5CQXA

E. coli mazf mutant e24a in complex with maze residues 68-82 form i
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
106
Chain Sequence
VSRYVPDMGDLIWVDFHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQEGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGLSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
total genus 22
structure length 106
sequence length 118
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cqxA00
5HK3A 5CKFA 5CKHA 5CO7A 5CQXA 4MZPA 1VUBA 2C06A 3NFCA 4ME7A 4HKEA 3G7ZA 1X75C 4OF1A 5CKBA 5CKDA 5CR2A 5CQYA 5DLOA 4MDXA 3VUBA 2VUBA 3JRZA 4MZMA 5CKEA 4MZTA 4ELYC 2KMTA 5CK9A 4VUBA 5HKCA 3TCJA 5HK0A 4ELZC 3JSCA 1M1FA 1UB4A 5CCAA 2MF2A 3HPWA 1NE8A
chains in the Genus database with same CATH superfamily
3CQTA 2RK2A 4C8QB 1QCOA 2ATCB 2E70A 2AIRB 2EQKA 3HRSA 3L2UA 1VQ8Q 2J7IA 1VYVA 1ABQA 1YJWA 1QLYA 4DBQA 7AT1B 2QA4Q 5D6YA 4FSXA 3QYGB 4ELZC 1D0XA 3CCQT 3CCMQ 4FYVB 5M9OA 1U06A 2DL8A 2LQNA 1R0BG 3M5AA 1KG1A 1TOVA 4M77B 4HCZA 1TS9A 1OU8A 3DLLA 5D6WA 2LNVA 3MJXA 1VQ7Q 1I81A 3OMGA 3GF5A 4CC7A 1WHHA 2DNUA 5GJVB 3NPFA 2ZCFB 4F7UE 2EQIA 3EFOA 2CH4W 3VYGA 3MEWA 3SD4A 1QP2A 2HKQB 4EMGA 2R57A 1ZUKA 2JW4A 2VC8A 1TSFA 4D8KA 2RI2A 1PCXA 3E9GA 2PVOB 1WLPB 2X4YA 5AT1B 1LPLA 4QQDA 4IUVA 1MNEA 5GMKe 3H6ZA 4LUEA 3SWNC 1YJNT 3CCLA 2DRMA 4J83A 2LDMA 1JJ2S 2YUQA 4FT4A 4M7DG 4XTWA 4HVVA 4WTOB 1G3WA 3MO8A 1TH7A 4ATOA 1KIKA 1YJ9A 4M7AF 3M0SA 1Q81R 2XG8D 4LNPA 3OBWA 4ZGJB 4BUGA 5FLXE 3MEVA 4N4GA 4AFQC 2QK0A 1JO8A 1RAEB 1VQOT 4RMOA 1WHJA 4J9BA 4VUBA 5GAMg 3UF4A 2KY9A 5HY6A 1PHTA 2RI3A 2L5QA 5GAN5 2CYZB 1ZX6A 2DD5A 2K5LA 3CPWP 1RLQC 2D8JA 2HKNA 4KUDK 1S72T 2RQTA 2OTLT 1WFWA 3PGGA 4Y28E 1W4SA 2LC4A 5GAMh 4OMNA 2ZAEA 3OW2P 2HEQA 2E4HA 5IH2A 5DY9A 2A08A 4IKFA 3AHUA 3UWNA 2P0QA 2FZKB 5C6SA 2DEUA 2FRYA 2O2OA 2YUPA 4RG2A 2DA9A 2HL5C 4HCBA 3CXCA 3CCVT 3M58A 1K9AA 4L5GA 4OMQA 3RESA 1T0HA 2BTTA 2M9UA 2F69A 4KRTA 4HVUA 4KH0B 3S3NA 1D09B 3X26B 1YBYA 2PUOB 4M75F 3RERA 5GAOq 4M7AB 1Y57A 3UT1A 1QVGS 2WSCE 3QWXX 2Y90A 3A8GB 4EDUA 3L42A 1QQJA 1YCYA 2MMPA 1ZBXA 1D1CA 5GAOm 3FJ5A 2DJQA 4C0DC 4J9FA 1QVFA 1FWZA 4OMMA 4M7DC 3JB9G 5CVIA 1VQ6A 4LXCA 3OSVA 2E5KA 3VS4A 1VQ8T 3M9QA 1GFDA 1ZSZA 3HFNA 1M90U 2V1RA 2QA4T 3PNWC 4MMLA 3S3OA 2F1LA 2L3RA 3JCMW 3CMEQ 1YIJQ 3ULRB 3L2WA 2ED1A 3CCMT 5LJ3e 3ME9A 5FU6B 2X4JA 2E6NA 1VQ9T 2DM1A 3MP6A 4C8QA 2E5QA 3I55A 2FHDA 3KXTA 5IXBA 4R55A 2AKKA 4CC3A 4JDSA 5IHNA 1AWWA 1FYNA 1VQ7T 4F7UF 1EZZB 5FWCA 1UDLA 2Y4YA 3OYDA 3LYIA 1IGQA 1CSKA 3VRZA 1KQ1A 1W2BA 4M75B 3OMCA 3OYCA 5GMKl 4M7DD 3NHNA 2PZ1A 4FU6A 3M53A 5FU7B 4M77A 3FB9A 2QGFB 5DLOA 1K0XA 1QCFA 3OYMA 3DB3A 1UECA 3A8OB 4RTXA 2CP7A 4M78E 4XTZA 2QQ9A 3M0TA 3OS1A 4C8QE 1PWTA 1TWBA 3CCSA 1UB4A 3HPWA 2EIFA 5GAN8 4RUGA 2CDTA 1K9MC 3GLXA 4NS5A 4JRQA 3CCUQ 1VQNT 3QUIA 5CR2A 3ZL7C 1TUGB 4ANJA 4BACA 2RPNA 3HFOA 2K5IA 1GBQA 1I07A 3JCMQ 1WJSA 1UGQB 2LX9A 3CCEA 1D3BA 1Q7YR 4M77E 2RHYA 3VS1A 5FWBA 3G71A 4JUVA 2ABLA 1Q82C 4II1A 4XU1A 3I5RA 2MYSA 5GAOp 4LDYA 4E2FB 4F7UB 3OYHA 1YI2T 3QYHB 1Y7XA 3I56A 1XQHA 2X51A 1NYGA 2MI6A 3LWIA 4RTUA 4RCCA 3G6EA 2X9HA 5KYWB 3JCMV 1UE9A 3TVTA 1G83A 2X35A 3M4YA 1UGPB 4J9EA 3FRNA 3CCRQ 1I5OB 3JB9J 4JLIA 3FC3A 3C4SA 1QP3A 2RA2A 3M0PA 2JTEA 4Z8AA 2D1XA 4OB2B 1OU9A 4GLMA 5GAMd 2KRSA 4QVZA 1M9SA 1U8RA 1JU5C 1VOMA 2ZPHB 2JOYA 4J7IA 3JB9D 1N8RC 1MMNA 1FX7A 2PVGB 3CPFA 1TG0A 2QDLA 1UHFA 2PTKA 3EFOB 4CRIA 3SHWA 3QDRB 3RMQA 1BI1A 1OX8A 4KH1B 2LCLA 5FROA 1E7OA 3CD6A 3TQ7P 4OB0B 1YITQ 1YHQQ 2GFAA 2ZPBB 5IT9E 4LDVA 4D6WA 1BBZA 2CZ7B 2DVEA 2HCKA 4E47A 2HSEB 4V2SA 5I2MA 2MWOA 3GP8A 2O4XA 1SKUB 2R5MA 1W70A 2XD0A 2RHUA 2DBKA 3JCMc 3CMAT 4PNOA 3R6NA 1MHNA 2LJ1A 2ZPGB 1JRIA 4IURA 1CKAA 1EIFA 3A8HB 2QDYB 5GAN2 1YFNA 1M1KC 2C0IA 3CC2A 1MMAA 5D7UA 1OPKA 1B34A 3EG9A 2VV5A 1YIJT 2K2MA 2DEQA 2LQKA 1MGQA 1QVFS 3MP8A 4RTWA 1I0CA 1WQWA 3UA6A 3J80E 4A4KA 4D8DA 1K4US 2YWWA 4QVDA 2MIOA 3L2ZA 3FLGA 2CUBA 2Z0WA 3F70A 5GAMf 2W10A 2M02A 3JAME 4BY6C 4FYXB 3TU4K 3EFSA 4MZTA 2CT4A 1VQMT 1HSQA 3MPUB 2F2WA 3JSCA 3OQ5A 4C5HA 3GPLA 2VB6A 5ECAA 2CP3A 2CZ1B 1VQ4A 2FEIA 1MV3A 4M78F 5FW9A 1G5VA 4C8QF 2DERA 4IUUA 1V1CA 2D0QB 1W2BS 1X6BA 2QQRA 2XDPA 2LRQA 1V29B 4ELYC 4M78D 3LW5E 2B8AA 1ZUYA 4WF2A 1IZ6A 2F2XA 2DZCA 2EGCA 3L1AA 1FMVA 1KFZA 3CCUT 4X9CA 2KXCA 1PG5B 1WNLA 3GBQA 3VS5A 2EYZA 3OA6A 1C1AA 4X1VA 3CCLQ 2AK5A 2Y4XA 1FMKA 3V8LA 4M77F 1Y71A 2D0NA 1SRLA 4XAXB 2CGHA 1U1TA 2K6DA 4LN2A 1UFFA 2RHZA 3G4ST 2LQ8A 1T3LA 1KC8R 4EMKC 1P92A 4BB7A 3OS0A 3PTAA 3CCQA 4PLIA 2K3YA 4N0AA 4ZN3A 2EQUA 2GCXA 2PUKB 3KBGA 2DZ9A 3CC7Q 1WPYA 3CCRT 3CPWA 2K9GA 2H3EB 4PLLA 2BZ8A 2DLPA 1CKBA 2E10A 4M78B 1KD1U 5CKHA 4M7DA 3OW2A 4F7UA 4KULA 3OY9A 4KGXB 1WXBA 2L89A 3MP1A 4OMPA 4PFZA 2FB7A 2YLCA 2ROTA 2RMOA 3ER0A 5KYWA 1RI9A 3BDLA 1PM3A 2P0PA 2A3LA 1U3OA 4XTUA 2RD1A 4BY6B 1M1FA 5GANg 3E2UA 4DEYA 1Z9ZA 2YUNA 1YHQT 2O9VA 4LD6A 1V76A 2DTIA 1WHGA 3LGFA 1XNIA 3JRZA 4OMFB 4IUPA 4J6XA 1MNDA 4C5GA 1JJ2P 5GANh 1GCQA 5L23A 3LLRA 3GNFB 1K73C 4F16A 2IIMA 1UG1A 4M7DE 2DF6A 2NWMA 5GAN6 3FEOA 1NEGA 4X9DA 2QG9B 3C94A 2JNGA 1YJNA 5GAMj 5D6XA 3JCMP 2BZXA 2VUBA 3NTHA 3E1SA 1F1BB 1AT1B 4PJOG 3EG1A 2VXEA 4C0ZA 2EPDA 3VS6A 3VS2A 1AOJA 3BW1A 2O31A 1VQLT 4QVCA 1JXOA 1B3QA 2RQRA 3VS3A 1VQOA 3RIRA 3EH2A 1I8FA 1YWPA 1D3BB 4IUQA 1RABB 4JZ3A 2EQMA 2DJZA 4UC4A 4IUTA 3FIFA 3LX7A 1WDXA 2EJGA 3I55Q 1WJQA 1S72A 2OTLA 2KAFA 1BB9A 2P4TA 1BIBA 2XK0A 4F14A 5KYXA 2DL3A 1YCSB 4DOVA 1Y0MA 3H0IA 4N4IA 4JRIA 2MWPA 5DM7R 5LL6S 2IVWA 2JMCA 2RJFA 2GTJA 3I5SA 3CCVA 1DJ7B 1PD0A 5GAOr 1QVGP 2HQEA 1AWJA 1D0ZA 3M56A 3OSSC 1VQKA 3SDZA 4ME7A 1KQSA 1HXDA 3MEUA 2FRWA 2V1QA 3V8KA 4R0KA 4E7SA 2WACA 8ATCB 4RTYA 4LDWA 5FRMA 5KE3A 1ACMB 1PKSA 2QQBA 2LJ3A 2LMJA 3CCSQ 2DIGA 2EAYA 4LUDA 1D1BA 1I5LA 3JCMJ 4Y92A 1H8KA 3VU3C 1Q7YU 1KD1R 3BE3A 2ECZA 2AT1B 3QBYA 4JRKA 1RACB 2O4XB 3PIPA 4MDXA 3C0CA 2DXUA 4PJOC 2F2VA 2JM8A 3R6OA 2A36A 3CCEQ 1VQ8A 5KCHA 4FL6A 2X4XA 1NJIR 2QA4A 3A98A 3G71Q 2KNBB 4E7LA 2BE9B 1Q86C 4HT9A 4MZPA 1YNZA 2HZYA 4KGZB 3CCJT 2RJDA 3CCMA 4A4HA 2HDAA 3NMZC 1VQ9A 3PIOA 3CC7T 2IG0A 1B34B 3EG9B 2YHTA 1S1NA 2DFUA 1EFNA 2M16A 5GAN7 4XTVA 4JJCA 3X20B 5GAOn 3ASKA 3RUXA 3S6WA 3JCMd 3DKMA 1VQ7A 1TU0B 2RNAA 3JB9H 4QW2A 1N9RA 2L8DA 