5CR2A

E. coli mazf in complex with single strand dna substrate analog
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
b'VSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 24
structure length 111
sequence length 111
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cr2A00
4ELZC 5HK0A 5CKFA 3VUBA 4MDXA 3HPWA 5HK3A 5CQXA 2VUBA 1X75C 5CK9A 3NFCA 5CKHA 4ME7A 5CKBA 1VUBA 5CO7A 5CQYA 5HKCA 5CR2A 4MZPA 2KMTA 5DLOA 3JSCA 4MZTA 4ELYC 3G7ZA 1NE8A 4OF1A 4VUBA 3TCJA 5CKDA 2MF2A 1M1FA 1UB4A 3JRZA 5CKEA 5CCAA 4MZMA 4HKEA 2C06A
chains in the Genus database with same CATH superfamily
4M7AC 1PRLC 3VUBA 3DB3A 1MNEA 2DD5A 3CMAT 1BKBA 2E5QA 4BE1A 4A4GA 4HXJA 1CKAA 1BCMA 2OTLT 2DERA 1M4ZA 2VGNA 4R0KA 5GANj 2OAUA 2NYSA 3PMTA 2MF2A 2JTEA 2A08A 3M57A 2B86A 2P0QA 3CCJQ 5KE2A 2RQWA 2X4WA 3CCSQ 1OOTA 4M7DE 2MPXC 1VYVA 4PJOD 5GANd 1BB9A 3CCRA 2RK1A 3BE3A 3OYCA 4HVVA 3E1SA 1SPKA 4PKCC 1VQ8Q 1WHLA 2MCNA 2FL7A 1SSHA 1BI1A 4BY6B 2EYYA 1Y96A 4CC4B 5IXFA 3M0QA 2EKHA 1W2BP 3WXMB 3EG2A 3CMEA 1WPYA 3OS1A 2KT8A 4OMMA 1SKUB 2R5AA 4XU0A 1KFZA 5LJ5h 1PWTA 2OAWA 1I5LA 3OSVA 3C4SA 2VASA 4M77A 1FWZA 4Z8AA 2YXYA 4PFOA 1Y71A 4J7FA 2JMCA 2HDAA 1VQOQ 1RAAB 1M3AA 1QWFA 2W0ZA 1K1ZA 1WA7A 3EFRA 1YHQA 3EG3A 1PD0A 2EGAA 3NGPA 2K9GA 4AFUC 1H3HA 2PVGB 4A63B 1X6BA 3VS0A 4KUIA 3QO3A 1K0XA 3VS4A 3MEWA 2DMOA 2J06A 5AYFA 4ATOA 2V26A 1K0SA 4IUPA 4M75F 5CQYA 5GAMe 5KYNA 2HMAA 3OYLA 4XU3A 3VS2A 3CCVA 1JXOA 3X24B 4C8QF 2QQSA 4V2SA 2DL3A 2JNGA 3VRZA 3L42A 2YWWA 4FW2A 1YJNA 3CCEA 2DIQA 2DRMA 2DJZA 3CCRT 3O8VA 3V7SA 2O88A 3H8ZA 2LJ0A 2JXBA 4EMKB 3O5ZA 4LD6A 4DBHA 1WDXA 2O9VA 4C92B 3OA6A 3CBMA 2RO0A 1GBQA 3G4SA 3R6NA 4R55A 4ELZC 4BE2A 3QWXX 5GAN7 3CMET 4XK8E 3RMSA 2W10A 4X9CA 3EGUA 3EFOA 3FJPA 3OYBA 4XTXA 4LE9A 5GAOq 3JCMh 1TSFA 3OYJA 2RQTA 2DIGA 5IXBA 5HK0A 1YHQT 4D8DA 4C5IA 3CC7Q 4TVRA 3WVDB 3CCLT 1XOVA 2X4JA 4OB3B 3WVEB 4ME7A 4LDUA 1R0BG 5LJ3d 4XQ3A 1T0HA 1N27A 1Q81R 2ZZDA 4RKUE 4M7DA 3GLXA 2QQ9A 3CCQA 1YIJQ 3MPUB 3JCMJ 1V1CA 2YDLA 1KQ1A 2EAYA 2VWFA 3CXCP 3SWNB 4M77B 2RK2A 1UEBA 5C6SA 2GF7A 2FZKB 4BI3A 4E7LA 2H3EB 1VQNQ 1VQ6Q 1YI2A 1YJ9Q 2D8HA 3QIIA 5GAOp 1YWOA 2HKQB 5FRNA 1YJNT 1UJYA 2WSEE 4C92C 1X2KA 4PJMA 3CD6A 1EZZB 4QKUA 3CCET 2PNIA 2FYKA 3QJ6A 2ATCB 5L8RE 2XDPA 3A8OB 2M02A 1UTIA 1QP3A 2F5TX 3QDRB 4J9IA 3G4ST 3FC3A 3E9FA 2CP3A 2AZVA 2V1QA 1NLPC 4FM4B 4EDUA 4XTWA 2MYSA 1PKTA 1ZQ1A 4JLIA 5KYYA 2FRYA 1M1GA 4F7UG 4E47A 1D1BA 4RTTA 1YJWQ 4J9GA 2QQRA 2DFUA 3G71A 2FPDA 4M7AE 4KUDK 2EJ9A 2EQUA 3F70A 2DX1A 3H6ZA 2DTIA 4X1VA 1TUCA 2GTOA 3RNJA 4D6WA 2EQKA 1Q82R 3D7SB 3SWNC 4DQ2A 1Z9ZA 4J8OA 4JPBW 2XICA 2LP5A 1ZA2B 3CCQT 1EFNA 1U1SA 2E64A 1QLYA 5I22A 1VQ4A 1VQLA 2B8AA 2JS0A 3CMAQ 2V1RA 2GBQA 4MMLA 2K2MA 2OTLQ 1JU5C 2GFAA 1YCSB 4HCCA 1IHWA 4OGCA 3MCAB 2EGEA 1AZGB 3LWHA 2J6OA 3V7RA 2ZCFB 3CD6T 5GAMj 2J05A 2MWPA 4Z89A 2H8HA 3I56A 2X3WD 3RESA 3LH5A 3SEMA 3TSWA 1KJWA 5LJ5e 2LQNA 1VQKA 2D6FA 1X01A 4PJOB 4M7DB 2OTJA 2KEAA 3AT1B 4R56A 2YUPA 1QCNA 4KGXB 4LUEA 4JRPA 1WHKA 1KSWA 2QI2A 4M75D 2JM9A 3M4YA 2I2LA 2QGFB 3RKYA 1CSKA 2DL5A 2YUOA 1MMNA 5GANf 4C8QD 3L2UA 2KYMA 2FG0A 2HEQA 2I0NA 1AWOA 4FT4A 2A3LA 3G71T 1H8KA 3OYYA 4AFSC 4CI0C 2K79A 2DNUA 3NTKA 3M54A 4E7HA 4M78E 3QZ5B 2V8JA 4IUTA 2XD0A 2KI7A 1UFFA 2ED1A 4A4KA 3DLLA 2SRCA 3JCMV 1KQSS 4MDXA 2A36A 4XU2A 2RI2A 2L3RA 4PL6A 2RJCA 4BE0A 1VQ4T 1GCQC 1VQLT 5KYYB 1J3TA 1X69A 2BIVA 5I11A 1ZSZA 1TUGB 2M0YA 2RM4A 1WHHA 3URGA 3L1AA 4IUUA 1NYGA 2YUQA 3L2RA 1HK9A 2PUOB 3VS5A 1ZUKA 4FU6A 3OYEA 4HCKA 4JS5A 3MP6A 2VGMA 1W2BA 2AIRB 1VQKT 3M0UA 4NOYA 3JCMQ 1K9MU 2OTJT 1AT1B 3CCRQ 3JCMe 4MZPA 2LX9A 3BDUA 3HFNA 4ESRA 4XTVA 3LH0A 4M7AA 2L3QA 1SSFA 2VVKA 2JW4A 2EKOA 2YSQA 2Y4YA 2FB7A 5CKEA 2O4XA 4LDVA 3EAEA 1GCPA 3M0PA 3CMEQ 1TUDA 1AWXA 4J6YA 1P92A 2JZ2A 4OVAA 3VKIA 2HAXA 1RAHB 4FL6A 5L23A 5D6XA 4OMNA 4AMCA 3EHQA 3OS0A 1QMCA 4L5GA 2G6FX 2JTFA 1DJ7B 1FX7A 2RJEA 1YHQQ 3BW1A 2ROLA 4ZN1A 3CCLQ 2LNVA 5IAYA 2E5KA 1OEBA 3FB9A 4J7IA 1VQ9A 1KD1C 1AEYA 3JAME 1S72Q 4JJBA 1M90C 2QQAA 3OYDA 1UUEA 4J5YA 4C5HA 2YLCA 2HL3A 3OSSC 4ZTFA 1HD3A 1M3BA 1M3CA 4FCYA 2KRSA 2RN8A 4YTLA 4HKEA 2VKNA 2RHUA 4CC3A 1IGUA 1QVFS 1WHGA 2QK0A 3A8MB 3UA6A 1Z9QA 1YJNQ 1M8MA 3CCEQ 2K2VA 2QQBA 3CPWS 2J6KA 2JVVA 2GQVA 2E65A 4WCIA 4PJLA 1RI0A 4X9DA 5DLQE 2M0OA 3SDZA 2P4TA 3PVLA 1Q7YC 3M58A 1IO6A 2CUDA 5GAN4 4M78A 3RERA 3G4SQ 4M77D 5FU6B 2IVWA 4QQDA 5GANg 1AVZC 3N5BB 4D8KA 3Q1JA 2DAQA 2EQMA 3X26B 5LJ5j 4BDZA 2LX7A 5GAOl 3HSBA 1VQ7A 2DO3A 3JSCA 2PTKA 5KYXA 2A0FB 1JB0E 3LW5E 1IB8A 2ABLA 4F7UF 5LJ5d 1NEBA 1N9SA 2QEXA 1FYNA 1RUWA 3JCMc 1GFCA 2DBKA 3CXCA 2BZYA 1I8FA 4IURA 2EYZA 2DTHA 2L3SA 2XDBA 2L2PA 3BY7A 2GNCA 4FIBA 1VQ9T 2O4XB 3HRTA 4C92G 1K73U 