5CQXA

E. coli mazf mutant e24a in complex with maze residues 68-82 form i
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
106
Chain Sequence
b'VSRYVPDMGDLIWVDFHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQEGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGLSHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
total genus 22
structure length 106
sequence length 118
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cqxA00
4MZTA 5CK9A 3HPWA 1VUBA 4ELZC 5CQYA 5CKEA 4HKEA 2C06A 4VUBA 5HKCA 3JRZA 5CKHA 5CO7A 5CQXA 2VUBA 4ELYC 1NE8A 5HK0A 4MZMA 5CR2A 5CKBA 2KMTA 3VUBA 4OF1A 1UB4A 3G7ZA 5CKFA 1X75C 3TCJA 5CKDA 4MZPA 5CCAA 5HK3A 3JSCA 4MDXA 2MF2A 5DLOA 4ME7A 3NFCA 1M1FA
chains in the Genus database with same CATH superfamily
3QKJA 1IZ6A 4OGEA 2IPOB 2RK1A 2C06A 4DBQA 5KYXA 1Q81R 1Q7YU 2HAXA 2KK4A 4WCIA 3M0QA 2GQIA 1AWXA 1VIFA 3EGDA 3I5RA 3JCMb 4IUQA 2HL3A 1X69A 2XIDA 2CP3A 1QKXA 3PIPA 5FRMA 1AWJA 2CP2A 4KH0B 5FU6C 3CC2Q 1AHJB 4M78E 3LGLA 1RAAB 3I56Q 2RO0A 1KQ1A 1TH7A 2LJ0A 1ACMB 3ZEHA 2D1XA 3RUXA 4R55A 4OGCA 2K57A 2EQMA 1SRLA 4A4KA 3FRNA 3CBMA 2DILA 3OW2S 5LJ5g 2KQWA 2KT8A 2GCXA 2Z0WA 3CXCP 2COZA 2ED1A 3P8DA 4FYXB 2BKDN 2JXBA 3QZ5B 5GAOm 3H41A 1VQNT 1WPYA 2DX1A 3EFSA 3OYEA 4C8QB 4LDUA 3UATA 2EWNA 1VQ9T 2RHZA 1VOMA 4FIBA 2HBWA 4DEXA 2QEXT 2NLUA 1YWOA 3I5SA 3QYGB 5LJ3f 3PMTA 5I2MA 4HCKA 5KYWB 5FLXE 2M16A 3VUBA 2JN0A 1NLPC 3GNGA 4NL3A 1I0CA 1YCSB 3CCRA 1M3CA 3VS3A 1G5VA 4BY6B 2CZ0B 1YJ9A 1KJWA 2YLCA 3X20B 4GBQA 1U1SA 1M2VA 3EH2A 1WFWA 3G4SQ 2XKOC 4J9GA 4OMNA 3RNJA 3SB2A 3WXMB 3X26B 1I81A 2KNBB 5KE3A 4RCCA 4BE2A 1K73C 1YHQA 2YDLA 2DETA 5GMKe 1Q82U 3M9QA 4M7AF 2LP5A 5GANg 4J8OA 3HPWA 1VUBA 3CMAT 2VASA 3E1SA 1YJWA 4M7DG 2EBPA 3CQTA 3HRTA 1WIEA 3UT1A 2DTHA 4J6YA 4JLIA 4JLGA 1GFCA 5LJ3e 3IQLA 1P92A 1CSKA 4KGVB 4IKFA 2E6ZA 2COWA 1UEBA 1M90R 4PNOA 1D0YA 4FYYB 3E2UA 4QQDA 1U8RA 3I55A 4M7DA 3VKIA 2JMCA 4RMOA 1KG1A 2JUFA 1QLYA 2K3YA 3JCMP 2VXFA 2ENMA 5CR2A 2QTVA 3EG3A 1MMGA 1RI0A 2DK3A 3OY9A 3PMIA 1AZEA 4QQGA 4EDUA 1QP3A 1LVKA 4RTXA 3SD4A 5IHKA 3CCRT 1Z9ZA 2WACA 2B86A 3S3OA 1Q95G 3JCMd 4NS5A 4ATOA 2CT3A 3OS5A 5GAN3 2DE0X 1KHIA 1UGPB 3CCQQ 1JEGA 1K73R 2EYQA 4J9DA 2JVVA 3CCUA 2C0TA 1M1FA 2MAMA 1XJWB 1IHVA 4RTZA 1YHQT 3TSZA 1TG0A 2HZYA 4OB2B 4EMHA 2OJ2A 4OP0A 2YSQA 5FU7B 5GAN8 1YJWT 3J80E 4CC2A 5FROA 3CC4Q 1VQOQ 4JRIA 4ZNXA 3WVDB 2QQBA 5A0LA 1J3TA 1LJOA 2QK0A 4OVAA 2ZPEB 4CI0C 3WVEB 1QCFA 1PM3A 2YRVA 4JS5A 1C6VX 5KYXB 2OTLT 1Q7YR 2E3HA 2QYZA 2VC8A 2K3BA 4DBFA 4F7UG 3G6EA 1MUZA 3VS4A 2RJEA 2IG0A 1BI0A 2PTKA 1Y71A 5IAYA 4PFOA 1M27C 2RMOA 2FRWA 2K7AA 2CDTA 3OSVA 3I55T 4XU0A 4HA8A 1ZA1B 2YUPA 1BBZA 2K2VA 1KC8U 1WJQA 1TUCA 4AFZC 3M54A 5GJVB 3M0TA 4M75D 5EG2A 4FSXA 4F7UA 5AYFA 2CYZB 4ZGDB 4PJNA 2X4WA 2RF0A 1KIKA 1WGSA 1GFDA 4C0ZA 3M53A 1Q82C 1YIJQ 1YI2A 4M7DE 4JJBA 2DXCA 4M75F 4RG8A 3GNFB 2DIQA 4LE9A 4C5HA 3G71A 4HCZA 3JB9D 2MCNA 5GMKi 4BI4A 4M77D 3OYLA 2JM9A 2YUQA 2E4HA 5LJ5d 2E41A 1VQ7A 3MP1A 4CC7A 2KY9A 4J9FA 4II1A 2EW3A 3ZFJA 4EMKB 1UFFA 2E5KA 5CK9A 1N6AA 2PVDB 4LD9K 4OB0B 4NL2A 4N4GA 3CCJQ 3NGPA 3CC2T 3CCEQ 3I56T 1RLPC 2EGAA 4EIKA 1T3LA 2G6FX 3DLMA 1H3HA 3H8ZA 1V76A 2LX9A 3RMQA 2DVEA 2XMFA 1Q86C 2CKKA 5CKEA 3HRUA 1YNZA 1SPKA 2QGFB 3V8LA 4OMOA 4JZ3A 2AKKA 1IB8A 4KBMB 1WHGA 4LUDA 1Q82R 4ORZA 4JDSA 3GBQA 2CUBA 3JB9H 2MMPA 4A54A 1RAEB 3VS2A 1KQSA 3UA7A 4BDZA 1OULA 1UUEA 1Y96B 2EGCA 5CAIA 1X27A 5GANd 2PNIA 1JJ2A 2NYSA 1WI7A 1WJSA 3QHSA 3DKMA 4F7UE 1NG2A 1LPLA 1RAFB 1M9SA 2H3JA 2KYMA 1HJDA 3MKDA 1HXDA 1HK9A 1BI1A 4KRTA 2DRMA 3GP8A 5FU6B 4J9IA 3FLGA 5D6XA 1QVFS 3L1AA 4RTTA 1KC8C 3CXCS 4O6JA 1GBRA 3PGGA 1I4K1 3G4ST 4GLMA 1WZOA 2VGMA 2VUBA 3HL8A 4E2FB 3FC3A 2C0OA 3OS0A 3V7RA 3TSWA 2HSEB 2H8HA 3EG9B 2M0YA 4AMCA 4J9BA 2JS0A 1JBMA 2E70A 3RKYA 1VQ8Q 2NWMA 2V26A 4N0AC 3D7SB 1B34B 2KYBA 3TEEA 5KYUA 4HKEA 3CBOA 2HMAA 5LJ3j 3EG1A 4J9HA 2I2LA 1D3BA 1H641 2P0KA 3TREA 2BZXA 2DFUA 3EGXA 3ZL7C 3CMEQ 1YITQ 3SWNC 1UGVA 4LDWA 1PWTA 2CP5A 2RI2A 1YCYA 1QVGA 4JUVA 5J3BA 3CD6A 2QDLA 1C0MA 3KBGA 1K1ZA 4J83A 1VYVA 1WXTA 3HTRA 3MEUA 1M1KU 2RH2A 4HVVA 2JZ2A 1I1JA 2AKLA 3O5ZA 5A0DA 4M7AG 1R0BG 4AFQC 1ZHIA 3OBYA 3CEYA 2QXFA 3EH1A 4C92F 5CCAA 1XOVA 1JXMA 2R57A 1ZA2B 7AT1B 3J81E 1VQKA 2JT4A 1YJNQ 3L2QA 3C95A 3EAEA 2FZCB 1KC8R 1Q81C 2J6OA 2ZPFB 4M7AA 3CPFA 1M90U 1JQQA 4E47A 4F7UB 1KHCA 2M9UA 4JJCA 2QQRA 4M75C 3OB9A 1OZ2A 1RABB 2QQ9A 2RJFA 2NUTA 4C0GA 3ULRB 3VYHB 4Y91A 2JMAA 1YFNA 5LJ3h 2VGNA 1KQSP 1ZBXA 3CC4T 2EKHA 2L2PA 2L3QA 1W2BA 1MNEA 2RA2A 2CH4A 3SEMA 2FPEA 3QYHB 2PVGB 1A0NB 4ME7A 2MI6A 3OYCA 3TVTA 1JJ2P 1Z9QA 1WXUA 4L5GA 3NTHA 4M77C 5KYYA 3CD6T 1I8FA 2O9VA 4IUTA 1SSHA 2RJDA 4RTUA 3NHNA 2HKQB 1VQNA 1I5LA 2LJ1A 4J9EA 4DBRA 1E7OA 2HBPA 2NUPA 3KXTA 4HVWA 3OS1A 4RUGA 4MMLA 2J06A 1OV3A 3NPFA 1VQ9A 2HD0A 2X4XA 1G3SA 1UTIA 2QEXA 1Y7XA 2E3IA 3META 4N0AA 1QVPA 4PK4A 2MYSA 3S6WA 1VQKT 3HSBA 1GCPA 4BACA 5CQXA 4M4ZA 4E7IA 2QASA 1LOJA 3QWXX 2KMTA 3A1PA 2X4YA 3SWNA 1M3AA 1V1CA 4PJOB 1BK2A 2MIOA 2F69A 3JCMf 1OI1A 4M7DC 1PD0A 2P84A 3Q1JA 5HKCA 5DY9A 1TUGB 4IIOA 1PRLC 2DJQA 3OS2A 5LJ3g 2D0QB 2GTOA 4CC4B 2F1LA 2Y4YA 1M1KC 2KSSA 3CMAA 2K5IA 1W6XA 2H3EB 1C1AA 3LH0A 4A4FA 3UPUA 1SKUB 3G6EQ 4A63B 2M02A 1QCNA 2X3WD 1K9AA 2X3XD 3H9NA 4M75G 5CVIA 2KRSA 4KH1B 4BDYA 2VB6A 3HP9A 1NYGA 2RQUA 3JCMX 1RLQC 1IHWA 1NE8A 2QA4A 2RJCA 1K4US 3MP8A 4OF1A 1WNLA 4C8QF 3FEOA 2E1HA 1M90C 4X9DA 4M75A 3EFOA 2DMOA 2RHUA 3OSSC 3JB9G 5FRNA 3JCMe 2O4XA 4CRIA 3THKA 2JJ9A 2X51A 1VQMQ 4WTOB 4M77G 5I22A 3CCLT 3RMSA 2V8JA 1YI2Q 4ELYC 1PKSA 5GAMj 1S72Q 3CCVT 2P0QA 1GBQA 1OU8A 2HQEA 1IGUA 1PSFA 5GAN6 3CC7A 2XDDA 2KXDA 1OX8A 4XTVA 3VYGA 2XK0A 1TSFA 3H0IA 1RAHB 2DXUA 1B3QA 2QG9B 4DBHA 4LDXA 3G1JA 1MMNA 4M7AD 4M77A 1BI3A 1PKTA 1U5SA 2YUNA 1U3OA 3QJ6A 3JCMJ 1SRMA 3CCMQ 3FIFA 2RN8A 2BZ8A 1W2BP 4IUPA 3M57A 1YBYA 4N4IA 2LNHB 1M1KR 1VQ4Q 2FB7A 2FPFA 4ELZC 5L23A 1D1AA 2SRCA 3X25B 3UDCA 4M78F 2OTJQ 4M78B 3VRYA 4C0DB 2OTLA 1X2QA 4QKUA 3CCSQ 5GAOr 2QA4T 1WA7A 3R6OA 1Q7YC 2RI5A 2W0ZA 3TU4K 2ZZDA 4RTVA 4FSSA 1VQ8T 3A8GB 5GAOn 1WDXA 1ZX6A 2DEQA 1CKBA 3RKWA 5GAMh 1QP2A 3CMET 4E7ZA 3C94A 4HT9A 2BUDA 2MPXC 2GFAA 4E7LA 3C12A 4WF2A 4XTZA 4XTWA 3KFVA 1TOVA 5GAOq 3CC7T 1QWFA 2L3PA 1MGQA 