1VQ4I 1R22A 3KLOA 1X1AA 1B9NA 3P9CA 2RAEA 3FWEA 2LD5A 3G3ZA 1OCOH 5EJCA 4Y13A 4ZJZA 1O4XA 2ZFWA 2G7UA 5LHGA 3BJAA 3DTKA 1BBYA 3QRFF 3FK7A 2DMUA 4RB2C 2WAQA 1IO2A 1XSDA 5JI6A 3I55I 4I7HA 4A3IJ 1ETWA 5FD5A 3SDBA 2HS5A 2L7MP 2W25A 3F72A 3WHCA 3HG9A 4KISA 1SANA 3I53A 1TBXA 1Y8RB 1QHGA 4UUVA 5J1RA 3G71I 5BQTA 3KETA 2NNNA 2A5WA 1R23A 1F9NA 3BG5A 2PBIA 2Z16A 1QHHD 2K4BA 4RLFA 2B7EA 2BXZA 2CV2A 1D0ZA 1T33A 4RM3A 4DNCA 4CDGA 4IKFA 2STTA 3L2WA 3E6CC 2HVQA 1DP3A 3WTWC 4ZYAA 4G6QA 1RC9A 1SVMA 5IPAA 3OSGA 2K3PA 4L5EA 4YFKF 2HR3A 3HIFA 3K69A 4HZFA 4L5IA 3I3LA 4II2A 4V2FA 4IHXA 4HLYA 4KUMA 4PGHA 2L7ZA 3RI4A 2L4AA 1T08B 4HBLA 1DGRM 4RB1A 1LNWA 1O3TA 2QBYB 1EV7A 2V9PA 1SFEA 3DU5A 1ON2A 2COMA 5A2QK 2KJCA 3CLQA 1WFXA 5GPCA 4RB3C 5K7ZA 4CCMA 3BR2A 1TWGJ 3BTLA 3ZQ7A 4YFXF 2NOJB 1I27A 3HKZN 4XSZF 3WG9A 1TLHB 4EV0A 1MIJA 1R5ID 2VKHA 3LSKA 2F5DA 4ABZA 2JA8J 5EZGA 4LK0F 1I1GA 1Z05A 1LE8A 4DYRA 2FBIA 3GEZA 1ZK8A 4QTRA 1S8NA 3TP0A 3OYGA 1R6RA 5EDNA 1Y39A 2DYRH 1SD6A 3D5RC 3KPHA 1UAAA 1BJAA 2DFEA 1U0JA 4CZZA 5BPDA 1J5YA 2E5NA 1Y8QB 2KRFA 2O7OA 2MLGA 3OYLA 2ESHA 4BEHA 3N97A 4ZDLA 3VODA 3FXLA 1E3PA 4AIKA 1U2WA 1QVTA 2P4WA 4G6TB 4IQJA 1DU6A 2WWYA 4I2OA 3QOPA 4ZDOA 3HTUA 2NVYJ 1ZG5A 2O3FA 4W97A 5L3BA 3VB2A 4NC7A 3PQJA 2XKOA 4A3FJ 4UB8C 2LK2A 1S7AA 2VQHA 3OS1A 3K7AJ 2IA1A 1EA3A 2DDBA 4UUSB 3RKWA 2MC3A 2OTJI 1MMSA 1OYIA 1U3EM 3SJMA 2KZVA 3KYLA 1V55H 2O6GE 1JGGA 2GAUA 2HQAA 1ZHFA 2D1HA 5DUKA 1USTA 3ZR8X 1G3SA 6PAXA 1JKOC 5A2QZ 1MKMA 2FA5A 2FQ3A 2Y48A 4XN0A 1FOKA 3IRRA 2LYCA 1LJ9A 3K1NA 1X3UA 3TL4X 2J5OA 2XF5A 1BL0A 3OWTA 1YQAA 3HUGA 1POGA 3FMSA 1WKMA 4N0BA 2F5CA 3MZ8A 2NVUB 3JRDA 1MDMA 4EM2A 1IC8A 2DA5A 2DYSH 3WU2C 5DCFA 3E7LA 4HNTA 2M7BA 1STZA 5B66C 2KLOA 2JUGA 1IN7A 3K70C 2XAJA 1RESA 2QQ9A 2Y30A 5GAHJ 4O3MA 2VT3A 4D5CA 2HOAA 2OF7A 2M3AA 1X1PA 3K4CA 5HNHA 2FUG2 1IV8A 4X0GA 1S7OA 2K5CA 4U87A 1T6SA 5M3MJ 2DODA 2E2IJ 3AG2H 4PJNA 5F08A 2BXYA 3DQVC 4RM2A 3E6DA 2RC4A 4HOBA 1FP2A 1VF9A 4OIPF 4U0WA 5D5WB 3DTEA 1RUOA 3OIOA 4RGXA 2LRDA 3Q0WA 5FLMJ 3W2WA 1DP7P 3IH2A 3QODA 2X51A 2A07F 5IYCJ 5H6QA 5L3FA 1S7EA 2R3SA 2PJRA 1TT5B 1D0YA 4B1RA 3HOYJ 4JX6A 3G2BA 5D4RA 4ENMA 1TQPA 2PMUA 1XDSA 3HOZJ 4IX7A 3RKXA 3GMEA 2KJBA 2X48A 3F8CA 1ZREA 3I4MJ 4KIGA 1UZCA 3BTCA 4DBQA 3W6KB 1OJLA 2HOSA 1CF7A 5EG0B 4ZYEA 3CMMA 2PMZN 4ZYGA 3CJQB 1OCPA 3ZXSA 3R61A 3QYEA 1TQMA 3C2GA 2XKPA 2WAFA 3PNVA 5E17F 2E7XA 1FYLA 2MC4A 2HOTA 4HDVA 4R1HA 1X58A 4PDKA 2VJJA 3KZIC 3MAJA 4KT6A 3V42A 1P7IA 3BG3A 4XR6A 3GFJA 4S0HB 2X4HA 1R4MB 1ZAOA 3H9QA 3L1PA 4P39A 1DPRA 2KKOA 2HFHA 4E6KG 4ASNA 1R1VA 1T38A 3KP6A 1P4AA 1USSA 4AIDA 4D5FA 3RQIA 1C5AA 1IUYA 3BLYA 2CJJA 1QBJA 4EM0B 3CZ6A 1UMQA 2FEZA 4LB5A 5IT3A 1DUXC 5M5XJ 2ISZA 2OAZA 1A31A 3PO3J 1REPC 3Q9VA 1W7PA 1L0OC 3CCVI 2EZKA 2VPLA 1I50J 1P4WA 4RAFA 4WK8F 4I01A 2K9QA 4EGYA 3S3OA 3HPHA 3G73A 2KMUA 4XICA 2EZLA 4EGZA 5JVGF 2P8TA 5HS8A 3H35A 2L01A 2BW3B 4DYCA 1HA8A 2E1OA 3VYRB 2RQQA 4AIJA 4F92B 2KRHA 1TWAJ 1X4PA 4XNFA 2BYVE 3I59B 4HV6A 5AIPA 1WJBA 1NTCA 2O8KA 1ZG3A 3RPQA 2QA4I 2EA2A 1SVLA 1VI0A 2L3DA 5CQGA 3RTRA 4BXUA 3EUAA 2YR2A 1RUNA 4L9JA 4CYDA 2XROA 1LDDA 2L5QA 5F0CA 4WXHA 4BACA 4FETA 4PFPA 5HLHA 3KCCA 2P0WA 1SC7A 2VQLA 1GV2A 2NVXJ 3OYCA 3OYKA 3WTTC 4EATA 1I1SA 5E20A 1SMYF 2ID6A 3CUQA 4KFCA 4BJTA 1VNDA 1W5SA 2DA1A 4YELA 2GOXB 3GWZA 5DM6F 4XOPA 5J8CA 2DN0A 3ERMA 2LF8A 4XOTA 1ERDA 3NAUA 3RYRA 4C3JJ 1HDDC 3FX3A 4KN4X 1QO0D 4WB2A 1ZKGA 1TWCJ 4HW5A 1BI3A 3LSRA 3CF5F 1E0EA 4II3A 2HVRA 4XL9A 4QPOA 3I71A 3OSFA 1VQ8I 2R7QA 4MGRA 1BI2A 2DFIA 1BIAA 1DQUA 4BHPA 3SEZA 1YOVB 1VQLI 2V7FA 1B8IA 3A2KA 2FU4A 3HSRA 4NC8A 2H94A 3S1MJ 3NWSA 2LSOA 3HKZA 2KL4A 2QSHX 3B6CA 3WGGA 4BH9A 3JTHA 3CJRB 4BJ5C 5GADJ 3FMRA 5D6FA 2F2EA 3PUFA 1XD7A 1ZQ3P 3RPUD 2OZUA 1Z3XA 2XB0X 3E6BA 4Y52J 2TCTA 3LSTA 4CO8A 2Q2EA 2MG4A 2Z3YA 4NQWB 2P7CB 2CV0A 2EQRA 4ITVA 4QIWN 3IV5A 3CCQI 3GTKJ 1P92A 4HX7A 2LY1A 3MEXA 3JTGA 2XPVA 3Q0VA 1U5TA 2M1BA 1YI2I 5FFZA 3GX4X 4GO1A 3RZOJ 2LKXA 3DLLF 3Q3SA 2EV5A 3CMYA 4BDYA 2RV8A 2E2HJ 2W7NA 1APLC 2HDDA 1BR2A 2H6BA 3BTIA 1OR7A 1MJ9A 3GZ5A 3I4PA 3SDGA 1IGNA 2QWWA 1OLTA 5FKLA 1RETA 3I9V2 3GLXA 2GWRA 5IP7J 2VXDA 1Z1DA 2XAFA 2HYGD 1QZYA 2Z99A 2QSGX 3V7CA 4A12A 2L0KA 3A03A 5EGOB 2VT2A 4JQFA 4CYCB 2B9SA 4HF0A 4XLCA 1HDPA 4A3DJ 3O2PE 2FF4A 2UUZA 3P7NA 1BR4A 5J6XA 3JCUC 1O3SA 3GFMA 3MKZA 4ESBA 3E1SA 1FNNA
chains in the Genus database with same CATH topology
4DOZA 2V6EA 3QOEA 4OWRB 4OAZA 3K10A 4B47A 2ZSHB 1T95A 1TZLA 2LY2A 3UNGC 2GOMA 4KITB 4B44A 2MYSA 5TGTA 2OC6A 4E7LA 1WJAA 2K9MA 2LBFB 2R7XA 3ZRGA 2CFOA 4BGDA 2VQCA 5FRNA 2LC2A 4H4KC 2Q1ZB 2Y0SA 2OV7A 1Z21A 4F3QA 1YX3A 2HU9A 3EPZA 2LREA 4CH7A 2HDWA 3HOSA 3C2HA 5CQEA 1S9HA 3W2AA 4LIVA 1FMWA 2E5ZA 4P5OA 3H9GA 4E7SA 4RLQA 3W3CA 3RSNA 1X1AA 3OMYA 4DIQA 4PJMA 3DLAA 3IAM2 4ZJZA 1Y56A 1MMAA 3FDYA 2JVHA 3UR3C 4CUGA 2DT6A 3CP2A 1OR7C 3DTKA 4XM3A 3TMOA 5LD2C 3RQ4A 1N75A 3MKYB 4C30A 2QKMB 2L9NA 4J00A 2WAQA 2WA0A 4P1WA 4E7HA 4R79A 4KJZA 4BQQA 4XLEA 2OUMA 3SDBA 2AQFA 3NWTA 4XORA 4KISA 3HG9A 3HC7A 3L2UA 1X1BA 3H5NA 1QHGA 1Z3YA 2KHMA 3AL0C 2AQEA 1D1AA 4E7KA 4ZTJA 2A5WA 1X1CA 5JPMB 3LL7A 2QKLB 2W82A 2XSJC 2Z16A 2L7KA 3HL2A 1QHHD 1DGWY 4RLFA 4BDZA 2CV2A 1D0ZA 4RM3A 4IKFA 1JI8A 2HPMA 3L2WA 4XKVA 2HVQA 1N77A 1DP3A 4ZYAA 3BG7A 2Q2EB 4ZDPA 3U21A 3GBGA 2K3PA 4XN3A 1W36C 4XKBA 3I3LA 4II2A 3VYUB 2WY7Q 5LFAA 1DGRM 4Y3OA 1G8XA 2VIXA 1UELB 1VZ0A 3DU5A 4YEJA 3LSIA 3DWLE 2X85A 3LSGA 3EUHC 1WFXA 4PK4A 4CCMA 3ZQQA 3OYNA 4CCJA 1KONA 3KX2A 3MD2A 1NG7A 2NOJB 4XMYA 3OYJA 3SEQA 2VKHA 3S93A 3LSKA 