1ZQ1A 3SWNB 2E41A 4FW1A 5CKBA 4BDZA 2CUDA 4C92G 3CC4Q 2COWA 4PJOD 2CZ0B 1RAHB 4ORZA 4M78A 4E7HA 1KQ2A 3OW2S 2M0YA 3UDCA 2DKGA 2HQXA 3EGDA 3CD6Q 3U23A 3VS7A 1M5Q1 2KK4A 3OS2A 3S3MA 3HTRA 2RQWA 4C0FA 1O9SA 1PRLC 4M7DF 5GANd 2LNHB 1VQNA 3RMSA 2QQAA 1WI7A 3QKJA 1RL2A 1R0CB 4KGVB 3C12A 2EGAA 2DIQA 3L2VA 2M0OA 1VQPQ 3G7ZA 4DEXA 2CKKA 1U5SA 3ZEHA 2KDSA 3EGXB 2EJFA 4QQ6A 4DBFA 2K7AA 2JTFA 3O5ZA 5LJ5d 3GNGA 2DL7A 1YI2A 1BIAA 3QG1A 3CC2Q 4AG2C 3VYHB 5I11A 3P8HA 4J8OA 3VRYA 3E9FA 3UATA 4QKUA 1B7TA 2MAMA 1N9SA 4RG8A 2RHIA 4HCKA 2YDLA 1BCOA 2COYA 3EG0A 3JCMf 2RB6A 4LD9K 2EBPA 2DO3A 4JJDA 4AMCA 1X6OA 2RM4A 4J9IA 4XU3A 2KYBA 5KCOA 1BI0A 2J6OA 2KI7A 2VXFA 2K2VA 5KYYB 2DMOA 2KRNA 4C0DB 1GL5A 3GOXA 2I0NA 1QKWA 4M7DB 4A63B 4C92C 1OPLA 4FM4B 3RKXA 4ZNXA 1M2VB 5C0MA 3TREA 2LP5A 4EPCA 5IXFA 1WXTA 2RN8A 3O8VA 1EX4A 2VGNA 1GRIA 1X01A 2DPPB 4FSSA 4DA4A 2OTJQ 2EQJA 3META 1I4K1 3M0UA 2K5FA 1BK2A 5GANf 3J7AF 1K0SA 1IREB 1M3BA 2MCNA 1BI3A 2XICA 1M8VA 3JB9F 3PVLA 5A0DA 2GFUA 1AHJB 1K8AC 4AG1C 2QEXQ 4FW2A 4KUIA 2DYBA 1ZBJA 2NLUA 1NLPC 2K79A 1AZGB 3CMAA 1J3TA 2RF0A 1KQSS 1LNXA 2JMAA 3QSUA 2GTOA 4JZ4A 2KSSA 2BZYA 2YSQA 1AVZC 1Q82U 3HSBA 2JJ9A 1UEBA 2F5TX 1QVFP 4E6RA 1KC8U 5LJ5f 1SPKA 5AYFA 4C92D 5CKEA 2AKLA 1VQ5Q 3OYKA 2XKOC 3I9QA 1WQ7A 2NUTA 1YIJA 4IIOA 5GAOl 2KE9A 4AFSC 3ZBDA 5GAMe 3CXCS 1O75A 1UUEA 3P8BB 2KEAA 3OYIA 2RJEA 3HKSA 3EG2A 4JPBW 1M4ZA 1X69A 3BY7A 2EYQA 2K3XA 3SB2A 3EH1A 1IXDA 1N6AA 2CREA 3EHQA 1M8MA 2DRKA 1M1GA 3SEMA 5GMKh 4FT2A 2A28A 1N8RU 2CP6A 1NE8A 2QTVA 4K11A 1SSHA 1VQMA 2KR3A 3CC4T 1W2BP 1JB0E 1K1ZA 2MPXC 1MUZA 5KYXB 1YJWQ 2RK1A 1D0YA 4PK4A 3CMET 3EHRA 2J06A 2DX1A 1G2BA 2COZA 4C92B 2JN0A 2HSPA 2ZGWA 4OP0A 4ZTJA 4E7IA 3SWNA 2EYWA 4HCCA 2KVQG 5A0GA 2QXFA 3QXEB 4WCIA 3V8JA 2FL7A 4C0GA 6AT1B 2ROLA 4Y91A 2M51A 2QASA 1H3ZA 5A0LA 1FMWA 4PFOA 2R58A 2GF7A 3NTKA 2HD0A 3FJPA 4J6YA 4ZGDB 4J7FA 1WXUA 1AEYA 2F5KA 5DLQE 1PRMC 1VQPT 3H0HA 1QKXA 1M27C 2RI5A 3VS0A 1MV0B 1I1JA 3OYFA 1Q81C 3H8ZA 1UTIA 1LOJA 3NTIA 4DQ2A 5A2QE 3H41A 2XDDA 4ZN1A 2I2LA 1C6VX 3G4SA 1HD3A 2ZPIB 3REBB 1VQOQ 2QQSA 3ZFJA 3BFMA 5CIUA 4XU2A 1Z9QA 3QJYA 1QWFA 4P5NA 4O6JA 3CCRA 2IPOB 1X2KA 2FG0A 1K9MR 4CC2A 3EGXA 5GANj 1ZSGA 4BI4A 1KHIA 9ATCB 2X4WA 2CSQA 4AFUC 1S72Q 4O5VA 4FYWB 4JS4A 1LVKA 4PJOA 4AFZC 2GNCA 4XTYA 3VJPA 1YJ9Q 2EJ9A 2G3RA 1Q82R 3JCMg 5LJ5j 1KK7A 3VUBA 2MK5A 1QVGA 2DE0X 2VWFA 4FYYB 2JS2A 5LJ3g 2J6FA 1VYUA 1QWEA 1UJ0A 1WHLA 2KMTA 2QYZA 3EFRA 3EG3A 1YHQA 1T0JA 3D7SB 2OTJT 2X3XD 4M7AG 5KYYA 1VQKQ 3JCMh 2LX7A 3L2RA 2LCCA 5KYUB 2ENMA 2V26A 3M4GA 3PE0A 1RLPC 2WSFE 1A0NB 5LJ3h 4XQ3A 1Y96B 4IIMA 3UA7A 3EGDB 2QEXT 1RADB 2OX7A 4RKUE 2LJ0A 1M2VA 1JXMA 1RUWA 2JM9A 1NYFA 4PJMA 2PNIA 4PJOE 1H641 3OBYA 3H9NA 1X2QA 4L59A 3A8MB 5HCKA 2RJCA 1SSFA 4RTZA 1G3YA 1VA7A 1NJIU 3HHTB 4BD3A 2OI3A 2MF2A 1N8RR 5CKFA 4OVAA 3JCMX 1OEBA 3T9NA 3M0QA 3CBOA 3X25B 3KFVA 1YITT 1X75C 2VVKA 3OYEA 1VQ5T 3VV0A 1VQLA 2DXCA 1NBEB 3QDFA 1HYOA 1WHKA 1R8OB 3MHXA 2LTOA 2L3QA 2EYXA 3G1JA 3M59A 2FZGB 5LJ5g 1VQ9Q 1R77A 2P0KA 4MDWA 4JRPA 3RR6A 2XIDA 4HKEA 1NPRA 1WA7A 5I22A 3JV3A 1RAAB 3GIBA 4M75G 4GLKA 2EKOA 1OQKA 5LJ5h 2DXBA 3QHSA 2YRDA 2HQHA 2A7YA 4OB1B 1VQ6Q 5CCAA 2JT4A 4ZTFA 2L2PA 3MEAA 1YJWT 2EYYA 2RQVA 1M1KR 2K3BA 1OZ2A 3THKA 3TSZA 1AD5A 1IB8A 3PT9A 2HBPA 5GMKm 4M7AC 1TTHB 4PJNA 1K73U 2CSIA 4EMKB 1GBRA 2E12A 4HT8A 1ARKA 4PFPA 2E3IA 5J26A 1NPPA 3OYGA 2QAZA 1OV3A 3URGA 3OYLA 3RKYA 5FRNA 4J9CA 1VQNQ 1H92A 1SRMA 1SEMA 4C92A 1B07A 2HMAA 3PMIA 4XK8E 3JCMb 2G6FX 4C5EA 3QJ6A 1VYTA 1Q7YC 2CS7A 4F7UG 2P4RA 1RAFB 1VIFA 2EWNA 4JS5A 2RO0A 4F04B 2DAQA 1C0MA 5IAYA 1PKTA 1UGSB 2DK3A 2JTMA 1JBMA 4OF1A 5FU6C 2E3HA 2JXBA 3WXMB 2EGEA 2FPEA 3EAEA 3OYBA 1YI2Q 4J9HA 3LH0A 3V7SA 2O88A 3CCJA 1X43A 4E7JA 1BCMA 1WX6A 2A37A 4R56A 2X3WD 2DTHA 3QWYA 3HL8A 4M7AD 2KROA 3CC7A 3OB9A 2NUPB 4E7ZA 2VASA 2OJ2A 2NUTB 2GGRA 2E1HA 4HXJA 4DBHA 3CCLT 1QW1A 2H3JA 4M75C 4C92E 1XOVA 1ZA1B 2EVRA 3BDUA 2ZPEB 3OS5A 1PNJA 2B86A 4LE9A 5FU7C 1YJ9T 1IRXA 3MKDA 3TEEA 2P84A 2OAUA 2HAXA 2C06A 2GBQA 1SF9A 3I56Q 1LCKA 1M90C 3G6EQ 2LT1A 1WYXA 1VQKT 4BI3A 1IHVA 3UPUA 1SHGA 2V8JA 3QIIA 4FIBA 2VYTA 1MMDA 3X28B 4A4EA 1NEBA 2V8KA 4PKCC 4OGEA 2JUFA 2BIVA 4PJOF 1Q95G 3QZ5B 2PVDB 5LJ3d 4N0AC 1UGRB 4HA8A 1Y07A 1D1AA 2CT3A 3C95A 1HJDA 5EG2A 3PVQA 4M75D 3DLMA 3CPWS 4MMKA 3CMAQ 5EC7A 1KSWA 4KT0E 2QI2A 5KYUA 1Q86U 3RKWA 1Y96A 3JB9I 4J6WA 1VUBA 2DILA 4LDUA 2E64A 3RNJA 1M3CA 4J9DA 2LQWA 4OMOA 2ZZDA 4DOWA 3JCMe 2QTXA 2SRCA 3OYAA 2DTOA 1NLOC 4YTLA 3A8LB 4HVWA 1K73R 2DYIA 4GBQA 3P8DA 4PJLA 3M57A 2O9SA 2AHJB 3FDRA 2V8IA 3LH5A 2O01E 1W1FA 3HRTA 3VUZA 2EKHA 1GCQC 4JLGA 4B9XA 5J3BA 3KUFA 2H8HA 4C5IA 3J81E 1VQ6T 1ZLMA 3QZ9B 1RAGB 1GCPA 8AT1B 2LCSA 1WIEA 2ZPFB 2K57A 1QVPA 4XU0A 4PJOB 1VQMQ 2VGMA 2XMFA 4ZGEB 3A1PA 1PSFA 2K4YA 4X34A 2CH4A 5GANe 5GAN4 4BE2A 1M30A 3I55T 2JVVA 2VKNA 1KQSP 4EIKA 1BYMA 3PMTA 2QGGA 5LJ3f 1E6GA 2BUDA 1NM7A 2C0OA 2KGTA 3DB4A 2NYSA 2XDBA 2A0FB 4FCYA 4Z02A 1SHFA 2JZ2A 5LJ5e 5GMKi 3L2QA 2CP5A 2PU9B 4CI0C 3IQLA 2ESWA 4JJBA 3QO3A 3OYNA 2W0ZA 3M0RA 5GMKj 4EMKA 2XU8A 1G8XA 2M1HA 3CBMA 1RAIB 4ESRA 4A54A 3CXCP 3MCAB 1XTDA 1VQ4Q 1AWOA 1QCNA 4Q5WA 3HRUA 3EGUA 3INZA 5CO7A 5GAN3 1X27A 4A53A 4TVRA 3LGLA 1KC8C 4J5YA 4E7KA 1K9MU 2FYKA 1ZA2B 1TUCA 2KXDA 3CBPA 5CQYA 3G4SQ 3CEYA 3CCST 2ED0A 2BKDN 2YUOA 1IHWA 2J05A 2KBTA 4M78G 1YP5A 4AT1B 1GFCA 2KRMA 1PC0A 4C8QG 1OOTA 2MOXA 1OI1A 1H3HA 2PQWA 1W6XA 4C92F 1K76A 4EMHA 2YRVA 1OULA 3A5ZB 5L8RE 1JEGA 1M2OA 3NGPA 3CCET 2EFIA 4XTXA 2XI9A 1G3SA 5IHKA 1SG5A 1E6HA 2LVMA 4CC4B 1AWXA 2WSEE 3G71T 3CC4A 2XHCA 2FPDA 5HKCA 2NUPA 3CMEA 3WVEB 1Q86R 3I56T 5IHIA 4M77G 3CCQQ 1OYXA 2CP2A 3G6ET 1ZUUA 1M90R 2E6ZA 3RDVA 2KYMA 1PSEA 4F17A 4OB3B 2D8HA 1LJOA 4A4FA 2L0AA 2CP0A 1K8AU 2AZVA 3VKIA 4BE1A 4KBMB 5I21A 3N5BB 2C0TA 4NOYA 1NG2A 2JS0A 2BE7D 3AT1B 2KQWA 4RCBA 1N5ZA 2NUZA 1UJYA 2KT8A 1X6GA 1YN8A 1FXXA 3M55A 2DL4A 1VQPA 1IGUA 3QPHA 4RTVA 4BDYA 1MMGA 3E19A 4BE0A 2SEMA 4B9WA 2YRCA 3CD6T 5IN1A 4M7AA 4N4HA 5HK3A 4GY5A 1ZSZC 4OMLA 1JJ2A 1VQLQ 2AZSA 1NZ9A 3OYJA 1WJRA 2LT4A 3H0FA 2J6KA 4M78C 3CCUA 2GQIA 4C8QC 5CK9A 2GQVA 1JQQA 1UHCA 3TCJA 3I35A 4A4GA 5LJ3j 4PJJA 1YJNQ 5KH6A 1KJWA 5I2SA 2DD4A 2E65A 4OGCA 1RI0A 1M3AA 4JJNK 1M1KU 2DETA 1AZEA 5KE2A 2FPFA 4QQGA 5J39A 2DBMA 5GJWB 4BI8B 3OYYA 2D9TA 3CC2T 1ABOA 4M7AE 4L6V5 1WZOA 1U1SA 1GXIE 4M77C 1OZ3A 2RH2A 5CQXA 2OTJA 3HP9A 5CAIA 2L3SA 3SFMA 1WHMA 4MZMA 1VIEA 5KYNA 2HNIA 4PL6A 3X24B 2DVJA 1YWOA 4M75A 2OTLQ 3RBBB 2QEXA 4C8QD 4Z88A 1ZHIA 2LZ6B 2RHXA 1G3TA 1KD1C 3V7RA 4B6MA 2YXYA 2YT6A 2HBWA 1N27A 3NFCA 1WGSA 5CKDA 3WVDB 1Q81U 1BU1A 3V7CA 4NL3A 2YLBA 4NL2A 2OAWA 3CCVQ 1QMCA 1VQ4T 3M54A 4Z89A 2EW3A 1YITA 4RTTA 1NJIC 2DXTA 1VQ5A 5HK0A 1KHCA 4M4ZA 2FVUA 1XJWB 3PFSA 4M77D 4DBRA 2CZ6B 2L3PA 1TUDA 1OX9A 4LDXA 2DL5A 3Q1JA 3CCJQ 1TXQA 2RQUA 4M75E 1ZSZB 1PD1A 4J9GA 3REAB 2FZCB 1K8AR 1HK9A 3LWHA 1BI2A 2R5AA 2KT1A 4QT7A 1T3SA 1IO6A 1UGVA 2FO0A 2HL3A 1BKBA 3TSWA 2D6FA