3DLLA 3OYDA 3GLXA 2CSQA 4M75E 3QDFA 2B8AA 2DYIA 3QJYA 1G3WA 3INZA 1JXOA 2DVJA 1OU9A 2XU8A 4XU2A 3MEAA 3JB9J 3JCMW 1PRMC 2LQKA 3KUFA 5IH2A 2AZSA 2R58A 1YJNT 1M1GA 2NUPB 2KDSA 3OYKA 3NTKA 4PJMA 1VQPT 3V8KA 3ZBDA 3M0UA 2EFIA 2V1QA 2DXTA 2SEMA 4IUVA 1K9MR 4M77E 4DOWA 2DZCA 2D8JA 5IHIA 1G8XA 4LUEA 1FYNA 4P5NA 3J7AF 3L42A 1VYTA 1VQLQ 3I35A 5HCKA 3CPWA 4QVZA 3JCMc 3TQ7P 1AWWA 2J05A 1KD1U 3CC2A 1PSEA 3A5ZB 3I9QA 1OPLA 1M3BA 3I56A 3OYHA 2QQSA 3OA6A 2FRYA 3E19A 3EGDB 4Z88A 4C0FA 2CP6A 1OEBA 3A8OB 3SHWA 4QVCA 2LQWA 4IIMA 1VQ5T 1OZ3A 4JRKA 1VQ6Q 5CKDA 3PVQA 2XD0A 4XQ3A 2OX7A 4PFZA 4RCBA 2LQNA 1AEYA 5GAN7 4IURA 2YT6A 1PNJA 4RTYA 4A4GA 1X2KA 1BIAA 2D9TA 1SHFA 3EGUA 2EYWA 1TTHB 3BDUA 3OMCA 4GY5A 2ZGWA 1D09B 4TVRA 2KR3A 4BI3A 1E6HA 2AZVA 3VS7A 1NPRA 4EMGA 3GOXA 2LCLA 1RL2A 1WYXA 1RAIB 3LH5A 1KQSS 2FPDA 1K8AU 2D8HA 2I0NA 3FDRA 4BD3A 2CS7A 2DL8A 1BCMA 1X75C 5GAMf 3QBYA 2MF2A 2DIGA 2HKNA 4Z02A 3OYNA 1JJ2S 2E12A 2FZKB 1QWEA 4FYVB 1OPKA 2HSPA 5J39A 3G4SA 2LJ3A 1MNDA 2CSIA 2LZ6B 3C0CA 4XAXB 4XTUA 1UJYA 2JM8A 5LL6S 4HVUA 3G7ZA 1M2VB 4J5YA 2DRKA 1HSQA 2M1HA 4KGZB 3ASKA 4JRPA 3C4SA 5GMKl 4Z89A 2G3RA 3PE0A 3FJ5A 4M7AC 4OMPA 3OYFA 2J6FA 4QVDA 3MP6A 4JPBW 4FCYA 1AD5A 1PD1A 4A53A 1UJ0A 1QMCA 1YWPA 2L3RA 5GJWB 2CT4A 1WX6A 2QAZA 3OYMA 5GAMe 5DLOA 4PL6A 2F2WA 5IXBA 2QEXQ 3EG2A 1V29B 2EYXA 4QT7A 4XTXA 1FMWA 5C0MA 2LC4A 2OAWA 3HRSA 1R8OB 2GNCA 2YUOA 4AG1C 4J6XA 2CZ7B 3GPLA 3HKSA 2LCCA 1YP5A 3JCMQ 1UG1A 1KD1C 4MMKA 1NEGA 3JSCA 4M7DB 5KYNA 3O8VA 3CPWP 2EJFA 2ATCB 4RG2A 3T9NA 1TU0B 4DEYA 2K5FA 4Z8AA 5D6WA 1EIFA 2P4RA 2DA9A 2PVOB 2ROTA 1PC0A 1N27A 4C8QG 1KQ2A 1M5Q1 2WSCE 3BY7A 2KE9A 1WXBA 3CCQA 2O31A 2V8IA 3CCMT 2RQVA 3UF4A 4KT0E 1N9RA 1G83A 3QO3A 2EQIA 1UGRB 1N9SA 1UDLA 1VQ4T 4FT4A 4C8QA 5D6YA 2Y4XA 1ARKA 4ZTFA 3CC4A 1ABQA 2DF6A 1IGQA 1ABOA 2WSEE 3R6NA 2OTJT 1AVZC 5FU7C 2DL7A 2L0AA 2LMJA 2DL5A 5KYWA 5A0GA 3CCST 2OAUA 5I2SA 3SDZA 3HFOA 3JCMh 1K8AC 1OYXA 4C92D 1K0SA 2JNGA 2FVUA 2P0PA 2K4YA 2KI7A 2LRQA 2W10A 4ZN1A 2EQJA 2O9SA 4F17A 1W2BS 4GLKA 2CZ6B 4E7JA 1AOJA 2LTOA 2YLBA 1KD1R 1LNXA 2GF7A 1PG5B 3V7SA 1H92A 5LJ5j 3CCRQ 4AG2C 4Y28E 1BU1A 5KCOA 1YJ9Q 2J6KA 2KRNA 1FX7A 3M55A 1QVFA 3H0HA 2XHCA 3QUIA 4LN2A 2J7IA 4PFPA 2HDAA 3OBWA 2YRDA 1YIJA 5KCHA 3PFSA 4B9WA 4BUGA 4F7UF 4JS4A 3VJPA 1TUDA 5C6SA 3REAB 2COYA 2QDYB 3CCQT 1GXIE 3VV0A 1YHQQ 3QIIA 3LWIA 1QQJA 2DTIA 4F04B 3LX7A 3N5BB 1IXDA 4LDVA 4X9CA 4UC4A 1YJWQ 3LW5E 2ZAEA 2M51A 1UGQB 1T0HA 1NZ9A 4OMFB 4PJJA 2QQAA 2RHXA 3VS6A 4LDYA 2LNVA 3HHTB 1NJIR 1VQOT 3NMZC 4C5EA 2DJZA 1DJ7B 3A8LB 2BE7D 2NUZA 4RKUE 2EYYA 3PT9A 2JTMA 1VQLT 1F1BB 2GGRA 4FW2A 1K8AR 3JCMg 3I55Q 3VU3C 2ZPIB 2EIFA 2A3LA 3CCEA 3S3MA 4R56A 1SEMA 3EFRA 3GF5A 2EVRA 5CKFA 5GANj 1M8VA 1NYFA 1SG5A 2HCKA 1VQ6T 2K6DA 1HYOA 1VYUA 1ZLMA 5LJ5h 1TS9A 2RM4A 1K9MU 4PJOD 1TWBA 5ECAA 3CCLA 1H3ZA 4KUIA 3CCVA 5FW9A 1E6GA 2HQXA 1YIJT 4J9CA 4A4EA 3BW1A 4XU3A 3MHXA 4PJOF 2P4TA 2LCSA 1NLOC 3CCUQ 4L59A 1WHKA 1T3SA 3VS1A 8ATCB 5IN1A 2DLPA 2BZYA 2JS2A 1MHNA 1EX4A 4HCBA 1N8RR 1U06A 2DKGA 1O9SA 3VS5A 2K79A 4M7AE 1QVGP 4MDXA 1I07A 3NFCA 4PLLA 1JU5C 3OYYA 3RIRA 3BDLA 4C8QD 2D0NA 1FXXA 2LT1A 1MV3A 2LT4A 5I11A 5GAN4 3OYAA 2R5MA 3CCJT 2DD4A 2DAQA 2K2MA 3CCET 2DO3A 3UA6A 1BI2A 1EFNA 5GANh 2EJ9A 3A98A 3QG1A 2HEQA 1VQ8A 2AIRB 3M4GA 3MO8A 3OYIA 3S3NA 1QVFP 4C5GA 3M58A 2DM1A 2QGGA 1D0ZA 2D6FA 2O2OA 2O88A 3CMEA 1YITA 2K5LA 3L2WA 2JTEA 2WSFE 4KUDK 3QZ9B 2MWPA 1B07A 1PHTA 5DLQE 5KYUB 2DZ9A 3H6ZA 5KH6A 4HCCA 3G71Q 2RHIA 3FJPA 1D3BB 1PCXA 4XK8E 2KXCA 3EGXB 3VS0A 3RKXA 5D7UA 2OI3A 4EMKA 3OQ5A 1NEBA 1JB0E 1WLPB 3BFMA 4PLIA 2M0OA 2ZPHB 3JV3A 2KGTA 1AZGB 3QSUA 1K76A 2XICA 1HD3A 4M78D 1VQ7Q 5GMKm 4KULA 1GCQC 2PUOB 1I5OB 1YJNA 5LJ5f 4C92C 2MOXA 3L2UA 1VQPA 4ZN3A 1ZSZC 1K0XA 2YWWA 3JCMV 3OW2A 1UECA 4LXCA 4FM4B 4E7KA 2C0IA 2RD1A 1K9MC 1ZUYA 3P8HA 2X9HA 4F14A 1CKAA 4D8KA 2YRCA 2RPNA 3U23A 2CUDA 4QW2A 1X6GA 4C5IA 4M7AB 2DPPB 2A28A 4JJNK 4FU6A 2A37A 5EC7A 1Y57A 2CH4W 1MMAA 1Y96A 1JRIA 1SHGA 2E65A 1RI9A 5J26A 4HT8A 1VQ5A 2KBTA 1YN8A 1WQWA 2GBQA 4DOVA 2DYBA 1YITT 3CPWS 3M0SA 2AK5A 2DL3A 2NUTB 2BIVA 2L8DA 4E7HA 3M5AA 5DM7R 1NM7A 5LJ5e 2ESWA 4NOYA 5CO7A 2RK2A 1ZSGA 4XTYA 5GAOp 2DTOA 3RDVA 3TCJA 4K11A 2EKOA 8AT1B 3FB9A 3MEWA 5KYYB 3QWYA 1BIBA 5A2QE 5GANf 2O01E 1W1FA 3EG9A 1N5ZA 3CBPA 1YJ9T 2JOYA 3JAME 3URGA 4D6WA 4ZGJB 1B34A 4MZMA 1Q86U 1M2OA 2A7YA 3QDRB 2DD5A 3MPUB 2HL5C 1UHFA 2LX7A 4AT1B 3OYJA 5CQYA 9ATCB 4PJOC 3V7CA 2QI2A 3SWNB 4C92G 4JJDA 5FWCA 3RERA 3HFNA 4J7IA 3L2RA 1EZZB 2IIMA 5GAMg 5I21A 2RI3A 3AT1B 4AFSC 3M0RA 1GCQA 5GANe 3CD6Q 1Y07A 3RESA 3QPHA 2F2VA 4C92A 1TXQA 4D8DA 1RACB 1UGSB 1ZSZA 4X1VA 4XU1A 1D0XA 1BB9A 1KSWA 4AFUC 1AWOA 3PIOA 3MCAB 2EGEA 2E6NA 2FL7A 2VVKA 1O75A 2ED0A 5LJ3d 1JO8A 2R5AA 2E5QA 2RQRA 3A8HB 3PVLA 1VQKQ 1NJIU 2XG8D 2EQKA 4C8QC 1VQMA 3L2ZA 3OMGA 3OW2P 4OB3B 2PU9B 2RB6A 5GAN2 1FMVA 1S72A 1XQHA 4QQ6A 2PUKB 1R0CB 1SF9A 4M75B 3EFOB 4FL6A 5IHNA 2O4XB 3UWNA 3LGFA 2GTJA 1ZUUA 1RUWA 1VIEA 5GAOl 1KFZA 1OX9A 2L5QA 2QTXA 3CCUT 1ZUKA 4RTWA 2BE9B 2ECZA 3H0FA 4FT2A 4BY6C 3EG0A 2DXBA 2DEUA 2XDPA 3CCMA 2A0FB 3ME9A 1QW1A 3OYGA 1M4ZA 3JB9F 2EPDA 3PNWC 6AT1B 1QKWA 3JB9I 2V1RA 4MZPA 3E9GA 5M9OA 4M77F 4JZ4A 1VQ4A 4M77B 4L6V5 2PQWA 4JRQA 2GFUA 3G6ET 2LDMA 2V8KA 2CP7A 4PJOG 3RR6A 2OTJA 2AHJB 2A08A 1VQNQ 2KEAA 5FWBA 1WQ7A 2CREA 3CCSA 1UB4A 3AHUA 1Q81U 3BE3A 4M78C 2X35A 4PJLA 5IXFA 4C0DC 4X34A 1NBEB 1VQ9Q 1N8RU 5L8RE 4PKCC 3LYIA 2ZPGB 3QXEB 4M7DD 2LQ8A 2EYZA 3MJXA 4IUUA 4O5VA 3CCLQ 4PJOA 1RADB 1VA7A 1IRXA 3CCVQ 3DB4A 4OB1B 5GAN5 1VQMT 2VXEA 5HK0A 1Y0MA 2VWFA 2DERA 2FO0A 5CKBA 4C92E 1YI2T 1QVGS 4Y92A 5HK3A 1S72T 4M7DF 1OOTA 3X28B 2KRMA 1BYMA 4J7FA 4F16A 5KE2A 4ESRA 2E10A 3G71T 2ZCFB 1XTDA 1M30A 2E64A 2AT1B 3RBBB 3EHQA 2K3XA 1WJRA 2PZ1A 2JW4A 5AT1B 4B9XA 1QCOA 1FMKA 1VQ7T 2IVWA 1BCOA 3CMAQ 2JTFA 1W4SA 1ZBJA 2X4JA 1T0JA 2DL4A 3JRZA 2CP0A 2BTTA 4Q5WA 1VQOA 1WHHA 2L89A 2VKNA 2DBKA 2KAFA 3P8BB 1G3TA 5GMKj 2QA4Q 1XNIA 1NJIC 4B6MA 1OQKA 1X43A 1VQLA 1AT1B 4DQ2A 4MZTA 4EPCA 4OMQA 2KROA 1Q86R 2F2XA 4DA4A 1UHCA 3M59A 3DB3A 4ZTJA 3LLRA 5CKHA 2L3SA 3LWHA 3VRZA 1S1NA 4LD6A 4BB7A 4YTLA 1FWZA 3ER0A 4OMMA 3M56A 3REBB 1U1TA 1VQ6A 1SSFA 3SFMA 3CC7Q 2RHYA 2RQTA 2F5KA 3M4YA 4R0KA 2A36A 4M78G 2FYKA 3GIBA 3A8MB 4J6WA 1D1CA 4ZGEB 1IO6A 2EAYA 2ROLA 1LCKA 2YHTA 1NPPA 3CXCA 1UE9A 1X6OA 1BKBA 1G3YA 3OYBA 2MK5A 4PJOE 2XI9A 2FG0A 4C92B 1X01A 4M78A 2Y90A 5GAMd 1WHLA 1ZSZB 2EJGA 3F70A 4N4HA 3X24B 3EHRA 1VQPQ 1WHJA 1ZQ1A 4BE1A 4MDWA 2CGHA 2VYTA 1GL5A 1MMDA 1N8RC 4OMLA 1G2BA 5GMKh 2OTLQ 1GRIA 1R77A 2K9GA 5CIUA 4E6RA 4A4HA 4FYWB 2DNUA 1D1BA 1M8MA 2YXYA 3E9FA 1RAGB 3PTAA 4KGXB 4BE0A 2ZPBB 4VUBA 4EMKC 1KK7A 2EQUA 3CCJA 3M0PA 2LVMA 3L2VA 1VQ5Q 2DBMA 4BI8B 4E7SA 4HXJA 4C8QE 1IREB 4V2SA 3VUZA 2F5TX 4LNPA 5HY6A 2ABLA 2RNAA 3MEVA 2HQHA 1B7TA 1K73U 4CC3A 1MV0B 4FW1A 1X6BA 2KT1A 2GQVA 3V8JA 2RQWA 2CZ1B 4ANJA 2MWOA 1WHMA 2VV5A 1H8KA 2KVQG 2XDBA 3NTIA 5IT9E 2FHDA 2FEIA 1W70A 2HNIA 2FZGB