4OMFB 4GY5A 1E6HA 3JV3A 4ZTJA 1VQMA 2HSEB 1PSFA 1IRXA 2DA9A 2JOYA 5GMKl 3CCQQ 1G3TA 4RCBA 1SG5A 2CSIA 2K7AA 2KSSA 1UJ0A 4E6RA 3CQTA 2EVRA 1IZ6A 3ZL7C 1NJIC 5CR2A 2DF6A 1U06A 4OMOA 3OBWA 4RTUA 3RKWA 3CD6Q 1M5Q1 4AT1B 6AT1B 3NPFA 1WJRA 2MI6A 2IPOB 4QT7A 3RMQA 3RDVA 3VUZA 1X6OA 4FT2A 4L59A 2CH4W 1YP5A 4M75B 1Q7YU 4RTXA 3VRYA 3VV0A 3RIRA 1VQ7T 2KK4A 2YRDA 1LNXA 3JRZA 4OMQA 3OYAA 4C8QB 4MDWA 3M55A 5GAMf 3A1PA 4RTVA 2PU9B 3G71Q 1N6AA 4M7AF 2QEXT 4M7DD 3JCMd 3JB9F 3EH1A 2RQRA 2A7YA 1N8RU 4DOWA 2BTTA 2X4XA 4JJCA 4P5NA 4C5EA 2RHIA 2DXUA 4BACA 4FYWB 1VQMT 1AZEA 1G3YA 4LNPA 1WXBA 4JRQA 4N0AA 5KYXB 1VQ4Q 1OU8A 1VQLQ 4J9HA 5LJ3g 3RBBB 2DXCA 3QJYA 1BIBA 2JT4A 2J7IA 3QUIA 1D3BA 2DYIA 1GRIA 4RG8A 1JRIA 1ZX6A 2CP0A 1WLPB 1O9SA 1UB4A 2OJ2A 4KH1B 5IN1A 1RAGB 1KQSP 1VQPQ 1VQKQ 2OTJQ 1TWBA 4EPCA 2YUNA 2K4YA 3UATA 4MMKA 2ZAEA 4K11A 1K8AC 3CCUA 5A2QE 3GNFB 1JQQA 1E6GA 2RF0A 4ELYC 1Y57A 1Y0MA 3EG9A 1RABB 2E10A 1KQ2A 2LCCA 4FSXA 1PSEA 1M30A 3I5SA 1YFNA 2ZPHB 8ATCB 2F2VA 1GBRA 2J6FA 4RCCA 3CC4A 2CREA 5I21A 1K9MR 1B7TA 4OGEA 3VS6A 2QA4A 3H0IA 4BY6C 1PHTA 3EFSA 3HRUA 2EPDA 2M16A 2NUPA 4M78F 3P8BB 3TQ7P 1UGPB 1RLPC 4PJOG 2C06A 5GAN2 1MMAA 2HBWA 2FZCB 3FJ5A 4HCZA 4HT8A 1W6XA 2C0OA 1BK2A 5HKCA 3H9NA 2DE0X 3UDCA 4J9BA 3LGLA 2VXEA 1ACMB 3OQ5A 2HZYA 3DLMA 3G6EA 5LL6S 1MV0B 2AHJB 3QXEB 1O75A 2HQEA 4F7UE 2MOXA 3C12A 2DM1A 4LXCA 3EGXA 1B3QA 1VUBA 7AT1B 4BUGA 1Y96B 1G2BA 3OYNA 4J9EA 3CCUT 3PT9A 2R58A 3CCVT 1I81A 4WTOB 1R77A 1PKSA 2DXBA 3E19A 1UGVA 2P0PA 5KYUA 3GP8A 1D3BB 4JJNK 2JMAA 4WF2A 3SB2A 2LDMA 2O01E 3LGFA 5GAMg 1KK7A 1QVFP 1OZ2A 1OX8A 2EQJA 4EMKC 1ZUYA 3QWYA 5ECAA 1WXUA 2EYWA 2LCSA 1Q86C 1VYUA 2QA4T 3CPWP 2WACA 3HRSA 2YHTA 3C0CA 5HCKA 3MEUA 2GGRA 4QVZA 4O6JA 4C0DB 1OYXA 2XMFA 1VYTA 2IG0A 4CC2A 4NL3A 2RI5A 2K5FA 5J26A 1SRMA 4A4FA 1M2VA 2DKGA 2ED0A 1LVKA 1PC0A 2E12A 2KRNA 3OMGA 4EIKA 4B6MA 1OV3A 1IGQA 1E7OA 5GAOr 2E1HA 5D6WA 1U5SA 5LJ5f 1WHJA 3OYIA 3G6ET 3SD4A 5FLXE 1NYFA 1ZUUA 3HKSA 2LQ8A 3J80E 2KNBB 2ROTA 5IHNA 2PUKB 2NUPB 2RHZA 1MNDA 2DZ9A 4M7AD 1SRLA 2V8IA 2DJQA 2LZ6B 2IIMA 1K73R 2RB6A 2EW3A 3M0RA 3JB9D 2X9HA 1NE8A 4M77C 3CCJA 3EG1A 2H3JA 3DKMA 1PRMC 1M90R 1YCYA 4OMPA 3EFOB 1B34A 2KDSA 3HPWA 3C95A 1SHGA 3L2ZA 1WYXA 2YLBA 2FO0A 5FU7B 2XG8D 1YI2T 2F1LA 4E7KA 5DY9A 1VQ7Q 1NPPA 3JCMP 5GMKi 1RAIB 3EGXB 3OYGA 2JUFA 2NWMA 4E2FB 3SHWA 2AT1B 3MKDA 1Q86U 2K3YA 2CT3A 1X27A 5J39A 3REBB 1I5OB 2WSFE 5GAMd 4J83A 5FW9A 1GXIE 2KGTA 1VQOA 4F7UA 2E3IA 1Q7YR 3MEVA 2DL7A 4KT0E 4ZGEB 5KYUB 1EIFA 1MGQA 2M1HA 3NTHA 1VQMQ 1G3SA 4JDSA 1WJSA 4QQ6A 3TSZA 3JCMf 3QKJA 1FMKA 4GLKA 5CKHA 1QCFA 1BI3A 1R8OB 1ZBJA 1KC8C 3M5AA 2QGGA 3PMIA 5I2SA 1N8RR 2LJ1A 1M2VB 1RI9A 4B9XA 4M78D 2ENMA 3THKA 2EYQA 1HXDA 4A4EA 1D1CA 3OW2S 5CAIA 3CCJT 4HVWA 2E41A 5GAN8 3MHXA 3PTAA 4BI8B 2KXCA 1Q95G 3VS3A 3OS2A 4FYVB 2RA2A 2DL8A 2O2OA 1QWEA 2A37A 2JN0A 4PJOC 1K9AA 4M7DC 2CKKA 2QDYB 2QG9B 1QVGS 1UGQB 1YBYA 2YRCA 2XDDA 3I56T 2F2WA 1TH7A 3UA7A 4HVUA 2RJFA 2ZGWA 2PVDB 4RTWA 2X35A 4F16A 4DA4A 1RL2A 2E6ZA 1B34B 2VYTA 3QHSA 4HCBA 2QTVA 3GOXA 5KYWA 2EJFA 4IIOA 1MMDA 5LJ5g 2DILA 4FW1A 3V8LA 3OB9A 4M75G 3CC2A 3RR6A 3SFMA 5CVIA 1W1FA 1WIEA 1KQSA 2E70A 4PFZA 3S3MA 1VQ5A 4C8QG 3OYMA 1QQJA 4OB1B 1KC8U 3NHNA 1X2QA 4F7UB 1VQNA 1U8RA 4QVCA 1I4K1 2O9SA 1VQ6A 4DEXA 2HQXA 1PG5B 2FPEA 2C0IA 5I2MA 3E9GA 2CGHA 2P4RA 2RI3A 1QKWA 2NLUA 2KMTA 1OZ3A 1TTHB 1JJ2S 4C92E 4A53A 2COYA 4E7IA 1W4SA 1ZSGA 2DYBA 2HL5C 3QPHA 3CCVQ 1Q82C 3META 2K3XA 3EH2A 4JRIA 4J6WA 1KIKA 5GJVB 2KQWA 3DB4A 3S6WA 4B9WA 4N4HA 1RLQC 4A54A 1NPRA 3LYIA 2E4HA 2X51A 1BBZA 3RUXA 1D0YA 3LWIA 3OYKA 4MZMA 1KG1A 1ZSZB 3PIOA 2L5QA 1ZLMA 2AKLA 1K4US 4FYXB 5IHIA 3INZA 3JCMg 1UGRB 3CC2T 1LOJA 3PFSA 3J7AF 2LQKA 2D8JA 3MEAA 3G6EQ 4RMOA 1VQ5T 4M77E 1G83A 3I35A 2CZ6B 4ZGDB 1GL5A 4FSSA 1XJWB 1VQNT 4EMHA 3CBOA 1VQ6T 4M7AB 3H0HA 1BI2A 3PNWC 3JCMb 2M9UA 5KYWB 2FPFA 2DEUA 2DPPB 3OYHA 3PE0A 1IXDA 2RNAA 1QVFA 3NMZC 2XIDA 4QQGA 3JCMW 3TU4K 3QDFA 1KD1U 1SF9A 4ZN3A 3JCMX 3S3NA 3KXTA 3CPWA 2RQUA 1M90U 4XTUA 3HL8A 1NZ9A 2Y90A 5CK9A 1PNJA 5FWCA 3OMCA 2D1XA 4M4ZA 1M9SA 1YI2Q 2KRMA 3JB9J 3ASKA 3FLGA 2CZ0B 1ZSZC 3C94A 5FU6C 2VB6A 2F5KA 3GBQA 4C0ZA 2QTXA 3MJXA 1YITA 2GCXA 1D0XA 2R5MA 5HK3A 3JB9I 4Q5WA 1AWWA 2CYZB 2RQVA 4BD3A 1OPKA 2COWA 4JLGA 1MHNA 5GAOn 1BU1A 1TS9A 4PK4A 2HD0A 3GF5A 1WQ7A 4M77G 4AFZC 4QW2A 1PD1A 1ZHIA 4EMKA 1N9RA 2EIFA 4C92A 1Q86R 3QYGB 1U1TA 1F1BB 2FZGB 4E7ZA 3JB9H 5CKBA 2X4YA 1K76A 2BZXA 4IUVA 2QYZA 4BI4A 5KE3A 3I5RA 4MZTA 3PIPA 4PNOA 2YT6A 4M78B 4VUBA 1M1FA 3S3OA 1WZOA 5C0MA 4F14A 3VYHB 4PJOE 2RD1A 3CCMA 1WJQA 2P84A 2CP7A 3KUFA 4Y28E 2DXTA 1V29B 1RADB 3M59A 3M56A 3FIFA 2CT4A 3VYGA 2GFUA 4DEYA 3TCJA 5CKDA 1TOVA 1UGSB 