chains in the Genus database with same CATH topology
2QDYB 5GAN2 2RK2A 4C8QB 1M1KC 3CC2A 2E70A 3P8HA 4J8OA 2E1HA 3CCLT 1B34A 1QW1A 3E9FA 2EQKA 2H3JA 2VV5A 4M75C 4C92E 1XOVA 2MAMA 3HRSA 3L2UA 1N9SA 4RG8A 2RHIA 1YIJT 2DEQA 2LQKA 1MGQA 3BDUA 2ZPEB 3MP8A 3OS5A 2RB6A 3JCMf 1YJWA 1QVFS 4LD9K 2DO3A 1X6OA 2RM4A 1WQWA 4XU3A 5D6YA 5FU7C 3J80E 1YJ9T 4FSXA 4A4KA 5KCOA 3QYGB 4ELZC 1BI0A 3CCQT 3TEEA 4QVDA 2VXFA 3L2ZA 2K2VA 5M9OA 3FLGA 4C0DB 2OAUA 2HAXA 3GOXA 2C06A 3F70A 5GAMf 4M7DB 1M90C 4C92C 3M5AA 1KG1A 4M77B 3JAME 4FM4B 4HCZA 3RKXA 4BY6C 3TU4K 5C0MA 2LT1A 3EFSA 4MZTA 3DLLA 5D6WA 3TREA 1VQKT 4BI3A 2LNVA 4EPCA 3UPUA 1VQMT 1I81A 2V8JA 3O8VA 3OMGA 3QIIA 4FIBA 2VYTA 3GF5A 3X28B 2VGNA 4A4EA 2ZCFB 3JSCA 3OQ5A 2V8KA 4PKCC 4C5HA 4F7UE 2DPPB 1X01A 4OGEA 2JUFA 4DA4A 3GPLA 3VYGA 3MEWA 2EQJA 2BIVA 3META 4PJOF 2CZ1B 1I4K1 1VQ4A 3SD4A 3QZ5B 4M78F 2PVDB 5LJ3d 4N0AC 1QP2A 1G5VA 2K5FA 5GANf 1UGRB 4HA8A 1Y07A 4C8QF 1IREB 3J7AF 4EMGA 1BI3A 2R57A 2XICA 3C95A 1M8VA 3JB9F 5A0DA 2GFUA 3PTAA 5EG2A 1AHJB 4IUUA 1K8AC 4M75D 2D0QB 3DLMA 3CPWS 1W2BS 4MMKA 2QQRA 2XDPA 2LRQA 4KUIA 1V29B 4ELYC 2VC8A 2NLUA 4M78D 4KT0E 2RI2A 3LW5E 2B8AA 2QI2A 4WF2A 1IZ6A 3CMAA 2DZCA 1Q86U 3L1AA 1KQSS 3E9GA 2PVOB 1LNXA 3QSUA 3RKWA 1Y96A 3CCUT 2X4YA 4X9CA 3JB9I 4J6WA 1VUBA 2KSSA 4QQDA 1WNLA 1Q82U 4LDUA 3HSBA 1UEBA 2F5TX 2E64A 1KC8U 5LJ5f 3OA6A 2ZZDA 4IUVA 4DOWA 5AYFA 2Y4XA 4C92D 3JCMe 5GMKe 2QTXA 5CKEA 3H6ZA 3V8LA 4M77F 3OYAA 2DTOA 3SWNC 1YJNT 4YTLA 3OYKA 1Y71A 2XKOC 3CCLA 3A8LB 4XAXB 4J83A 2CGHA 1U1TA 1WQ7A 2LDMA 1YIJA 1JJ2S 3S3MA 5GAOl 3P8DA 3M57A 4FT4A 4M7DG 4XTWA 2AHJB 3G6EA 1G3WA 3FDRA 3ZBDA 2RHZA 2V8IA 2O01E 1O75A 3MO8A 3HRTA 1TH7A 5GAMe 3CXCS 3G4ST 2LQ8A 3P8BB 4ATOA 1YJ9A 3OYIA 4M7AF 3VUZA 4JLGA 4EMKC 1P92A 2XG8D 2RJEA 3OBWA 3HKSA 4B9XA 4BB7A 3OS0A 4PLIA 1M4ZA 4BUGA 4ZGJB 5J3BA 5FLXE 2K3YA 3BY7A 3KUFA 2EYQA 3MEVA 4N0AA 4N4GA 4C5IA 2K3XA 3SB2A 4ZN3A 3J81E 1VQ6T 2EQUA 1VQOT 2GCXA 2PUKB 3QZ9B 4RMOA 3KBGA 2DZ9A 1N6AA 1WPYA 3CCRT 4VUBA 3CPWA 2ZPFB 1M1GA 5GAMg 2K57A 1QVPA 4PLLA 4XU0A 5GMKh 4FT2A 4PJOB 2VGMA 4ZGEB 2KY9A 1N8RU 1KD1U 2E10A 4M78B 1NE8A 5HY6A 5CKHA 1PSFA 4M7DA 3OW2A 2K4YA 2RI3A 4F7UA 2L5QA 5GAN5 1VQMA 2CYZB 2DD5A 2K5LA 4X34A 5GANe 1JB0E 3CC4T 4KULA 3OY9A 5GAN4 4KUDK 1S72T 4BE2A 2RK1A 2OTLT 3CMET 3PGGA 2L89A 3MP1A 1W4SA 2LC4A 4Y28E 5GAMh 3I55T 2FB7A 2YLCA 2JVVA 3ER0A 3BDLA 5DY9A 1BYMA 2P0PA 2JN0A 3PMTA 4C92B 2A3LA 4IKFA 5LJ3f 4XTUA 3UWNA 2ZGWA 2RD1A 4BY6B 4OP0A 3AHUA 4ZTJA 1M1FA 2P0QA 5GANg 4E7IA 2BUDA 3SWNA 5C6SA 4HCCA 3DB4A 2KVQG 4RG2A 2XDBA 4Z02A 5A0GA 2QXFA 3QXEB 3V8JA 2JZ2A 2FL7A 4C0GA 5GMKi 5LJ5e 4LD6A 3L2QA 2PU9B 4Y91A 1YHQT 4HCBA 3CXCA 2DTIA 4CI0C 3M58A 3CCVT 3LGFA 1XNIA 4L5GA 3RESA 3JRZA 1H3ZA 4OMFB 4IUPA 4J6XA 3QO3A 4C5GA 5A0LA 3OYNA 5GANh 2M9UA 5GMKj 4EMKA 2F69A 2XU8A 2R58A 2GF7A 3LLRA 3NTKA 2M1HA 3GNFB 3CBMA 2HD0A 3S3NA 1K73C 3FJPA 4J6YA 4A54A 4J7FA 3MCAB 1XTDA 4ZGDB 4M7DE 2F5KA 5DLQE 3X26B 5GAN6 3FEOA 1YBYA 2PUOB 4M75F 4Q5WA 4X9DA 3HRUA 1VQPT 5CO7A 3INZA 3RERA 3C94A 5GAN3 2JNGA 5GAOq 4A53A 1YJNA 4TVRA 4M7AB 3LGLA 3UT1A 2RI5A 1QVGS 1KC8C 2WSCE 4J5YA 2Y90A 5GAMj 3OYFA 3H8ZA 2FYKA 3A8GB 5D6XA 4EDUA 4E7KA 1LOJA 3CBPA 3NTIA 3L42A 5CQYA 4DQ2A 5A2QE 1YCYA 3JCMP 2MMPA 2VUBA 3CEYA 3E1SA 2BKDN 3NTHA 4ZN1A 2XDDA 3CCST 1ZBXA 5GAOm 4PJOG 1Q81C 2VXEA 2I2LA 4M78G 4C0DC 3G4SA 4C0ZA 2ZPIB 1QVFA 1FWZA 4C8QG 3BW1A 4M7DC 2QQSA 3ZFJA 1OI1A 1VQLT 3BFMA 2PQWA 5CIUA 4QVCA 3JB9G 4C92F 4XU2A 5CVIA 4EMHA 2YRVA 1VQ6A 3QJYA 1VQOA 3RIRA 3OSVA 3A5ZB 1I8FA 5L8RE 4P5NA 1D3BB 4O6JA 3CCRA 1VQ8T 4IUQA 3M9QA 3HFNA 1M90U 5GANj 4BI4A 2EQMA 2QA4T 2DJZA 3PNWC 4UC4A 3CCET 1KHIA 2EFIA 4XTXA 2X4WA 4MMLA 3S3OA 2XI9A 4IUTA 3FIFA 1G3SA 2L3RA 3LX7A 3JCMW 2LVMA 4O5VA 2EJGA 3G71T 2WSEE 4JS4A 3CC4A 4PJOA 2XHCA 3L2WA 3CCMT 5HKCA 1WJQA 3ME9A 5LJ3e 1S72A 5FU6B 2X4JA 2E6NA 2OTLA 2KAFA 4XTYA 3CMEA 2P4TA 1VQ9T 3MP6A 4C8QA 2E5QA 3WVEB 3I55A 3I56T 2FHDA 1BIBA 2XK0A 3VJPA 3KXTA 2EJ9A 4M77G 2G3RA 4DOVA 1OYXA 3JCMg 4R55A 3G6ET 4JDSA 4N4IA 4JRIA 2E6ZA 5LJ5j 2MWPA 1PSEA 3VUBA 5DM7R 1QVGA 4OB3B 1LJOA 4A4FA 1VQ7T 4F7UF 5LJ3g 1K8AU 5LL6S 3VKIA 2IVWA 4BE1A 2Y4YA 4KBMB 3OYDA 5I21A 2RJFA 2KMTA 3LYIA 3N5BB 3EFRA 1YHQA 1KQ1A 2OTJT 1W2BA 3CCVA 4M7AG 4NOYA 4M75B 1DJ7B 5GAOr 3JCMh 3OS2A 2HQEA 2KQWA 3L2RA 4RCBA 2LCCA 3OMCA 5GMKl 3OYCA 4M7DD 3M4GA 3M56A 3OSSC 2WSFE 1VQKA 5LJ3h 4XQ3A 1Y96B 4FU6A 3M53A 4ME7A 5FU7B 3SDZA 1HXDA 3MEUA 4M77A 1KQSA 1FXXA 3V8KA 3FB9A 2QEXT 3M55A 2WACA 4RKUE 5DLOA 3OYMA 3DB3A 4LDWA 3A8OB 5KE3A 5FRMA 1VQPA 4PJOE 1H641 3OBYA 3QPHA 4L59A 4M78E 2QQBA 3A8MB 4XTZA 2QQ9A 2DIGA 3OS1A 4BDYA 2RJCA 1SSFA 2EAYA 4C8QE 3E19A 4BE0A 4B9WA 1G3YA 1NJIU 1I5LA 3JCMJ 3HHTB 4BD3A 3CCSA 3CD6T 5IN1A 1UB4A 4M7AA 2MF2A 4N4HA 3HPWA 3VU3C 4GY5A 5HK3A 1Q7YU 2EIFA 5CKFA 4OVAA 5GAN8 3JCMX 1JJ2A 3T9NA 3CBOA 1K9MC 3QBYA 1NZ9A 3X25B 1YITT 3GLXA 4NS5A 4JRQA 1X75C 4JRKA 3OYJA 3OYEA 1VQNT 2O4XB 3QUIA 5CR2A 1WJRA 2LT4A 3PIPA 1VQ5T 3VV0A 1VQLA 4MDXA 2DXCA 2DXUA 4PJOC 4BACA 4M78C 3HFOA 2K5IA 3R6OA 3CCUA 1R8OB 3JCMQ 1VQ8A 3MHXA 2LTOA 5KCHA 4C8QC 4FL6A 5CK9A 1WJSA 2GQVA 2X4XA 3TCJA 1UGQB 2LX9A 2QA4A 4A4GA 3CCEA 5LJ3j 4E7LA 1Q86C 5KH6A 4HT9A 3M59A 1D3BA 5I2SA 2E65A 2DD4A 5LJ5g 4M77E 2RHYA 4MZPA 4OGCA 1RI0A 3G71A 4JUVA 2P0KA 2RJDA 4MDWA 3CCJT 4JJNK 4II1A 4XU1A 3CCMA 4JRPA 1Q82C 4A4HA 2XIDA 5GAOp 4HKEA 1NPRA 4LDYA 4F7UB 1YI2T 3OYHA 1VQ9A 3QYHB 1Y7XA 5KE2A 3PIOA 3CC7T 3I56A 3GIBA 2IG0A 4QQGA 1B34B 4M75G 5J39A 2YHTA 4GLKA 1XQHA 2EKOA 2M16A 4BI8B 