chains in the Genus database with same CATH topology
4QW2A 3QKJA 3OMCA 4C5IA 4M7AB 1IZ6A 1JBMA 2DPPB 4GY5A 2E70A 2ZGWA 4OGEA 3RKYA 4JJNK 4TVRA 4FU6A 4N0AC 1B34B 3TEEA 2RK1A 4BI3A 4HKEA 1Y96A 2C06A 3CBOA 1JRIA 5LJ3j 1Q7YU 1NPRA 2E65A 2I2LA 1D3BA 2LCLA 5J26A 4EMGA 3GOXA 1H641 1RL2A 2HAXA 2P0KA 3TREA 1VQ5A 4HT8A 2KK4A 1KQSS 1K8AU 3FDRA 3SWNC 4BD3A 2CS7A 1WQWA 4LDWA 4DOVA 1VIFA 1X75C 5GAMf 3JCMb 1YITT 2RI2A 3CPWS 3BDUA 4IUQA 3QBYA 1YCYA 2MF2A 2DIGA 1QVGA 4JUVA 2BIVA 2L8DA 5J3BA 3CD6A 4E7HA 2XIDA 3M5AA 4Z02A 5DM7R 3OYNA 1JJ2S 2E12A 3G4SA 5J39A 3KBGA 3PIPA 5LJ5e 5FRMA 4J83A 3MEUA 5FU6C 1AHJB 4M78E 1M1KU 2RH2A 3LGLA 4XAXB 4NOYA 2JZ2A 5CO7A 2RK2A 2RO0A 4XTUA 5A0DA 4M7AG 4XTYA 1KQ1A 1TH7A 5GAOp 1ZHIA 2DTOA 3OBYA 5LL6S 3ZEHA 3G7ZA 3CEYA 3TCJA 2QXFA 3RUXA 4J5YA 4C92F 1XOVA 2EKOA 5CCAA 4R55A 2R57A 3FB9A 4OGCA 3MEWA 2K57A 5A2QE 1BIBA 3J81E 5GANf 2O01E 1VQKA 2EQMA 2M1HA 4A4KA 3ASKA 4JRPA 3C4SA 3FRNA 3CBMA 3L2QA 3CBPA 5GMKl 3C95A 5LJ5g 3OW2S 2KQWA 2G3RA 3EAEA 1YJ9T 2GCXA 2JOYA 2ZPFB 3JAME 1Q81C 4M7AC 3URGA 3OYFA 4M7AA 4QVDA 3CPFA 3MP6A 4D6WA 1M90U 4A53A 4ZGJB 1B34A 3P8DA 2BKDN 2L3RA 4MZMA 4E47A 1KHCA 2M9UA 3QZ5B 4F7UB 5GAOm 1Q86U 1VQNT 1WPYA 2QQRA 2A7YA 3QDRB 2DD5A 3EFSA 3OYMA 3OYEA 4C8QB 4LDUA 5GAMe 5DLOA 4M75C 4PL6A 3OB9A 2EWNA 1OZ2A 1VQ9T 2RHZA 4FIBA 3OYJA 2QQ9A 5CQYA 4PJOC 1V29B 4XTXA 2RJFA 3V7CA 2QEXT 4C0GA 2QI2A 2LC4A 5C0MA 3SWNB 4C92G 3VYHB 2NLUA 3HRSA 4Y91A 3RERA 1R8OB 3QYGB 5LJ3h 5LJ3f 3PMTA 2VGNA 4J6XA 3HFNA 2CZ7B 5I2MA 3GPLA 3HKSA 2LCCA 5FLXE 2M16A 1ZBXA 3JCMQ 3VUBA 3CC4T 2JN0A 1KD1C 1W2BA 4J7IA 4MMKA 2RA2A 3L2RA 3GNGA 3JSCA 4NL3A 3CCRA 4M7DB 3QYHB 3O8VA 2PVGB 5I21A 5GAMg 4ME7A 2EJFA 2RI3A 1G5VA 4RG2A 4BY6B 2MI6A 3T9NA 2CZ0B 1YJ9A 5GANe 2YLCA 2K5FA 3X20B 3OYCA 1U1SA 1Y07A 5D6WA 1EIFA 3RESA 2PVOB 3QPHA 4M77C 3NTHA 4L5GA 4C92A 2XKOC 3CD6T 1I8FA 1N27A 4C8QG 4IUTA 2RJDA 1KQ2A 1M5Q1 2WSCE 3BY7A 1VQNA 1I5LA 1UGSB 3SB2A 3WXMB 3X26B 1I81A 4XU1A 2HBPA 3CCQA 2V8IA 5KE3A 3PIOA 4RCCA 3CCMT 3MCAB 4BE2A 1K73C 2E6NA 2FL7A 5LJ3d 1O75A 3KXTA 2R5AA 3OS1A 4KT0E 4MMLA 3J80E 1YHQA 1N9RA 1VQ9A 2HD0A 2X4XA 2E5QA 3QO3A 5GMKe 1Q82U 1G3SA 3M9QA 4M7AF 2QEXA 3A8HB 1UGRB 4C92E 1N9SA 5GANg 4J8OA 3HPWA 1VUBA 1VQ4T 1NJIU 1Y7XA 3CMAT 2XG8D 2EQKA 3E1SA 4C8QC 1YJWA 4FT4A 3META 4N0AA 1QVPA 4C8QA 1VQMA 3S6WA 1VQKT 3HSBA 4M7DG 3L2ZA 3OMGA 5D6YA 2Y4XA 3HRTA 4BACA 4OB3B 2PU9B 2RB6A 5CQXA 3UT1A 2DTHA 5GAN2 4ZTFA 3CC4A 4J6YA 4JLIA 4E7IA 4JLGA 1S72A 1LOJA 5LJ3e 1XQHA 4QQ6A 2KMTA 2PUKB 2X4YA 3SWNA 2WSEE 2OTJT 4M75B 1P92A 5FU7C 4FL6A 2O4XB 4IKFA 2E6ZA 3UWNA 3LGFA 5A0GA 3CCST 4PJOB 2OAUA 1VIEA 5GAOl 5I2SA 1UEBA 2F69A 3SDZA 4PNOA 3HFOA 3JCMh 1K8AC 1OYXA 2L5QA 3JCMf 4C92D 1OI1A 2QTXA 4QQDA 3CCUT 4M7DC 1U8RA 3I55A 3Q1JA 4M7DA 2JNGA 2FVUA 5HKCA 2P0PA 2K4YA 3VKIA 4FT2A 4BY6C 4RMOA 1KG1A 2DXBA 2JUFA 2LRQA 5DY9A 4ZN1A 2EQJA 2XDPA 2K3YA 3CCMA 3JCMP 3ME9A 1QW1A 1VQMT 1W2BS 4GLKA 2CZ6B 3OS2A 3OYGA 4E7JA 2LTOA 2VXFA 5LJ3g 5CR2A 1M4ZA 2D0QB 3JB9F 1RI0A 2YLBA 3PNWC 2DK3A 3OY9A 3PMIA 1LNXA 2GF7A 2Y4YA 4MZPA 3E9GA 5M9OA 3JB9I 1M1KC 3V7SA 4M77F 2KSSA 5LJ5j 4QQGA 3CMAA 1VQ4A 4EDUA 1QP3A 2K5IA 4M77B 4Y28E 3LH0A 4A4FA 4L6V5 3UPUA 2PQWA 4JRQA 3SD4A 3CCRT 5KCOA 4M75G 2GFUA 2WACA 1FX7A 3M55A 5CVIA 1QVFA 2XHCA 3G6ET 3QUIA 2LDMA 4BDYA 3S3OA 2V8KA 4PJOG 3JCMd 4NS5A 4ATOA 3OBWA 1YIJA 5KCHA 2OTJA 3HP9A 2AHJB 3JCMX 3PFSA 4B9WA 3OS5A 4BUGA 4F7UF 1NE8A 5GAN3 2QA4A 3VJPA 1WQ7A 2RJCA 4JS4A 3MP8A 1KHIA 5C6SA 1UGPB 4OF1A 3CCSA 1UB4A 3AHUA 1Q81U 1WNLA 2EYQA 4M78C 4C8QF 2X35A 2QDYB 3CCQT 1GXIE 3VV0A 2JVVA 4C0DC 3QIIA 3FEOA 4X34A 2E1HA 3LWIA 2MAMA 1M1FA 5L8RE 2DTIA 1N8RU 3LX7A 3N5BB 4PKCC 1M90C 3LYIA 2ZPGB 3QXEB 4LDVA 4M75A 4X9DA 4M7DD 2LQ8A 1YHQT 2RHUA 3OSSC 4X9CA 3JB9G 3JCMe 2O4XA 5FRNA 4IUUA 4CRIA 4UC4A 4O5VA 4PJOA 3LW5E 4OB2B 4EMHA 1UGQB 4OP0A 4M77G 1NZ9A 4OMFB 5FU7B 5GAN8 1YJWT 3CCLT 3DB4A 4OB1B 2V8JA 3RMSA 5FROA 5GAN5 2VXEA 4JRIA 3WVDB 2QQBA 4ELYC 5A0LA 5HK0A 5GAMj 1LJOA 5CKBA 2QQAA 2RHXA 2P0QA 4LDYA 2ZPEB 2LNVA 3HHTB 4OVAA 2HQEA 3WVEB 4CI0C 4C5EA 1VQOT 1YI2T 1QVGS 1PSFA 2DJZA 2YRVA 5GAN6 1DJ7B 5HK3A 3CC7A 3A8LB 4JS5A 3X28B 1S72T 4M7DF 2XDDA 2OTLT 1BYMA 4RKUE 4J7FA 4XTVA 3PT9A 5KE2A 2JTMA 3VYGA 2XK0A 2E10A 2VC8A 4F7UG 3G6EA 3G71T 1VQLT 2ZCFB 1XTDA 2RJEA 2DXUA 3JCMg 2IG0A 2E64A 4LDXA 1BI0A 3VU3C 4M7AD 1Y71A 2ZPIB 4M77A 1BI3A 5IAYA 2EIFA 2A3LA 3CCEA 3QJ6A 3S3MA 3OSVA 3I55T 4R56A 3JCMJ 4XU0A 4HA8A 3FIFA 2K2VA 3EFRA 3GF5A 2K3XA 4IUPA 1KC8U 1WJQA 1WJRA 3M57A 5CKFA 5GANj 1M8VA 3M54A 4B9XA 1YBYA 4N4IA 1VQ6T 4M75D 1VQ7T 2IVWA 5EG2A 4FSXA 4F7UA 5LJ5h 5AYFA 2JTFA 2CYZB 2RM4A 4ZGDB 1W4SA 1K9MU 4PJOD 2FB7A 2X4JA 4ELZC 3CCLA 2X4WA 3X25B 1H3ZA 1WGSA 4KUIA 3JRZA 3UDCA 4C0ZA 3CCVA 3M53A 1Q82C 4M78F 4Q5WA 1YI2A 1VQOA 2L89A 2KAFA 4M78B 2HQXA 3P8BB 4M7DE 1G3TA 2DXCA 4C0DB 1XNIA 4M75F 5GMKj 4RG8A 1YIJT 1NJIC 3GNFB 2OTLA 2DIQA 4A4EA 5GAOr 3BW1A 4XU3A 3R6OA 4C5HA 3G71A 3MHXA 4PJOF 2QA4T 1VQLA 2P4TA 4HCZA 1Q7YC 2RI5A 3JB9D 4DQ2A 4L59A 4MZTA 5GMKi 3TU4K 4EPCA 2ZZDA 5IN1A 4BI4A 4M77D 4DA4A 3OYLA 1VQ8T 3A8GB 3M59A 1MHNA 3DB3A 5LJ5d 5GAOn 4ZTJA 3LLRA 5CKHA 4HCBA 3LWHA 2DKGA 2DEQA 4LD6A 3RKWA 4BB7A 4YTLA 1FWZA 3ER0A 2E41A 3M56A 5GAMh 1O9SA 1QP2A 1U1TA 3CMET 1VQ6A 3C94A 1VQ7A 4HT9A 3MP1A 2BUDA 2GFAA 2KY9A 1SSFA 4M7AE 4II1A 3SFMA 4MDXA 4E7LA 2RHYA 3M4YA 2F5KA 3NFCA 3ZFJA 4EMKB 4M78G 3C12A 4PLLA 2FYKA 4WF2A 3GIBA 4XTZA 4XTWA 5GAOq 3OYYA 3RIRA 5CK9A 3CCVT 1N6AA 2PVDB 3CC7T 3BDLA 4C8QD 4LD9K 1MGQA 3DLLA 3A8MB 4J6WA 3OYDA 