3MMYB 4BL0B 4BQOA 2HVSA 1ZELA 1WJCA 4Y4RA 3OS2A 3FHNA 1X1DA 3OYGA 1R6RA 2E1MC 4NUBA 1W36D 3D5RC 4BQNA 1UAAA 4C2UA 1U0JA 2E5NA 1WJFA 2CS3A 5JHFA 5FRMA 3VYTB 3OYLA 4BEHA 4ZDLA 3LSHA 3ZGKA 4G6TB 3DKYA 3K4JA 4IQJA 3H9JA 2I8DA 3OOUA 2X6XA 3S3MA 2WAEA 5KCMA 2XF7A 1LVKA 2ELJA 4ZDOA 2KPMA 1SFKA 2X1EA 1MNEA 4CZCA 4Y33A 4BUPA 1AA7A 2M0MA 3H0DA 3OY9A 4NC7A 2X6YA 2VQHA 3OS1A 2DT7B 4PJJA 1EA3A 4PFOA 2CV1A 4LG3A 2KZVA 3M8JA 3KYLA 3MKWB 4LIUA 2HQAA 2BVLA 3ZR8X 1WJDA 2LOOA 4FXGB 2BW3A 1FMVA 2V9KA 4HSRA 2WBMA 2JSPA 4XN0A 4CSWA 4XKWA 2MD0A 2LYCA 3OR1C 4XONA 1T0FC 4F93B 2CW8A 3DU6A 3TL4X 2BVMA 3HPGA 2E1MB 2XF5A 3S8PA 3OWTA 2VXZA 2X6WA 4IQ4A 4E7ZA 1V5FA 2LH9A 3IAS2 3SYTA 2V26A 3LFUA 4HPQA 3L2VA 1D1CA 3D5LA 4AYBA 4BE0A 3LSMA 1MNDA 4HNTA 2M7BA 3AKZA 3DPTA 1WJ5A 3K4NA 4PUSA 2KLOA 4XLHA 2IS2A 2K9LA 2JUGA 3K70C 3A4CA 5FROA 3DTIA 3OYIA 2M3AA 4BE2A 3K4CA 5HNHA 2FUG2 1WJEA 2L2OA 2ZXHA 4X0GA 3CF2A 5HLTA 2M4GA 2K5CA 4U87A 4QPQA 1Y6IA 2ZXIA 4HSTA 3VSLA 4PJNA 3PUBA 2Z2SB 3DQVC 5CKTA 4RM2A 2RREA 2MFZA 2PMZA 3VYSB 1D1BA 4HG2A 1G59A 3DTEA 2DOAA 2F5VA 5KHDA 4PSWA 2LRDA 3BCAA 5HNFA 4BE1A 3W2WA 4CA0A 3QODA 2X51A 4ZC3A 2KQRA 1LKXA 2PJRA 1D0YA 3K70D 1BOBA 2W00A 2WADA 1V5EA 3G2BA 3SZGA 5KNLA 1TT0A 2W1OA 2IS1A 2DJIA 3H5RA 2DXIA 3VSKA 1MMGA 4IX7A 2XAUA 3AFHA 2F6CA 1P9QC 1PYVA 3FKJA 3OR2C 3QYBA 4DBQA 3OYFA 2JA2A 4B48A 3PFYA 1MW7A 3CMMA 3PSFA 3CJQB 3OYBA 3ZXSA 3QYEA 3AL0B 3C2GA 3LMMA 4PJLA 4E7IA 2WAFA 3PNVA 4CCOA 2WY8Q 4CCKA 2MC4A 3D5SC 4BEHB 4JOMA 2VQGA 2VJJA 4KT6A 3PJRA 3M1CA 3RCOA 3PSIA 4XR6A 4XLAA 3V42A 4BXFA 4N4NB 3ZCOA 3W2VA 4XLFA 3DKXA 3H9QA 2HZDA 4E6KG 3BG6A 2IGNA 4FASD 2JVGA 3HOTA 2XDVA 4F55A 4IZZA 3K4KA 4CCLA 4BJ6C 2E60A 3BLYA 3IUOA 4GRIA 3BC8A 3CZ6A 3HXLA 3TBIA 1LFPA 4DGWB 3K4BA 4B43A 4RMNA 2XF6A 2IGKA 3ONQA 2X1CA 2VPLA 4YRVA 4CCNA 4XQFA 3CP8A 4C9YA 3S32A 2VJIA 3J7AY 4HNUA 2XC7A 3S3OA 3VWBA 2UV1A 3OYMA 1QU3A 3HPHA 2KMUA 4ZTFA 3H35A 4F52A 2BW3B 1HA8A 1MMNA 2ZFUA 4HRIA 3VYRB 3OIQA 2RQQA 4F92B 2KP6A 3BCBA 2KRHA 1X4PA 3F9KA 2A6TA 2LBFA 4XNFA 4DJAA 1WJBA 3H5AA 3IP4B 5CPRB 2LG4A 3HUGB 3OYHA 1N78A 2X1DA 5CQGA 2VKDA 3FBNB 1YX5A 3EUAA 4XKCA 3RTRA 3OYAA 2ZSIB 3A1YA 1YE9A 1D0XA 2BOLA 1Z7LA 2L5QA 2R4GA 4BACA 2V1NA 4FETA 4PFPA 2IS4A 2VLAA 1PJRA 2F4IA 2P0WA 1K6YA 2VQLA 1MMDA 2VASA 5HVQC 3OYCA 3PNTA 4PSXA 4EATA 3OYKA 1X19A 3KEYA 3CESA 3FBIB 4ANJA 4F91B 4BJTA 4YELA 2IGMA 2GOXB 3K4LA 4XOPA 4XOTA 4D1QA 4OAYA 2O5RA 1ERDA 2CMPA 4BU2A 1BR1A 1X4OA 3K4MA 4N4OB 2R7TA 2RNGA 1E0EA 2VL8A 4II3A 2HVRA 4XL9A 4D9JA 4QPOA 2DCEA 2R7QA 2KDOA 3S3NA 4C2TA 1DQUA 3SEZA 2WB1A 2V7FA 2VJ5A 3N05A 3A2KA 1J09A 4AVZA 2PJRB 4NC8A 2CUJA 4E7JA 2CH0A 2R7RA 2MABA 4BS9A 3NWSA 2V4JC 3HKZA 3PL8A 2KL4A 4LITA 2IS6A 2Z1DA 4HEA2 3E0JB 3OL4A 3CJRB 4BJ5C 3L2QA 2UWMA 2HNHA 3QYFA 1UG0A 3OL3A 5HOOA 3RPUD 1IRXA 1V5GA 1Z3XA 2CW7A 3EUKL 3OYEA 2M4KA 4NNJA 4NQWB 2CV0A 2R7OA 4ITVA 2LY1A 3DPLC 2R7WA 2IGOA 2KRCA 4E4HA 3L2RA 4DBRA 3K6GA 3OS0A 4MLOA 4J01A 4BDYA 3PNYA 1LDKB 2W7NA 4U7BA 1BR2A 3DPUA 1NG6A 3OYDA 1OLTA 2R7SA 1SAUA 4AU7A 2R7VA 3I9V2 3DEEA 2VB6A 3VDXA 2VXDA 2M7AA 2IXSA 2HPIA 2L9SA 1GLNA 3OIPA 4B3XA 2CUZA 4JQFA 2VJ4A 4XLCA 2R7UA 2W4SA 2UUZA 1BR4A 3MKZA 3E1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AA7 A;  4ITV A;  3MD2 A;  1EA3 A;  3VDX A;  2Z16 A;  4PUS A;  5CQE A;  4D9J A;  4IQ4 A; 
#chains in the Genus database with same CATH topology
 4OIR F;  2V6C A;  5BNG A;  5B3S H;  1J59 A;  2YX4 A;  3KLN A;  3G1O A;  3QOE A;  4CXF A;  2D2W A;  2YS9 A;  1G4D A;  2D1V A;  4MQV A;  2Y31 A;  4BYY A;  5J4Y A;  5CYV A;  2VN2 A;  2ZJ2 A;  4B44 A;  2FMY A;  4P55 A;  5TGT A;  3S2D J;  4A0X A;  3QU6 A;  3ZRG A;  3J7Z I;  4NBQ A;  2LFB A;  1ODD A;  2LC2 A;  3BWG A;  1A35 A;  2P6T A;  3H3Z A;  5CVJ A;  4A3B J;  2FNP A;  1VFC A;  1Z21 A;  2ZKZ A;  5EZH A;  3QPL A;  1WQ2 A;  4F3Q A;  3CCR I;  2LRE A;  2HDW A;  2DFF A;  2HYF A;  3EET A;  2TDX A;  1WH7 A;  1XB4 A;  3SFI A;  3T5X A;  4P5O A;  2CUE A;  5KAF C;  1BM9 A;  3GW2 A;  3F22 A;  5FKM A;  2YU3 A;  3HRM A;  3OMY A;  3C3W A;  3NEU A;  3V8J A;  4UV9 A;  1ETO A;  3DLA A;  3IAM 2;  1Z77 A;  5L3G A;  1J2X A;  2DMT A;  1G3T A;  1Y56 A;  2R5Y A;  4CUG A;  2HYJ A;  4MEY F;  3CP2 A;  2Z33 A;  1VQK I;  3TMO A;  5LD2 C;  3MN2 A;  3MVP A;  3GTG J;  1N75 A;  2M0C A;  3MKY B;  2QKM B;  4GYG A;  2L9N A;  1Z91 A;  2OCE A;  3LSJ A;  2WA0 A;  4E7H A;  2IEK A;  4IOA F;  1ZRC A;  2AXT C;  3H0G J;  2L02 A;  2MLK A;  3IWF A;  3K9T A;  3KP3 A;  2RQP A;  1EKE A;  2ID3 A;  4BY7 J;  4FX4 A;  3L2U A;  1X1B A;  1J75 A;  3I58 A;  3ZMV A;  3AL0 C;  3QQA A;  3KZY A;  1WI9 A;  4BBS J;  3LL7 A;  2W82 A;  2LVS A;  4M3D A;  4FE4 A;  1DGW Y;  4BDZ A;  3WU0 A;  3C7J A;  3OV8 A;  2EJR A;  2HPM A;  2A05 A;  4Q4Z F;  4ZDP A;  3U21 A;  3ZN1 A;  1IAW A;  2LTP A;  2EPF A;  3LAP A;  2GZW A;  3VYU B;  2WY7 Q;  1PUE E;  1R4N B;  4E70 A;  1YJW I;  1MJB A;  3ECH A;  3FHZ A;  1W1W E;  4ENN A;  1RKW A;  3ZQI A;  4M3E A;  4I0A A;  1SD5 A;  4HV5 A;  5E1W A;  2ETH A;  4YEJ A;  1V3F A;  2ZCW A;  2X85 A;  3DWL E;  3HJE A;  5CVI A;  5KVR A;  2QQ8 A;  1D3Y A;  1Z67 A;  3E5Q A;  3EUH C;  2JRT A;  2OPT A;  2ZME A;  2KIS A;  3A01 B;  4U0Y A;  2WB1 N;  3OYN A;  2QCO A;  3M1E A;  4LMY A;  4CCJ A;  3ZQF A;  1K7A A;  2XAG A;  1NG7 A;  2JMW A;  3BG9 A;  1ETX A;  2HVS A;  1ZEL A;  3CUO A;  1SD7 A;  3NRV A;  4A2U A;  1XS9 A;  1RRJ A;  1VQ5 I;  2CQ7 A;  3SZT A;  3BJO A;  5IP9 J;  4NUB A;  3H3V K;  2VKV A;  2E35 A;  3HHG A;  4HQM A;  2YPR A;  2I10 A;  4C2U A;  4EJW A;  1OCR