3A5ZB 1FMWA 2X3XD 1NJIU 3OW2P 1YITT 4AG1C 1TXQA 3I56Q 1UHFA 4M75C 3MO8A 3SWNA 3VU3C 4JRKA 2EJGA 4KRTA 2K5IA 1M1KC 3AHUA 3A8LB 4C8QC 3CBPA 2CUBA 2CH4A 2F2XA 2MMPA 3CCLA 2KT1A 1D1AA 3I55A 4F17A 4LUDA 2KBTA 1OI1A 3ME9A 1QVGP 1S72A 1X75C 4JZ3A 3NFCA 1PM3A 2RPNA 2DVEA 4N4GA 4C0GA 4OP0A 4M78C 3OBYA 1N5ZA 4O5VA 3T9NA 2KE9A 4XU1A 1FXXA 2BZ8A 3ZBDA 2CP6A 2LQWA 2EQIA 1TG0A 3M9QA 4M7DG 3REAB 1M2OA 4AFQC 2LNHB 3H41A 2JM8A 3HP9A 4II1A 3CEYA 1QCOA 3CCMT 1QW1A 5KCHA 3BDLA 3M53A 2DK3A 4QVDA 4HT9A 2XKOC 4OMLA 2KY9A 5GMKh 4C5GA 4IKFA 3LX7A 1KC8R 1LJOA 3U23A 3V7CA 2JJ9A 1QP2A 2HKNA 3V8JA 4L6V5 4KH0B 3G1JA 4GBQA 4HA8A 1TU0B 2COZA 5GANh 1I1JA 4IIMA 2K3BA 2LJ3A 3I9QA 5LJ3j 1JJ2P 5A0GA 1GCQA 2DETA 2DVJA 2K6DA 2FVUA 5EG2A 1K8AU 1M1KU 5GAOm 2LCLA 3FDRA 3HTRA 3QYHB 3I55T 5EC7A 3BFMA 2AKKA 3OYFA 4CRIA 2K57A 1S72T 4PJNA 3CC2Q 1I0CA 2CP2A 3CC4T 4PJOA 4RUGA 1OULA 5KCOA 2FHDA 4CC7A 4XTYA 1VQ5Q 2ESWA 1SHFA 1CKBA 8AT1B 3ZEHA 1R0CB 3TEEA 2C0TA 4OB2B 3EGDA 4E7SA 3EG9B 5GMKm 4Z02A 4J9FA 1VQ9Q 3QG1A 5FROA 1H92A 4DBRA 2JTMA 4C92F 1UECA 4PLLA 2R57A 1NLOC 2BUDA 5GAN5 2LVMA 1UDLA 2A28A 3E2UA 4C0FA 4AG2C 2HQHA 1VA7A 3A8HB 4ZGJB 2KR3A 1D0ZA 3A98A 1C0MA 1C6VX 3UF4A 2EYXA 3GNGA 3TVTA 4N0AC 1W70A 4GLMA 4EMGA 2RHXA 1S1NA 4IUQA 1IREB 5A0LA 1KD1R 2ZPGB 1H3ZA 4PLIA 3CCSA 1WHMA 3TREA 4E7JA 1V76A 2RHYA 4ANJA 5AT1B 3PGGA 1HJDA 2QDLA 1VQ8A 2BE9B 5D6YA 2F69A 4LD9K 3QSUA 4F04B 2DD4A 3L2VA 3HHTB 4C0DC 4PFPA 5KH6A 4M77F 4N4IA 1HSQA 2ZPEB 2AK5A 2D9TA 2NUZA 5CCAA 3UT1A 4ORZA 2HBPA 4RG2A 1KHIA 1X6GA 2HNIA 4LDWA 2XHCA 4JS4A 2QEXQ 1AOJA 2AZSA 2KYBA 4FYYB 2XK0A 2XI9A 3QZ9B 4JZ4A 4KGZB 1JXMA 5LJ3h 1XNIA 2EWNA 2EGCA 1H641 1MV3A 1K9MC 4J9CA 3GPLA 1WXTA 3RKXA 1XQHA 2BKDN 2SEMA 1GFDA 2ZPBB 3LLRA 2VC8A 2FRWA 1VQPA 1WNLA 2PVOB 4OB0B 4BB7A 2PZ1A 4LDXA 1WFWA 4DBFA 3EG0A 3M4GA 4M75E 1Y7XA 2VXFA 4Z88A 2VV5A 2G3RA 2RJDA 2JS2A 1W2BS 5GAN6 4JJDA 4C8QE 2KVQG 3EGDB 3PVQA 4ZNXA 1NBEB 4M7AG 1VOMA 3L2QA 1YITQ 2NUTA 3CCST 1HYOA 1UHCA 1YNZA 5FU7C 1OX9A 3JB9G 2KAFA 5GJWB 1AWJA 2K5LA 3EHRA 1VQ8T 3OS5A 3VS1A 1QVPA 1WX6A 2LT4A 2ZPIB 4NL2A 3P8DA 1Q81C 2YRVA 1NJIR 4KGVB 1D09B 5J3BA 1G3WA 1KHCA 1T3SA 3GIBA 2EFIA 2DBMA 5GMKe 2QXFA 1C1AA 1VQOT 1OPLA 1T0JA 1LPLA 4OF1A 2DZCA 3QBYA 1UG1A 5IT9E 2D0QB 2DEQA 3CC7A 3V8KA 1I07A 4PJOF 4M7DF 2EBPA 1FMVA 2LRQA 3M0TA 1VQPT 5GANe 3CCMQ 3OW2A 2RMOA 1RAFB 4BDYA 3X28B 1YIJA 3X25B 3L2WA 1LCKA 1WI7A 9ATCB 3X20B 2QASA 1AD5A 1YJ9A 3MP1A 4KULA 2E3HA 2LT1A 2WSCE 1MMGA 2DLPA 4J6XA 1QKXA 1U3OA 1PCXA 1QVGA 4M78G 5GAMh 3KFVA 1T3LA 3CCUQ 2L0AA 2E6NA 1ARKA 4C92D 1UE9A 1BIAA 1X43A 2BE7D 2DRKA 3ULRB 1M27C 3J81E 4DBQA 1K73C 5GAN3 2GQIA 2GTJA 5CKFA 4DOVA 1EX4A 3I55Q 1B07A 2RH2A 1ABOA 5CO7A 3IQLA 3UPUA 3CC4Q 1Q81U 4RTYA 2D0NA 2QA4Q 1NG2A 2NUTB 3KBGA 4KBMB 3CXCS 1YJWA 1OU9A 2PQWA 4M75A 4XTZA 2CZ1B 1K8AR 1M1KR 5LJ3f 5FRMA 3CC7T 1BYMA 1AHJB 1MUZA 1ZBXA 4LN2A 2VUBA 5HY6A 4C8QA 3CPFA 5A0DA 1WGSA 3VS7A 1RAEB 2OX7A 2HSPA 2ZPFB 2MIOA 2CP5A 3FRNA 2CS7A 2CDTA 2LC4A 1YIJT 1YN8A 2CSQA 2V8KA 3CMAA 2L8DA 1SEMA 2ECZA 2P0KA 1JJ2A 2QAZA 3M0SA 4LDYA 5CQXA 2L89A 1IHVA 2OTLA 1NM7A 1YJ9T 3A8GB 2DTOA 1Y07A 5CIUA 2KROA 4Y91A 1VIEA 2MK5A 1G8XA 5IHKA 1JEGA 3FEOA 3HFOA 5FWBA 2L3PA 5M9OA 2OI3A 1XTDA 1N8RC 1VIFA 4X34A 3NTIA 2MAMA 1JBMA 3OY9A 5LJ3e 2HCKA 2M51A 1Q82U 3MP8A 2KXDA 4PJJA 3ZFJA 3VJPA 3H0FA 2Y4XA 1RACB 2O31A 1A0NB 1ABQA 1BCOA 4XAXB 4RTZA 1WQWA 1YWPA 1YJWT 3R6OA 3UWNA 1M8VA 1OQKA 4JUVA 3P8HA 3ER0A 2XU8A 1ZA1B 2MWOA 4NS5A 4Y92A 5DLOA 5D7UA 2CZ7B 2DL4A 4UC4A 4J9DA 3G7ZA 1NEGA 2LMJA 5IH2A 1JO8A 1G5VA 2Z0WA 1BI0A 2LTOA 5DM7R 5GMKj 2FEIA 4A4HA
chains in the Genus database with same CATH topology
3BW1A 4M7AC 4ZN1A 3VUBA 2LNVA 5IAYA 3DB3A 3FB9A 1Q86U 2K3YA 3V7CA 2DD5A 3CMAT 5J39A 4J7IA 1BKBA 1QP2A 1VQ9A 1KD1C 2WSFE 2E5QA 5GAMd 4J83A 3V8JA 4BE1A 4A4GA 4L6V5 3JAME 1GXIE 1VQOA 2OTLT 4F7UA 4HA8A 1M90C 5GANh 3MEVA 2QQAA 1M4ZA 3OYDA 2VGNA 4KT0E 4J5YA 4C5HA 2YLCA 4ZGEB 2OAUA 5GANj 5LJ3j 3OSSC 1EIFA 4ZTFA 3PMTA 2MF2A 1MGQA 5A0GA 2M1HA 3NTHA 3M57A 4YTLA 4HKEA 2P0QA 1G3SA 4JDSA 1WJSA 4QQ6A 2FVUA 5EG2A 2RHUA 5KE2A 1K8AU 1M1KU 2X4WA 3JCMf 2LCLA 5GAOm 3FDRA 3QKJA 4M7DE 1QVFS 3QYHB 3I55T 4PJOD 5GANd 4GLKA 3CCRA 3BFMA 2RK1A 3A8MB 5CKHA 1BI3A 3OYFA 4CRIA 1R8OB 2K57A 3OYCA 1S72T 1KC8C 3CC4T 3M5AA 3E1SA 4PJOA 2K2VA 2QQBA 3CPWS 3PMIA 4PKCC 5I2SA 2JVVA 5KCOA 2GQVA 2E65A 2FHDA 2FL7A 1RI0A 4X9DA 1BI1A 4BY6B 5DLQE 2M0OA 4B9XA 4XTYA 4M78D 1Y96A 3SDZA 3OW2S 3WXMB 2EYQA 1HXDA 4A4EA 2P4TA 5CAIA 3M58A 3CMEA 3CCJT 1Q7YC 1WPYA 3OS1A 2E41A 4M78A 5GAN8 5GAN4 4M77D 3ZEHA 3MHXA 5FU6B 3RERA 2IVWA 4QQDA 2R5AA 4XU0A 3PTAA 4BI8B 3TEEA 5LJ5h 5GANg 3N5BB 4OB2B 3Q1JA 3OS2A 1I5LA 2DAQA 3C4SA 2EQMA 3OSVA 3X26B 