4OB0B 1FXXA 2LT1A 4ZGEB 2EAYA 4NL2A 3GLXA 4N4GA 2LT4A 3CC2T 2YHTA 1NPPA 4M75E 3CXCA 3I56T 1X6OA 5GAN4 3OYAA 1BKBA 1G3YA 2R5MA 3CCJT 2DD4A 2DAQA 3OYBA 2B8AA 4PJOE 3CCET 3QJYA 2DO3A 2XI9A 1G3WA 3INZA 1BI2A 4C92B 2XU8A 1X01A 3DLMA 5GANh 2EJ9A 4M78A 3MEAA 2Y90A 4XU2A 3JB9J 5GAMd 3QG1A 3H8ZA 3JCMW 1VQ8A 2LX9A 2LQKA 2EJGA 2DVEA 3F70A 4N4HA 3M4GA 3MO8A 3RMQA 3OYIA 3KUFA 3X24B 4C5GA 3M58A 3S3NA 1Q86C 2CKKA 5CKEA 3HRUA 2R58A 2D6FA 1YJNT 1M1GA 3V8LA 1ZQ1A 4BE1A 2KDSA 4MDWA 2CGHA 2VYTA 3NTKA 3OYKA 4KBMB 3CMEA 3V8KA 3ZBDA 1YITA 1VQPT 2K5LA 3L2WA 1N8RC 2EFIA 2WSFE 4JDSA 2DXTA 4KUDK 2MMPA 3JB9H 3QZ9B 2MWPA 4IUVA 4A54A 4M77E 1KQSA 5GMKh 4DOWA 2DZCA 5DLQE 5CIUA 4BDZA 4P5NA 2DZ9A 1Y96B 4A4HA 3J7AF 3H6ZA 3L42A 5KH6A 4HCCA 2RHIA 3CCUA 5CAIA 3E9FA 3FJPA 4QVZA 1D3BB 3JCMc 3CPWA 4XK8E 3PTAA 5GANd 4BE0A 1KD1U 3CC2A 1PSEA 2ZPBB 3A5ZB 4VUBA 3RKXA 1JJ2A 4EMKC 3I56A 1WJSA 3QHSA 3OYHA 2EQUA 2QQSA 3DKMA 4EMKA 3OA6A 3CCJA 4F7UE 3E19A 2LVMA 3OQ5A 1JB0E 3L2VA 3BFMA 4C0FA 4BI8B 4PLIA 3A8OB 2M0OA 2ZPHB 4QVCA 1M9SA 2H3JA 1IREB 4C8QE 1VQ5T 3VUZA 2XICA 2F5TX 3QSUA 4V2SA 1OZ3A 4JRKA 4M78D 1HXDA 5CKDA 5HY6A 2XD0A 1HK9A 1BI1A 4XQ3A 5GMKm 4RCBA 3GP8A 4KULA 5FU6B 5GAN7 4IURA 3MEVA 3FLGA 2PUOB 1YJNA 5D6XA 5LJ5f 1QVFS 3L1AA 4C92C 1K73U 1KC8C 3L2UA 3CXCS 1VQPA 4O6JA 4A4GA 3PGGA 1I4K1 2GQVA 1BIAA 4ZN3A 3G4ST 3V8JA 3JCMV 3OW2A 2VGMA 2VUBA 3HL8A 2CZ1B 4FM4B 4E7KA 2D9TA 3FC3A 2MWOA 2RD1A 2VV5A 3OS0A 3V7RA 1K9MC 2KVQG 2XDBA 3P8HA 3NTIA 5IT9E 2FHDA 2HNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZT A;  5CK9 A;  3HPW A;  1VUB A;  4ELZ C;  5CQY A;  5CKE A;  4HKE A;  2C06 A;  4VUB A;  5HKC A;  3JRZ A;  5CKH A;  5CO7 A;  5CQX A;  2VUB A;  4ELY C;  1NE8 A;  5HK0 A;  4MZM A;  5CR2 A;  5CKB A;  2KMT A;  3VUB A;  4OF1 A;  1UB4 A;  3G7Z A;  5CKF A;  1X75 C;  3TCJ A;  5CKD A;  4MZP A;  5CCA A;  5HK3 A;  3JSC A;  4MDX A;  2MF2 A;  5DLO A;  4ME7 A;  3NFC A;  1M1F A; 
#chains in the Genus database with same CATH topology
 3QKJ A;  1IZ6 A;  4OGE A;  2IPO B;  2RK1 A;  2C06 A;  4DBQ A;  5KYX A;  1Q81 R;  1Q7Y U;  2HAX A;  2KK4 A;  4WCI A;  3M0Q A;  2GQI A;  1AWX A;  1VIF A;  3EGD A;  3I5R A;  3JCM b;  4IUQ A;  2HL3 A;  1X69 A;  2XID A;  2CP3 A;  1QKX A;  3PIP A;  5FRM A;  1AWJ A;  2CP2 A;  4KH0 B;  5FU6 C;  3CC2 Q;  1AHJ B;  4M78 E;  3LGL A;  1RAA B;  3I56 Q;  2RO0 A;  1KQ1 A;  1TH7 A;  2LJ0 A;  1ACM B;  3ZEH A;  2D1X A;  3RUX A;  4R55 A;  4OGC A;  2K57 A;  2EQM A;  1SRL A;  4A4K A;  3FRN A;  3CBM A;  2DIL A;  3OW2 S;  5LJ5 g;  2KQW A;  2KT8 A;  2GCX A;  2Z0W A;  3CXC P;  2COZ A;  2ED1 A;  3P8D A;  4FYX B;  2BKD N;  2JXB A;  3QZ5 B;  5GAO m;  3H41 A;  1VQN T;  1WPY A;  2DX1 A;  3EFS A;  3OYE A;  4C8Q B;  4LDU A;  3UAT A;  2EWN A;  1VQ9 T;  2RHZ A;  1VOM A;  4FIB A;  2HBW A;  4DEX A;  2QEX T;  2NLU A;  1YWO A;  3I5S A;  3QYG B;  5LJ3 f;  3PMT A;  5I2M A;  4HCK A;  5KYW B;  5FLX E;  2M16 A;  3VUB A;  2JN0 A;  1NLP C;  3GNG A;  4NL3 A;  1I0C A;  1YCS B;  3CCR A;  1M3C A;  3VS3 A;  1G5V A;  4BY6 B;  2CZ0 B;  1YJ9 A;  1KJW A;  2YLC A;  3X20 B;  4GBQ A;  1U1S A;  1M2V A;  3EH2 A;  1WFW A;  3G4S Q;  2XKO C;  4J9G A;  4OMN A;  3RNJ A;  3SB2 A;  3WXM B;  3X26 B;  1I81 A;  2KNB B;  5KE3 A;  4RCC A;  4BE2 A;  1K73 C;  1YHQ A;  2YDL A;  2DET A;  5GMK e;  1Q82 U;  3M9Q A;  4M7A F;  2LP5 A;  5GAN g;  4J8O A;  3HPW A;  1VUB A;  3CMA T;  2VAS A;  3E1S A;  1YJW A;  4M7D G;  2EBP A;  3CQT A;  3HRT A;  1WIE A;  3UT1 A;  2DTH A;  4J6Y A;  4JLI A;  4JLG A;  1GFC A;  5LJ3 e;  3IQL A;  1P92 A;  1CSK A;  4KGV B;  4IKF A;  2E6Z A;  2COW A;  1UEB A;  1M90 R;  4PNO A;  1D0Y A;  4FYY B;  3E2U A;  4QQD A;  1U8R A;  3I55 A;  4M7D A;  3VKI A;  2JMC A;  4RMO A;  1KG1 A;  2JUF A;  1QLY A;  2K3Y A;  3JCM P;  2VXF A;  2ENM A;  5CR2 A;  2QTV A;  3EG3 A;  1MMG A;  1RI0 A;  2DK3 A;  3OY9 A;  3PMI A;  1AZE A;  4QQG A;  4EDU A;  1QP3 A;  1LVK A;  4RTX A;  3SD4 A;  5IHK A;  3CCR T;  1Z9Z A;  2WAC A;  2B86 A;  3S3O A;  1Q95 G;  3JCM d;  4NS5 A;  4ATO A;  2CT3 A;  3OS5 A;  5GAN 3;  2DE0 X;  1KHI A;  1UGP B;  3CCQ Q;  1JEG A;  1K73 R;  2EYQ A;  4J9D A;  2JVV A;  3CCU A;  2C0T A;  1M1F A;  2MAM A;  1XJW B;  1IHV A;  4RTZ A;  1YHQ T;  3TSZ A;  1TG0 A;  2HZY A;  4OB2 B;  4EMH A;  2OJ2 A;  4OP0 A;  2YSQ A;  5FU7 B;  5GAN 8;  1YJW T;  3J80 E;  4CC2 A;  5FRO A;  3CC4 Q;  1VQO Q;  4JRI A;  4ZNX A;  3WVD B;  2QQB A;  5A0L A;  1J3T A;  1LJO A;  2QK0 A;  4OVA A;  2ZPE B;  4CI0 C;  3WVE B;  1QCF A;  1PM3 A;  2YRV A;  4JS5 A;  1C6V X;  5KYX B;  2OTL T;  1Q7Y R;  2E3H A;  2QYZ A;  2VC8 A;  2K3B A;  4DBF A;  4F7U G;  3G6E A;  1MUZ A;  3VS4 A;  2RJE A;  2IG0 A;  1BI0 A;  2PTK A;  1Y71 A;  5IAY A;  4PFO A;  1M27 C;  2RMO A;  2FRW A;  2K7A A;  2CDT A;  3OSV A;  3I55 T;  4XU0 A;  4HA8 A;  1ZA1 B;  2YUP A;  1BBZ A;  2K2V A;  1KC8 U;  1WJQ A;  1TUC A;  4AFZ C;  3M54 A;  5GJV B;  3M0T A;  4M75 D;  5EG2 A;  4FSX A;  4F7U A;  5AYF A;  2CYZ B;  4ZGD B;  4PJN A;  2X4W A;  2RF0 A;  1KIK A;  1WGS A;  1GFD A;  4C0Z A;  3M53 A;  1Q82 C;  1YIJ Q;  1YI2 A;  4M7D E;  4JJB A;  2DXC A;  4M75 F;  4RG8 A;  3GNF B;  2DIQ A;  4LE9 A;  4C5H A;  3G71 A;  4HCZ A;  3JB9 D;  2MCN A;  5GMK i;  4BI4 A;  4M77 D;  3OYL A;  2JM9 A;  2YUQ A;  2E4H A;  5LJ5 d;  2E41 A;  1VQ7 A;  3MP1 A;  4CC7 A;  2KY9 A;  4J9F A;  4II1 A;  2EW3 A;  3ZFJ A;  4EMK B;  1UFF A;  2E5K A;  5CK9 A;  1N6A A;  2PVD B;  4LD9 K;  4OB0 B;  4NL2 A;  4N4G A;  3CCJ Q;  3NGP A;  3CC2 T;  3CCE Q;  3I56 T;  1RLP C;  2EGA A;  4EIK A;  1T3L A;  2G6F X;  3DLM A;  1H3H A;  3H8Z A;  1V76 A;  2LX9 A;  3RMQ A;  2DVE A;  2XMF A;  1Q86 C;  2CKK A;  5CKE A;  3HRU A;  1YNZ A;  1SPK A;  2QGF B;  3V8L A;  4OMO A;  4JZ3 A;  2AKK A;  1IB8 A;  4KBM B;  1WHG A;  4LUD A;  1Q82 R;  4ORZ A;  4JDS A;  3GBQ A;  2CUB A;  3JB9 H;  2MMP A;  4A54 A;  1RAE B;  3VS2 A;  1KQS A;  3UA7 A;  4BDZ A;  1OUL A;  1UUE A;  1Y96 B;  2EGC A;  5CAI A;  1X27 A;  5GAN d;  2PNI A;  1JJ2 A;  2NYS A;  1WI7 A;  1WJS A;  3QHS A;  3DKM A;  4F7U E;  1NG2 A;  1LPL A;  1RAF B;  1M9S A;  2H3J A;  2KYM A;  1HJD A;  3MKD A;  1HXD A;  1HK9 A;  1BI1 A;  4KRT A;  2DRM A;  3GP8 A;  5FU6 B;  4J9I A;  3FLG A;  5D6X A;  