H;  4HQE A;  5BS6 A;  5D8L B;  3QPT A;  4GGG A;  2CSO A;  2IT0 A;  3VYT B;  1AU7 A;  1YS6 A;  2A6H F;  3BQZ A;  2VE8 A;  2XUB A;  1IG7 A;  1D8J A;  2OTL I;  3DKY A;  2V79 A;  3K4J A;  3H9J A;  4M9S A;  2ME6 A;  5H2F C;  1R36 A;  5GTI C;  4V2G A;  5KCM A;  2XF7 A;  2A6E F;  2ELJ A;  2PMH A;  4IRI A;  1SFK A;  2X1E A;  2V9V A;  4C3I J;  2PN6 A;  2Y9Y A;  3TDZ C;  4Y7N J;  4I09 A;  4UVA A;  1OCC H;  2M0M A;  2YSR A;  3OY9 A;  1K4T A;  3FF5 A;  1RPW A;  3RKQ A;  4RAG A;  1S72 I;  1G3Y A;  2HOE A;  2M9H A;  4OMY A;  4PJJ A;  2EZH A;  3P9K A;  4PFO A;  2CV1 A;  2W84 A;  2IP2 A;  4LG3 A;  5E79 C;  4L5J A;  4MO7 A;  3FXK A;  4R8H A;  2LR8 A;  5F1R A;  2NS0 A;  4HAM A;  1YO5 C;  2NYX A;  1WJD A;  1B72 A;  1FMV A;  4HSR A;  3TP3 A;  3HSF A;  1PP7 U;  1ZAR A;  2JSP A;  2DK8 A;  2IA2 A;  4F7Z A;  1BA5 A;  4XKW A;  2MD0 A;  3OR1 C;  4JBA A;  3ZQC A;  4XON A;  1T0F C;  4IEJ A;  4XRS G;  2CW8 A;  3HPG A;  2BBY A;  1JE8 A;  3S8P A;  2CG4 A;  4P96 A;  3QAH A;  2VXZ A;  3RIR A;  1IDY A;  4XRS A;  2O8X A;  1XDU A;  2M87 A;  3A0H C;  2LH9 A;  2LMD A;  3FM3 A;  4E7Z A;  3MCZ A;  1KU3 A;  2VOO A;  2NS7 A;  4IL6 C;  2XAS A;  2HTJ A;  2RGV A;  1D1C A;  1RI7 A;  1H88 C;  1SVO A;  5D6E A;  4IHY A;  2Y0S N;  1JTX A;  1Y1W J;  1MJA A;  4OOI A;  4NC6 A;  2FOK A;  4NDL A;  4HW0 A;  1GDT A;  3A4C A;  4I76 A;  3TOA A;  5FRO A;  5B1A H;  5HS7 A;  3OYI A;  2L2O A;  2ZXH A;  4B3A A;  1Z9C A;  3CF2 A;  3KP4 A;  2LY9 A;  3GUD A;  2M4G A;  4WXD A;  3M3Y J;  4OIQ F;  1Y6I A;  4HST A;  1H9G A;  4X6A J;  2FD5 A;  1GXP A;  2KFD A;  1IXC A;  2FML A;  4WXC A;  5CKT A;  3GTM J;  2RRE A;  5DS9 A;  1HW5 A;  2K9S A;  1YHQ I;  3CCY A;  2K4J A;  2HQN A;  1IZ1 A;  1PUF A;  3EDP A;  3P9I A;  2GA1 A;  2HXO A;  2DOA A;  4UV8 A;  4I6Z A;  1IF1 A;  5E3O A;  3H3U A;  4BE1 A;  1RIO H;  3EQL F;  5D5V B;  4CA0 A;  4LFU A;  2KQR A;  1JUS A;  3ZQH A;  5HDN A;  3K70 D;  5BPI A;  4FQG A;  3VEP A;  1K78 B;  3WU1 B;  4OIO F;  2QYO A;  2W1O A;  5KNL A;  4ZZD A;  1ETV A;  4W1U A;  3H5R A;  3VSK A;  3F23 A;  2EV0 A;  2VOD A;  3KLS A;  2QGU A;  2F6C A;  1K83 J;  3KFW X;  1P9Q C;  2DMQ A;  5LHI A;  1PYV A;  1UG2 A;  2PEX A;  5ICE A;  1FYM A;  3BPV A;  1KGS A;  4B48 A;  4DW6 A;  5E3N A;  4P3B A;  2DOE A;  3DP7 A;  4G7O F;  4AUX A;  3R6S A;  3HEF A;  4GXO A;  4RGU A;  5E18 F;  1MH4 A;  3F8N A;  3FZV A;  3LNQ A;  2CFX A;  4PJL A;  2P5L C;  4E7I A;  1KJS A;  4CCO A;  1JT0 A;  2WY8 Q;  3F0C A;  2H27 A;  2M5W A;  3OOP A;  3PFI A;  4JOM A;  2VQG A;  1SEU A;  3PJR A;  4EJT A;  3W6J B;  3JW4 A;  3ZMD A;  1FSH A;  5C44 J;  3A02 A;  5EF6 A;  4KNY A;  2KT0 A;  5K7H A;  1FPQ A;  3HHH A;  3B6A A;  5FB2 A;  3WE2 A;  4FAS D;  1VQM I;  2JVG A;  4IZZ A;  2HTS A;  4F55 A;  3IC7 A;  3K4K A;  4CCL A;  4ZYD A;  3JSO A;  2AO9 A;  4G94 A;  3I54 A;  3CDH A;  2E60 A;  2R7D A;  3ROU A;  1ZGW A;  2H1K A;  2YU9 J;  3TO9 A;  4GRI A;  3BC8 A;  3TBI A;  3L7W A;  4DGW B;  3K4B A;  4IRG A;  1ZRD A;  2IGK A;  3MWM A;  3M07 A;  1A36 A;  2WC2 A;  2X1C A;  3HRS A;  1YRN A;  4XQF A;  4IOC F;  3S32 A;  1R7J A;  3IH4 A;  2BGC A;  3MQ0 A;  4HNU A;  3VWB A;  2UV1 A;  4DZJ A;  2JN6 A;  1H0M A;  4I02 A;  5KK1 A;  2L54 A;  4HDU A;  4F52 A;  5J47 A;  2E7W A;  2ZFU A;  4M72 A;  2XHK A;  4HRI A;  2BHZ A;  3BPX A;  4M74 A;  1BC7 C;  1AOY A;  3MZY A;  2VBW A;  3BCB A;  3IKT A;  2LBF A;  4DJA A;  3CC7 I;  3H5A A;  4ESJ A;  1PDN C;  4YIF A;  2XB5 A;  5CPR B;  5LGU A;  3OYH A;  4LG0 B;  1UHW A;  3SHF A;  3FBN B;  5L3C A;  2O0Y A;  4XKC A;  5GAG J;  3CCM I;  1YYV A;  4A3E J;  2LNB A;  1GXQ A;  3A1Y A;  3BQY A;  5HLG A;  1D0X A;  1I39 A;  2EIM H;  3E5U A;  1XGN A;  2VLA A;  1R58 A;  1K6Y A;  1MSE C;  3J7Y J;  1I6H J;  4EEF G;  3CCS I;  5GP9 A;  4A3L J;  5HVQ C;  3Q5F A;  1T98 A;  4PSX A;  3FBI B;  4ANJ A;  3LFK A;  1KQ8 A;  1HQC A;  4RGS A;  1HST A;  4U0V A;  3GFL A;  4CIC A;  2F5E A;  1ZRF A;  2CQQ A;  3TOB A;  2O5R A;  3G1M A;  4BKX A;  2LLK A;  2GBY A;  1GVD A;  3BR6 A;  3L2C A;  1BR1 A;  1X4O A;  3K1M A;  2VON A;  1XMA A;  1JJ6 C;  4QLC U;  2M2E A;  1B1B A;  2VL8 A;  4NB5 A;  3WOD F;  3AG4 H;  2CW0 F;  5FLV A;  4IPA A;  1O7L A;  2FE3 A;  1I5Z A;  4IHW A;  4C2T A;  1MBE A;  1O57 A;  2MW8 A;  4G7H F;  2WB1 A;  3CME I;  4A3C J;  2DMN A;  1HOM A;  2MAB A;  2V4J C;  1Y0N A;  2JZY A;  1RR7 A;  2IS6 A;  2EK5 A;  4IVN A;  2Z1D A;  5TJJ A;  2XAQ A;  5FKK A;  1T56 A;  2EFN A;  1U6G A;  3H92 A;  4LGW A;  1UG0 A;  3OL3 A;  1CQT A;  5HOO A;  3DEW A;  1IRX A;  3E6M A;  4A3K J;  1U8B A;  4EJO A;  4HF1 A;  4A5N A;  2O03 A;  1FX7 A;  3O8G A;  2AXL A;  4BQA A;  4A3M J;  1F4K A;  4QSH A;  2M34 A;  2QEN A;  2LDU A;  1K79 A;  5EYR A;  1JTY A;  2R7W A;  2IGO A;  3COA C;  3W6V A;  2Q0O A;  1FIA A;  4KN7 X;  4BXX J;  2JPC A;  4MLO A;  2QBY A;  2GM4 A;  1VQN I;  3PNY A;  3BR5 A;  4ZYH A;  1KYZ A;  2P7V B;  1OQY A;  1NG6 A;  3FXU A;  5B1B H;  1SAU A;  4A69 C;  2R7V A;  4D7N A;  3CD6 I;  2YUS A;  3DEE A;  2VB6 A;  1XGS A;  5IYB J;  2M7A A;  5K1Y A;  2HPI A;  2DPD A;  2L9S A;  1FC3 A;  1ZYR F;  4A5M A;  1OIS A;  4B09 A;  3OIP A;  1HLV A;  2DTR A;  2A73 B;  3Q0U A;  5DCM B;  3GTO J;  3C1D A;  1KYW A;  3M7G A;  3X2Q H;  1O7F A;  1QRY A;  4Q47 A;  1UCR A;  2W4S A;  1IXS B;  3DV8 A;  4Z2Y A;  5EEA A;  3JRB A;  5CVR A;  1RNL A;  4IJA A;  3KEO A;  1FP1 D;  1T2K A;  4B47 A;  1R71 A;  5HLI A;  1ENH A;  1GT0 C;  2O9L A;  2DK5 A;  2ZSH B;  1TZL A;  2LY2 A;  1IDZ A;  2Z5U A;  2NNY A;  1P2F A;  2VBY A;  1XMX