5GMKm 4M77A 4Z02A 5LJ5j 4BDZA 3QG1A 5FROA 5GAOl 1FWZA 3HSBA 1VQ7A 1Y71A 4J7FA 2DO3A 3JSCA 2JTMA 2RA2A 1JB0E 3LW5E 4C92F 4PLLA 2R57A 2BUDA 3EFRA 5GAN5 1YHQA 2LVMA 2JN0A 4PJOC 4M7DC 4F7UF 5LJ5d 4C0FA 2CKKA 2QDYB 1QVGS 2PVGB 1N9SA 1UGQB 3A8HB 1YBYA 3QO3A 4KUIA 4ZGJB 2QEXA 2XDDA 3JCMc 3I56T 3MEWA 3CXCA 1I8FA 4IURA 5AYFA 2DTHA 4ATOA 2XDBA 3BY7A 4IUPA 4M75F 1TH7A 5CQYA 5GAMe 4FIBA 2RJFA 3GNGA 3OYLA 1VQ9T 2O4XB 2ZGWA 3HRTA 2PVDB 4C92G 4N0AC 1K73U 4OMFB 2X35A 4XU3A 4GY5A 4DA4A 1RL2A 2E6ZA 1B34B 2VYTA 3CCVA 3QHSA 4EMGA 4ZTJA 1VQMA 4HCBA 2RHXA 4IUQA 1PSFA 3GOXA 2JOYA 5GMKl 1IREB 3X24B 5A0LA 2ZPGB 1G3TA 1H3ZA 4C8QF 2QQSA 4RCBA 2EJFA 4V2SA 4PLIA 5LJ5g 3CCSA 3TREA 2JNGA 2KSSA 4E7JA 3L42A 2RHYA 3V8LA 1YJNA 3PGGA 3OB9A 4M75G 3CC2A 1IZ6A 3CCEA 3SFMA 1NJIC 2DIQA 5CR2A 2DJZA 3CCRT 3O8VA 5CVIA 3V7SA 1VQ8A 5D6YA 2F69A 3H8ZA 4LD9K 1KQSA 3QSUA 2DD4A 2E70A 3L2VA 3OBWA 4EMKB 3HHTB 4LD6A 3RKWA 4C0DC 3S3MA 1VQ5A 4C92B 4C8QG 1M5Q1 3OYMA 3OA6A 4OB1B 5KH6A 1WJRA 3CBMA 2MI6A 2RO0A 4M77F 4N4IA 2ZPEB 5CCAA 2D9TA 1KC8U 3G4SA 3UT1A 4ELZC 4F7UB 4R55A 4QVCA 1I4K1 4BE2A 1U8RA 1VQNA 2HBPA 4RG2A 1KHIA 1VQ6A 3RMQA 2HNIA 4LDWA 2XHCA 5GAN7 3CMET 2HQXA 4JS4A 5I2MA 4XK8E 3VUZA 3E9GA 1X6OA 4FT2A 3RMSA 4X9CA 2CGHA 2RI3A 2XK0A 4L59A 4M75B 2NLUA 2XI9A 3QZ9B 2KMTA 3FJPA 4XTXA 3OYBA 1OZ3A 1Q7YU 5GAOq 5LJ3h 1XNIA 3JCMh 1JJ2S 3VV0A 2EWNA 4C92E 3OYJA 3RIRA 4A53A 4E7IA 2DIGA 1H641 1W4SA 1K9MC 3GPLA 1VQ7T 2KK4A 3QPHA 3RKXA 1LNXA 3JRZA 3OYAA 1XQHA 2BKDN 1Q82C 4C8QB 4MDWA 2ZPBB 3LLRA 2VC8A 3M55A 3META 2K3XA 5HK0A 1WNLA 2PVOB 1VQPA 4C5IA 1YHQT 5GAMf 4TVRA 3WVDB 4OB0B 3CCLT 4BB7A 2PU9B 4JRIA 1N6AA 4J6WA 1XOVA 4M7AF 2X4JA 4OB3B 2QEXT 3WVEB 4M7DD 4ME7A 4LDUA 4LDXA 5LJ3d 3JCMd 3M4GA 4M75E 4XQ3A 2KQWA 3DB4A 1N27A 1Y7XA 3S6WA 2VXFA 4B9WA 3JB9F 4N4HA 2ZZDA 4RKUE 4M7DA 3GLXA 2VV5A 4A54A 2QQ9A 1NPRA 2A7YA 2G3RA 1N8RU 3LYIA 2RJDA 2X4XA 4DOWA 3CCQA 1W2BS 4P5NA 3JCMJ 4C5EA 5GAN6 2RHIA 2DXUA 1KQ1A 2EAYA 3RUXA 2KVQG 4C8QE 3LWIA 4BACA 1VQMT 3SWNB 3OYKA 4MZMA 4M77B 1KG1A 2RK2A 1UEBA 1G3YA 4M7AG 3L2QA 4JRQA 5C6SA 3CCST 4N0AA 3PIOA 2GF7A 2L5QA 4BI3A 4E7LA 1YI2A 3QIIA 5FU7C 5GAOp 5LJ3g 3JCMg 2KAFA 3INZA 3JB9G 2DXCA 3QJYA 5FRNA 1BIBA 1YJNT 1UGRB 2WSEE 4C92C 2K5LA 3QUIA 3CC2T 3CD6A 3CCET 1D3BA 1LOJA 3PFSA 3J7AF 2FYKA 1JRIA 2LQKA 4RG8A 3OS5A 1VQ8T 3QJ6A 5L8RE 1O9SA 1QVPA 3MEAA 2LT4A 2XDPA 2ZPIB 1UB4A 3A8OB 4NL2A 4RMOA 1VQ5T 4M77E 3P8DA 1Q81C 2YRVA 1QP3A 2F5TX 3QDRB 2CZ6B 4ZGDB 5J3BA 3G4ST 5IN1A 1G3WA 1KHCA 1VQNT 4EMHA 3CBOA 3FC3A 1VQ6T 4M7AB 1BI2A 3E9FA 3PNWC 3JCMb 2M9UA 2EFIA 3GIBA 4EPCA 2K4YA 4MMKA 1K8AC 4FM4B 2DPPB 4EDUA 3OYHA 4XTWA 3CCUA 5A2QE 3GNFB 5GMKe 2QXFA 1QVFA 1ZQ1A 4ELYC 1VQOT 4OF1A 2XIDA 2DZCA 2E10A 3QBYA 4JLIA 4QQGA 3JCMW 1KQ2A 2LCCA 3TU4K 5IT9E 4FSXA 1M1GA 1PSEA 2D0QB 4F7UG 2DEQA 4E47A 3CC7A 4ZN3A 3JCMX 1KD1U 3S3NA 3V8KA 2QQRA 3KXTA 3G71A 3CPWA 1M90U 4PJOF 2ZPHB 4M7DF 4RCCA 2LRQA 4XTUA 3HL8A 1NZ9A 2Y90A 3CC4A 1VQPT 4KUDK 4M7AE 2EJ9A 5CK9A 5I21A 2EQUA 3F70A 3H6ZA 2DTIA 5GANe 4OGEA 3OW2A 3OMCA 1M9SA 4D6WA 2EQKA 3X28B 4BDYA 2QA4A 3JB9J 1YIJA 4BY6C 3X25B 3HRUA 3EFSA 3ASKA 2M16A 4M78F 3L2WA 3FLGA 3SWNC 3P8BB 4DQ2A 4J8OA 2CZ0B 2XICA 3X20B 1UGPB 3C94A 3CCQT 1U1SA 2E64A 5FU6C 4PJOG 2F5KA 4C0ZA 1YITA 2QTXA 2C06A 2GCXA 5GAN2 1VQ4A 1VQLA 2B8AA 4HCZA 2R5MA 3MP1A 4KULA 1YJ9A 5HK3A 2LT1A 3JB9I 4Q5WA 4HT8A 2CYZB 4MMLA 2WSCE 4BD3A 4J6XA 2GFAA 5HKCA 4HCCA 3UDCA 1QVGA 4JLGA 4M78G 3LGLA 2VXEA 4OGCA 3MCAB 1MHNA 5GAMh 3OQ5A 3LWHA 3DLMA 5GAOn 3G6EA 3V7RA 2ZCFB 5LL6S 3CD6T 5GAMj 2E6NA 2HD0A 3GF5A 1WQ7A 4M77G 2MWPA 2AHJB 4C92D 1BIAA 3QXEB 4QW2A 3J81E 1O75A 1ZHIA 3I56A 2HQEA 1K73C 3RESA 5GAN3 4EMKA 4F7UE 3C12A 1N9RA 2EIFA 5CKFA 5LJ5e 4C92A 4DOVA 1VQKA 1X01A 2D6FA 3QYGB 4M7DB 4PJOB 2OTJA 1U1TA 2RH2A 3JB9H 5CO7A 5CKBA 4R56A 1VUBA 2X4YA 3UPUA 4BUGA 1Y96B 4IUVA 4JRPA 1Q81U 4BI4A 2QI2A 4M75D 3M4YA 5KE3A 2I2LA 3OYNA 4MZTA 3PIPA 4PNOA 3CCUT 4M78B 3KBGA 4KBMB 3CXCS 3RKYA 4VUBA 3PT9A 1YJWA 1M1FA 4M75A 2PQWA 3S3OA 4XTZA 2R58A 3CCVT 2CZ1B 1I81A 5C0MA 5GANf 2DXBA 4C8QD 3E19A 5LJ3f 3VYHB 3L2UA 4PJOE 5FRMA 2P0PA 3CC7T 1BYMA 3GP8A 1D3BB 1AHJB 1ZBXA 2RD1A 2VUBA 4FT4A 5HY6A 2A3LA 3G71T 3CCMA 4WF2A 4JJNK 3OYYA 1WJQA 2LDMA 3SB2A 2O01E 3LGFA 4CI0C 5GAMg 4C8QA 3CPFA 5A0DA 1OZ2A 1WGSA 2EQJA 3KUFA 4Y28E 4EMKC 3NTKA 2ZPFB 3M54A 4E7HA 2DXTA 1V29B 3M59A 3M56A 1Q86C 3FRNA 3FIFA 4M78E 3VYGA 2GFUA 2QA4T 2CS7A 2WACA 3QZ5B 3HRSA 2V8JA 2LC4A 3TCJA 1YIJT 5CKDA 2YHTA 3MEUA 4IUTA 4QVZA 1UGSB 3A5ZB 4O6JA 1OYXA 4C0DB 2XD0A 2IG0A 4A4KA 4NL3A 2RI5A 3DLLA 2V8KA 3CMAA 2L8DA 2K5FA 1NJIU 3JCMV 1KQSS 4MDXA 2P0KA 5J26A 4XU2A 1JJ2A 4LDYA 1YITT 2RI2A 2L3RA 2L89A 2RJCA 4PL6A 5CQXA 4A4FA 4BE0A 1VQ4T 