1QVF S;  3L1A A;  4RTT A;  1KC8 C;  3CXC S;  4O6J A;  1GBR A;  3PGG A;  1I4K 1;  3G4S T;  4GLM A;  1WZO A;  2VGM A;  2VUB A;  3HL8 A;  4E2F B;  3FC3 A;  2C0O A;  3OS0 A;  3V7R A;  3TSW A;  2HSE B;  2H8H A;  3EG9 B;  2M0Y A;  4AMC A;  4J9B A;  2JS0 A;  1JBM A;  2E70 A;  3RKY A;  1VQ8 Q;  2NWM A;  2V26 A;  4N0A C;  3D7S B;  1B34 B;  2KYB A;  3TEE A;  5KYU A;  4HKE A;  3CBO A;  2HMA A;  5LJ3 j;  3EG1 A;  4J9H A;  2I2L A;  1D3B A;  1H64 1;  2P0K A;  3TRE A;  2BZX A;  2DFU A;  3EGX A;  3ZL7 C;  3CME Q;  1YIT Q;  3SWN C;  1UGV A;  4LDW A;  1PWT A;  2CP5 A;  2RI2 A;  1YCY A;  1QVG A;  4JUV A;  5J3B A;  3CD6 A;  2QDL A;  1C0M A;  3KBG A;  1K1Z A;  4J83 A;  1VYV A;  1WXT A;  3HTR A;  3MEU A;  1M1K U;  2RH2 A;  4HVV A;  2JZ2 A;  1I1J A;  2AKL A;  3O5Z A;  5A0D A;  4M7A G;  1R0B G;  4AFQ C;  1ZHI A;  3OBY A;  3CEY A;  2QXF A;  3EH1 A;  4C92 F;  5CCA A;  1XOV A;  1JXM A;  2R57 A;  1ZA2 B;  7AT1 B;  3J81 E;  1VQK A;  2JT4 A;  1YJN Q;  3L2Q A;  3C95 A;  3EAE A;  2FZC B;  1KC8 R;  1Q81 C;  2J6O A;  2ZPF B;  4M7A A;  3CPF A;  1M90 U;  1JQQ A;  4E47 A;  4F7U B;  1KHC A;  2M9U A;  4JJC A;  2QQR A;  4M75 C;  3OB9 A;  1OZ2 A;  1RAB B;  2QQ9 A;  2RJF A;  2NUT A;  4C0G A;  3ULR B;  3VYH B;  4Y91 A;  2JMA A;  1YFN A;  5LJ3 h;  2VGN A;  1KQS P;  1ZBX A;  3CC4 T;  2EKH A;  2L2P A;  2L3Q A;  1W2B A;  1MNE A;  2RA2 A;  2CH4 A;  3SEM A;  2FPE A;  3QYH B;  2PVG B;  1A0N B;  4ME7 A;  2MI6 A;  3OYC A;  3TVT A;  1JJ2 P;  1Z9Q A;  1WXU A;  4L5G A;  3NTH A;  4M77 C;  5KYY A;  3CD6 T;  1I8F A;  2O9V A;  4IUT A;  1SSH A;  2RJD A;  4RTU A;  3NHN A;  2HKQ B;  1VQN A;  1I5L A;  2LJ1 A;  4J9E A;  4DBR A;  1E7O A;  2HBP A;  2NUP A;  3KXT A;  4HVW A;  3OS1 A;  4RUG A;  4MML A;  2J06 A;  1OV3 A;  3NPF A;  1VQ9 A;  2HD0 A;  2X4X A;  1G3S A;  1UTI A;  2QEX A;  1Y7X A;  2E3I A;  3MET A;  4N0A A;  1QVP A;  4PK4 A;  2MYS A;  3S6W A;  1VQK T;  3HSB A;  1GCP A;  4BAC A;  5CQX A;  4M4Z A;  4E7I A;  2QAS A;  1LOJ A;  3QWX X;  2KMT A;  3A1P A;  2X4Y A;  3SWN A;  1M3A A;  1V1C A;  4PJO B;  1BK2 A;  2MIO A;  2F69 A;  3JCM f;  1OI1 A;  4M7D C;  1PD0 A;  2P84 A;  3Q1J A;  5HKC A;  5DY9 A;  1TUG B;  4IIO A;  1PRL C;  2DJQ A;  3OS2 A;  5LJ3 g;  2D0Q B;  2GTO A;  4CC4 B;  2F1L A;  2Y4Y A;  1M1K C;  2KSS A;  3CMA A;  2K5I A;  1W6X A;  2H3E B;  1C1A A;  3LH0 A;  4A4F A;  3UPU A;  1SKU B;  3G6E Q;  4A63 B;  2M02 A;  1QCN A;  2X3W D;  1K9A A;  2X3X D;  3H9N A;  4M75 G;  5CVI A;  2KRS A;  4KH1 B;  4BDY A;  2VB6 A;  3HP9 A;  1NYG A;  2RQU A;  3JCM X;  1RLQ C;  1IHW A;  1NE8 A;  2QA4 A;  2RJC A;  1K4U S;  3MP8 A;  4OF1 A;  1WNL A;  4C8Q F;  3FEO A;  2E1H A;  1M90 C;  4X9D A;  4M75 A;  3EFO A;  2DMO A;  2RHU A;  3OSS C;  3JB9 G;  5FRN A;  3JCM e;  2O4X A;  4CRI A;  3THK A;  2JJ9 A;  2X51 A;  1VQM Q;  4WTO B;  4M77 G;  5I22 A;  3CCL T;  3RMS A;  2V8J A;  1YI2 Q;  4ELY C;  1PKS A;  5GAM j;  1S72 Q;  3CCV T;  2P0Q A;  1GBQ A;  1OU8 A;  2HQE A;  1IGU A;  1PSF A;  5GAN 6;  3CC7 A;  2XDD A;  2KXD A;  1OX8 A;  4XTV A;  3VYG A;  2XK0 A;  1TSF A;  3H0I A;  1RAH B;  2DXU A;  1B3Q A;  2QG9 B;  4DBH A;  4LDX A;  3G1J A;  1MMN A;  4M7A D;  4M77 A;  1BI3 A;  1PKT A;  1U5S A;  2YUN A;  1U3O A;  3QJ6 A;  3JCM J;  1SRM A;  3CCM Q;  3FIF A;  2RN8 A;  2BZ8 A;  1W2B P;  4IUP A;  3M57 A;  1YBY A;  4N4I A;  2LNH B;  1M1K R;  1VQ4 Q;  2FB7 A;  2FPF A;  4ELZ C;  5L23 A;  1D1A A;  2SRC A;  3X25 B;  3UDC A;  4M78 F;  2OTJ Q;  4M78 B;  3VRY A;  4C0D B;  2OTL A;  1X2Q A;  4QKU A;  3CCS Q;  5GAO r;  2QA4 T;  1WA7 A;  3R6O A;  1Q7Y C;  2RI5 A;  2W0Z A;  3TU4 K;  2ZZD A;  4RTV A;  4FSS A;  1VQ8 T;  3A8G B;  5GAO n;  1WDX A;  1ZX6 A;  2DEQ A;  1CKB A;  3RKW A;  5GAM h;  1QP2 A;  3CME T;  4E7Z A;  3C94 A;  4HT9 A;  2BUD A;  2MPX C;  2GFA A;  4E7L A;  3C12 A;  4WF2 A;  4XTZ A;  4XTW A;  3KFV A;  1TOV A;  5GAO q;  3CC7 T;  1QWF A;  2L3P A;  1MGQ A;  3DLL A;  3OYD A;  3GLX A;  2CSQ A;  4M75 E;  3QDF A;  2B8A A;  2DYI A;  3QJY A;  1G3W A;  3INZ A;  1JXO A;  2DVJ A;  1OU9 A;  2XU8 A;  4XU2 A;  3MEA A;  3JB9 J;  3JCM W;  1PRM C;  2LQK A;  3KUF A;  5IH2 A;  2AZS A;  2R58 A;  1YJN T;  1M1G A;  2NUP B;  2KDS A;  3OYK A;  3NTK A;  4PJM A;  1VQP T;  3V8K A;  3ZBD A;  3M0U A;  2EFI A;  2V1Q A;  2DXT A;  2SEM A;  4IUV A;  1K9M R;  4M77 E;  4DOW A;  2DZC A;  2D8J A;  5IHI A;  1G8X A;  4LUE A;  1FYN A;  4P5N A;  3J7A F;  3L42 A;  1VYT A;  1VQL Q;  3I35 A;  5HCK A;  3CPW A;  4QVZ A;  3JCM c;  3TQ7 P;  1AWW A;  2J05 A;  1KD1 U;  3CC2 A;  1PSE A;  3A5Z B;  3I9Q A;  1OPL A;  1M3B A;  3I56 A;  3OYH A;  2QQS A;  3OA6 A;  2FRY A;  3E19 A;  3EGD B;  4Z88 A;  4C0F A;  2CP6 A;  1OEB A;  3A8O B;  3SHW A;  4QVC A;  2LQW A;  4IIM A;  1VQ5 T;  1OZ3 A;  4JRK A;  1VQ6 Q;  5CKD A;  3PVQ A;  2XD0 A;  4XQ3 A;  2OX7 A;  4PFZ A;  4RCB A;  2LQN A;  1AEY A;  5GAN 7;  4IUR A;  2YT6 A;  1PNJ A;  4RTY A;  4A4G A;  1X2K A;  1BIA A;  2D9T A;  1SHF A;  3EGU A;  2EYW A;  1TTH B;  3BDU A;  3OMC A;  4GY5 A;  2ZGW A;  1D09 B;  4TVR A;  2KR3 A;  4BI3 A;  1E6H A;  2AZV A;  3VS7 A;  1NPR A;  4EMG A;  3GOX A;  2LCL A;  1RL2 A;  1WYX A;  1RAI B;  3LH5 A;  1KQS S;  2FPD A;  1K8A U;  2D8H A;  2I0N A;  3FDR A;  4BD3 A;  2CS7 A;  2DL8 A;  1BCM A;  1X75 C;  5GAM f;  3QBY A;  2MF2 A;  2DIG A;  2HKN A;  4Z02 A;  3OYN A;  1JJ2 S;  2E12 A;  2FZK B;  1QWE A;  4FYV B;  1OPK A;  2HSP A;  5J39 A;  3G4S A;  2LJ3 A;  1MND A;  2CSI A;  2LZ6 B;  3C0C A;  4XAX B;  4XTU A;  1UJY A;  2JM8 A;  5LL6 S;  4HVU A;  3G7Z A;  1M2V B;  4J5Y A;  2DRK A;  1HSQ A;  2M1H A;  4KGZ B;  3ASK A;  4JRP A;  3C4S A;  5GMK l;  4Z89 A;  2G3R A;  3PE0 A;  3FJ5 A;  4M7A C;  4OMP A;  3OYF A;  2J6F A;  4QVD A;  3MP6 A;  4JPB W;  4FCY A;  1AD5 A;  1PD1 A;  4A53 A;  1UJ0 A;  1QMC A;  1YWP A;  2L3R A;  5GJW B;  2CT4 A;  1WX6 A;  2QAZ A;  3OYM A;  5GAM e;  5DLO A;  4PL6 A;  2F2W A;  5IXB A;  2QEX Q;  3EG2 A;  1V29 B;  2EYX A;  4QT7 A;  4XTX A;  1FMW A;  5C0M A;  2LC4 A;  2OAW A;  3HRS A;  1R8O B;  2GNC A;  2YUO A;  4AG1 C;  4J6X A;  2CZ7 B;  3GPL A;  3HKS A;  2LCC A;  1YP5 A;  3JCM Q;  1UG1 A;  1KD1 C;  4MMK A;  1NEG A;  3JSC A;  4M7D B;  5KYN A;  3O8V A;  3CPW P;  2EJF A;  2ATC