A;  2MYS A;  3T1B A;  2R7X A;  2ZXJ A;  2CFO A;  3U9G A;  5D8K B;  4BGD A;  4M6V A;  1EJ9 A;  3GTL J;  2Q1Z B;  2Y0S A;  5M5W J;  3NQO A;  4DQ2 A;  2HU9 A;  2B0L A;  3HOS A;  1LEB A;  2KIU A;  2A3S A;  1U8R A;  3RZD J;  2JQ7 A;  5CQE A;  1MBK A;  1S9H A;  1GV5 A;  3DXJ F;  4UUS A;  2E5Z A;  1KU9 A;  2R5Z B;  4E7S A;  1JUM A;  2BE5 F;  1DDN A;  2BZT A;  1B4A A;  4DIQ A;  2G9W A;  2OQG A;  5LLQ A;  3EYI A;  3HTS B;  3T8R A;  2XRL A;  4GFB A;  1MGT A;  2RKH A;  1C0W A;  5K5O A;  1MMA A;  2R7F A;  1EH6 A;  2DT6 A;  4D7M A;  4XM3 A;  3RQ4 A;  4BHC A;  3FIW A;  4J00 A;  5K5Q A;  2WV1 A;  4R79 A;  4JX4 A;  9ANT A;  2F5F A;  4XLE A;  1CFA A;  4XLP F;  3WTU C;  5ILU A;  3ABL H;  4MNU A;  4XOR A;  4BNC A;  1AKH B;  2DTZ A;  3HM5 A;  4JX5 A;  3R0J A;  3ZQG A;  1VQ6 I;  3CDL A;  1Z3Y A;  2KHM A;  1XPX A;  4Y17 A;  5CVV A;  2K86 A;  2AQE A;  1D1A A;  4E7K A;  3MZH A;  4H0E A;  5JPM B;  1CGP A;  3J7A O;  4BAY A;  2L7K A;  2VI6 A;  3ULQ B;  2Y69 H;  2QUF A;  5LRS A;  1WHU A;  3T8T A;  4XKV A;  1FBQ A;  1WVR A;  2CWE A;  4WWC A;  2CQX A;  1BW6 A;  2H1L A;  3ZMT A;  2STW A;  1O3R A;  1YLF A;  3GBG A;  1W36 C;  4XKB A;  1W5C C;  1EH7 A;  1MBG A;  2DOF A;  1K6O A;  3KZZ A;  2E1C A;  2QF7 A;  1QGP A;  2X6O A;  4LB6 B;  4D0P A;  2IW5 A;  1IUF A;  2ZC2 A;  3M8E A;  3CC2 I;  3HOV J;  4YIR X;  1J0R A;  3LSI A;  2F4O B;  5C4J J;  2KDZ A;  3LSG A;  4KT5 C;  3BZ6 A;  2DAO A;  4FXK B;  2UXX A;  1FWZ A;  4PK4 A;  2PJP A;  3FXM A;  3Q9S A;  5K7F A;  1KON A;  2EFP A;  3KX2 A;  1ZH5 A;  2OCC H;  2EBI A;  1W0T A;  3VFZ A;  4FE7 A;  4XMY A;  3MMY B;  3V8L A;  1FIP A;  3FKI J;  4BL0 B;  4BQO A;  4ETS A;  3CMA I;  5IT9 K;  2I5U A;  3IWZ A;  1Z7U A;  3M9A A;  5EG0 A;  1V54 H;  3FXQ A;  5F64 A;  1X1D A;  1LFB A;  1S5L C;  2E1M C;  4FCY A;  1TTY A;  3IHU A;  5FKO A;  4BQN A;  3RKY A;  4PGG A;  3RDI A;  2IRF G;  3DFG A;  2CS3 A;  5JHF A;  4TV7 A;  2MA3 A;  1ON1 A;  1FZP B;  5H6R A;  1YJ9 I;  1GVJ A;  2LP0 A;  3GLL A;  4A0Z A;  1W4M A;  4RBO A;  4HX4 A;  1VTN C;  4MFD A;  2XVC A;  1KQ0 A;  3H36 A;  2CRG A;  1HC8 A;  2WAE A;  3DBR B;  5D4S A;  1PP8 F;  2E1N A;  1MNE A;  1E2X A;  4CZC A;  2FRH A;  1RZ4 A;  1ZLJ A;  3PIP F;  4RAZ A;  2MH2 A;  1K4S A;  3V8K A;  3ZPL A;  3BZK A;  2L7F P;  4GDF A;  5LRR A;  2VOP A;  3CO6 C;  3S15 J;  1HKT A;  1NH3 A;  3QP5 A;  1NK3 P;  2DT7 B;  2ZNY A;  4L9V A;  2ADU A;  1FOY A;  1T8I A;  1B9M A;  2JUC A;  3QU3 A;  4NHJ A;  4P9F A;  3M8J A;  1HW1 A;  2KIF A;  3MKW B;  2EFQ A;  4DYQ A;  3HSE A;  4LIU A;  1GHC A;  1X3Z B;  2BVL A;  2LOO A;  4FXG B;  2BW3 A;  2V9K A;  4G9Y A;  3DCF A;  2WBM A;  3F8M A;  1J9I A;  4CSW A;  3GTJ J;  3V4G A;  1H89 C;  1JHF A;  2JSC A;  3SZP A;  3I59 A;  4EJU A;  2E1M B;  1MD0 A;  2HKX A;  1MZB A;  2QZ8 A;  1V5F A;  1OPC A;  1LPQ A;  2BHY A;  3ABK H;  3JR9 A;  3BZC A;  4HPQ A;  3ZQL A;  5ERI A;  2K9N A;  5IT9 Z;  3LSM A;  3WTV C;  3K2Z A;  1WJ5 A;  3ISP A;  4MIM A;  2K9L A;  4XLH A;  4YII A;  3BY6 A;  3S2H J;  1Q1H A;  1Y1V J;  2DW4 A;  1JHH A;  1WJE A;  2ELH A;  3CCJ I;  2ZJR F;  4EQQ A;  5HLT A;  3S1R J;  4FIS A;  4LK1 F;  4FX0 A;  4QPQ A;  1R9T J;  1V4R A;  2XIG A;  3ASN H;  2HQR A;  4B8X A;  2ZXI A;  3VSL A;  1X3W B;  2VBX A;  3PUB A;  2A68 F;  3A0B C;  3S1Q J;  4L18 B;  3L00 A;  2H09 A;  2MFZ A;  2PMZ A;  4UVC A;  2DA4 A;  5AIQ A;  3VYS B;  4S05 A;  4U7D A;  1D1B A;  4L0Z B;  4HLX A;  3M4O J;  2EFW A;  3HQA A;  4HG2 A;  2DFH A;  2DJN A;  4ENK A;  2F5V A;  4KDP A;  4KA4 A;  4I98 B;  1QNT A;  3L9F A;  1YIO A;  1XMK A;  1ONV A;  2V1D A;  3PM1 A;  3MFK A;  2CUF A;  1TWH J;  3EYY A;  5FFX A;  2XGX A;  2IBD A;  3ZN0 A;  2JWT A;  1BOB A;  3HYI A;  1OYW A;  3VPR A;  1V5E A;  3SZG A;  1TT0 A;  3F21 A;  2VKE A;  2DJI A;  1HW2 A;  2ZO4 A;  3IH3 A;  1ETK A;  2A5Y B;  2NVQ J;  2ECB A;  3AFH A;  2M8E A;  3KIO A;  3HZJ A;  5IYD J;  1T39 A;  2BY3 A;  2GLO A;  2HEO A;  3FKJ A;  3OR2 C;  2PFB A;  2GA2 A;  2JA2 A;  2ACJ A;  3PFY A;  1MW7 A;  3CO7 C;  3NAR A;  1LE8 B;  4NQW A;  3PSF A;  1YW7 A;  4ZZL A;  3OYB A;  1YIT I;  3HRU A;  4XBF A;  2AS5 F;  5HS9 A;  3G4S I;  2FJ1 A;  3AL0 B;  1SFO J;  2H8W A;  3LMM A;  5DD4 A;  3DBH B;  4MTD A;  4CCK A;  4N9I A;  4RA2 A;  4AC0 A;  4BEH B;  1IXR C;  3CJT B;  5LGN A;  1W7P D;  3M1C A;  3QP6 A;  4WF2 A;  1MBF A;  3PSI A;  4BXF A;  4XLA A;  3LA3 A;  4N4N B;  3ZCO A;  4A6D A;  3WE3 A;  3O3K A;  5FJ8 J;  4XLF A;  3HQB A;  4N9H A;  1LQ1 A;  2JA5 J;  2HZD A;  1MBH A;  5EEG A;  2XDV A;  1X2M A;  2CYY A;  4BJ6 C;  1UJ8 A;  3IUO A;  1FTT A;  5EGO A;  5ED4 A;  2P81 A;  1MSF C;  1LFP A;  5GAE J;  4CYC A;  3FXR A;  3ERE D;  1WWX A;  4RMN A;  1QPI A;  2QVO A;  2FOW A;  3B02 A;  2PG4 A;  4C9Y A;  1BI0 A;  3J7A Y;  1QU3 A;  2IJL A;  4M71 A;  3C18 A;  4ZTF A;  1LEA A;  1ETQ A;  3AG3 H;  3WTS C;  4M73 A;  1MMN A;  3KP2 A;  1WRJ A;  3JRA A;  3JRF A;  4UU9 C;  3GF2 A;  2A6T A;  4ESF A;  4Z6Y A;  5GPA A;  3JAM K;  2K02 A;  2FSW A;  2R0Q C;  3IP4 B;  5J1Y A;  2LG4 A;  3HUG B;  1N78 A;  3CJN A;  3G1L A;  1MDM B;  2EIK H;  1YX5 A;  2BY0 A;  2P5K A;  5DTD A;  2ZSI B;  2FQ4 A;  2X0L A;  2BV6 A;  4IRH A;  5IY5 H;  3IL2 A;  2BOL A;  1Z7L A;  2RVC A;  2V1N A;  1PJR A;  2F4I A;  1BI1 A;  1MMD A;  5ICC A;  1P4X A;  2VAS A;  5JFR A;  3PNT A;  1X19 A;  3KEY A;  1OCZ H;  1YTY A;  3CES A;  5DYM A;  2P6S A;  4F91 B;  1O3Q A;  2Y9Z A;  1FT9 A;  5JLW A;  2IGM A;  4XRM A;  4EM1 A;  4D1Q A;  2CMP A;  4IHT A;  4BU2 A;  2QM3 A;  1G3W A;  1XN7 A;  4KIF