2DKGA 4M75C 1VQLT 2OTLA 3MO8A 3SWNA 2E12A 3A8GB 3VU3C 3OMGA 1YJ9T 4JRKA 2DTOA 2BIVA 1Y07A 2EJGA 5CIUA 2K5IA 2RM4A 4Y91A 1M1KC 3URGA 3L1AA 4IUUA 3AHUA 3A8LB 1VIEA 5GAOr 3L2RA 2E1HA 5D6WA 5LJ5f 4C8QC 3FEOA 3CBPA 3HFOA 1HK9A 5M9OA 3OYIA 2MMPA 3G6ET 3CCLA 3SD4A 5FLXE 2PUOB 3HKSA 1XTDA 4JS5A 4FU6A 3OYEA 3I55A 2LQ8A 3MP6A 3J80E 1OI1A 1N8RC 1VIFA 3ME9A 2PUKB 4X34A 2RHZA 2VGMA 3NTIA 1S72A 1W2BA 1X75C 2MAMA 3NFCA 1VQKT 1JBMA 2DZ9A 4NOYA 3JCMQ 3OY9A 4N4GA 2DVEA 1K9MU 4M7AD 2OTJT 4C0GA 4OP0A 2V8IA 5LJ3e 3JCMe 4M78C 2LX9A 3OBYA 4MZPA 3BDUA 2RB6A 4O5VA 1Q82U 3HFNA 3MP8A 3T9NA 3JB9D 4XTVA 3ZFJA 3LH0A 4M7AA 4XU1A 1FXXA 3VJPA 1SSFA 1NE8A 2Y4XA 4M77C 3ZBDA 3CCJA 2EKOA 2H3JA 3DKMA 2Y4YA 2FB7A 4XAXB 5CKEA 2O4XA 1WQWA 1YCYA 3M9QA 1YJWT 3R6OA 4M7DG 4LDVA 3EAEA 1B34A 2KDSA 3HPWA 3C95A 3UWNA 3HP9A 1M8VA 4J6YA 1P92A 4JUVA 3P8HA 2JZ2A 4OVAA 4II1A 3VKIA 3L2ZA 2YLBA 3CEYA 2HAXA 3ER0A 2XU8A 3CCMT 2MWOA 1QW1A 4NS5A 5KCHA 3BDLA 4FL6A 5FU7B 2XG8D 5D6XA 5DLOA 1YI2T 3M53A 2DK3A 3OS0A 2CZ7B 4E7KA 4UC4A 4QVDA 4HT9A 5DY9A 3G7ZA 2XKOC 4L5GA 2KY9A 5GMKh 3JCMP 1G5VA 4C5GA 5GMKi 2JTFA 4IKFA 1BI0A 1DJ7B 1FX7A 2JUFA 3OYGA 2LTOA 3LX7A 1LJOA 2RJEA 5DM7R 5GMKj 1NPPA 4A4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELZ C;  5HK0 A;  5CKF A;  3VUB A;  4MDX A;  3HPW A;  5HK3 A;  5CQX A;  2VUB A;  1X75 C;  5CK9 A;  3NFC A;  5CKH A;  4ME7 A;  5CKB A;  1VUB A;  5CO7 A;  5CQY A;  5HKC A;  5CR2 A;  4MZP A;  2KMT A;  5DLO A;  3JSC A;  4MZT A;  4ELY C;  3G7Z A;  1NE8 A;  4OF1 A;  4VUB A;  3TCJ A;  5CKD A;  2MF2 A;  1M1F A;  1UB4 A;  3JRZ A;  5CKE A;  5CCA A;  4MZM A;  4HKE A;  2C06 A; 
#chains in the Genus database with same CATH topology
 4M7A C;  1PRL C;  3VUB A;  3DB3 A;  1MNE A;  2DD5 A;  3CMA T;  1BKB A;  2E5Q A;  4BE1 A;  4A4G A;  4HXJ A;  1CKA A;  1BCM A;  2OTL T;  2DER A;  1M4Z A;  2VGN A;  4R0K A;  5GAN j;  2OAU A;  2NYS A;  3PMT A;  2MF2 A;  2JTE A;  2A08 A;  3M57 A;  2B86 A;  2P0Q A;  3CCJ Q;  5KE2 A;  2RQW A;  2X4W A;  3CCS Q;  1OOT A;  4M7D E;  2MPX C;  1VYV A;  4PJO D;  5GAN d;  1BB9 A;  3CCR A;  2RK1 A;  3BE3 A;  3OYC A;  4HVV A;  3E1S A;  1SPK A;  4PKC C;  1VQ8 Q;  1WHL A;  2MCN A;  2FL7 A;  1SSH A;  1BI1 A;  4BY6 B;  2EYY A;  1Y96 A;  4CC4 B;  5IXF A;  3M0Q A;  2EKH A;  1W2B P;  3WXM B;  3EG2 A;  3CME A;  1WPY A;  3OS1 A;  2KT8 A;  4OMM A;  1SKU B;  2R5A A;  4XU0 A;  1KFZ A;  5LJ5 h;  1PWT A;  2OAW A;  1I5L A;  3OSV A;  3C4S A;  2VAS A;  4M77 A;  1FWZ A;  4Z8A A;  2YXY A;  4PFO A;  1Y71 A;  4J7F A;  2JMC A;  2HDA A;  1VQO Q;  1RAA B;  1M3A A;  1QWF A;  2W0Z A;  1K1Z A;  1WA7 A;  3EFR A;  1YHQ A;  3EG3 A;  1PD0 A;  2EGA A;  3NGP A;  2K9G A;  4AFU C;  1H3H A;  2PVG B;  4A63 B;  1X6B A;  3VS0 A;  4KUI A;  3QO3 A;  1K0X A;  3VS4 A;  3MEW A;  2DMO A;  2J06 A;  5AYF A;  4ATO A;  2V26 A;  1K0S A;  4IUP A;  4M75 F;  5CQY A;  5GAM e;  5KYN A;  2HMA A;  3OYL A;  4XU3 A;  3VS2 A;  3CCV A;  1JXO A;  3X24 B;  4C8Q F;  2QQS A;  4V2S A;  2DL3 A;  2JNG A;  3VRZ A;  3L42 A;  2YWW A;  4FW2 A;  1YJN A;  3CCE A;  2DIQ A;  2DRM A;  2DJZ A;  3CCR T;  3O8V A;  3V7S A;  2O88 A;  3H8Z A;  2LJ0 A;  2JXB A;  4EMK B;  3O5Z A;  4LD6 A;  4DBH A;  1WDX A;  2O9V A;  4C92 B;  3OA6 A;  3CBM A;  2RO0 A;  1GBQ A;  3G4S A;  3R6N A;  4R55 A;  4ELZ C;  4BE2 A;  3QWX X;  5GAN 7;  3CME T;  4XK8 E;  3RMS A;  2W10 A;  4X9C A;  3EGU A;  3EFO A;  3FJP A;  3OYB A;  4XTX A;  4LE9 A;  5GAO q;  3JCM h;  1TSF A;  3OYJ A;  2RQT A;  2DIG A;  5IXB A;  5HK0 A;  1YHQ T;  4D8D A;  4C5I A;  3CC7 Q;  4TVR A;  3WVD B;  3CCL T;  1XOV A;  2X4J A;  4OB3 B;  3WVE B;  4ME7 A;  4LDU A;  1R0B G;  5LJ3 d;  4XQ3 A;  1T0H A;  1N27 A;  1Q81 R;  2ZZD A;  4RKU E;  4M7D A;  3GLX A;  2QQ9 A;  3CCQ A;  1YIJ Q;  3MPU B;  3JCM J;  1V1C A;  2YDL A;  1KQ1 A;  2EAY A;  2VWF A;  3CXC P;  3SWN B;  4M77 B;  2RK2 A;  1UEB A;  5C6S A;  2GF7 A;  2FZK B;  4BI3 A;  4E7L A;  2H3E B;  1VQN Q;  1VQ6 Q;  1YI2 A;  1YJ9 Q;  2D8H A;  3QII A;  5GAO p;  1YWO A;  2HKQ B;  5FRN A;  1YJN T;  1UJY A;  2WSE E;  4C92 C;  1X2K A;  4PJM A;  3CD6 A;  1EZZ B;  4QKU A;  3CCE T;  2PNI A;  2FYK A;  3QJ6 A;  2ATC B;  5L8R E;  2XDP A;  3A8O B;  2M02 A;  1UTI A;  1QP3 A;  2F5T X;  3QDR B;  4J9I A;  3G4S T;  3FC3 A;  3E9F A;  2CP3 A;  2AZV A;  2V1Q A;  1NLP C;  4FM4 B;  4EDU A;  4XTW A;  2MYS A;  1PKT A;  1ZQ1 A;  4JLI A;  5KYY A;  2FRY A;  1M1G A;  4F7U G;  4E47 A;  1D1B A;  4RTT A;  1YJW Q;  4J9G A;  2QQR A;  2DFU A;  3G71 A;  2FPD A;  4M7A E;  4KUD K;  2EJ9 A;  2EQU A;  3F70 A;  2DX1 A;  3H6Z A;  2DTI A;  4X1V A;  1TUC A;  2GTO A;  3RNJ A;  4D6W A;  2EQK A;  1Q82 R;  3D7S B;  3SWN C;  4DQ2 A;  1Z9Z A;  