B;  4RG2 A;  3T9N A;  1TU0 B;  4DEY A;  2K5F A;  4Z8A A;  5D6W A;  1EIF A;  2P4R A;  2DA9 A;  2PVO B;  2ROT A;  1PC0 A;  1N27 A;  4C8Q G;  1KQ2 A;  1M5Q 1;  2WSC E;  3BY7 A;  2KE9 A;  1WXB A;  3CCQ A;  2O31 A;  2V8I A;  3CCM T;  2RQV A;  3UF4 A;  4KT0 E;  1N9R A;  1G83 A;  3QO3 A;  2EQI A;  1UGR B;  1N9S A;  1UDL A;  1VQ4 T;  4FT4 A;  4C8Q A;  5D6Y A;  2Y4X A;  1ARK A;  4ZTF A;  3CC4 A;  1ABQ A;  2DF6 A;  1IGQ A;  1ABO A;  2WSE E;  3R6N A;  2OTJ T;  1AVZ C;  5FU7 C;  2DL7 A;  2L0A A;  2LMJ A;  2DL5 A;  5KYW A;  5A0G A;  3CCS T;  2OAU A;  5I2S A;  3SDZ A;  3HFO A;  3JCM h;  1K8A C;  1OYX A;  4C92 D;  1K0S A;  2JNG A;  2FVU A;  2P0P A;  2K4Y A;  2KI7 A;  2LRQ A;  2W10 A;  4ZN1 A;  2EQJ A;  2O9S A;  4F17 A;  1W2B S;  4GLK A;  2CZ6 B;  4E7J A;  1AOJ A;  2LTO A;  2YLB A;  1KD1 R;  1LNX A;  2GF7 A;  1PG5 B;  3V7S A;  1H92 A;  5LJ5 j;  3CCR Q;  4AG2 C;  4Y28 E;  1BU1 A;  5KCO A;  1YJ9 Q;  2J6K A;  2KRN A;  1FX7 A;  3M55 A;  1QVF A;  3H0H A;  2XHC A;  3QUI A;  4LN2 A;  2J7I A;  4PFP A;  2HDA A;  3OBW A;  2YRD A;  1YIJ A;  5KCH A;  3PFS A;  4B9W A;  4BUG A;  4F7U F;  4JS4 A;  3VJP A;  1TUD A;  5C6S A;  3REA B;  2COY A;  2QDY B;  3CCQ T;  1GXI E;  3VV0 A;  1YHQ Q;  3QII A;  3LWI A;  1QQJ A;  2DTI A;  4F04 B;  3LX7 A;  3N5B B;  1IXD A;  4LDV A;  4X9C A;  4UC4 A;  1YJW Q;  3LW5 E;  2ZAE A;  2M51 A;  1UGQ B;  1T0H A;  1NZ9 A;  4OMF B;  4PJJ A;  2QQA A;  2RHX A;  3VS6 A;  4LDY A;  2LNV A;  3HHT B;  1NJI R;  1VQO T;  3NMZ C;  4C5E A;  2DJZ A;  1DJ7 B;  3A8L B;  2BE7 D;  2NUZ A;  4RKU E;  2EYY A;  3PT9 A;  2JTM A;  1VQL T;  1F1B B;  2GGR A;  4FW2 A;  1K8A R;  3JCM g;  3I55 Q;  3VU3 C;  2ZPI B;  2EIF A;  2A3L A;  3CCE A;  3S3M A;  4R56 A;  1SEM A;  3EFR A;  3GF5 A;  2EVR A;  5CKF A;  5GAN j;  1M8V A;  1NYF A;  1SG5 A;  2HCK A;  1VQ6 T;  2K6D A;  1HYO A;  1VYU A;  1ZLM A;  5LJ5 h;  1TS9 A;  2RM4 A;  1K9M U;  4PJO D;  1TWB A;  5ECA A;  3CCL A;  1H3Z A;  4KUI A;  3CCV A;  5FW9 A;  1E6G A;  2HQX A;  1YIJ T;  4J9C A;  4A4E A;  3BW1 A;  4XU3 A;  3MHX A;  4PJO F;  2P4T A;  2LCS A;  1NLO C;  3CCU Q;  4L59 A;  1WHK A;  1T3S A;  3VS1 A;  8ATC B;  5IN1 A;  2DLP A;  2BZY A;  2JS2 A;  1MHN A;  1EX4 A;  4HCB A;  1N8R R;  1U06 A;  2DKG A;  1O9S A;  3VS5 A;  2K79 A;  4M7A E;  1QVG P;  4MDX A;  1I07 A;  3NFC A;  4PLL A;  1JU5 C;  3OYY A;  3RIR A;  3BDL A;  4C8Q D;  2D0N A;  1FXX A;  2LT1 A;  1MV3 A;  2LT4 A;  5I11 A;  5GAN 4;  3OYA A;  2R5M A;  3CCJ T;  2DD4 A;  2DAQ A;  2K2M A;  3CCE T;  2DO3 A;  3UA6 A;  1BI2 A;  1EFN A;  5GAN h;  2EJ9 A;  3A98 A;  3QG1 A;  2HEQ A;  1VQ8 A;  2AIR B;  3M4G A;  3MO8 A;  3OYI A;  3S3N A;  1QVF P;  4C5G A;  3M58 A;  2DM1 A;  2QGG A;  1D0Z A;  2D6F A;  2O2O A;  2O88 A;  3CME A;  1YIT A;  2K5L A;  3L2W A;  2JTE A;  2WSF E;  4KUD K;  3QZ9 B;  2MWP A;  1B07 A;  1PHT A;  5DLQ E;  5KYU B;  2DZ9 A;  3H6Z A;  5KH6 A;  4HCC A;  3G71 Q;  2RHI A;  3FJP A;  1D3B B;  1PCX A;  4XK8 E;  2KXC A;  3EGX B;  3VS0 A;  3RKX A;  5D7U A;  2OI3 A;  4EMK A;  3OQ5 A;  1NEB A;  1JB0 E;  1WLP B;  3BFM A;  4PLI A;  2M0O A;  2ZPH B;  3JV3 A;  2KGT A;  1AZG B;  3QSU A;  1K76 A;  2XIC A;  1HD3 A;  4M78 D;  1VQ7 Q;  5GMK m;  4KUL A;  1GCQ C;  2PUO B;  1I5O B;  1YJN A;  5LJ5 f;  4C92 C;  2MOX A;  3L2U A;  1VQP A;  4ZN3 A;  1ZSZ C;  1K0X A;  2YWW A;  3JCM V;  3OW2 A;  1UEC A;  4LXC A;  4FM4 B;  4E7K A;  2C0I A;  2RD1 A;  1K9M C;  1ZUY A;  3P8H A;  2X9H A;  4F14 A;  1CKA A;  4D8K A;  2YRC A;  2RPN A;  3U23 A;  2CUD A;  4QW2 A;  1X6G A;  4C5I A;  4M7A B;  2DPP B;  2A28 A;  4JJN K;  4FU6 A;  2A37 A;  5EC7 A;  1Y57 A;  2CH4 W;  1MMA A;  1Y96 A;  1JRI A;  1SHG A;  2E65 A;  1RI9 A;  5J26 A;  4HT8 A;  1VQ5 A;  2KBT A;  1YN8 A;  1WQW A;  2GBQ A;  4DOV A;  2DYB A;  1YIT T;  3CPW S;  3M0S A;  2AK5 A;  2DL3 A;  2NUT B;  2BIV A;  2L8D A;  4E7H A;  3M5A A;  5DM7 R;  1NM7 A;  5LJ5 e;  2ESW A;  4NOY A;  5CO7 A;  2RK2 A;  1ZSG A;  4XTY A;  5GAO p;  2DTO A;  3RDV A;  3TCJ A;  4K11 A;  2EKO A;  8AT1 B;  3FB9 A;  3MEW A;  5KYY B;  3QWY A;  1BIB A;  5A2Q E;  5GAN f;  2O01 E;  1W1F A;  3EG9 A;  1N5Z A;  3CBP A;  1YJ9 T;  2JOY A;  3JAM E;  3URG A;  4D6W A;  4ZGJ B;  1B34 A;  4MZM A;  1Q86 U;  1M2O A;  2A7Y A;  3QDR B;  2DD5 A;  3MPU B;  2HL5 C;  1UHF A;  2LX7 A;  4AT1 B;  3OYJ A;  5CQY A;  9ATC B;  4PJO C;  3V7C A;  2QI2 A;  3SWN B;  4C92 G;  4JJD A;  5FWC A;  3RER A;  3HFN A;  4J7I A;  3L2R A;  1EZZ B;  2IIM A;  5GAM g;  5I21 A;  2RI3 A;  3AT1 B;  4AFS C;  3M0R A;  1GCQ A;  5GAN e;  3CD6 Q;  1Y07 A;  3RES A;  3QPH A;  2F2V A;  4C92 A;  1TXQ A;  4D8D A;  1RAC B;  1UGS B;  1ZSZ A;  4X1V A;  4XU1 A;  1D0X A;  1BB9 A;  1KSW A;  4AFU C;  1AWO A;  3PIO A;  3MCA B;  2EGE A;  2E6N A;  2FL7 A;  2VVK A;  1O75 A;  2ED0 A;  5LJ3 d;  1JO8 A;  2R5A A;  2E5Q A;  2RQR A;  3A8H B;  3PVL A;  1VQK Q;  1NJI U;  2XG8 D;  2EQK A;  4C8Q C;  1VQM A;  3L2Z A;  3OMG A;  3OW2 P;  4OB3 B;  2PU9 B;  2RB6 A;  5GAN 2;  1FMV A;  1S72 A;  1XQH A;  4QQ6 A;  2PUK B;  1R0C B;  1SF9 A;  4M75 B;  3EFO B;  4FL6 A;  5IHN A;  2O4X B;  3UWN A;  3LGF A;  2GTJ A;  1ZUU A;  1RUW A;  1VIE A;  5GAO l;  1KFZ A;  1OX9 A;  2L5Q A;  2QTX A;  3CCU T;  1ZUK A;  4RTW A;  2BE9 B;  2ECZ A;  3H0F A;  4FT2 A;  4BY6 C;  3EG0 A;  2DXB A;  2DEU A;  2XDP A;  3CCM A;  2A0F B;  3ME9 A;  1QW1 A;  3OYG A;  1M4Z A;  3JB9 F;  2EPD A;  3PNW C;  6AT1 B;  1QKW A;  3JB9 I;  2V1R A;  4MZP A;  3E9G A;  5M9O A;  4M77 F;  4JZ4 A;  1VQ4 A;  4M77 B;  4L6V 5;  2PQW A;  4JRQ A;  2GFU A;  3G6E T;  2LDM A;  2V8K A;  2CP7 A;  4PJO G;  3RR6 A;  2OTJ A;  2AHJ B;  2A08 A;  1VQN Q;  2KEA A;  5FWB A;  1WQ7 A;  2CRE A;  3CCS A;  1UB4 A;  3AHU A;  1Q81 U;  3BE3 A;  4M78 C;  2X35 A;  4PJL A;  5IXF A;  4C0D C;  4X34 A;  1NBE B;  1VQ9 Q;  1N8R U;  5L8R E;  4PKC C;  3LYI A;  2ZPG B;  3QXE B;  4M7D D;  2LQ8 A;  2EYZ A;  3MJX A;  4IUU A;  4O5V A;  3CCL Q;  4PJO A;  1RAD B;  1VA7 A;  1IRX A;  3CCV Q;  3DB4 A;  4OB1 B;  5GAN 5;  1VQM T;  2VXE A;  5HK0 A;  1Y0M A;  2VWF A;  2DER A;  2FO0 A;  5CKB A;  4C92 E;  1YI2 T;  1QVG S;  4Y92 A;  5HK3 A;  1S72 T;  4M7D F;  1OOT A;  3X28 B;  2KRM A;  1BYM A;  4J7F A;  4F16 A;  5KE2 A;  4ESR A;  