A;  3ABM H;  3S2W A;  3K4M A;  2R7T A;  3DF8 A;  1HKQ A;  2Z9O A;  4ZH4 F;  4I99 C;  3AG1 H;  4C2M J;  3U1D A;  2ZBK A;  3CDI A;  2KDO A;  4UXN A;  2IA0 A;  3LOC A;  3JSP A;  1TW3 A;  4UUT A;  4RGR A;  2DMP A;  5BOX A;  4AVZ A;  2PJR B;  2CUJ A;  1ZN2 A;  1DPU A;  4AYB N;  4E7J A;  1YW9 A;  5JHU A;  4BS9 A;  3PL8 A;  4XID A;  1YJN I;  5IOY A;  3GFI A;  3G6E I;  3E0J B;  2UWM A;  2DBB A;  1BOA A;  1RR8 C;  1V5G A;  2MSY A;  4KMU X;  5E1Z B;  3TKY A;  3KE2 A;  2TRT A;  1SMT A;  3JAM Z;  2CW7 A;  3EUK L;  1CF7 B;  1TWF J;  5ICF A;  1Q1V A;  2R7O A;  2OZ6 A;  3O8H A;  3TGN A;  2QQA A;  5L3E A;  2IPQ X;  5HDG A;  3DPL C;  2EWN A;  3KEQ A;  3L2R A;  1H8A C;  5J4V A;  2H8R A;  2PX9 A;  3K6G A;  2DPU A;  5LGT A;  2CQK A;  5BMZ A;  5FGM A;  4IO9 F;  2PI0 A;  5DM7 F;  3PIO F;  2O61 A;  1IRZ A;  4U7B A;  1BC8 C;  2L9V A;  3RPU A;  2ZB9 A;  3DPU A;  5JVT A;  1TC3 C;  3A01 A;  2KIQ A;  3R60 A;  2B63 J;  2ZJQ F;  3F3X A;  4HWJ A;  1XGO A;  2IXS A;  3CUQ C;  4XLN F;  2DA6 A;  2DA3 A;  4XK4 A;  1LVA A;  3GCM A;  4RB0 A;  1A5J A;  1U78 A;  1OYY A;  4B3X A;  1QZZ A;  2CUZ A;  1TNS A;  1W0U A;  3ASO H;  2R7U A;  1GUU A;  3E97 A;  2JT1 A;  1LUJ B;  1W7P B;  2VC1 A;  2ESN A;  3B73 A;  1LB2 A;  1I3Q J;  1KQ9 A;  1JJ8 C;  2XGE A;  2V6E A;  3LQR A;  4OWR B;  4FTH A;  3FXJ A;  2EIJ H;  3BDD A;  2R92 J;  3BP8 A;  4FT8 A;  5DD8 A;  4HF2 A;  5ILS A;  3UNG C;  3VOE A;  1BJZ A;  2GOM A;  4LOC A;  4RDU A;  4KIT B;  3BJ6 A;  2PLY A;  2OC6 A;  2HXI A;  2JJ7 A;  1WH5 A;  1WJA A;  2OU2 A;  1BW5 A;  3GTP J;  2EH3 A;  2VQC A;  5FRN A;  1EH8 A;  3HGY A;  4U88 A;  1ORK A;  1QPM A;  1X2N A;  3KYC B;  1U9O A;  2OV7 A;  4A0Y A;  2CO5 A;  4P9U A;  4IF4 A;  1JKQ C;  1FY7 A;  4UHT A;  1YX3 A;  1A6Q A;  4M6X A;  3ELK A;  3C2H A;  3EUH A;  1WI3 A;  2DI3 A;  1FMW A;  1SD4 A;  3H9G A;  1JKR C;  3GO5 A;  2VE9 A;  4KIC A;  2RNJ A;  4RLQ A;  5F0F A;  3W3C A;  3RSN A;  3CUQ B;  3R0A A;  2A69 F;  2NOG A;  1R1U A;  1U5T C;  4PJM A;  3U1K A;  2YX7 A;  2ME0 A;  1B59 A;  3KP7 A;  5DDG A;  1HBX G;  4L9N A;  5E8G A;  3FDY A;  2NXN B;  2JVH A;  5TIS C;  3UR3 C;  4B4C A;  1VQO I;  2K40 A;  1OR7 C;  3JRG A;  3LQQ A;  4JYK A;  2FBK A;  4PZJ A;  2FNA A;  4C30 A;  1ULY A;  5DUI A;  1VQP I;  3D0S A;  4P1W A;  4KJZ A;  1L3L A;  4BQQ A;  2OUM A;  1IRF A;  2AQF A;  3NWT A;  2Q8K A;  1R1T A;  1ZLK A;  2HQ5 A;  2XGC A;  3HC7 A;  2OA4 A;  2NAZ A;  1A04 A;  3H5N A;  1B8I B;  2DU9 A;  1Z6T A;  3ESW B;  4ZTJ A;  4UB6 C;  2DT5 A;  1X1C A;  1FOX A;  1D8K A;  3ZMS A;  4BBR J;  2NVT J;  2K3F A;  2EV6 A;  2QKL B;  2XSJ C;  3HL2 A;  5F04 A;  1HF0 A;  2X9D A;  4KMF A;  2V1U A;  1ITY A;  2F4M B;  1UHM A;  4J19 A;  4L0Y B;  1JI8 A;  2KIM A;  4P3A A;  2MBF A;  2VPR A;  1N77 A;  2XPU A;  2CGP A;  3BG7 A;  2Q2E B;  3F6V A;  4XN3 A;  2JPB A;  2K7L A;  2J5P A;  3WG7 H;  2BEO A;  2NRA C;  1S29 A;  4HYE A;  1RKT A;  1OFC X;  5LFA A;  1QQI A;  4Y3O A;  3WTZ A;  1U5T B;  2AHQ A;  1JXS A;  2P5V A;  2DA2 A;  1G8X A;  2VIX A;  2XV4 S;  4RS8 A;  2E2J J;  1D5V A;  2R93 J;  1UEL B;  3IRQ A;  1S6L A;  1VZ0 A;  1T0F A;  1QVU A;  2XRN A;  1SFU A;  5JR3 A;  1K78 A;  2K27 A;  5E8I A;  1ZR4 A;  2OQR A;  5DV5 A;  3ZQQ A;  2WV0 A;  3JRH A;  1MNM C;  3ZMZ A;  4CHU A;  3O6B B;  2IVM A;  3MD2 A;  1JKP C;  1KU7 A;  2JA6 J;  1MBJ A;  3I4N J;  1FEX A;  3OYJ A;  3SEQ A;  3S93 A;  3HB9 A;  5C4X J;  2DQR A;  1SAX A;  1K61 A;  3FMQ A;  1WJC A;  2OBP A;  4Y4R A;  1WSU A;  3OS2 A;  3FHN A;  1OCT C;  5D5X B;  5M3F J;  1R5G A;  2EB7 A;  1W36 D;  1R5H A;  3GVA A;  5IOZ A;  4G12 A;  3GTQ J;  2RDP A;  1P6R A;  1WJF A;  5FRM A;  2OD5 A;  1M1E B;  3RYP A;  2M8G X;  3QPH A;  2FX0 A;  2GXB A;  4ON0 A;  3LSH A;  4FHT A;  3I56 I;  4MEX F;  3ZGK A;  5EEH A;  2I8D A;  3OOU A;  3SXY A;  4S04 A;  2X6X A;  3S3M A;  4DZP A;  4CGZ A;  1LVK A;  1F1Z A;  3HBL A;  3WHB A;  2KPM A;  3S17 J;  4C3H J;  4WCG A;  1E3H A;  2W24 A;  4Y33 A;  4BUP A;  4IHS A;  1AA7 A;  3TW6 A;  3H0D A;  5LEK A;  2FXA A;  5LHH A;  2X6Y A;  2ISY A;  2GQQ A;  3I0T A;  1AWC A;  4MFE A;  1NK2 P;  4M3B A;  4UNO A;  4Q48 A;  1U9N A;  2VBZ A;  1FSE A;  3GYH X;  1KU2 A;  4G6D A;  2DO7 A;  3ZMU A;  4G8X A;  4HNV A;  4OMZ A;  1HXD A;  2DQL A;  3PO2 J;  1XX5 A;  2EIL H;  4JP0 A;  5DEQ A;  3JRE A;  2R5Y B;  2GXG A;  4F93 B;  3DU6 A;  2JTV A;  2QLZ A;  2BVM A;  3BTJ A;  5C3E J;  4I0B A;  2C6Y A;  3S14 J;  1ZG1 A;  3GZ6 A;  2ZME C;  1XG1 A;  1PVE A;  2X6W A;  5F6F A;  4IQ4 A;  4LG0 A;  3IAS 2;  3SYT A;  1IRG A;  1WCM J;  2V26 A;  4M9Z A;  3LFU A;  3UKG A;  4WB3 A;  3L2V A;  4X1E A;  1BIB A;  1OMI A;  2EIN H;  3D5L A;  4AYB A;  4BE0 A;  4YG2 F;  2LKS A;  1IN5 A;  3C2B A;  1MND A;  3AKZ A;  4AM3 A;  1S3J A;  1TQI A;  3DPT A;  3HOU J;  1XGM A;  3K4N A;  4LJZ F;  4PUS A;  2R7Z J;  2IS2 A;  2V1X A;  2B39 A;  3CCL I;  1IN4 A;  5ICG A;  3DTI A;  2L4M A;  1JT6 A;  4BE2 A;  5M5Y J;  5E1X A;  3K2A A;  2W85 A;  2PQ8 A;  5FLX K;  4OU0 A;  4AIH A;  1A6I A;  2EFO A;  2Z2S B;  3LWF A;  1Z6R A;  3TED A;  2Y75 A;  1IV6 A;  1WGX A;  1H9T A;  4AWX B;  3CQZ J;  2Y0M A;  3HDD A;  5B5E C;  3CLO A;  1G59 A;  3CCE I;  1SFX A;  5KHD A;  1KA8 A;  3N4M A;  4A3J J;  4PSW A;  2ZJP F;  3BCA A;  2WAQ N;  2K85 A;  4MQ9 F;  5H20 A;  5HNF A;  3J81 K;  4YFN F;  4LD5 A;  3QPS A;  4ZC3 A;  2KZG A;  1LKX A;  3CC4 I;  4PCQ A;  2LKP A;  5J3L A;  2W00 A;  2WAD A;  5CJ9 A;  1UB9 A;  2ZME B;  2IS1 A;  2DXI A;  2BY1 A;  2BY2 A;  1MMG A;  4LLL A;  2E71 A;  3E3V A;  4Y15 A;  