4J8O A;  4JPB W;  2XIC A;  2LP5 A;  1ZA2 B;  3CCQ T;  1EFN A;  1U1S A;  2E64 A;  1QLY A;  5I22 A;  1VQ4 A;  1VQL A;  2B8A A;  2JS0 A;  3CMA Q;  2V1R A;  2GBQ A;  4MML A;  2K2M A;  2OTL Q;  1JU5 C;  2GFA A;  1YCS B;  4HCC A;  1IHW A;  4OGC A;  3MCA B;  2EGE A;  1AZG B;  3LWH A;  2J6O A;  3V7R A;  2ZCF B;  3CD6 T;  5GAM j;  2J05 A;  2MWP A;  4Z89 A;  2H8H A;  3I56 A;  2X3W D;  3RES A;  3LH5 A;  3SEM A;  3TSW A;  1KJW A;  5LJ5 e;  2LQN A;  1VQK A;  2D6F A;  1X01 A;  4PJO B;  4M7D B;  2OTJ A;  2KEA A;  3AT1 B;  4R56 A;  2YUP A;  1QCN A;  4KGX B;  4LUE A;  4JRP A;  1WHK A;  1KSW A;  2QI2 A;  4M75 D;  2JM9 A;  3M4Y A;  2I2L A;  2QGF B;  3RKY A;  1CSK A;  2DL5 A;  2YUO A;  1MMN A;  5GAN f;  4C8Q D;  3L2U A;  2KYM A;  2FG0 A;  2HEQ A;  2I0N A;  1AWO A;  4FT4 A;  2A3L A;  3G71 T;  1H8K A;  3OYY A;  4AFS C;  4CI0 C;  2K79 A;  2DNU A;  3NTK A;  3M54 A;  4E7H A;  4M78 E;  3QZ5 B;  2V8J A;  4IUT A;  2XD0 A;  2KI7 A;  1UFF A;  2ED1 A;  4A4K A;  3DLL A;  2SRC A;  3JCM V;  1KQS S;  4MDX A;  2A36 A;  4XU2 A;  2RI2 A;  2L3R A;  4PL6 A;  2RJC A;  4BE0 A;  1VQ4 T;  1GCQ C;  1VQL T;  5KYY B;  1J3T A;  1X69 A;  2BIV A;  5I11 A;  1ZSZ A;  1TUG B;  2M0Y A;  2RM4 A;  1WHH A;  3URG A;  3L1A A;  4IUU A;  1NYG A;  2YUQ A;  3L2R A;  1HK9 A;  2PUO B;  3VS5 A;  1ZUK A;  4FU6 A;  3OYE A;  4HCK A;  4JS5 A;  3MP6 A;  2VGM A;  1W2B A;  2AIR B;  1VQK T;  3M0U A;  4NOY A;  3JCM Q;  1K9M U;  2OTJ T;  1AT1 B;  3CCR Q;  3JCM e;  4MZP A;  2LX9 A;  3BDU A;  3HFN A;  4ESR A;  4XTV A;  3LH0 A;  4M7A A;  2L3Q A;  1SSF A;  2VVK A;  2JW4 A;  2EKO A;  2YSQ A;  2Y4Y A;  2FB7 A;  5CKE A;  2O4X A;  4LDV A;  3EAE A;  1GCP A;  3M0P A;  3CME Q;  1TUD A;  1AWX A;  4J6Y A;  1P92 A;  2JZ2 A;  4OVA A;  3VKI A;  2HAX A;  1RAH B;  4FL6 A;  5L23 A;  5D6X A;  4OMN A;  4AMC A;  3EHQ A;  3OS0 A;  1QMC A;  4L5G A;  2G6F X;  2JTF A;  1DJ7 B;  1FX7 A;  2RJE A;  1YHQ Q;  3BW1 A;  2ROL A;  4ZN1 A;  3CCL Q;  2LNV A;  5IAY A;  2E5K A;  1OEB A;  3FB9 A;  4J7I A;  1VQ9 A;  1KD1 C;  1AEY A;  3JAM E;  1S72 Q;  4JJB A;  1M90 C;  2QQA A;  3OYD A;  1UUE A;  4J5Y A;  4C5H A;  2YLC A;  2HL3 A;  3OSS C;  4ZTF A;  1HD3 A;  1M3B A;  1M3C A;  4FCY A;  2KRS A;  2RN8 A;  4YTL A;  4HKE A;  2VKN A;  2RHU A;  4CC3 A;  1IGU A;  1QVF S;  1WHG A;  2QK0 A;  3A8M B;  3UA6 A;  1Z9Q A;  1YJN Q;  1M8M A;  3CCE Q;  2K2V A;  2QQB A;  3CPW S;  2J6K A;  2JVV A;  2GQV A;  2E65 A;  4WCI A;  4PJL A;  1RI0 A;  4X9D A;  5DLQ E;  2M0O A;  3SDZ A;  2P4T A;  3PVL A;  1Q7Y C;  3M58 A;  1IO6 A;  2CUD A;  5GAN 4;  4M78 A;  3RER A;  3G4S Q;  4M77 D;  5FU6 B;  2IVW A;  4QQD A;  5GAN g;  1AVZ C;  3N5B B;  4D8K A;  3Q1J A;  2DAQ A;  2EQM A;  3X26 B;  5LJ5 j;  4BDZ A;  2LX7 A;  5GAO l;  3HSB A;  1VQ7 A;  2DO3 A;  3JSC A;  2PTK A;  5KYX A;  2A0F B;  1JB0 E;  3LW5 E;  1IB8 A;  2ABL A;  4F7U F;  5LJ5 d;  1NEB A;  1N9S A;  2QEX A;  1FYN A;  1RUW A;  3JCM c;  1GFC A;  2DBK A;  3CXC A;  2BZY A;  1I8F A;  4IUR A;  2EYZ A;  2DTH A;  2L3S A;  2XDB A;  2L2P A;  3BY7 A;  2GNC A;  4FIB A;  1VQ9 T;  2O4X B;  3HRT A;  4C92 G;  1K73 U;  4OMF B;  4GY5 A;  1E6H A;  3JV3 A;  4ZTJ A;  1VQM A;  2HSE B;  1PSF A;  1IRX A;  2DA9 A;  2JOY A;  5GMK l;  3CCQ Q;  1G3T A;  4RCB A;  1SG5 A;  2CSI A;  2K7A A;  2KSS A;  1UJ0 A;  4E6R A;  3CQT A;  2EVR A;  1IZ6 A;  3ZL7 C;  1NJI C;  5CR2 A;  2DF6 A;  1U06 A;  4OMO A;  3OBW A;  4RTU A;  3RKW A;  3CD6 Q;  1M5Q 1;  4AT1 B;  6AT1 B;  3NPF A;  1WJR A;  2MI6 A;  2IPO B;  4QT7 A;  3RMQ A;  3RDV A;  3VUZ A;  1X6O A;  4FT2 A;  4L59 A;  2CH4 W;  1YP5 A;  4M75 B;  1Q7Y U;  4RTX A;  3VRY A;  3VV0 A;  3RIR A;  1VQ7 T;  2KK4 A;  2YRD A;  1LNX A;  3JRZ A;  4OMQ A;  3OYA A;  4C8Q B;  4MDW A;  3M55 A;  5GAM f;  3A1P A;  4RTV A;  2PU9 B;  3G71 Q;  1N6A A;  4M7A F;  2QEX T;  4M7D D;  3JCM d;  3JB9 F;  3EH1 A;  2RQR A;  2A7Y A;  1N8R U;  4DOW A;  2BTT A;  2X4X A;  4JJC A;  4P5N A;  4C5E A;  2RHI A;  2DXU A;  4BAC A;  4FYW B;  1VQM T;  1AZE A;  1G3Y A;  4LNP A;  1WXB A;  4JRQ A;  4N0A A;  5KYX B;  1VQ4 Q;  1OU8 A;  1VQL Q;  4J9H A;  5LJ3 g;  3RBB B;  2DXC A;  3QJY A;  1BIB A;  2JT4 A;  2J7I A;  3QUI A;  1D3B A;  2DYI A;  1GRI A;  4RG8 A;  1JRI A;  1ZX6 A;  2CP0 A;  1WLP B;  1O9S A;  1UB4 A;  2OJ2 A;  4KH1 B;  5IN1 A;  1RAG B;  1KQS P;  1VQP Q;  1VQK Q;  2OTJ Q;  1TWB A;  4EPC A;  2YUN A;  2K4Y A;  3UAT A;  4MMK A;  2ZAE A;  4K11 A;  1K8A C;  3CCU A;  5A2Q E;  3GNF B;  1JQQ A;  1E6G A;  2RF0 A;  4ELY C;  1Y57 A;  1Y0M A;  3EG9 A;  1RAB B;  2E10 A;  1KQ2 A;  2LCC A;  4FSX A;  1PSE A;  1M30 A;  3I5S A;  1YFN A;  2ZPH B;  8ATC B;  2F2V A;  1GBR A;  2J6F A;  4RCC A;  3CC4 A;  2CRE A;  