2E10 A;  3G71 T;  2ZCF B;  1XTD A;  1M30 A;  2E64 A;  2AT1 B;  3RBB B;  3EHQ A;  2K3X A;  1WJR A;  2PZ1 A;  2JW4 A;  5AT1 B;  4B9X A;  1QCO A;  1FMK A;  1VQ7 T;  2IVW A;  1BCO A;  3CMA Q;  2JTF A;  1W4S A;  1ZBJ A;  2X4J A;  1T0J A;  2DL4 A;  3JRZ A;  2CP0 A;  2BTT A;  4Q5W A;  1VQO A;  1WHH A;  2L89 A;  2VKN A;  2DBK A;  2KAF A;  3P8B B;  1G3T A;  5GMK j;  2QA4 Q;  1XNI A;  1NJI C;  4B6M A;  1OQK A;  1X43 A;  1VQL A;  1AT1 B;  4DQ2 A;  4MZT A;  4EPC A;  4OMQ A;  2KRO A;  1Q86 R;  2F2X A;  4DA4 A;  1UHC A;  3M59 A;  3DB3 A;  4ZTJ A;  3LLR A;  5CKH A;  2L3S A;  3LWH A;  3VRZ A;  1S1N A;  4LD6 A;  4BB7 A;  4YTL A;  1FWZ A;  3ER0 A;  4OMM A;  3M56 A;  3REB B;  1U1T A;  1VQ6 A;  1SSF A;  3SFM A;  3CC7 Q;  2RHY A;  2RQT A;  2F5K A;  3M4Y A;  4R0K A;  2A36 A;  4M78 G;  2FYK A;  3GIB A;  3A8M B;  4J6W A;  1D1C A;  4ZGE B;  1IO6 A;  2EAY A;  2ROL A;  1LCK A;  2YHT A;  1NPP A;  3CXC A;  1UE9 A;  1X6O A;  1BKB A;  1G3Y A;  3OYB A;  2MK5 A;  4PJO E;  2XI9 A;  2FG0 A;  4C92 B;  1X01 A;  4M78 A;  2Y90 A;  5GAM d;  1WHL A;  1ZSZ B;  2EJG A;  3F70 A;  4N4H A;  3X24 B;  3EHR A;  1VQP Q;  1WHJ A;  1ZQ1 A;  4BE1 A;  4MDW A;  2CGH A;  2VYT A;  1GL5 A;  1MMD A;  1N8R C;  4OML A;  1G2B A;  5GMK h;  2OTL Q;  1GRI A;  1R77 A;  2K9G A;  5CIU A;  4E6R A;  4A4H A;  4FYW B;  2DNU A;  1D1B A;  1M8M A;  2YXY A;  3E9F A;  1RAG B;  3PTA A;  4KGX B;  4BE0 A;  2ZPB B;  4VUB A;  4EMK C;  1KK7 A;  2EQU A;  3CCJ A;  3M0P A;  2LVM A;  3L2V A;  1VQ5 Q;  2DBM A;  4BI8 B;  4E7S A;  4HXJ A;  4C8Q E;  1IRE B;  4V2S A;  3VUZ A;  2F5T X;  4LNP A;  5HY6 A;  2ABL A;  2RNA A;  3MEV A;  2HQH A;  1B7T A;  1K73 U;  4CC3 A;  1MV0 B;  4FW1 A;  1X6B A;  2KT1 A;  2GQV A;  3V8J A;  2RQW A;  2CZ1 B;  4ANJ A;  2MWO A;  1WHM A;  2VV5 A;  1H8K A;  2KVQ G;  2XDB A;  3NTI A;  5IT9 E;  2FHD A;  2FEI A;  1W70 A;  2HNI A;  2FZG B; 
#chains in the Genus database with same CATH homology
 4QW2 A;  3QKJ A;  3OMC A;  4C5I A;  4M7A B;  1IZ6 A;  1JBM A;  2DPP B;  4GY5 A;  2E70 A;  2ZGW A;  4OGE A;  3RKY A;  4JJN K;  4TVR A;  4FU6 A;  4N0A C;  1B34 B;  3TEE A;  2RK1 A;  4BI3 A;  4HKE A;  1Y96 A;  2C06 A;  3CBO A;  1JRI A;  5LJ3 j;  1Q7Y U;  1NPR A;  2E65 A;  2I2L A;  1D3B A;  2LCL A;  5J26 A;  4EMG A;  3GOX A;  1H64 1;  1RL2 A;  2HAX A;  2P0K A;  3TRE A;  1VQ5 A;  4HT8 A;  2KK4 A;  1KQS S;  1K8A U;  3FDR A;  3SWN C;  4BD3 A;  2CS7 A;  1WQW A;  4LDW A;  4DOV A;  1VIF A;  1X75 C;  5GAM f;  3JCM b;  1YIT T;  2RI2 A;  3CPW S;  3BDU A;  4IUQ A;  3QBY A;  1YCY A;  2MF2 A;  2DIG A;  1QVG A;  4JUV A;  2BIV A;  2L8D A;  5J3B A;  3CD6 A;  4E7H A;  2XID A;  3M5A A;  4Z02 A;  5DM7 R;  3OYN A;  1JJ2 S;  2E12 A;  3G4S A;  5J39 A;  3KBG A;  3PIP A;  5LJ5 e;  5FRM A;  4J83 A;  3MEU A;  5FU6 C;  1AHJ B;  4M78 E;  1M1K U;  2RH2 A;  3LGL A;  4XAX B;  4NOY A;  2JZ2 A;  5CO7 A;  2RK2 A;  2RO0 A;  4XTU A;  5A0D A;  4M7A G;  4XTY A;  1KQ1 A;  1TH7 A;  5GAO p;  1ZHI A;  2DTO A;  3OBY A;  5LL6 S;  3ZEH A;  3G7Z A;  3CEY A;  3TCJ A;  2QXF A;  3RUX A;  4J5Y A;  4C92 F;  1XOV A;  2EKO A;  5CCA A;  4R55 A;  2R57 A;  3FB9 A;  4OGC A;  3MEW A;  2K57 A;  5A2Q E;  1BIB A;  3J81 E;  5GAN f;  2O01 E;  1VQK A;  2EQM A;  2M1H A;  4A4K A;  3ASK A;  4JRP A;  3C4S A;  3FRN A;  3CBM A;  3L2Q A;  3CBP A;  5GMK l;  3C95 A;  5LJ5 g;  3OW2 S;  2KQW A;  2G3R A;  3EAE A;  1YJ9 T;  2GCX A;  2JOY A;  2ZPF B;  3JAM E;  1Q81 C;  4M7A C;  3URG A;  3OYF A;  4M7A A;  4QVD A;  3CPF A;  3MP6 A;  4D6W A;  1M90 U;  4A53 A;  4ZGJ B;  1B34 A;  3P8D A;  2BKD N;  2L3R A;  4MZM A;  4E47 A;  1KHC A;  2M9U A;  3QZ5 B;  4F7U B;  5GAO m;  1Q86 U;  1VQN T;  1WPY A;  2QQR A;  2A7Y A;  3QDR B;  2DD5 A;  3EFS A;  3OYM A;  3OYE A;  4C8Q B;  4LDU A;  5GAM e;  5DLO A;  4M75 C;  4PL6 A;  3OB9 A;  2EWN A;  1OZ2 A;  1VQ9 T;  2RHZ A;  4FIB A;  3OYJ A;  2QQ9 A;  5CQY A;  4PJO C;  1V29 B;  4XTX A;  2RJF A;  3V7C A;  2QEX T;  4C0G A;  2QI2 A;  2LC4 A;  5C0M A;  3SWN B;  4C92 G;  3VYH B;  2NLU A;  3HRS A;  4Y91 A;  3RER A;  1R8O B;  3QYG B;  5LJ3 h;  5LJ3 f;  3PMT A;  2VGN A;  4J6X A;  3HFN A;  2CZ7 B;  5I2M A;  3GPL A;  3HKS A;  2LCC A;  5FLX E;  2M16 A;  1ZBX A;  3JCM Q;  3VUB A;  3CC4 T;  2JN0 A;  1KD1 C;  1W2B A;  4J7I A;  4MMK A;  2RA2 A;  3L2R A;  3GNG A;  3JSC A;  4NL3 A;  3CCR A;  4M7D B;  3QYH B;  3O8V A;  2PVG B;  5I21 A;  5GAM g;  4ME7 A;  2EJF A;  2RI3 A;  1G5V A;  4RG2 A;  4BY6 B;  2MI6 A;  3T9N A;  2CZ0 B;  1YJ9 A;  5GAN e;  2YLC A;  2K5F A;  3X20 B;  3OYC A;  1U1S A;  1Y07 A;  5D6W A;  1EIF A;  3RES A;  2PVO B;  3QPH A;  4M77 C;  3NTH A;  4L5G A;  4C92 A;  2XKO C;  3CD6 T;  1I8F A;  1N27 A;  4C8Q G;  4IUT A;  2RJD A;  1KQ2 A;  1M5Q 1;  2WSC E;  3BY7 A;  1VQN A;  1I5L A;  1UGS B;  3SB2 A;  3WXM B;  3X26 B;  1I81 A;  4XU1 A;  2HBP A;  3CCQ A;  2V8I A;  5KE3 A;  3PIO A;  4RCC A;  3CCM T;  3MCA B;  4BE2 A;  1K73 C;  2E6N A;  2FL7 A;  5LJ3 d;  1O75 A;  3KXT A;  2R5A A;  3OS1 A;  4KT0 E;  4MML A;  3J80 E;  1YHQ A;  1N9R A;  1VQ9 A;  2HD0 A;  2X4X A;  2E5Q A;  3QO3 A;  5GMK e;  1Q82 U;  1G3S A;  3M9Q A;  4M7A F;  2QEX A;  3A8H B;  1UGR B;  4C92 E;  1N9S A;  5GAN g;  4J8O A;  3HPW A;  1VUB A;  1VQ4 T;  1NJI U;  1Y7X A;  3CMA T;  2XG8 D;  2EQK A;  3E1S A;  4C8Q C;  1YJW A;  4FT4 A;  3MET A;  4N0A A;  1QVP A;  4C8Q A;  1VQM A;  3S6W A;  1VQK T;  3HSB A;  4M7D G;  3L2Z A;  3OMG A;  5D6Y A;  2Y4X A;  3HRT A;  4BAC A;  4OB3 B;  2PU9 B;  2RB6 A;  5CQX A;  3UT1 A;  2DTH A;  5GAN 2;  4ZTF A;  3CC4 A;  4J6Y A;  4JLI A;  4E7I A;  4JLG A;  1S72 A;  1LOJ A;  5LJ3 e;  1XQH A;  4QQ6 A;  2KMT A;  2PUK B;  2X4Y A;  3SWN A;  2WSE E;  2OTJ T;  4M75 B;  1P92 A;  5FU7 C;  4FL6 A;  2O4X B;  4IKF A;  2E6Z A;  3UWN A;  3LGF A;  5A0G A;  3CCS T;  4PJO B;  2OAU A;  1VIE A;  5GAO l;  5I2S A;  1UEB A;  2F69 A;  3SDZ A;  4PNO A;  3HFO A;  3JCM h;  1K8A C;  1OYX A;  2L5Q A;  3JCM f;  4C92 D;  1OI1 A;  2QTX A;  4QQD A;  3CCU T;  4M7D C;  1U8R A;  3I55 A;  3Q1J A;  4M7D A;  2JNG A;  2FVU A;  5HKC A;  2P0P A;  2K4Y A;  3VKI A;  4FT2 A;  4BY6 C;  4RMO A;  1KG1 A;  2DXB A;  2JUF A;  2LRQ A;  5DY9 A;  4ZN1 A;  2EQJ A;  2XDP A;  2K3Y A;  3CCM A;  3JCM P;  