3OYYA 2MI6A 2D9TA 5LJ5h 5GAN7 3LWIA 4XTVA 3CC2T 4RCCA 3X20B 4M7AE 5GAOn 3ASKA 3RUXA 3S6WA 2DXBA 3QHSA 4L6V5 3JCMV 2A7YA 4OB1B 1M1KU 2X35A 3JCMd 3M4YA 3DKMA 5CCAA 1VQ7A 1U1SA 1GXIE 1UGPB 3FRNA 4M77C 1OZ3A 4ZTFA 2RH2A 4QW2A 3JB9H 1N9RA 5CQXA 3JB9J 4JLIA 3MEAA 2L8DA 1ZQ1A 3SWNB 2E41A 3FC3A 3C4SA 1YJWT 1QP3A 2RA2A 2OTJA 5CKBA 1OZ2A 3HP9A 5CAIA 4OB2B 4BDZA 3SFMA 4C92G 5GAMd 4MZMA 1VIEA 2HNIA 4PL6A 4QVZA 4PJOD 3X24B 3PT9A 4M75A 2HBPA 5GMKm 1M9SA 2CZ0B 4M7AC 1U8RA 2ZPHB 2QEXA 1K73U 4EMKB 2E12A 2JOYA 4M78A 4C8QD 4E7HA 1ZHIA 4HT8A 1K9MU 3OW2S 1KQ2A 2RHXA 3UDCA 4J7IA 1G3TA 3JB9D 2DKGA 1N8RC 1KD1C 1FX7A 3V7RA 2PVGB 2HQXA 3CPFA 5J26A 1M5Q1 1NPPA 4CRIA 1N27A 2KK4A 3QDRB 1BI1A 3NFCA 3RMQA 2LCLA 5FROA 1WGSA 5CKDA 3WVDB 3OYGA 1Q81U 4C0FA 1O9SA 3CD6A 3V7CA 3URGA 4OB0B 4NL3A 2YLBA 3OYLA 3CCQA 4NL2A 3RKYA 5FRNA 4M7DF 2GFAA 2ZPBB 5IT9E 4LDVA 4D6WA 4C92A 2CZ7B 5GANd 1VQ4T 2DVEA 3M54A 1YITA 4E47A 3PMIA 1NJIC 4XK8E 1VQNA 3JCMb 3RMSA 2DXTA 2QQAA 1VQ5A 5HK0A 4C5EA 3QKJA 4V2SA 3QJ6A 1KHCA 5I2MA 1Q7YC 1RL2A 2CS7A 2FVUA 4F7UG 1VIFA 2EWNA 2MWOA 4JS5A 3GP8A 2RO0A 3PFSA 2O4XA 4M77D 2DAQA 3C12A 2DIQA 2R5MA 5IAYA 2CZ6B 3L2VA 1UGSB 4LDXA 2DK3A 2JTMA 2M0OA 1JBMA 3G7ZA 3Q1JA 4OF1A 2XD0A 2CKKA 2RHUA 5FU6C 3JCMc 4M75E 3CMAT 4PNOA 2KDSA 3ZEHA 2EJFA 4QQ6A 3WXMB 3EAEA 3OYBA 1HK9A 3LH0A 3V7SA 3LWHA 1BI2A 2JTFA 5LJ5d 3CCJA 1MHNA 2R5AA 3GNGA 4E7JA 4R56A 2ZPGB 1JRIA 1YI2A 2DTHA 4IURA 3HL8A 1BIAA 4M7AD 1EIFA 3QG1A 3CC7A 3A8HB 1BKBA 3VYHB 3OB9A 2D6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HK3 A;  5CKF A;  5CKH A;  5CO7 A;  5CQX A;  4MZP A;  1VUB A;  2C06 A;  3NFC A;  4ME7 A;  4HKE A;  3G7Z A;  1X75 C;  4OF1 A;  5CKB A;  5CKD A;  5CR2 A;  5CQY A;  5DLO A;  4MDX A;  3VUB A;  2VUB A;  3JRZ A;  4MZM A;  5CKE A;  4MZT A;  4ELY C;  2KMT A;  5CK9 A;  4VUB A;  5HKC A;  3TCJ A;  5HK0 A;  4ELZ C;  3JSC A;  1M1F A;  1UB4 A;  5CCA A;  2MF2 A;  3HPW A;  1NE8 A; 
#chains in the Genus database with same CATH topology
 3CQT A;  2RK2 A;  4C8Q B;  1QCO A;  2ATC B;  2E70 A;  2AIR B;  2EQK A;  3HRS A;  3L2U A;  1VQ8 Q;  2J7I A;  1VYV A;  1ABQ A;  1YJW A;  1QLY A;  4DBQ A;  7AT1 B;  2QA4 Q;  5D6Y A;  4FSX A;  3QYG B;  4ELZ C;  1D0X A;  3CCQ T;  3CCM Q;  4FYV B;  5M9O A;  1U06 A;  2DL8 A;  2LQN A;  1R0B G;  3M5A A;  1KG1 A;  1TOV A;  4M77 B;  4HCZ A;  1TS9 A;  1OU8 A;  3DLL A;  5D6W A;  2LNV A;  3MJX A;  1VQ7 Q;  1I81 A;  3OMG A;  3GF5 A;  4CC7 A;  1WHH A;  2DNU A;  5GJV B;  3NPF A;  2ZCF B;  4F7U E;  2EQI A;  3EFO A;  2CH4 W;  3VYG A;  3MEW A;  3SD4 A;  1QP2 A;  2HKQ B;  4EMG A;  2R57 A;  1ZUK A;  2JW4 A;  2VC8 A;  1TSF A;  4D8K A;  2RI2 A;  1PCX A;  3E9G A;  2PVO B;  1WLP B;  2X4Y A;  5AT1 B;  1LPL A;  4QQD A;  4IUV A;  1MNE A;  5GMK e;  3H6Z A;  4LUE A;  3SWN C;  1YJN T;  3CCL A;  2DRM A;  4J83 A;  2LDM A;  1JJ2 S;  2YUQ A;  4FT4 A;  4M7D G;  4XTW A;  4HVV A;  4WTO B;  1G3W A;  3MO8 A;  1TH7 A;  4ATO A;  1KIK A;  1YJ9 A;  4M7A F;  3M0S A;  1Q81 R;  2XG8 D;  4LNP A;  3OBW A;  4ZGJ B;  4BUG A;  5FLX E;  3MEV A;  4N4G A;  4AFQ C;  2QK0 A;  1JO8 A;  1RAE B;  1VQO T;  4RMO A;  1WHJ A;  4J9B A;  4VUB A;  5GAM g;  3UF4 A;  2KY9 A;  5HY6 A;  1PHT A;  2RI3 A;  2L5Q A;  5GAN 5;  2CYZ B;  1ZX6 A;  2DD5 A;  2K5L A;  3CPW P;  1RLQ C;  2D8J A;  2HKN A;  4KUD K;  1S72 T;  2RQT A;  2OTL T;  1WFW A;  3PGG A;  4Y28 E;  1W4S A;  2LC4 A;  5GAM h;  4OMN A;  2ZAE A;  3OW2 P;  2HEQ A;  2E4H A;  5IH2 A;  5DY9 A;  2A08 A;  4IKF A;  3AHU A;  3UWN A;  2P0Q A;  2FZK B;  5C6S A;  2DEU A;  2FRY A;  2O2O A;  2YUP A;  4RG2 A;  2DA9 A;  2HL5 C;  4HCB A;  3CXC A;  3CCV T;  3M58 A;  1K9A A;  4L5G A;  4OMQ A;  3RES A;  1T0H A;  2BTT A;  2M9U A;  2F69 A;  4KRT A;  4HVU A;  4KH0 B;  3S3N A;  1D09 B;  3X26 B;  1YBY A;  2PUO B;  4M75 F;  3RER A;  5GAO q;  4M7A B;  1Y57 A;  3UT1 A;  1QVG S;  2WSC E;  3QWX X;  2Y90 A;  3A8G B;  4EDU A;  3L42 A;  1QQJ A;  1YCY A;  2MMP A;  1ZBX A;  1D1C A;  5GAO m;  3FJ5 A;  2DJQ A;  4C0D C;  4J9F A;  1QVF A;  1FWZ A;  4OMM A;  4M7D C;  3JB9 G;  5CVI A;  1VQ6 A;  4LXC A;  3OSV A;  2E5K A;  3VS4 A;  1VQ8 T;  3M9Q A;  1GFD A;  1ZSZ A;  3HFN A;  1M90 U;  2V1R A;  2QA4 T;  3PNW C;  4MML A;  3S3O A;  2F1L A;  2L3R A;  3JCM W;  3CME Q;  1YIJ Q;  3ULR B;  3L2W A;  2ED1 A;  3CCM T;  5LJ3 e;  3ME9 A;  5FU6 B;  2X4J A;  2E6N A;  1VQ9 T;  2DM1 A;  3MP6 A;  4C8Q A;  2E5Q A;  3I55 A;  2FHD A;  3KXT A;  5IXB A;  4R55 A;  2AKK A;  4CC3 A;  4JDS A;  5IHN A;  1AWW A;  1FYN A;  1VQ7 T;  4F7U F;  1EZZ B;  5FWC A;  1UDL A;  2Y4Y A;  3OYD A;  3LYI A;  1IGQ A;  1CSK A;  3VRZ A;  1KQ1 A;  1W2B A;  4M75 B;  3OMC A;  3OYC A;  5GMK l;  4M7D D;  3NHN A;  2PZ1 A;  4FU6 A;  3M53 A;  5FU7 B;  4M77 A;  3FB9 A;  2QGF B;  5DLO A;  1K0X A;  1QCF A;  3OYM A;  3DB3 A;  1UEC A;  3A8O B;  4RTX A;  2CP7 A;  4M78 E;  4XTZ A;  2QQ9 A;  3M0T A;  3OS1 A;  4C8Q E;  1PWT A;  1TWB A;  3CCS A;  1UB4 A;  3HPW A;  2EIF A;  5GAN 8;  4RUG A;  2CDT A;  1K9M C;  3GLX A;  4NS5 A;  4JRQ A;  3CCU Q;  1VQN T;  3QUI A;  5CR2 A;  3ZL7 C;  1TUG B;  4ANJ A;  4BAC A;  2RPN A;  3HFO A;  2K5I A;  1GBQ A;  1I07 A;  3JCM Q;  1WJS A;  1UGQ B;  2LX9 A;  3CCE A;  1D3B A;  1Q7Y R;  4M77 E;  2RHY A;  3VS1 A;  5FWB A;  3G71 A;  4JUV A;  2ABL A;  1Q82 C;  4II1 A;  4XU1 A;  3I5R A;  2MYS A;  5GAO p;  4LDY A;  4E2F B;  4F7U B;  3OYH A;  1YI2 T;  3QYH B;  1Y7X A;  3I56 A;  1XQH A;  2X51 A;  1NYG A;  2MI6 A;  3LWI A;  4RTU A;  4RCC A;  3G6E A;  2X9H A;  5KYW B;  3JCM V;  1UE9 A;  3TVT A;  1G83 A;  2X35 A;  3M4Y A;  1UGP B;  4J9E A;  3FRN A;  3CCR Q;  1I5O B;  3JB9 J;  4JLI A;  3FC3 A;  3C4S A;  1QP3 A;  2RA2 A;  3M0P A;  2JTE A;  4Z8A A;  2D1X A;  4OB2 B;  1OU9 A;  4GLM A;  5GAM d;  2KRS A;  4QVZ A;  1M9S A;  1U8R A;  1JU5 C;  1VOM A;  2ZPH B;  2JOY A;  4J7I A;  3JB9 D;  1N8R C;  1MMN A;  1FX7 A;  2PVG B;  3CPF A;  1TG0 A;  2QDL A;  1UHF A;  2PTK A;  3EFO B;  4CRI A;  3SHW A;  3QDR B;  3RMQ A;  1BI1 A;  1OX8 A;  4KH1 B;  2LCL A;  5FRO A;  1E7O A;  3CD6 A;  3TQ7 P;  4OB0 B;  1YIT Q;  1YHQ Q;  2GFA A;  2ZPB B;  5IT9 E;  4LDV A;  4D6W A;  1BBZ A;  2CZ7 B;  2DVE A;  2HCK A;  4E47 A;  2HSE B;  4V2S A;  5I2M A;  2MWO A;  