2XAU A;  3V7R A;  1LDJ A;  3FM5 A;  1HSJ A;  5F1J A;  3FK6 A;  3QYB A;  3ML6 A;  3OYF A;  5GTH C;  1J7K A;  3M8F A;  3BR3 A;  2HZT A;  1TP4 A;  5AON A;  3WGI A;  2UXN A;  3WGH A;  4G7Z F;  1KZH A;  3ZP5 A;  2OJE D;  1TL8 A;  4V19 K;  3K1P A;  3QWL A;  1IJW C;  1F43 A;  1HKS A;  3D5S C;  1IW7 F;  3P5J A;  3REO A;  2M30 A;  1FBU A;  3WTX C;  1WPK A;  3BRO A;  3RCO A;  3TO7 A;  2WTE A;  1FBS A;  2QQB A;  1ZR2 A;  3W2V A;  3DKX A;  3FXO A;  1XC5 A;  1UFM A;  2MH9 A;  1XSX A;  1YW8 A;  3BG6 A;  3KYD B;  5FLX Z;  2IGN A;  3HOT A;  5F27 A;  1P7J A;  3ABU A;  3ZOB A;  5J1U A;  3KP5 A;  4GYI A;  1XCV A;  4QWQ A;  5DCM A;  2XAH A;  2RN7 A;  3HXL A;  4B43 A;  1TW2 A;  2XF6 A;  5FD6 A;  2XGD A;  1ETY A;  2E34 A;  3ONQ A;  4YRV A;  3T0Y A;  4CCN A;  3TO6 A;  3CP8 A;  2HGC A;  2VJI A;  2HDC A;  1IN8 A;  3DBL B;  2XC7 A;  4O5V A;  3OYM A;  3E5X A;  4MHG A;  3LSP A;  3K0L A;  3J81 Z;  4I6O A;  5J8F A;  5FKN A;  1B72 B;  1ZTR A;  2W48 A;  4GCV A;  3OIQ A;  1UHS A;  2KP6 A;  3F9K A;  4XRF A;  4EVI A;  5LEJ A;  1WZ2 A;  1XCB A;  2X1D A;  3RJP A;  4A6E A;  2CQN A;  2VKD A;  1LFU P;  2A61 A;  3OYA A;  2ZNZ A;  2MGQ A;  1YE9 A;  3JRC A;  2ZXW H;  4ENJ A;  4UY8 I;  2R4G A;  2XSD C;  1HCR A;  2E19 A;  2IS4 A;  3ABT A;  3IKV A;  2R5Z A;  2CU7 A;  1I3A A;  1R49 A;  1IN6 A;  3LAJ A;  5E3M A;  2VUM J;  3J80 K;  2H6C A;  2DLL A;  1N25 A;  3K4L A;  5CVU A;  4WX9 A;  4OAY A;  5LBQ A;  1MH3 A;  3TW7 A;  2QEX I;  4Q5S F;  3AAF A;  1OKR A;  1R00 A;  2ELK A;  2QSF X;  3H1C A;  1XSV A;  4N4O B;  4MTE A;  1PUF B;  4RAY A;  2RNG A;  1QA6 A;  5HOD A;  1Z0X A;  5K5R A;  2UZK A;  3DEU A;  4HX8 A;  2JRM A;  3F8B A;  4D9J A;  2DCE A;  2MD5 A;  3D1N I;  3S3N A;  1EF4 A;  1AKH A;  3DKW A;  3F6O A;  4HA8 A;  4M3G A;  2GXA A;  2L9R A;  2VJ5 A;  3N05 A;  4BY1 J;  1J09 A;  4IXA A;  4EJV A;  5JPN B;  4BHB A;  4OIN F;  4M6Y A;  2CH0 A;  2R7R A;  3BT9 A;  4K2E A;  1FLI A;  5E3L A;  4LIT A;  3HOX J;  5F0H A;  4HEA 2;  1E17 A;  1JUP A;  1YFH A;  3OL4 A;  1YG2 A;  2JK3 A;  3L2Q A;  2D45 A;  3SQN A;  1JGS A;  2HWV A;  2HNH A;  3QYF A;  5FO5 A;  1FOW A;  1FJL A;  1B6A A;  4PJ0 C;  1ZGJ A;  3I64 A;  4EMS A;  3V7S A;  1ACI A;  3OYE A;  3MKL A;  2M4K A;  3BOQ A;  4NNJ A;  1E3O C;  1XTA A;  5J40 A;  3U2R A;  2COB A;  2NS8 A;  3JRI A;  4KYW A;  4IHV A;  1G2H A;  2KRC A;  4E4H A;  4L9T A;  4DBR A;  3GZN B;  4UVB A;  3OS0 A;  5B4P B;  3FIS A;  4A3G J;  4J01 A;  1LDK B;  4O6J A;  3PQK A;  2FBH A;  3OYD A;  2R7S A;  2ECC A;  4XSX F;  4AU7 A;  2HI3 A;  5JLX A;  3CCU I;  1NHA A;  3J80 Z;  3VDX A;  2Y2Z A;  2N8G A;  2D5V A;  2DA7 A;  3R4K A;  1GLN A;  4M9X A;  4LLN A;  3WTY C;  1TNT A;  2HKO A;  1ZGA A;  2EA4 A;  2VC0 A;  3SFZ A;  3HRT A;  2VJ4 A;  3CU7 A;  2EZI A;  2G7H A;  1VQ9 I;  2JA7 J;  2DDA A;  2XPW A;  1FYK A;  3S16 J;  1YRN B;  3HOW J;  3I5U A;  1AHD P;  2GIV A;  2W57 A;  4DOZ A;  4OAZ A;  3CTA A;  1Y0U A;  3K10 A;  1YIJ I;  5CLS A;  3ECO A;  1D5Y A;  1T95 A;  3LA7 A;  2ICW G;  1VQ7 I;  2IAI A;  1FTZ A;  5L3D A;  1QZE A;  3TDU C;  2E36 A;  3L09 A;  5D5U B;  3S1N J;  2G0E A;  4E7L A;  2K9M A;  2LBF B;  5IP6 A;  5ILV A;  3F8F A;  3LA2 A;  1G6N A;  2M45 A;  4M3F A;  4H4K C;  3HGG A;  3GXO A;  4JK1 X;  1BN5 A;  4AD9 A;  2F48 A;  1F36 A;  3EPZ A;  4CH7 A;  1F5T A;  4LLG F;  4AVP A;  2GIZ A;  2LF7 A;  4A93 J;  5HDK A;  3TQN A;  1I6X A;  5KAI C;  3W2A A;  4LIV A;  3BR0 A;  1W5T A;  3BR1 A;  4KIB A;  5TRD A;  1DU0 A;  1YS7 A;  1VQ4 I;  1R22 A;  3KLO A;  1X1A A;  1B9N A;  3P9C A;  2RAE A;  3FWE A;  2LD5 A;  3G3Z A;  1OCO H;  5EJC A;  4Y13 A;  4ZJZ A;  1O4X A;  2ZFW A;  2G7U A;  5LHG A;  3BJA A;  3DTK A;  1BBY A;  3QRF F;  3FK7 A;  2DMU A;  4RB2 C;  2WAQ A;  1IO2 A;  1XSD A;  5JI6 A;  3I55 I;  4I7H A;  4A3I J;  1ETW A;  5FD5 A;  3SDB A;  2HS5 A;  2L7M P;  2W25 A;  3F72 A;  3WHC A;  3HG9 A;  4KIS A;  1SAN A;  3I53 A;  1TBX A;  1Y8R B;  1QHG A;  4UUV A;  5J1R A;  3G71 I;  5BQT A;  3KET A;  2NNN A;  2A5W A;  1R23 A;  1F9N A;  3BG5 A;  2PBI A;  2Z16 A;  1QHH D;  2K4B A;  4RLF A;  2B7E A;  2BXZ A;  2CV2 A;  1D0Z A;  1T33 A;  4RM3 A;  4DNC A;  4CDG A;  4IKF A;  2STT A;  3L2W A;  3E6C C;  2HVQ A;  1DP3 A;  3WTW C;  4ZYA A;  4G6Q A;  1RC9 A;  1SVM A;  5IPA A;  3OSG A;  2K3P A;  4L5E A;  4YFK F;  2HR3 A;  3HIF A;  3K69 A;  4HZF A;  4L5I A;  3I3L A;  4II2 A;  4V2F A;  4IHX A;  4HLY A;  4KUM A;  4PGH A;  2L7Z A;  3RI4 A;  2L4A A;  1T08 B;  4HBL A;  1DGR M;  4RB1 A;  1LNW A;  1O3T A;  2QBY B;  1EV7 A;  2V9P A;  1SFE A;  3DU5 A;  1ON2 A;  2COM A;  5A2Q K;  2KJC A;  3CLQ A;  1WFX A;  5GPC A;  4RB3 C;  5K7Z A;  4CCM A;  3BR2 A;  1TWG J;  3BTL A;  3ZQ7 A;  4YFX F;  2NOJ B;  1I27 A;  3HKZ N;  4XSZ F;  3WG9 A;  1TLH B;  4EV0 A;  1MIJ A;  1R5I D;  2VKH A;  3LSK A;  2F5D A;  4ABZ A;  2JA8 J;  5EZG A;  4LK0 F;  1I1G A;  1Z05 A;  1LE8 A;  4DYR A;  2FBI A;  3GEZ A;  1ZK8 A;  4QTR A;  1S8N A;  3TP0 A;  3OYG A;  1R6R A;  5EDN A;  1Y39 A;  2DYR H;  1SD6 A;  3D5R C;  3KPH A;  1UAA A;  1BJA A;  2DFE A;  1U0J A;  4CZZ A;  5BPD A;  1J5Y A;  2E5N A;  1Y8Q B;  2KRF A;  2O7O A;  2MLG A;  3OYL A;  2ESH A;  4BEH A;  3N97 A;  4ZDL A;  3VOD A;  3FXL A;  1E3P A;  4AIK A;  1U2W A;  1QVT A;  2P4W A;  4G6T B;  4IQJ A;  1DU6 A;  2WWY A;  4I2O A;  3QOP A;  4ZDO A;  3HTU A;  2NVY J;  1ZG5 A;  2O3F A;  4W97 A;  5L3B A;  3VB2 A;  4NC7 A;  3PQJ A;  2XKO A;  4A3F J;  4UB8 C;  2LK2 A;  1S7A A;  2VQH A;  3OS1 A;  3K7A J;  2IA1 A;  1EA3 A;  2DDB A;  4UUS B;  3RKW A;  