5I21 A;  1K9M R;  1B7T A;  4OGE A;  3VS6 A;  2QA4 A;  3H0I A;  4BY6 C;  1PHT A;  3EFS A;  3HRU A;  2EPD A;  2M16 A;  2NUP A;  4M78 F;  3P8B B;  3TQ7 P;  1UGP B;  1RLP C;  4PJO G;  2C06 A;  5GAN 2;  1MMA A;  2HBW A;  2FZC B;  3FJ5 A;  4HCZ A;  4HT8 A;  1W6X A;  2C0O A;  1BK2 A;  5HKC A;  3H9N A;  2DE0 X;  3UDC A;  4J9B A;  3LGL A;  2VXE A;  1ACM B;  3OQ5 A;  2HZY A;  3DLM A;  3G6E A;  5LL6 S;  1MV0 B;  2AHJ B;  3QXE B;  1O75 A;  2HQE A;  4F7U E;  2MOX A;  3C12 A;  2DM1 A;  4LXC A;  3EGX A;  1B3Q A;  1VUB A;  7AT1 B;  4BUG A;  1Y96 B;  1G2B A;  3OYN A;  4J9E A;  3CCU T;  3PT9 A;  2R58 A;  3CCV T;  1I81 A;  4WTO B;  1R77 A;  1PKS A;  2DXB A;  3E19 A;  1UGV A;  2P0P A;  5KYU A;  3GP8 A;  1D3B B;  4JJN K;  2JMA A;  4WF2 A;  3SB2 A;  2LDM A;  2O01 E;  3LGF A;  5GAM g;  1KK7 A;  1QVF P;  1OZ2 A;  1OX8 A;  2EQJ A;  4EMK C;  1ZUY A;  3QWY A;  5ECA A;  1WXU A;  2EYW A;  2LCS A;  1Q86 C;  1VYU A;  2QA4 T;  3CPW P;  2WAC A;  3HRS A;  2YHT A;  3C0C A;  5HCK A;  3MEU A;  2GGR A;  4QVZ A;  4O6J A;  4C0D B;  1OYX A;  2XMF A;  1VYT A;  2IG0 A;  4CC2 A;  4NL3 A;  2RI5 A;  2K5F A;  5J26 A;  1SRM A;  4A4F A;  1M2V A;  2DKG A;  2ED0 A;  1LVK A;  1PC0 A;  2E12 A;  2KRN A;  3OMG A;  4EIK A;  4B6M A;  1OV3 A;  1IGQ A;  1E7O A;  5GAO r;  2E1H A;  5D6W A;  1U5S A;  5LJ5 f;  1WHJ A;  3OYI A;  3G6E T;  3SD4 A;  5FLX E;  1NYF A;  1ZUU A;  3HKS A;  2LQ8 A;  3J80 E;  2KNB B;  2ROT A;  5IHN A;  2PUK B;  2NUP B;  2RHZ A;  1MND A;  2DZ9 A;  4M7A D;  1SRL A;  2V8I A;  2DJQ A;  2LZ6 B;  2IIM A;  1K73 R;  2RB6 A;  2EW3 A;  3M0R A;  3JB9 D;  2X9H A;  1NE8 A;  4M77 C;  3CCJ A;  3EG1 A;  2H3J A;  3DKM A;  1PRM C;  1M90 R;  1YCY A;  4OMP A;  3EFO B;  1B34 A;  2KDS A;  3HPW A;  3C95 A;  1SHG A;  3L2Z A;  1WYX A;  2YLB A;  2FO0 A;  5FU7 B;  2XG8 D;  1YI2 T;  2F1L A;  4E7K A;  5DY9 A;  1VQ7 Q;  1NPP A;  3JCM P;  5GMK i;  1RAI B;  3EGX B;  3OYG A;  2JUF A;  2NWM A;  4E2F B;  3SHW A;  2AT1 B;  3MKD A;  1Q86 U;  2K3Y A;  2CT3 A;  1X27 A;  5J39 A;  3REB B;  1I5O B;  2WSF E;  5GAM d;  4J83 A;  5FW9 A;  1GXI E;  2KGT A;  1VQO A;  4F7U A;  2E3I A;  1Q7Y R;  3MEV A;  2DL7 A;  4KT0 E;  4ZGE B;  5KYU B;  1EIF A;  1MGQ A;  2M1H A;  3NTH A;  1VQM Q;  1G3S A;  4JDS A;  1WJS A;  4QQ6 A;  3TSZ A;  3JCM f;  3QKJ A;  1FMK A;  4GLK A;  5CKH A;  1QCF A;  1BI3 A;  1R8O B;  1ZBJ A;  1KC8 C;  3M5A A;  2QGG A;  3PMI A;  5I2S A;  1N8R R;  2LJ1 A;  1M2V B;  1RI9 A;  4B9X A;  4M78 D;  2ENM A;  3THK A;  2EYQ A;  1HXD A;  4A4E A;  1D1C A;  3OW2 S;  5CAI A;  3CCJ T;  4HVW A;  2E41 A;  5GAN 8;  3MHX A;  3PTA A;  4BI8 B;  2KXC A;  1Q95 G;  3VS3 A;  3OS2 A;  4FYV B;  2RA2 A;  2DL8 A;  2O2O A;  1QWE A;  2A37 A;  2JN0 A;  4PJO C;  1K9A A;  4M7D C;  2CKK A;  2QDY B;  2QG9 B;  1QVG S;  1UGQ B;  1YBY A;  2YRC A;  2XDD A;  3I56 T;  2F2W A;  1TH7 A;  3UA7 A;  4HVU A;  2RJF A;  2ZGW A;  2PVD B;  4RTW A;  2X35 A;  4F16 A;  4DA4 A;  1RL2 A;  2E6Z A;  1B34 B;  2VYT A;  3QHS A;  4HCB A;  2QTV A;  3GOX A;  5KYW A;  2EJF A;  4IIO A;  1MMD A;  5LJ5 g;  2DIL A;  4FW1 A;  3V8L A;  3OB9 A;  4M75 G;  3CC2 A;  3RR6 A;  3SFM A;  5CVI A;  1W1F A;  1WIE A;  1KQS A;  2E70 A;  4PFZ A;  3S3M A;  1VQ5 A;  4C8Q G;  3OYM A;  1QQJ A;  4OB1 B;  1KC8 U;  3NHN A;  1X2Q A;  4F7U B;  1VQN A;  1U8R A;  4QVC A;  1I4K 1;  2O9S A;  1VQ6 A;  4DEX A;  2HQX A;  1PG5 B;  2FPE A;  2C0I A;  5I2M A;  3E9G A;  2CGH A;  2P4R A;  2RI3 A;  1QKW A;  2NLU A;  2KMT A;  1OZ3 A;  1TTH B;  1JJ2 S;  4C92 E;  4A53 A;  2COY A;  4E7I A;  1W4S A;  1ZSG A;  2DYB A;  2HL5 C;  3QPH A;  3CCV Q;  1Q82 C;  3MET A;  2K3X A;  3EH2 A;  4JRI A;  4J6W A;  1KIK A;  5GJV B;  2KQW A;  3DB4 A;  3S6W A;  4B9W A;  4N4H A;  1RLQ C;  4A54 A;  1NPR A;  3LYI A;  2E4H A;  2X51 A;  1BBZ A;  3RUX A;  1D0Y A;  3LWI A;  3OYK A;  4MZM A;  1KG1 A;  1ZSZ B;  3PIO A;  2L5Q A;  1ZLM A;  2AKL A;  1K4U S;  4FYX B;  5IHI A;  3INZ A;  3JCM g;  1UGR B;  3CC2 T;  1LOJ A;  3PFS A;  3J7A F;  2LQK A;  2D8J A;  3MEA A;  3G6E Q;  4RMO A;  1VQ5 T;  4M77 E;  1G83 A;  3I35 A;  2CZ6 B;  4ZGD B;  1GL5 A;  4FSS A;  1XJW B;  1VQN T;  4EMH A;  3CBO A;  1VQ6 T;  4M7A B;  3H0H A;  1BI2 A;  3PNW C;  3JCM b;  2M9U A;  5KYW B;  2FPF A;  2DEU A;  2DPP B;  3OYH A;  3PE0 A;  1IXD A;  2RNA A;  1QVF A;  3NMZ C;  2XID A;  4QQG A;  3JCM W;  3TU4 K;  3QDF A;  1KD1 U;  1SF9 A;  4ZN3 A;  3JCM X;  3S3N A;  3KXT A;  3CPW A;  2RQU A;  1M90 U;  4XTU A;  3HL8 A;  1NZ9 A;  2Y90 A;  5CK9 A;  1PNJ A;  5FWC A;  3OMC A;  2D1X A;  4M4Z A;  1M9S A;  1YI2 Q;  2KRM A;  3JB9 J;  3ASK A;  3FLG A;  2CZ0 B;  1ZSZ C;  3C94 A;  5FU6 C;  2VB6 A;  2F5K A;  3GBQ A;  4C0Z A;  2QTX A;  3MJX