3GP8 A;  2O4X A;  1SKU B;  2R5M A;  1W70 A;  2XD0 A;  2RHU A;  2DBK A;  3JCM c;  3CMA T;  4PNO A;  3R6N A;  1MHN A;  2LJ1 A;  2ZPG B;  1JRI A;  4IUR A;  1CKA A;  1EIF A;  3A8H B;  2QDY B;  5GAN 2;  1YFN A;  1M1K C;  2C0I A;  3CC2 A;  1MMA A;  5D7U A;  1OPK A;  1B34 A;  3EG9 A;  2VV5 A;  1YIJ T;  2K2M A;  2DEQ A;  2LQK A;  1MGQ A;  1QVF S;  3MP8 A;  4RTW A;  1I0C A;  1WQW A;  3UA6 A;  3J80 E;  4A4K A;  4D8D A;  1K4U S;  2YWW A;  4QVD A;  2MIO A;  3L2Z A;  3FLG A;  2CUB A;  2Z0W A;  3F70 A;  5GAM f;  2W10 A;  2M02 A;  3JAM E;  4BY6 C;  4FYX B;  3TU4 K;  3EFS A;  4MZT A;  2CT4 A;  1VQM T;  1HSQ A;  3MPU B;  2F2W A;  3JSC A;  3OQ5 A;  4C5H A;  3GPL A;  2VB6 A;  5ECA A;  2CP3 A;  2CZ1 B;  1VQ4 A;  2FEI A;  1MV3 A;  4M78 F;  5FW9 A;  1G5V A;  4C8Q F;  2DER A;  4IUU A;  1V1C A;  2D0Q B;  1W2B S;  1X6B A;  2QQR A;  2XDP A;  2LRQ A;  1V29 B;  4ELY C;  4M78 D;  3LW5 E;  2B8A A;  1ZUY A;  4WF2 A;  1IZ6 A;  2F2X A;  2DZC A;  2EGC A;  3L1A A;  1FMV A;  1KFZ A;  3CCU T;  4X9C A;  2KXC A;  1PG5 B;  1WNL A;  3GBQ A;  3VS5 A;  2EYZ A;  3OA6 A;  1C1A A;  4X1V A;  3CCL Q;  2AK5 A;  2Y4X A;  1FMK A;  3V8L A;  4M77 F;  1Y71 A;  2D0N A;  1SRL A;  4XAX B;  2CGH A;  1U1T A;  2K6D A;  4LN2 A;  1UFF A;  2RHZ A;  3G4S T;  2LQ8 A;  1T3L A;  1KC8 R;  4EMK C;  1P92 A;  4BB7 A;  3OS0 A;  3PTA A;  3CCQ A;  4PLI A;  2K3Y A;  4N0A A;  4ZN3 A;  2EQU A;  2GCX A;  2PUK B;  3KBG A;  2DZ9 A;  3CC7 Q;  1WPY A;  3CCR T;  3CPW A;  2K9G A;  2H3E B;  4PLL A;  2BZ8 A;  2DLP A;  1CKB A;  2E10 A;  4M78 B;  1KD1 U;  5CKH A;  4M7D A;  3OW2 A;  4F7U A;  4KUL A;  3OY9 A;  4KGX B;  1WXB A;  2L89 A;  3MP1 A;  4OMP A;  4PFZ A;  2FB7 A;  2YLC A;  2ROT A;  2RMO A;  3ER0 A;  5KYW A;  1RI9 A;  3BDL A;  1PM3 A;  2P0P A;  2A3L A;  1U3O A;  4XTU A;  2RD1 A;  4BY6 B;  1M1F A;  5GAN g;  3E2U A;  4DEY A;  1Z9Z A;  2YUN A;  1YHQ T;  2O9V A;  4LD6 A;  1V76 A;  2DTI A;  1WHG A;  3LGF A;  1XNI A;  3JRZ A;  4OMF B;  4IUP A;  4J6X A;  1MND A;  4C5G A;  1JJ2 P;  5GAN h;  1GCQ A;  5L23 A;  3LLR A;  3GNF B;  1K73 C;  4F16 A;  2IIM A;  1UG1 A;  4M7D E;  2DF6 A;  2NWM A;  5GAN 6;  3FEO A;  1NEG A;  4X9D A;  2QG9 B;  3C94 A;  2JNG A;  1YJN A;  5GAM j;  5D6X A;  3JCM P;  2BZX A;  2VUB A;  3NTH A;  3E1S A;  1F1B B;  1AT1 B;  4PJO G;  3EG1 A;  2VXE A;  4C0Z A;  2EPD A;  3VS6 A;  3VS2 A;  1AOJ A;  3BW1 A;  2O31 A;  1VQL T;  4QVC A;  1JXO A;  1B3Q A;  2RQR A;  3VS3 A;  1VQO A;  3RIR A;  3EH2 A;  1I8F A;  1YWP A;  1D3B B;  4IUQ A;  1RAB B;  4JZ3 A;  2EQM A;  2DJZ A;  4UC4 A;  4IUT A;  3FIF A;  3LX7 A;  1WDX A;  2EJG A;  3I55 Q;  1WJQ A;  1S72 A;  2OTL A;  2KAF A;  1BB9 A;  2P4T A;  1BIB A;  2XK0 A;  4F14 A;  5KYX A;  2DL3 A;  1YCS B;  4DOV A;  1Y0M A;  3H0I A;  4N4I A;  4JRI A;  2MWP A;  5DM7 R;  5LL6 S;  2IVW A;  2JMC A;  2RJF A;  2GTJ A;  3I5S A;  3CCV A;  1DJ7 B;  1PD0 A;  5GAO r;  1QVG P;  2HQE A;  1AWJ A;  1D0Z A;  3M56 A;  3OSS C;  1VQK A;  3SDZ A;  4ME7 A;  1KQS A;  1HXD A;  3MEU A;  2FRW A;  2V1Q A;  3V8K A;  4R0K A;  4E7S A;  2WAC A;  8ATC B;  4RTY A;  4LDW A;  5FRM A;  5KE3 A;  1ACM B;  1PKS A;  2QQB A;  2LJ3 A;  2LMJ A;  3CCS Q;  2DIG A;  2EAY A;  4LUD A;  1D1B A;  1I5L A;  3JCM J;  4Y92 A;  1H8K A;  3VU3 C;  1Q7Y U;  1KD1 R;  3BE3 A;  2ECZ A;  2AT1 B;  3QBY A;  4JRK A;  1RAC B;  2O4X B;  3PIP A;  4MDX A;  3C0C A;  2DXU A;  4PJO C;  2F2V A;  2JM8 A;  3R6O A;  2A36 A;  3CCE Q;  1VQ8 A;  5KCH A;  4FL6 A;  2X4X A;  1NJI R;  2QA4 A;  3A98 A;  3G71 Q;  2KNB B;  4E7L A;  2BE9 B;  1Q86 C;  4HT9 A;  4MZP A;  1YNZ A;  2HZY A;  4KGZ B;  3CCJ T;  2RJD A;  3CCM A;  4A4H A;  2HDA A;  3NMZ C;  1VQ9 A;  3PIO A;  3CC7 T;  2IG0 A;  1B34 B;  3EG9 B;  2YHT A;  1S1N A;  2DFU A;  1EFN A;  2M16 A;  5GAN 7;  4XTV A;  4JJC A;  3X20 B;  5GAO n;  3ASK A;  3RUX A;  3S6W A;  3JCM d;  3DKM A;  1VQ7 A;  1TU0 B;  2RNA A;  3JB9 H;  4QW2 A;  1N9R A;  2L8D A;  1ZQ1 A;  3SWN B;  2E41 A;  4FW1 A;  5CKB A;  4BDZ A;  2CUD A;  4C92 G;  3CC4 Q;  2COW A;  4PJO D;  2CZ0 B;  1RAH B;  4ORZ A;  4M78 A;  4E7H A;  1KQ2 A;  3OW2 S;  2M0Y A;  3UDC A;  2DKG A;  2HQX A;  3EGD A;  3CD6 Q;  3U23 A;  3VS7 A;  1M5Q 1;  2KK4 A;  3OS2 A;  3S3M A;  3HTR A;  2RQW A;  4C0F A;  1O9S A;  1PRL C;  4M7D F;  5GAN d;  2LNH B;  1VQN A;  3RMS A;  2QQA A;  1WI7 A;  3QKJ A;  1RL2 A;  1R0C B;  4KGV B;  3C12 A;  2EGA A;  2DIQ A;  3L2V A;  2M0O A;  1VQP Q;  3G7Z A;  4DEX A;  2CKK A;  1U5S A;  3ZEH A;  2KDS A;  3EGX B;  2EJF A;  4QQ6 A;  4DBF A;  2K7A A;  2JTF A;  3O5Z A;  5LJ5 d;  3GNG A;  2DL7 A;  1YI2 A;  1BIA A;  3QG1 A;  3CC2 Q;  4AG2 C;  3VYH B;  5I11 A;  3P8H A;  4J8O A;  3VRY A;  3E9F A;  3UAT A;  4QKU A;  1B7T A;  2MAM A;  1N9S A;  4RG8 A;  2RHI A;  4HCK A;  2YDL A;  1BCO A;  2COY A;  3EG0 A;  3JCM f;  2RB6 A;  4LD9 K;  2EBP A;  2DO3 A;  4JJD A;  4AMC A;  1X6O A;  2RM4 A;  4J9I A;  4XU3 A;  2KYB A;  5KCO A;  1BI0 A;  2J6O A;  2KI7 A;  2VXF A;  2K2V A;  5KYY B;  2DMO A;  2KRN A;  4C0D B;  1GL5 A;  3GOX A;  2I0N A;  1QKW A;  4M7D B;  4A63 B;  4C92 C;  1OPL A;  4FM4 B;  3RKX A;  4ZNX A;  1M2V B;  5C0M A;  3TRE A;  2LP5 A;  4EPC A;  5IXF A;  1WXT A;  2RN8 A;  3O8V A;  1EX4 A;  2VGN A;  1GRI A;  1X01 A;  2DPP B;  4FSS A;  4DA4 A;  2OTJ Q;  2EQJ A;  3MET A;  1I4K 1;  3M0U A;  2K5F A;  1BK2 A;  5GAN f;  3J7A F;  1K0S A;  1IRE B;  1M3B A;  2MCN A;  1BI3 A;  2XIC A;  1M8V A;  3JB9 F;  3PVL A;  5A0D A;  2GFU A;  1AHJ B;  1K8A C;  4AG1 C;  2QEX Q;  4FW2 A;  4KUI A;  2DYB A;  1ZBJ A;  2NLU A;  1NLP C;  2K79 A;  1AZG B;  3CMA A;  1J3T A;  2RF0 A;  1KQS S;  1LNX A;  2JMA A;  3QSU A;  2GTO A;  4JZ4 A;  2KSS A;  2BZY A;  2YSQ A;  1AVZ C;  1Q82 U;  3HSB A;  2JJ9 A;  1UEB A;  2F5T X;  1QVF P;  4E6R A;  1KC8 U;  5LJ5 f;  1SPK A;  5AYF A;  4C92 D;  5CKE A;  2AKL A;  1VQ5 Q;  3OYK A;  2XKO C;  3I9Q A;  1WQ7 A;  2NUT A;  1YIJ A;  4IIO A;  5GAO l;  2KE9 A;  4AFS C;  3ZBD A;  5GAM e;  3CXC S;  1O75 A;  1UUE A;  3P8B B;  2KEA A;  3OYI A;  2RJE A;  3HKS A;  3EG2 A;  4JPB W;  1M4Z A;  1X69 A;  3BY7 A;  2EYQ A;  2K3X A;  3SB2 A;  3EH1 A;  1IXD A;  1N6A A;  2CRE A;  3EHQ A;  1M8M A;  2DRK A;  1M1G A;  3SEM A;  5GMK h;  4FT2 A;  2A28 A;  1N8R