2MC3 A;  2OTJ I;  1MMS A;  1OYI A;  1U3E M;  3SJM A;  2KZV A;  3KYL A;  1V55 H;  2O6G E;  1JGG A;  2GAU A;  2HQA A;  1ZHF A;  2D1H A;  5DUK A;  1UST A;  3ZR8 X;  1G3S A;  6PAX A;  1JKO C;  5A2Q Z;  1MKM A;  2FA5 A;  2FQ3 A;  2Y48 A;  4XN0 A;  1FOK A;  3IRR A;  2LYC A;  1LJ9 A;  3K1N A;  1X3U A;  3TL4 X;  2J5O A;  2XF5 A;  1BL0 A;  3OWT A;  1YQA A;  3HUG A;  1POG A;  3FMS A;  1WKM A;  4N0B A;  2F5C A;  3MZ8 A;  2NVU B;  3JRD A;  1MDM A;  4EM2 A;  1IC8 A;  2DA5 A;  2DYS H;  3WU2 C;  5DCF A;  3E7L A;  4HNT A;  2M7B A;  1STZ A;  5B66 C;  2KLO A;  2JUG A;  1IN7 A;  3K70 C;  2XAJ A;  1RES A;  2QQ9 A;  2Y30 A;  5GAH J;  4O3M A;  2VT3 A;  4D5C A;  2HOA A;  2OF7 A;  2M3A A;  1X1P A;  3K4C A;  5HNH A;  2FUG 2;  1IV8 A;  4X0G A;  1S7O A;  2K5C A;  4U87 A;  1T6S A;  5M3M J;  2DOD A;  2E2I J;  3AG2 H;  4PJN A;  5F08 A;  2BXY A;  3DQV C;  4RM2 A;  3E6D A;  2RC4 A;  4HOB A;  1FP2 A;  1VF9 A;  4OIP F;  4U0W A;  5D5W B;  3DTE A;  1RUO A;  3OIO A;  4RGX A;  2LRD A;  3Q0W A;  5FLM J;  3W2W A;  1DP7 P;  3IH2 A;  3QOD A;  2X51 A;  2A07 F;  5IYC J;  5H6Q A;  5L3F A;  1S7E A;  2R3S A;  2PJR A;  1TT5 B;  1D0Y A;  4B1R A;  3HOY J;  4JX6 A;  3G2B A;  5D4R A;  4ENM A;  1TQP A;  2PMU A;  1XDS A;  3HOZ J;  4IX7 A;  3RKX A;  3GME A;  2KJB A;  2X48 A;  3F8C A;  1ZRE A;  3I4M J;  4KIG A;  1UZC A;  3BTC A;  4DBQ A;  3W6K B;  1OJL A;  2HOS A;  1CF7 A;  5EG0 B;  4ZYE A;  3CMM A;  2PMZ N;  4ZYG A;  3CJQ B;  1OCP A;  3ZXS A;  3R61 A;  3QYE A;  1TQM A;  3C2G A;  2XKP A;  2WAF A;  3PNV A;  5E17 F;  2E7X A;  1FYL A;  2MC4 A;  2HOT A;  4HDV A;  4R1H A;  1X58 A;  4PDK A;  2VJJ A;  3KZI C;  3MAJ A;  4KT6 A;  3V42 A;  1P7I A;  3BG3 A;  4XR6 A;  3GFJ A;  4S0H B;  2X4H A;  1R4M B;  1ZAO A;  3H9Q A;  3L1P A;  4P39 A;  1DPR A;  2KKO A;  2HFH A;  4E6K G;  4ASN A;  1R1V A;  1T38 A;  3KP6 A;  1P4A A;  1USS A;  4AID A;  4D5F A;  3RQI A;  1C5A A;  1IUY A;  3BLY A;  2CJJ A;  1QBJ A;  4EM0 B;  3CZ6 A;  1UMQ A;  2FEZ A;  4LB5 A;  5IT3 A;  1DUX C;  5M5X J;  2ISZ A;  2OAZ A;  1A31 A;  3PO3 J;  1REP C;  3Q9V A;  1W7P A;  1L0O C;  3CCV I;  2EZK A;  2VPL A;  1I50 J;  1P4W A;  4RAF A;  4WK8 F;  4I01 A;  2K9Q A;  4EGY A;  3S3O A;  3HPH A;  3G73 A;  2KMU A;  4XIC A;  2EZL A;  4EGZ A;  5JVG F;  2P8T A;  5HS8 A;  3H35 A;  2L01 A;  2BW3 B;  4DYC A;  1HA8 A;  2E1O A;  3VYR B;  2RQQ A;  4AIJ A;  4F92 B;  2KRH A;  1TWA J;  1X4P A;  4XNF A;  2BYV E;  3I59 B;  4HV6 A;  5AIP A;  1WJB A;  1NTC A;  2O8K A;  1ZG3 A;  3RPQ A;  2QA4 I;  2EA2 A;  1SVL A;  1VI0 A;  2L3D A;  5CQG A;  3RTR A;  4BXU A;  3EUA A;  2YR2 A;  1RUN A;  4L9J A;  4CYD A;  2XRO A;  1LDD A;  2L5Q A;  5F0C A;  4WXH A;  4BAC A;  4FET A;  4PFP A;  5HLH A;  3KCC A;  2P0W A;  1SC7 A;  2VQL A;  1GV2 A;  2NVX J;  3OYC A;  3OYK A;  3WTT C;  4EAT A;  1I1S A;  5E20 A;  1SMY F;  2ID6 A;  3CUQ A;  4KFC A;  4BJT A;  1VND A;  1W5S A;  2DA1 A;  4YEL A;  2GOX B;  3GWZ A;  5DM6 F;  4XOP A;  5J8C A;  2DN0 A;  3ERM A;  2LF8 A;  4XOT A;  1ERD A;  3NAU A;  3RYR A;  4C3J J;  1HDD C;  3FX3 A;  4KN4 X;  1QO0 D;  4WB2 A;  1ZKG A;  1TWC J;  4HW5 A;  1BI3 A;  3LSR A;  3CF5 F;  1E0E A;  4II3 A;  2HVR A;  4XL9 A;  4QPO A;  3I71 A;  3OSF A;  1VQ8 I;  2R7Q A;  4MGR A;  1BI2 A;  2DFI A;  1BIA A;  1DQU A;  4BHP A;  3SEZ A;  1YOV B;  1VQL I;  2V7F A;  1B8I A;  3A2K A;  2FU4 A;  3HSR A;  4NC8 A;  2H94 A;  3S1M J;  3NWS A;  2LSO A;  3HKZ A;  2KL4 A;  2QSH X;  3B6C A;  3WGG A;  4BH9 A;  3JTH A;  3CJR B;  4BJ5 C;  5GAD J;  3FMR A;  5D6F A;  2F2E A;  3PUF A;  1XD7 A;  1ZQ3 P;  3RPU D;  2OZU A;  1Z3X A;  2XB0 X;  3E6B A;  4Y52 J;  2TCT A;  3LST A;  4CO8 A;  2Q2E A;  2MG4 A;  2Z3Y A;  4NQW B;  2P7C B;  2CV0 A;  2EQR A;  4ITV A;  4QIW N;  3IV5 A;  3CCQ I;  3GTK J;  1P92 A;  4HX7 A;  2LY1 A;  3MEX A;  3JTG A;  2XPV A;  3Q0V A;  1U5T A;  2M1B A;  1YI2 I;  5FFZ A;  3GX4 X;  4GO1 A;  3RZO J;  2LKX A;  3DLL F;  3Q3S A;  2EV5 A;  3CMY A;  4BDY A;  2RV8 A;  2E2H J;  2W7N A;  1APL C;  2HDD A;  1BR2 A;  2H6B A;  3BTI A;  1OR7 A;  1MJ9 A;  3GZ5 A;  3I4P A;  3SDG A;  1IGN A;  2QWW A;  1OLT A;  5FKL A;  1RET A;  3I9V 2;  3GLX A;  2GWR A;  5IP7 J;  2VXD A;  1Z1D A;  2XAF A;  2HYG D;  1QZY A;  2Z99 A;  2QSG X;  3V7C A;  4A12 A;  2L0K A;  3A03 A;  5EGO B;  2VT2 A;  4JQF A;  4CYC B;  2B9S A;  4HF0 A;  4XLC A;  1HDP A;  4A3D J;  3O2P E;  2FF4 A;  2UUZ A;  3P7N A;  1BR4 A;  5J6X A;  3JCU C;  1O3S A;  3GFM A;  3MKZ A;  4ESB A;  3E1S A;  1FNN A; 
#chains in the Genus database with same CATH homology
 4DOZ A;  2V6E A;  3QOE A;  4OWR B;  4OAZ A;  3K10 A;  4B47 A;  2ZSH B;  1T95 A;  1TZL A;  2LY2 A;  3UNG C;  2GOM A;  4KIT B;  4B44 A;  2MYS A;  5TGT A;  2OC6 A;  4E7L A;  1WJA A;  2K9M A;  2LBF B;  2R7X A;  3ZRG A;  2CFO A;  4BGD A;  2VQC A;  5FRN A;  2LC2 A;  4H4K C;  2Q1Z B;  2Y0S A;  2OV7 A;  1Z21 A;  4F3Q A;  1YX3 A;  2HU9 A;  3EPZ A;  2LRE A;  4CH7 A;  2HDW A;  3HOS A;  3C2H A;  5CQE A;  1S9H A;  3W2A A;  4LIV A;  1FMW A;  2E5Z A;  4P5O A;  3H9G A;  4E7S A;  4RLQ A;  3W3C A;  3RSN A;  1X1A A;  3OMY A;  4DIQ A;  4PJM A;  3DLA A;  3IAM 2;  4ZJZ A;  1Y56 A;  1MMA A;  3FDY A;  2JVH A;  3UR3 C;  4CUG A;  2DT6 A;  3CP2 A;  1OR7 C;  3DTK A;  4XM3 A;  3TMO A;  5LD2 C;  3RQ4 A;  1N75 A;  3MKY B;  4C30 A;  2QKM B;  2L9N A;  4J00 A;  2WAQ A;  2WA0 A;  4P1W A;  4E7H A;  4R79 A;  4KJZ A;  4BQQ A;  4XLE A;  2OUM A;  3SDB A;  2AQF A;  3NWT A;  4XOR A;  4KIS A;  3HG9 A;  3HC7 A;  3L2U A;  1X1B A;  3H5N A;  1QHG A;  1Z3Y A;  2KHM A;  3AL0 