3ME9 A;  1QW1 A;  1VQM T;  1W2B S;  4GLK A;  2CZ6 B;  3OS2 A;  3OYG A;  4E7J A;  2LTO A;  2VXF A;  5LJ3 g;  5CR2 A;  1M4Z A;  2D0Q B;  3JB9 F;  1RI0 A;  2YLB A;  3PNW C;  2DK3 A;  3OY9 A;  3PMI A;  1LNX A;  2GF7 A;  2Y4Y A;  4MZP A;  3E9G A;  5M9O A;  3JB9 I;  1M1K C;  3V7S A;  4M77 F;  2KSS A;  5LJ5 j;  4QQG A;  3CMA A;  1VQ4 A;  4EDU A;  1QP3 A;  2K5I A;  4M77 B;  4Y28 E;  3LH0 A;  4A4F A;  4L6V 5;  3UPU A;  2PQW A;  4JRQ A;  3SD4 A;  3CCR T;  5KCO A;  4M75 G;  2GFU A;  2WAC A;  1FX7 A;  3M55 A;  5CVI A;  1QVF A;  2XHC A;  3G6E T;  3QUI A;  2LDM A;  4BDY A;  3S3O A;  2V8K A;  4PJO G;  3JCM d;  4NS5 A;  4ATO A;  3OBW A;  1YIJ A;  5KCH A;  2OTJ A;  3HP9 A;  2AHJ B;  3JCM X;  3PFS A;  4B9W A;  3OS5 A;  4BUG A;  4F7U F;  1NE8 A;  5GAN 3;  2QA4 A;  3VJP A;  1WQ7 A;  2RJC A;  4JS4 A;  3MP8 A;  1KHI A;  5C6S A;  1UGP B;  4OF1 A;  3CCS A;  1UB4 A;  3AHU A;  1Q81 U;  1WNL A;  2EYQ A;  4M78 C;  4C8Q F;  2X35 A;  2QDY B;  3CCQ T;  1GXI E;  3VV0 A;  2JVV A;  4C0D C;  3QII A;  3FEO A;  4X34 A;  2E1H A;  3LWI A;  2MAM A;  1M1F A;  5L8R E;  2DTI A;  1N8R U;  3LX7 A;  3N5B B;  4PKC C;  1M90 C;  3LYI A;  2ZPG B;  3QXE B;  4LDV A;  4M75 A;  4X9D A;  4M7D D;  2LQ8 A;  1YHQ T;  2RHU A;  3OSS C;  4X9C A;  3JB9 G;  3JCM e;  2O4X A;  5FRN A;  4IUU A;  4CRI A;  4UC4 A;  4O5V A;  4PJO A;  3LW5 E;  4OB2 B;  4EMH A;  1UGQ B;  4OP0 A;  4M77 G;  1NZ9 A;  4OMF B;  5FU7 B;  5GAN 8;  1YJW T;  3CCL T;  3DB4 A;  4OB1 B;  2V8J A;  3RMS A;  5FRO A;  5GAN 5;  2VXE A;  4JRI A;  3WVD B;  2QQB A;  4ELY C;  5A0L A;  5HK0 A;  5GAM j;  1LJO A;  5CKB A;  2QQA A;  2RHX A;  2P0Q A;  4LDY A;  2ZPE B;  2LNV A;  3HHT B;  4OVA A;  2HQE A;  3WVE B;  4CI0 C;  4C5E A;  1VQO T;  1YI2 T;  1QVG S;  1PSF A;  2DJZ A;  2YRV A;  5GAN 6;  1DJ7 B;  5HK3 A;  3CC7 A;  3A8L B;  4JS5 A;  3X28 B;  1S72 T;  4M7D F;  2XDD A;  2OTL T;  1BYM A;  4RKU E;  4J7F A;  4XTV A;  3PT9 A;  5KE2 A;  2JTM A;  3VYG A;  2XK0 A;  2E10 A;  2VC8 A;  4F7U G;  3G6E A;  3G71 T;  1VQL T;  2ZCF B;  1XTD A;  2RJE A;  2DXU A;  3JCM g;  2IG0 A;  2E64 A;  4LDX A;  1BI0 A;  3VU3 C;  4M7A D;  1Y71 A;  2ZPI B;  4M77 A;  1BI3 A;  5IAY A;  2EIF A;  2A3L A;  3CCE A;  3QJ6 A;  3S3M A;  3OSV A;  3I55 T;  4R56 A;  3JCM J;  4XU0 A;  4HA8 A;  3FIF A;  2K2V A;  3EFR A;  3GF5 A;  2K3X A;  4IUP A;  1KC8 U;  1WJQ A;  1WJR A;  3M57 A;  5CKF A;  5GAN j;  1M8V A;  3M54 A;  4B9X A;  1YBY A;  4N4I A;  1VQ6 T;  4M75 D;  1VQ7 T;  2IVW A;  5EG2 A;  4FSX A;  4F7U A;  5LJ5 h;  5AYF A;  2JTF A;  2CYZ B;  2RM4 A;  4ZGD B;  1W4S A;  1K9M U;  4PJO D;  2FB7 A;  2X4J A;  4ELZ C;  3CCL A;  2X4W A;  3X25 B;  1H3Z A;  1WGS A;  4KUI A;  3JRZ A;  3UDC A;  4C0Z A;  3CCV A;  3M53 A;  1Q82 C;  4M78 F;  4Q5W A;  1YI2 A;  1VQO A;  2L89 A;  2KAF A;  4M78 B;  2HQX A;  3P8B B;  4M7D E;  1G3T A;  2DXC A;  4C0D B;  1XNI A;  4M75 F;  5GMK j;  4RG8 A;  1YIJ T;  1NJI C;  3GNF B;  2OTL A;  2DIQ A;  4A4E A;  5GAO r;  3BW1 A;  4XU3 A;  3R6O A;  4C5H A;  3G71 A;  3MHX A;  4PJO F;  2QA4 T;  1VQL A;  2P4T A;  4HCZ A;  1Q7Y C;  2RI5 A;  3JB9 D;  4DQ2 A;  4L59 A;  4MZT A;  5GMK i;  3TU4 K;  4EPC A;  2ZZD A;  5IN1 A;  4BI4 A;  4M77 D;  4DA4 A;  3OYL A;  1VQ8 T;  3A8G B;  3M59 A;  1MHN A;  3DB3 A;  5LJ5 d;  5GAO n;  4ZTJ A;  3LLR A;  5CKH A;  4HCB A;  3LWH A;  2DKG A;  2DEQ A;  4LD6 A;  3RKW A;  4BB7 A;  4YTL A;  1FWZ A;  3ER0 A;  2E41 A;  3M56 A;  5GAM h;  1O9S A;  1QP2 A;  1U1T A;  3CME T;  1VQ6 A;  3C94 A;  1VQ7 A;  4HT9 A;  3MP1 A;  2BUD A;  2GFA A;  2KY9 A;  1SSF A;  4M7A E;  4II1 A;  3SFM A;  4MDX A;  4E7L A;  2RHY A;  3M4Y A;  2F5K A;  3NFC A;  3ZFJ A;  4EMK B;  4M78 G;  3C12 A;  4PLL A;  2FYK A;  4WF2 A;  3GIB A;  4XTZ A;  4XTW A;  5GAO q;  3OYY A;  3RIR A;  5CK9 A;  3CCV T;  1N6A A;  2PVD B;  3CC7 T;  3BDL A;  4C8Q D;  4LD9 K;  1MGQ A;  3DLL A;  3A8M B;  4J6W A;  3OYD A;  4OB0 B;  1FXX A;  2LT1 A;  4ZGE B;  2EAY A;  4NL2 A;  3GLX A;  4N4G A;  2LT4 A;  3CC2 T;  2YHT A;  1NPP A;  4M75 E;  3CXC A;  3I56 T;  1X6O A;  5GAN 4;  3OYA A;  1BKB A;  1G3Y A;  2R5M A;  3CCJ T;  2DD4 A;  2DAQ A;  3OYB A;  2B8A A;  4PJO E;  3CCE T;  3QJY A;  2DO3 A;  2XI9 A;  1G3W A;  3INZ A;  1BI2 A;  4C92 B;  2XU8 A;  1X01 A;  3DLM A;  5GAN h;  2EJ9 A;  4M78 A;  3MEA A;  2Y90 A;  4XU2 A;  3JB9 J;  5GAM d;  3QG1 A;  3H8Z A;  3JCM W;  1VQ8 A;  2LX9 A;  2LQK A;  2EJG A;  2DVE A;  3F70 A;  4N4H A;  3M4G A;  3MO8 A;  3RMQ A;  3OYI A;  3KUF A;  3X24 B;  4C5G A;  3M58 A;  3S3N A;  1Q86 C;  2CKK A;  5CKE A;  3HRU A;  2R58 A;  2D6F A;  1YJN T;  1M1G A;  3V8L A;  1ZQ1 A;  4BE1 A;  2KDS A;  4MDW A;  2CGH A;  2VYT A;  3NTK A;  3OYK A;  4KBM B;  3CME A;  3V8K A;  3ZBD A;  1YIT A;  1VQP T;  2K5L A;  3L2W A;  1N8R C;  2EFI A;  2WSF E;  4JDS A;  2DXT A;  4KUD K;  2MMP A;  3JB9 H;  3QZ9 B;  2MWP A;  4IUV A;  4A54 A;  4M77 E;  1KQS A;  5GMK h;  4DOW A;  2DZC A;  5DLQ E;  5CIU A;  4BDZ A;  4P5N A;  2DZ9 A;  1Y96 B;  4A4H A;  3J7A F;  3H6Z A;  3L42 A;  5KH6 A;  4HCC A;  2RHI A;  3CCU A;  5CAI A;  3E9F A;  3FJP A;  4QVZ A;  1D3B B;  3JCM c;  3CPW A;  4XK8 E;  3PTA A;  5GAN d;  4BE0 A;  1KD1 U;  3CC2 A;  1PSE A;  2ZPB B;  3A5Z B;  4VUB A;  3RKX A;  1JJ2 A;  4EMK C;  3I56 A;  1WJS A;  3QHS A;  3OYH A;  2EQU A;  2QQS A;  3DKM A;  4EMK A;  3OA6 A;  3CCJ A;  4F7U E;  3E19 A;  2LVM A;  3OQ5 A;  1JB0 E;  3L2V A;  3BFM A;  4C0F A;  4BI8 B;  4PLI A;  3A8O B;  2M0O A;  2ZPH B;  4QVC A;  1M9S A;  2H3J A;  1IRE B;  4C8Q E;  1VQ5 T;  3VUZ A;  2XIC A;  2F5T X;  3QSU A;  4V2S A;  1OZ3 A;  4JRK A;  4M78 D;  1HXD A;  5CKD A;  5HY6 A;  2XD0 A;  1HK9 A;  1BI1 A;  4XQ3 A;  5GMK m;  4RCB A;  3GP8 A;  4KUL A;  5FU6 B;  5GAN 7;  4IUR A;  3MEV A;  3FLG A;  2PUO B;  1YJN A;  5D6X A;  5LJ5 f;  1QVF S;  3L1A A;  4C92 C;  1K73 U;  1KC8 C;  3L2U A;  3CXC S;  1VQP A;  4O6J A;  4A4G A;  3PGG A;  1I4K 1;  2GQV A;  1BIA A;  4ZN3 A;  3G4S T;  3V8J A;  3JCM V;  3OW2 A;  2VGM A;  2VUB A;  3HL8 A;  2CZ1 B;  4FM4 B;  4E7K A;  2D9T A;  3FC3 A;  2MWO A;  2RD1 A;  2VV5 A;  3OS0 A;  3V7R A;  1K9M C;  2KVQ G;  2XDB A;  3P8H A;  3NTI A;  5IT9 E;  2FHD A;  2HNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...