U;  2CP6 A;  1NE8 A;  2QTV A;  4K11 A;  1SSH A;  1VQM A;  2KR3 A;  3CC4 T;  1W2B P;  1JB0 E;  1K1Z A;  2MPX C;  1MUZ A;  5KYX B;  1YJW Q;  2RK1 A;  1D0Y A;  4PK4 A;  3CME T;  3EHR A;  2J06 A;  2DX1 A;  1G2B A;  2COZ A;  4C92 B;  2JN0 A;  2HSP A;  2ZGW A;  4OP0 A;  4ZTJ A;  4E7I A;  3SWN A;  2EYW A;  4HCC A;  2KVQ G;  5A0G A;  2QXF A;  3QXE B;  4WCI A;  3V8J A;  2FL7 A;  4C0G A;  6AT1 B;  2ROL A;  4Y91 A;  2M51 A;  2QAS A;  1H3Z A;  5A0L A;  1FMW A;  4PFO A;  2R58 A;  2GF7 A;  3NTK A;  2HD0 A;  3FJP A;  4J6Y A;  4ZGD B;  4J7F A;  1WXU A;  1AEY A;  2F5K A;  5DLQ E;  1PRM C;  1VQP T;  3H0H A;  1QKX A;  1M27 C;  2RI5 A;  3VS0 A;  1MV0 B;  1I1J A;  3OYF A;  1Q81 C;  3H8Z A;  1UTI A;  1LOJ A;  3NTI A;  4DQ2 A;  5A2Q E;  3H41 A;  2XDD A;  4ZN1 A;  2I2L A;  1C6V X;  3G4S A;  1HD3 A;  2ZPI B;  3REB B;  1VQO Q;  2QQS A;  3ZFJ A;  3BFM A;  5CIU A;  4XU2 A;  1Z9Q A;  3QJY A;  1QWF A;  4P5N A;  4O6J A;  3CCR A;  2IPO B;  1X2K A;  2FG0 A;  1K9M R;  4CC2 A;  3EGX A;  5GAN j;  1ZSG A;  4BI4 A;  1KHI A;  9ATC B;  2X4W A;  2CSQ A;  4AFU C;  1S72 Q;  4O5V A;  4FYW B;  4JS4 A;  1LVK A;  4PJO A;  4AFZ C;  2GNC A;  4XTY A;  3VJP A;  1YJ9 Q;  2EJ9 A;  2G3R A;  1Q82 R;  3JCM g;  5LJ5 j;  1KK7 A;  3VUB A;  2MK5 A;  1QVG A;  2DE0 X;  2VWF A;  4FYY B;  2JS2 A;  5LJ3 g;  2J6F A;  1VYU A;  1QWE A;  1UJ0 A;  1WHL A;  2KMT A;  2QYZ A;  3EFR A;  3EG3 A;  1YHQ A;  1T0J A;  3D7S B;  2OTJ T;  2X3X D;  4M7A G;  5KYY A;  1VQK Q;  3JCM h;  2LX7 A;  3L2R A;  2LCC A;  5KYU B;  2ENM A;  2V26 A;  3M4G A;  3PE0 A;  1RLP C;  2WSF E;  1A0N B;  5LJ3 h;  4XQ3 A;  1Y96 B;  4IIM A;  3UA7 A;  3EGD B;  2QEX T;  1RAD B;  2OX7 A;  4RKU E;  2LJ0 A;  1M2V A;  1JXM A;  1RUW A;  2JM9 A;  1NYF A;  4PJM A;  2PNI A;  4PJO E;  1H64 1;  3OBY A;  3H9N A;  1X2Q A;  4L59 A;  3A8M B;  5HCK A;  2RJC A;  1SSF A;  4RTZ A;  1G3Y A;  1VA7 A;  1NJI U;  3HHT B;  4BD3 A;  2OI3 A;  2MF2 A;  1N8R R;  5CKF A;  4OVA A;  3JCM X;  1OEB A;  3T9N A;  3M0Q A;  3CBO A;  3X25 B;  3KFV A;  1YIT T;  1X75 C;  2VVK A;  3OYE A;  1VQ5 T;  3VV0 A;  1VQL A;  2DXC A;  1NBE B;  3QDF A;  1HYO A;  1WHK A;  1R8O B;  3MHX A;  2LTO A;  2L3Q A;  2EYX A;  3G1J A;  3M59 A;  2FZG B;  5LJ5 g;  1VQ9 Q;  1R77 A;  2P0K A;  4MDW A;  4JRP A;  3RR6 A;  2XID A;  4HKE A;  1NPR A;  1WA7 A;  5I22 A;  3JV3 A;  1RAA B;  3GIB A;  4M75 G;  4GLK A;  2EKO A;  1OQK A;  5LJ5 h;  2DXB A;  3QHS A;  2YRD A;  2HQH A;  2A7Y A;  4OB1 B;  1VQ6 Q;  5CCA A;  2JT4 A;  4ZTF A;  2L2P A;  3MEA A;  1YJW T;  2EYY A;  2RQV A;  1M1K R;  2K3B A;  1OZ2 A;  3THK A;  3TSZ A;  1AD5 A;  1IB8 A;  3PT9 A;  2HBP A;  5GMK m;  4M7A C;  1TTH B;  4PJN A;  1K73 U;  2CSI A;  4EMK B;  1GBR A;  2E12 A;  4HT8 A;  1ARK A;  4PFP A;  2E3I A;  5J26 A;  1NPP A;  3OYG A;  2QAZ A;  1OV3 A;  3URG A;  3OYL A;  3RKY A;  5FRN A;  4J9C A;  1VQN Q;  1H92 A;  1SRM A;  1SEM A;  4C92 A;  1B07 A;  2HMA A;  3PMI A;  4XK8 E;  3JCM b;  2G6F X;  4C5E A;  3QJ6 A;  1VYT A;  1Q7Y C;  2CS7 A;  4F7U G;  2P4R A;  1RAF B;  1VIF A;  2EWN A;  4JS5 A;  2RO0 A;  4F04 B;  2DAQ A;  1C0M A;  5IAY A;  1PKT A;  1UGS B;  2DK3 A;  2JTM A;  1JBM A;  4OF1 A;  5FU6 C;  2E3H A;  2JXB A;  3WXM B;  2EGE A;  2FPE A;  3EAE A;  3OYB A;  1YI2 Q;  4J9H A;  3LH0 A;  3V7S A;  2O88 A;  3CCJ A;  1X43 A;  4E7J A;  1BCM A;  1WX6 A;  2A37 A;  4R56 A;  2X3W D;  2DTH A;  3QWY A;  3HL8 A;  4M7A D;  2KRO A;  3CC7 A;  3OB9 A;  2NUP B;  4E7Z A;  2VAS A;  2OJ2 A;  2NUT B;  2GGR A;  2E1H A;  4HXJ A;  4DBH A;  3CCL T;  1QW1 A;  2H3J A;  4M75 C;  4C92 E;  1XOV A;  1ZA1 B;  2EVR A;  3BDU A;  2ZPE B;  3OS5 A;  1PNJ A;  2B86 A;  4LE9 A;  5FU7 C;  1YJ9 T;  1IRX A;  3MKD A;  3TEE A;  2P84 A;  2OAU A;  2HAX A;  2C06 A;  2GBQ A;  1SF9 A;  3I56 Q;  1LCK A;  1M90 C;  3G6E Q;  2LT1 A;  1WYX A;  1VQK T;  4BI3 A;  1IHV A;  3UPU A;  1SHG A;  2V8J A;  3QII A;  4FIB A;  2VYT A;  1MMD A;  3X28 B;  4A4E A;  1NEB A;  2V8K A;  4PKC C;  4OGE A;  2JUF A;  2BIV A;  4PJO F;  1Q95 G;  3QZ5 B;  2PVD B;  5LJ3 d;  4N0A C;  1UGR B;  4HA8 A;  1Y07 A;  1D1A A;  2CT3 A;  3C95 A;  1HJD A;  5EG2 A;  3PVQ A;  4M75 D;  3DLM A;  3CPW S;  4MMK A;  3CMA Q;  5EC7 A;  1KSW A;  4KT0 E;  2QI2 A;  5KYU A;  1Q86 U;  3RKW A;  1Y96 A;  3JB9 I;  4J6W A;  1VUB A;  2DIL A;  4LDU A;  2E64 A;  3RNJ A;  1M3C A;  4J9D A;  2LQW A;  4OMO A;  2ZZD A;  4DOW A;  3JCM e;  2QTX A;  2SRC A;  3OYA A;  2DTO A;  1NLO C;  4YTL A;  3A8L B;  4HVW A;  1K73 R;  2DYI A;  4GBQ A;  3P8D A;  4PJL A;  3M57 A;  2O9S A;  2AHJ B;  3FDR A;  2V8I A;  3LH5 A;  2O01 E;  1W1F A;  3HRT A;  3VUZ A;  2EKH A;  1GCQ C;  4JLG A;  4B9X A;  5J3B A;  3KUF A;  2H8H A;  4C5I A;  3J81 E;  1VQ6 T;  1ZLM A;  3QZ9 B;  1RAG B;  1GCP A;  8AT1 B;  2LCS A;  1WIE A;  2ZPF B;  2K57 A;  1QVP A;  4XU0 A;  4PJO B;  1VQM Q;  2VGM A;  2XMF A;  4ZGE B;  3A1P A;  1PSF A;  2K4Y A;  4X34 A;  2CH4 A;  5GAN e;  5GAN 4;  4BE2 A;  1M30 A;  3I55 T;  2JVV A;  2VKN A;  1KQS P;  4EIK A;  1BYM A;  3PMT A;  2QGG A;  5LJ3 f;  1E6G A;  2BUD A;  1NM7 A;  2C0O A;  2KGT A;  3DB4 A;  2NYS A;  2XDB A;  2A0F B;  4FCY A;  4Z02 A;  1SHF A;  2JZ2 A;  5LJ5 e;  5GMK i;  3L2Q A;  2CP5 A;  2PU9 B;  4CI0 C;  3IQL A;  2ESW A;  4JJB A;  3QO3 A;  3OYN A;  2W0Z A;  3M0R A;  5GMK j;  4EMK A;  2XU8 A;  1G8X A;  2M1H A;  3CBM A;  1RAI B;  4ESR A;  4A54 A;  3CXC P;  3MCA B;  1XTD A;  1VQ4 Q;  1AWO A;  1QCN A;  4Q5W A;  3HRU A;  3EGU A;  3INZ A;  5CO7 A;  5GAN 3;  1X27 A;  4A53 A;  4TVR A;  3LGL A;  1KC8 C;  4J5Y A;  4E7K A;  1K9M U;  2FYK A;  1ZA2 B;  1TUC A;  2KXD A;  3CBP A;  5CQY A;  3G4S Q;  3CEY A;  3CCS T;  2ED0 A;  2BKD N;  2YUO A;  1IHW A;  2J05 A;  2KBT A;  4M78 G;  1YP5 A;  4AT1 B;  1GFC A;  2KRM A;  1PC0 A;  4C8Q G;  1OOT A;  2MOX A;  1OI1 A;  1H3H A;  2PQW A;  1W6X A;  4C92 F;  1K76 A;  4EMH A;  2YRV A;  1OUL A;  3A5Z B;  5L8R E;  1JEG A;  1M2O A;  3NGP A;  3CCE T;  2EFI A;  4XTX A;  2XI9 A;  1G3S A;  5IHK A;  1SG5 A;  1E6H A;  2LVM A;  4CC4 B;  1AWX A;  2WSE E;  3G71 T;  3CC4 A;  2XHC A;  2FPD A;  5HKC A;  2NUP A;  3CME A;  3WVE B;  1Q86 R;  3I56 T;  5IHI A;  4M77 G;  3CCQ Q;  1OYX A;  2CP2 A;  3G6E T;  1ZUU A;  1M90 R;  2E6Z A;  