C;  2AQE A;  1D1A A;  4E7K A;  4ZTJ A;  2A5W A;  1X1C A;  5JPM B;  3LL7 A;  2QKL B;  2W82 A;  2XSJ C;  2Z16 A;  2L7K A;  3HL2 A;  1QHH D;  1DGW Y;  4RLF A;  4BDZ A;  2CV2 A;  1D0Z A;  4RM3 A;  4IKF A;  1JI8 A;  2HPM A;  3L2W A;  4XKV A;  2HVQ A;  1N77 A;  1DP3 A;  4ZYA A;  3BG7 A;  2Q2E B;  4ZDP A;  3U21 A;  3GBG A;  2K3P A;  4XN3 A;  1W36 C;  4XKB A;  3I3L A;  4II2 A;  3VYU B;  2WY7 Q;  5LFA A;  1DGR M;  4Y3O A;  1G8X A;  2VIX A;  1UEL B;  1VZ0 A;  3DU5 A;  4YEJ A;  3LSI A;  3DWL E;  2X85 A;  3LSG A;  3EUH C;  1WFX A;  4PK4 A;  4CCM A;  3ZQQ A;  3OYN A;  4CCJ A;  1KON A;  3KX2 A;  3MD2 A;  1NG7 A;  2NOJ B;  4XMY A;  3OYJ A;  3SEQ A;  2VKH A;  3S93 A;  3LSK A;  3MMY B;  4BL0 B;  4BQO A;  2HVS A;  1ZEL A;  1WJC A;  4Y4R A;  3OS2 A;  3FHN A;  1X1D A;  3OYG A;  1R6R A;  2E1M C;  4NUB A;  1W36 D;  3D5R C;  4BQN A;  1UAA A;  4C2U A;  1U0J A;  2E5N A;  1WJF A;  2CS3 A;  5JHF A;  5FRM A;  3VYT B;  3OYL A;  4BEH A;  4ZDL A;  3LSH A;  3ZGK A;  4G6T B;  3DKY A;  3K4J A;  4IQJ A;  3H9J A;  2I8D A;  3OOU A;  2X6X A;  3S3M A;  2WAE A;  5KCM A;  2XF7 A;  1LVK A;  2ELJ A;  4ZDO A;  2KPM A;  1SFK A;  2X1E A;  1MNE A;  4CZC A;  4Y33 A;  4BUP A;  1AA7 A;  2M0M A;  3H0D A;  3OY9 A;  4NC7 A;  2X6Y A;  2VQH A;  3OS1 A;  2DT7 B;  4PJJ A;  1EA3 A;  4PFO A;  2CV1 A;  4LG3 A;  2KZV A;  3M8J A;  3KYL A;  3MKW B;  4LIU A;  2HQA A;  2BVL A;  3ZR8 X;  1WJD A;  2LOO A;  4FXG B;  2BW3 A;  1FMV A;  2V9K A;  4HSR A;  2WBM A;  2JSP A;  4XN0 A;  4CSW A;  4XKW A;  2MD0 A;  2LYC A;  3OR1 C;  4XON A;  1T0F C;  4F93 B;  2CW8 A;  3DU6 A;  3TL4 X;  2BVM A;  3HPG A;  2E1M B;  2XF5 A;  3S8P A;  3OWT A;  2VXZ A;  2X6W A;  4IQ4 A;  4E7Z A;  1V5F A;  2LH9 A;  3IAS 2;  3SYT A;  2V26 A;  3LFU A;  4HPQ A;  3L2V A;  1D1C A;  3D5L A;  4AYB A;  4BE0 A;  3LSM A;  1MND A;  4HNT A;  2M7B A;  3AKZ A;  3DPT A;  1WJ5 A;  3K4N A;  4PUS A;  2KLO A;  4XLH A;  2IS2 A;  2K9L A;  2JUG A;  3K70 C;  3A4C A;  5FRO A;  3DTI A;  3OYI A;  2M3A A;  4BE2 A;  3K4C A;  5HNH A;  2FUG 2;  1WJE A;  2L2O A;  2ZXH A;  4X0G A;  3CF2 A;  5HLT A;  2M4G A;  2K5C A;  4U87 A;  4QPQ A;  1Y6I A;  2ZXI A;  4HST A;  3VSL A;  4PJN A;  3PUB A;  2Z2S B;  3DQV C;  5CKT A;  4RM2 A;  2RRE A;  2MFZ A;  2PMZ A;  3VYS B;  1D1B A;  4HG2 A;  1G59 A;  3DTE A;  2DOA A;  2F5V A;  5KHD A;  4PSW A;  2LRD A;  3BCA A;  5HNF A;  4BE1 A;  3W2W A;  4CA0 A;  3QOD A;  2X51 A;  4ZC3 A;  2KQR A;  1LKX A;  2PJR A;  1D0Y A;  3K70 D;  1BOB A;  2W00 A;  2WAD A;  1V5E A;  3G2B A;  3SZG A;  5KNL A;  1TT0 A;  2W1O A;  2IS1 A;  2DJI A;  3H5R A;  2DXI A;  3VSK A;  1MMG A;  4IX7 A;  2XAU A;  3AFH A;  2F6C A;  1P9Q C;  1PYV A;  3FKJ A;  3OR2 C;  3QYB A;  4DBQ A;  3OYF A;  2JA2 A;  4B48 A;  3PFY A;  1MW7 A;  3CMM A;  3PSF A;  3CJQ B;  3OYB A;  3ZXS A;  3QYE A;  3AL0 B;  3C2G A;  3LMM A;  4PJL A;  4E7I A;  2WAF A;  3PNV A;  4CCO A;  2WY8 Q;  4CCK A;  2MC4 A;  3D5S C;  4BEH B;  4JOM A;  2VQG A;  2VJJ A;  4KT6 A;  3PJR A;  3M1C A;  3RCO A;  3PSI A;  4XR6 A;  4XLA A;  3V42 A;  4BXF A;  4N4N B;  3ZCO A;  3W2V A;  4XLF A;  3DKX A;  3H9Q A;  2HZD A;  4E6K G;  3BG6 A;  2IGN A;  4FAS D;  2JVG A;  3HOT A;  2XDV A;  4F55 A;  4IZZ A;  3K4K A;  4CCL A;  4BJ6 C;  2E60 A;  3BLY A;  3IUO A;  4GRI A;  3BC8 A;  3CZ6 A;  3HXL A;  3TBI A;  1LFP A;  4DGW B;  3K4B A;  4B43 A;  4RMN A;  2XF6 A;  2IGK A;  3ONQ A;  2X1C A;  2VPL A;  4YRV A;  4CCN A;  4XQF A;  3CP8 A;  4C9Y A;  3S32 A;  2VJI A;  3J7A Y;  4HNU A;  2XC7 A;  3S3O A;  3VWB A;  2UV1 A;  3OYM A;  1QU3 A;  3HPH A;  2KMU A;  4ZTF A;  3H35 A;  4F52 A;  2BW3 B;  1HA8 A;  1MMN A;  2ZFU A;  4HRI A;  3VYR B;  3OIQ A;  2RQQ A;  4F92 B;  2KP6 A;  3BCB A;  2KRH A;  1X4P A;  3F9K A;  2A6T A;  2LBF A;  4XNF A;  4DJA A;  1WJB A;  3H5A A;  3IP4 B;  5CPR B;  2LG4 A;  3HUG B;  3OYH A;  1N78 A;  2X1D A;  5CQG A;  2VKD A;  3FBN B;  1YX5 A;  3EUA A;  4XKC A;  3RTR A;  3OYA A;  2ZSI B;  3A1Y A;  1YE9 A;  1D0X A;  2BOL A;  1Z7L A;  2L5Q A;  2R4G A;  4BAC A;  2V1N A;  4FET A;  4PFP A;  2IS4 A;  2VLA A;  1PJR A;  2F4I A;  2P0W A;  1K6Y A;  2VQL A;  1MMD A;  2VAS A;  5HVQ C;  3OYC A;  3PNT A;  4PSX A;  4EAT A;  3OYK A;  1X19 A;  3KEY A;  3CES A;  3FBI B;  4ANJ A;  4F91 B;  4BJT A;  4YEL A;  2IGM A;  2GOX B;  3K4L A;  4XOP A;  4XOT A;  4D1Q A;  4OAY A;  2O5R A;  1ERD A;  2CMP A;  4BU2 A;  1BR1 A;  1X4O A;  3K4M A;  4N4O B;  2R7T A;  2RNG A;  1E0E A;  2VL8 A;  4II3 A;  2HVR A;  4XL9 A;  4D9J A;  4QPO A;  2DCE A;  2R7Q A;  2KDO A;  3S3N A;  4C2T A;  1DQU A;  3SEZ A;  2WB1 A;  2V7F A;  2VJ5 A;  3N05 A;  3A2K A;  1J09 A;  4AVZ A;  2PJR B;  4NC8 A;  2CUJ A;  4E7J A;  2CH0 A;  2R7R A;  2MAB A;  4BS9 A;  3NWS A;  2V4J C;  3HKZ A;  3PL8 A;  2KL4 A;  4LIT A;  2IS6 A;  2Z1D A;  4HEA 2;  3E0J B;  3OL4 A;  3CJR B;  4BJ5 C;  3L2Q A;  2UWM A;  2HNH A;  3QYF A;  1UG0 A;  3OL3 A;  5HOO A;  3RPU D;  1IRX A;  1V5G A;  1Z3X A;  2CW7 A;  3EUK L;  3OYE A;  2M4K A;  4NNJ A;  4NQW B;  2CV0 A;  2R7O A;  4ITV A;  2LY1 A;  3DPL C;  2R7W A;  2IGO A;  2KRC A;  4E4H A;  3L2R A;  4DBR A;  3K6G A;  3OS0 A;  4MLO A;  4J01 A;  4BDY A;  3PNY A;  1LDK B;  2W7N A;  4U7B A;  1BR2 A;  3DPU A;  1NG6 A;  3OYD A;  1OLT A;  2R7S A;  1SAU A;  4AU7 A;  2R7V A;  3I9V 2;  3DEE A;  2VB6 A;  3VDX A;  2VXD A;  2M7A A;  2IXS A;  2HPI A;  2L9S A;  1GLN A;  3OIP A;  4B3X A;  2CUZ A;  4JQF A;  2VJ4 A;  4XLC A;  2R7U A;  2W4S A;  2UUZ A;  1BR4 A;  3MKZ A;  3E1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...