3RDV A;  2KYM A;  1PSE A;  4F17 A;  4OB3 B;  2D8H A;  1LJO A;  4A4F A;  2L0A A;  2CP0 A;  1K8A U;  2AZV A;  3VKI A;  4BE1 A;  4KBM B;  5I21 A;  3N5B B;  2C0T A;  4NOY A;  1NG2 A;  2JS0 A;  2BE7 D;  3AT1 B;  2KQW A;  4RCB A;  1N5Z A;  2NUZ A;  1UJY A;  2KT8 A;  1X6G A;  1YN8 A;  1FXX A;  3M55 A;  2DL4 A;  1VQP A;  1IGU A;  3QPH A;  4RTV A;  4BDY A;  1MMG A;  3E19 A;  4BE0 A;  2SEM A;  4B9W A;  2YRC A;  3CD6 T;  5IN1 A;  4M7A A;  4N4H A;  5HK3 A;  4GY5 A;  1ZSZ C;  4OML A;  1JJ2 A;  1VQL Q;  2AZS A;  1NZ9 A;  3OYJ A;  1WJR A;  2LT4 A;  3H0F A;  2J6K A;  4M78 C;  3CCU A;  2GQI A;  4C8Q C;  5CK9 A;  2GQV A;  1JQQ A;  1UHC A;  3TCJ A;  3I35 A;  4A4G A;  5LJ3 j;  4PJJ A;  1YJN Q;  5KH6 A;  1KJW A;  5I2S A;  2DD4 A;  2E65 A;  4OGC A;  1RI0 A;  1M3A A;  4JJN K;  1M1K U;  2DET A;  1AZE A;  5KE2 A;  2FPF A;  4QQG A;  5J39 A;  2DBM A;  5GJW B;  4BI8 B;  3OYY A;  2D9T A;  3CC2 T;  1ABO A;  4M7A E;  4L6V 5;  1WZO A;  1U1S A;  1GXI E;  4M77 C;  1OZ3 A;  2RH2 A;  5CQX A;  2OTJ A;  3HP9 A;  5CAI A;  2L3S A;  3SFM A;  1WHM A;  4MZM A;  1VIE A;  5KYN A;  2HNI A;  4PL6 A;  3X24 B;  2DVJ A;  1YWO A;  4M75 A;  2OTL Q;  3RBB B;  2QEX A;  4C8Q D;  4Z88 A;  1ZHI A;  2LZ6 B;  2RHX A;  1G3T A;  1KD1 C;  3V7R A;  4B6M A;  2YXY A;  2YT6 A;  2HBW A;  1N27 A;  3NFC A;  1WGS A;  5CKD A;  3WVD B;  1Q81 U;  1BU1 A;  3V7C A;  4NL3 A;  2YLB A;  4NL2 A;  2OAW A;  3CCV Q;  1QMC A;  1VQ4 T;  3M54 A;  4Z89 A;  2EW3 A;  1YIT A;  4RTT A;  1NJI C;  2DXT A;  1VQ5 A;  5HK0 A;  1KHC A;  4M4Z A;  2FVU A;  1XJW B;  3PFS A;  4M77 D;  4DBR A;  2CZ6 B;  2L3P A;  1TUD A;  1OX9 A;  4LDX A;  2DL5 A;  3Q1J A;  3CCJ Q;  1TXQ A;  2RQU A;  4M75 E;  1ZSZ B;  1PD1 A;  4J9G A;  3REA B;  2FZC B;  1K8A R;  1HK9 A;  3LWH A;  1BI2 A;  2R5A A;  2KT1 A;  4QT7 A;  1T3S A;  1IO6 A;  1UGV A;  2FO0 A;  2HL3 A;  1BKB A;  3TSW A;  2D6F A; 
#chains in the Genus database with same CATH homology
 2QDY B;  5GAN 2;  2RK2 A;  4C8Q B;  1M1K C;  3CC2 A;  2E70 A;  3P8H A;  4J8O A;  2E1H A;  3CCL T;  1B34 A;  1QW1 A;  3E9F A;  2EQK A;  2H3J A;  2VV5 A;  4M75 C;  4C92 E;  1XOV A;  2MAM A;  3HRS A;  3L2U A;  1N9S A;  4RG8 A;  2RHI A;  1YIJ T;  2DEQ A;  2LQK A;  1MGQ A;  3BDU A;  2ZPE B;  3MP8 A;  3OS5 A;  2RB6 A;  3JCM f;  1YJW A;  1QVF S;  4LD9 K;  2DO3 A;  1X6O A;  2RM4 A;  1WQW A;  4XU3 A;  5D6Y A;  5FU7 C;  3J80 E;  1YJ9 T;  4FSX A;  4A4K A;  5KCO A;  3QYG B;  4ELZ C;  1BI0 A;  3CCQ T;  3TEE A;  4QVD A;  2VXF A;  3L2Z A;  2K2V A;  5M9O A;  3FLG A;  4C0D B;  2OAU A;  2HAX A;  3GOX A;  2C06 A;  3F70 A;  5GAM f;  4M7D B;  1M90 C;  4C92 C;  3M5A A;  1KG1 A;  4M77 B;  3JAM E;  4FM4 B;  4HCZ A;  3RKX A;  4BY6 C;  3TU4 K;  5C0M A;  2LT1 A;  3EFS A;  4MZT A;  3DLL A;  5D6W A;  3TRE A;  1VQK T;  4BI3 A;  2LNV A;  4EPC A;  3UPU A;  1VQM T;  1I81 A;  2V8J A;  3O8V A;  3OMG A;  3QII A;  4FIB A;  2VYT A;  3GF5 A;  3X28 B;  2VGN A;  4A4E A;  2ZCF B;  3JSC A;  3OQ5 A;  2V8K A;  4PKC C;  4C5H A;  4F7U E;  2DPP B;  1X01 A;  4OGE A;  2JUF A;  4DA4 A;  3GPL A;  3VYG A;  3MEW A;  2EQJ A;  2BIV A;  3MET A;  4PJO F;  2CZ1 B;  1I4K 1;  1VQ4 A;  3SD4 A;  3QZ5 B;  4M78 F;  2PVD B;  5LJ3 d;  4N0A C;  1QP2 A;  1G5V A;  2K5F A;  5GAN f;  1UGR B;  4HA8 A;  1Y07 A;  4C8Q F;  1IRE B;  3J7A F;  4EMG A;  1BI3 A;  2R57 A;  2XIC A;  3C95 A;  1M8V A;  3JB9 F;  5A0D A;  2GFU A;  3PTA A;  5EG2 A;  1AHJ B;  4IUU A;  1K8A C;  4M75 D;  2D0Q B;  3DLM A;  3CPW S;  1W2B S;  4MMK A;  2QQR A;  2XDP A;  2LRQ A;  4KUI A;  1V29 B;  4ELY C;  2VC8 A;  2NLU A;  4M78 D;  4KT0 E;  2RI2 A;  3LW5 E;  2B8A A;  2QI2 A;  4WF2 A;  1IZ6 A;  3CMA A;  2DZC A;  1Q86 U;  3L1A A;  1KQS S;  3E9G A;  2PVO B;  1LNX A;  3QSU A;  3RKW A;  1Y96 A;  3CCU T;  2X4Y A;  4X9C A;  3JB9 I;  4J6W A;  1VUB A;  2KSS A;  4QQD A;  1WNL A;  1Q82 U;  4LDU A;  3HSB A;  1UEB A;  2F5T X;  2E64 A;  1KC8 U;  5LJ5 f;  3OA6 A;  2ZZD A;  4IUV A;  4DOW A;  5AYF A;  2Y4X A;  4C92 D;  3JCM e;  5GMK e;  2QTX A;  5CKE A;  3H6Z A;  3V8L A;  4M77 F;  3OYA A;  2DTO A;  3SWN C;  1YJN T;  4YTL A;  3OYK A;  1Y71 A;  2XKO C;  3CCL A;  3A8L B;  4XAX B;  4J83 A;  2CGH A;  1U1T A;  1WQ7 A;  2LDM A;  1YIJ A;  1JJ2 S;  3S3M A;  5GAO l;  3P8D A;  3M57 A;  4FT4 A;  4M7D G;  4XTW A;  2AHJ B;  3G6E A;  1G3W A;  3FDR A;  3ZBD A;  2RHZ A;  2V8I A;  2O01 E;  1O75 A;  3MO8 A;  3HRT A;  1TH7 A;  5GAM e;  3CXC S;  3G4S T;  2LQ8 A;  3P8B B;  4ATO A;  1YJ9 A;  3OYI A;  4M7A F;  3VUZ A;  4JLG A;  4EMK C;  1P92 A;  2XG8 D;  2RJE A;  3OBW A;  3HKS A;  4B9X A;  4BB7 A;  3OS0 A;  4PLI A;  1M4Z A;  4BUG A;  4ZGJ B;  5J3B A;  5FLX E;  2K3Y A;  3BY7 A;  3KUF A;  2EYQ A;  3MEV A;  4N0A A;  4N4G A;  4C5I A;  2K3X A;  3SB2 A;  4ZN3 A;  3J81 E;  1VQ6 T;  2EQU A;  1VQO T;  2GCX A;  2PUK B;  3QZ9 B;  4RMO A;  3KBG A;  2DZ9 A;  1N6A A;  1WPY A;  3CCR T;  4VUB A;  3CPW A;  2ZPF B;  1M1G A;  5GAM g;  2K57 A;  1QVP A;  4PLL A;  4XU0 A;  5GMK h;  4FT2 A;  4PJO B;  2VGM A;  4ZGE B;  2KY9 A;  1N8R U;  1KD1 U;  2E10 A;  4M78 B;  1NE8 A;  5HY6 A;  5CKH A;  1PSF A;  4M7D A;  3OW2 A;  2K4Y A;  2RI3 A;  4F7U A;  2L5Q A;  5GAN 5;  1VQM A;  2CYZ B;  2DD5 A;  2K5L A;  4X34 A;  5GAN e;  1JB0 E;  3CC4 T;  4KUL A;  3OY9 A;  5GAN 4;  4KUD K;  1S72 T;  4BE2 A;  2RK1 A;  2OTL T;  3CME T;  3PGG A;  2L89 A;  3MP1 A;  1W4S A;  2LC4 A;  4Y28 E;  5GAM h;  3I55 T;  2FB7 A;  2YLC A;  2JVV A;  3ER0 A;  3BDL A;  5DY9 A;  1BYM A;  2P0P A;  2JN0 A;  3PMT A;  4C92 B;  2A3L A;  4IKF A;  5LJ3 f;  4XTU A;  3UWN A;  2ZGW A;  2RD1 A;  4BY6 B;  4OP0 A;  3AHU A;  4ZTJ A;  1M1F A;  2P0Q A;  5GAN g;  4E7I A;  2BUD A;  3SWN A;  5C6S A;  4HCC A;  3DB4 A;  2KVQ G;  4RG2 A;  2XDB A;  4Z02 A;  5A0G A;  2QXF A;  3QXE B;  3V8J A;  2JZ2 A;  2FL7 A;  4C0G A;  5GMK i;  5LJ5 e;  4LD6 A;  3L2Q A;  2PU9 B;  4Y91 A;  1YHQ T;  4HCB A;  3CXC A;  2DTI A;  4CI0 C;  3M58 A;  3CCV T;  3LGF A;  1XNI A;  4L5G A;  3RES A;  3JRZ A;  1H3Z A;  4OMF B;  4IUP A;  4J6X A;  3QO3 A;  4C5G A;  5A0L A;  3OYN A;  5GAN h;  2M9U A;  5GMK j;  4EMK A;  2F69 A;  2XU8 A;  2R58 A;  2GF7 A;  3LLR A;  3NTK A;  2M1H A;  3GNF B;  3CBM A;  2HD0 A;  3S3N A;  1K73 C;  3FJP A;  4J6Y A;  4A54 A;  4J7F A;  3MCA B;  1XTD A;  4ZGD B;  4M7D E;  2F5K A;  5DLQ E;  3X26 B;  5GAN 6;  3FEO A;  1YBY A;  2PUO B;  4M75 F;  4Q5W A;  4X9D A;  3HRU A;  1VQP T;  5CO7 A;  3INZ A;  3RER A;  3C94 A;  5GAN 3;  2JNG A;  5GAO q;  4A53 A;  1YJN A;  4TVR A;  4M7A B;  3LGL A;  3UT1 A;  2RI5 A;  1QVG S;  1KC8 C;  2WSC E;  4J5Y A;  2Y90 A;  5GAM j;  3OYF A;  3H8Z A;  2FYK A;  3A8G B;  5D6X A;  4EDU A;  4E7K A;  1LOJ A;  3CBP A;  3NTI A;  3L42 A;  5CQY A;  4DQ2 A;  5A2Q E;  1YCY A;  3JCM P;  2MMP A;  2VUB A;  3CEY A;  3E1S A;  2BKD N;  3NTH A;  4ZN1 A;  2XDD A;  3CCS T;  1ZBX A;  5GAO m;  4PJO G;  1Q81 C;  2VXE A;  2I2L A;  4M78 G;  4C0D C;  3G4S A;  4C0Z A;  2ZPI B;  1QVF A;  1FWZ A;  4C8Q G;  3BW1 A;  4M7D C;  2QQS A;  3ZFJ A;  1OI1 A;  1VQL T;  3BFM A;  2PQW A;  5CIU A;  4QVC A;  3JB9 G;  4C92 F;  4XU2 A;  5CVI A;  4EMH A;  2YRV A;  1VQ6 A;  3QJY A;  1VQO A;  3RIR A;  3OSV A;  3A5Z B;  1I8F A;  5L8R E;  4P5N A;  1D3B B;  4O6J A;  3CCR A;  1VQ8 T;  4IUQ A;  3M9Q A;  3HFN A;  1M90 U;  5GAN j;  4BI4 A;  2EQM A;  2QA4 T;  2DJZ A;  3PNW C;  4UC4 A;  3CCE T;  1KHI A;  2EFI A;  4XTX A;  2X4W A;  4MML A;  3S3O A;  2XI9 A;  4IUT A;  3FIF A;  1G3S A;  2L3R A;  3LX7 A;  3JCM W;  2LVM A;  4O5V A;  2EJG A;  3G71 T;  2WSE E;  4JS4 A;  3CC4 A;  4PJO A;  2XHC A;  3L2W A;  3CCM T;  5HKC A;  1WJQ A;  3ME9 A;  5LJ3 e;  1S72 A;  5FU6 B;  2X4J A;  2E6N A;  2OTL A;  2KAF A;  4XTY A;  3CME A;  2P4T A;  1VQ9 T;  3MP6 A;  4C8Q A;  2E5Q A;  3WVE B;  3I55 A;  3I56 T;  2FHD A;  1BIB A;  2XK0 A;  3VJP A;  3KXT A;  2EJ9 A;  4M77 G;  2G3R A;  4DOV A;  1OYX A;  3JCM g;  4R55 A;  3G6E T;  4JDS A;  4N4I A;  4JRI A;  2E6Z A;  5LJ5 j;  2MWP A;  1PSE A;  3VUB A;  5DM7 R;  1QVG A;  4OB3 B;  1LJO A;  4A4F A;  1VQ7 T;  4F7U F;  5LJ3 g;  1K8A U;  5LL6 S;  3VKI A;  2IVW A;  4BE1 A;  2Y4Y A;  4KBM B;  3OYD A;  5I21 A;  2RJF A;  2KMT A;  3LYI A;  3N5B B;  3EFR A;  1YHQ A;  1KQ1 A;  2OTJ T;  1W2B A;  3CCV A;  4M7A G;  4NOY A;  4M75 B;  1DJ7 B;  5GAO r;  3JCM h;  3OS2 A;  2HQE A;  2KQW A;  3L2R A;  4RCB A;  2LCC A;  3OMC A;  5GMK l;  3OYC A;  4M7D D;  3M4G A;  3M56 A;  3OSS C;  2WSF E;  1VQK A;  5LJ3 h;  4XQ3 A;  1Y96 B;  4FU6 A;  3M53 A;  4ME7 A;  5FU7 B;  3SDZ A;  1HXD A;  3MEU A;  4M77 A;  1KQS A;  1FXX A;  3V8K A;  3FB9 A;  2QEX T;  3M55 A;  2WAC A;  4RKU E;  5DLO A;  3OYM A;  3DB3 A;  4LDW A;  3A8O B;  5KE3 A;  5FRM A;  1VQP A;  4PJO E;  1H64 1;  3OBY A;  3QPH A;  4L59 A;  4M78 E;  2QQB A;  3A8M B;  4XTZ A;  2QQ9 A;  2DIG A;  3OS1 A;  4BDY A;  2RJC A;  1SSF A;  2EAY A;  4C8Q E;  3E19 A;  4BE0 A;  4B9W A;  1G3Y A;  1NJI U;  1I5L A;  3JCM J;  3HHT B;  4BD3 A;  3CCS A;  3CD6 T;  5IN1 A;  1UB4 A;  4M7A A;  2MF2 A;  4N4H A;  3HPW A;  3VU3 C;  4GY5 A;  5HK3 A;  1Q7Y U;  2EIF A;  5CKF A;  4OVA A;  5GAN 8;  3JCM X;  1JJ2 A;  3T9N A;  3CBO A;  1K9M C;  3QBY A;  1NZ9 A;  3X25 B;  1YIT T;  3GLX A;  4NS5 A;  4JRQ A;  1X75 C;  4JRK A;  3OYJ A;  3OYE A;  1VQN T;  2O4X B;  3QUI A;  5CR2 A;  1WJR A;  2LT4 A;  3PIP A;  1VQ5 T;  3VV0 A;  1VQL A;  4MDX A;  2DXC A;  2DXU A;  4PJO C;  4BAC A;  4M78 C;  3HFO A;  2K5I A;  3R6O A;  3CCU A;  1R8O B;  3JCM Q;  1VQ8 A;  3MHX A;  2LTO A;  5KCH A;  4C8Q C;  4FL6 A;  5CK9 A;  1WJS A;  2GQV A;  2X4X A;  3TCJ A;  1UGQ B;  2LX9 A;  2QA4 A;  4A4G A;  3CCE A;  5LJ3 j;  4E7L A;  1Q86 C;  5KH6 A;  4HT9 A;  3M59 A;  1D3B A;  5I2S A;  2E65 A;  2DD4 A;  5LJ5 g;  4M77 E;  2RHY A;  4MZP A;  4OGC A;  1RI0 A;  3G71 A;  4JUV A;  2P0K A;  2RJD A;  4MDW A;  3CCJ T;  4JJN K;  4II1 A;  4XU1 A;  3CCM A;  4JRP A;  1Q82 C;  4A4H A;  2XID A;  5GAO p;  4HKE A;  1NPR A;  4LDY A;  4F7U B;  1YI2 T;  3OYH A;  1VQ9 A;  3QYH B;  1Y7X A;  5KE2 A;  3PIO A;  3CC7 T;  3I56 A;  3GIB A;  2IG0 A;  4QQG A;  1B34 B;  4M75 G;  5J39 A;  2YHT A;  4GLK A;  1XQH A;  2EKO A;  2M16 A;  4BI8 B;  3OYY A;  2MI6 A;  2D9T A;  5LJ5 h;  5GAN 7;  3LWI A;  4XTV A;  3CC2 T;  4RCC A;  3X20 B;  4M7A E;  5GAO n;  3ASK A;  3RUX A;  3S6W A;  2DXB A;  3QHS A;  4L6V 5;  3JCM V;  2A7Y A;  4OB1 B;  1M1K U;  2X35 A;  3JCM d;  3M4Y A;  3DKM A;  5CCA A;  1VQ7 A;  1U1S A;  1GXI E;  1UGP B;  3FRN A;  4M77 C;  1OZ3 A;  4ZTF A;  2RH2 A;  4QW2 A;  3JB9 H;  1N9R A;  5CQX A;  3JB9 J;  4JLI A;  3MEA A;  2L8D A;  1ZQ1 A;  3SWN B;  2E41 A;  3FC3 A;  3C4S A;  1YJW T;  1QP3 A;  2RA2 A;  2OTJ A;  5CKB A;  1OZ2 A;  3HP9 A;  5CAI A;  4OB2 B;  4BDZ A;  3SFM A;  4C92 G;  5GAM d;  4MZM A;  1VIE A;  2HNI A;  4PL6 A;  4QVZ A;  4PJO D;  3X24 B;  3PT9 A;  4M75 A;  2HBP A;  5GMK m;  1M9S A;  2CZ0 B;  4M7A C;  1U8R A;  2ZPH B;  2QEX A;  1K73 U;  4EMK B;  2E12 A;  2JOY A;  4M78 A;  4C8Q D;  4E7H A;  1ZHI A;  4HT8 A;  1K9M U;  3OW2 S;  1KQ2 A;  2RHX A;  3UDC A;  4J7I A;  1G3T A;  3JB9 D;  2DKG A;  1N8R C;  1KD1 C;  1FX7 A;  3V7R A;  2PVG B;  2HQX A;  3CPF A;  5J26 A;  1M5Q 1;  1NPP A;  4CRI A;  1N27 A;  2KK4 A;  3QDR B;  1BI1 A;  3NFC A;  3RMQ A;  2LCL A;  5FRO A;  1WGS A;  5CKD A;  3WVD B;  3OYG A;  1Q81 U;  4C0F A;  1O9S A;  3CD6 A;  3V7C A;  3URG A;  4OB0 B;  4NL3 A;  2YLB A;  3OYL A;  3CCQ A;  4NL2 A;  3RKY A;  5FRN A;  4M7D F;  2GFA A;  2ZPB B;  5IT9 E;  4LDV A;  4D6W A;  4C92 A;  2CZ7 B;  5GAN d;  1VQ4 T;  2DVE A;  3M54 A;  1YIT A;  4E47 A;  3PMI A;  1NJI C;  4XK8 E;  1VQN A;  3JCM b;  3RMS A;  2DXT A;  2QQA A;  1VQ5 A;  5HK0 A;  4C5E A;  3QKJ A;  4V2S A;  3QJ6 A;  1KHC A;  5I2M A;  1Q7Y C;  1RL2 A;  2CS7 A;  2FVU A;  4F7U G;  1VIF A;  2EWN A;  2MWO A;  4JS5 A;  3GP8 A;  2RO0 A;  3PFS A;  2O4X A;  4M77 D;  2DAQ A;  3C12 A;  2DIQ A;  2R5M A;  5IAY A;  2CZ6 B;  3L2V A;  1UGS B;  4LDX A;  2DK3 A;  2JTM A;  2M0O A;  1JBM A;  3G7Z A;  3Q1J A;  4OF1 A;  2XD0 A;  2CKK A;  2RHU A;  5FU6 C;  3JCM c;  4M75 E;  3CMA T;  4PNO A;  2KDS A;  3ZEH A;  2EJF A;  4QQ6 A;  3WXM B;  3EAE A;  3OYB A;  1HK9 A;  3LH0 A;  3V7S A;  3LWH A;  1BI2 A;  2JTF A;  5LJ5 d;  3CCJ A;  1MHN A;  2R5A A;  3GNG A;  4E7J A;  4R56 A;  2ZPG B;  1JRI A;  1YI2 A;  2DTH A;  4IUR A;  3HL8 A;  1BIA A;  4M7A D;  1EIF A;  3QG1 A;  3CC7 A;  3A8H B;  1BKB A;  3VYH B;  3OB9 A;  2D6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...