A;  1YIT A;  2GCX A;  1D0X A;  2R5M A;  5HK3 A;  3JB9 I;  4Q5W A;  1AWW A;  2CYZ B;  2RQV A;  4BD3 A;  1OPK A;  2COW A;  4JLG A;  1MHN A;  5GAO n;  1BU1 A;  1TS9 A;  4PK4 A;  2HD0 A;  3GF5 A;  1WQ7 A;  4M77 G;  4AFZ C;  4QW2 A;  1PD1 A;  1ZHI A;  4EMK A;  1N9R A;  2EIF A;  4C92 A;  1Q86 R;  3QYG B;  1U1T A;  1F1B B;  2FZG B;  4E7Z A;  3JB9 H;  5CKB A;  2X4Y A;  1K76 A;  2BZX A;  4IUV A;  2QYZ A;  4BI4 A;  5KE3 A;  3I5R A;  4MZT A;  3PIP A;  4PNO A;  2YT6 A;  4M78 B;  4VUB A;  1M1F A;  3S3O A;  1WZO A;  5C0M A;  4F14 A;  3VYH B;  4PJO E;  2RD1 A;  3CCM A;  1WJQ A;  2P84 A;  2CP7 A;  3KUF A;  4Y28 E;  2DXT A;  1V29 B;  1RAD B;  3M59 A;  3M56 A;  3FIF A;  2CT4 A;  3VYG A;  2GFU A;  4DEY A;  3TCJ A;  5CKD A;  1TOV A;  1UGS B;  3A5Z B;  1FMW A;  2X3X D;  1NJI U;  3OW2 P;  1YIT T;  4AG1 C;  1TXQ A;  3I56 Q;  1UHF A;  4M75 C;  3MO8 A;  3SWN A;  3VU3 C;  4JRK A;  2EJG A;  4KRT A;  2K5I A;  1M1K C;  3AHU A;  3A8L B;  4C8Q C;  3CBP A;  2CUB A;  2CH4 A;  2F2X A;  2MMP A;  3CCL A;  2KT1 A;  1D1A A;  3I55 A;  4F17 A;  4LUD A;  2KBT A;  1OI1 A;  3ME9 A;  1QVG P;  1S72 A;  1X75 C;  4JZ3 A;  3NFC A;  1PM3 A;  2RPN A;  2DVE A;  4N4G A;  4C0G A;  4OP0 A;  4M78 C;  3OBY A;  1N5Z A;  4O5V A;  3T9N A;  2KE9 A;  4XU1 A;  1FXX A;  2BZ8 A;  3ZBD A;  2CP6 A;  2LQW A;  2EQI A;  1TG0 A;  3M9Q A;  4M7D G;  3REA B;  1M2O A;  4AFQ C;  2LNH B;  3H41 A;  2JM8 A;  3HP9 A;  4II1 A;  3CEY A;  1QCO A;  3CCM T;  1QW1 A;  5KCH A;  3BDL A;  3M53 A;  2DK3 A;  4QVD A;  4HT9 A;  2XKO C;  4OML A;  2KY9 A;  5GMK h;  4C5G A;  4IKF A;  3LX7 A;  1KC8 R;  1LJO A;  3U23 A;  3V7C A;  2JJ9 A;  1QP2 A;  2HKN A;  3V8J A;  4L6V 5;  4KH0 B;  3G1J A;  4GBQ A;  4HA8 A;  1TU0 B;  2COZ A;  5GAN h;  1I1J A;  4IIM A;  2K3B A;  2LJ3 A;  3I9Q A;  5LJ3 j;  1JJ2 P;  5A0G A;  1GCQ A;  2DET A;  2DVJ A;  2K6D A;  2FVU A;  5EG2 A;  1K8A U;  1M1K U;  5GAO m;  2LCL A;  3FDR A;  3HTR A;  3QYH B;  3I55 T;  5EC7 A;  3BFM A;  2AKK A;  3OYF A;  4CRI A;  2K57 A;  1S72 T;  4PJN A;  3CC2 Q;  1I0C A;  2CP2 A;  3CC4 T;  4PJO A;  4RUG A;  1OUL A;  5KCO A;  2FHD A;  4CC7 A;  4XTY A;  1VQ5 Q;  2ESW A;  1SHF A;  1CKB A;  8AT1 B;  3ZEH A;  1R0C B;  3TEE A;  2C0T A;  4OB2 B;  3EGD A;  4E7S A;  3EG9 B;  5GMK m;  4Z02 A;  4J9F A;  1VQ9 Q;  3QG1 A;  5FRO A;  1H92 A;  4DBR A;  2JTM A;  4C92 F;  1UEC A;  4PLL A;  2R57 A;  1NLO C;  2BUD A;  5GAN 5;  2LVM A;  1UDL A;  2A28 A;  3E2U A;  4C0F A;  4AG2 C;  2HQH A;  1VA7 A;  3A8H B;  4ZGJ B;  2KR3 A;  1D0Z A;  3A98 A;  1C0M A;  1C6V X;  3UF4 A;  2EYX A;  3GNG A;  3TVT A;  4N0A C;  1W70 A;  4GLM A;  4EMG A;  2RHX A;  1S1N A;  4IUQ A;  1IRE B;  5A0L A;  1KD1 R;  2ZPG B;  1H3Z A;  4PLI A;  3CCS A;  1WHM A;  3TRE A;  4E7J A;  1V76 A;  2RHY A;  4ANJ A;  5AT1 B;  3PGG A;  1HJD A;  2QDL A;  1VQ8 A;  2BE9 B;  5D6Y A;  2F69 A;  4LD9 K;  3QSU A;  4F04 B;  2DD4 A;  3L2V A;  3HHT B;  4C0D C;  4PFP A;  5KH6 A;  4M77 F;  4N4I A;  1HSQ A;  2ZPE B;  2AK5 A;  2D9T A;  2NUZ A;  5CCA A;  3UT1 A;  4ORZ A;  2HBP A;  4RG2 A;  1KHI A;  1X6G A;  2HNI A;  4LDW A;  2XHC A;  4JS4 A;  2QEX Q;  1AOJ A;  2AZS A;  2KYB A;  4FYY B;  2XK0 A;  2XI9 A;  3QZ9 B;  4JZ4 A;  4KGZ B;  1JXM A;  5LJ3 h;  1XNI A;  2EWN A;  2EGC A;  1H64 1;  1MV3 A;  1K9M C;  4J9C A;  3GPL A;  1WXT A;  3RKX A;  1XQH A;  2BKD N;  2SEM A;  1GFD A;  2ZPB B;  3LLR A;  2VC8 A;  2FRW A;  1VQP A;  1WNL A;  2PVO B;  4OB0 B;  4BB7 A;  2PZ1 A;  4LDX A;  1WFW A;  4DBF A;  3EG0 A;  3M4G A;  4M75 E;  1Y7X A;  2VXF A;  4Z88 A;  2VV5 A;  2G3R A;  2RJD A;  2JS2 A;  1W2B S;  5GAN 6;  4JJD A;  4C8Q E;  2KVQ G;  3EGD B;  3PVQ A;  4ZNX A;  1NBE B;  4M7A G;  1VOM A;  3L2Q A;  1YIT Q;  2NUT A;  3CCS T;  1HYO A;  1UHC A;  1YNZ A;  5FU7 C;  1OX9 A;  3JB9 G;  2KAF A;  5GJW B;  1AWJ A;  2K5L A;  3EHR A;  1VQ8 T;  3OS5 A;  3VS1 A;  1QVP A;  1WX6 A;  2LT4 A;  2ZPI B;  4NL2 A;  3P8D A;  1Q81 C;  2YRV A;  1NJI R;  4KGV B;  1D09 B;  5J3B A;  1G3W A;  1KHC A;  1T3S A;  3GIB A;  2EFI A;  2DBM A;  5GMK e;  2QXF A;  1C1A A;  1VQO T;  1OPL A;  1T0J A;  1LPL A;  4OF1 A;  2DZC A;  3QBY A;  1UG1 A;  5IT9 E;  2D0Q B;  2DEQ A;  3CC7 A;  3V8K A;  1I07 A;  4PJO F;  4M7D F;  2EBP A;  1FMV A;  2LRQ A;  3M0T A;  1VQP T;  5GAN e;  3CCM Q;  3OW2 A;  2RMO A;  1RAF B;  4BDY A;  3X28 B;  1YIJ A;  3X25 B;  3L2W A;  1LCK A;  1WI7 A;  9ATC B;  3X20 B;  2QAS A;  1AD5 A;  1YJ9 A;  3MP1 A;  4KUL A;  2E3H A;  2LT1 A;  2WSC E;  1MMG A;  2DLP A;  4J6X A;  1QKX A;  1U3O A;  1PCX A;  1QVG A;  4M78 G;  5GAM h;  3KFV A;  1T3L A;  3CCU Q;  2L0A A;  2E6N A;  1ARK A;  4C92 D;  1UE9 A;  1BIA A;  1X43 A;  2BE7 D;  2DRK A;  3ULR B;  1M27 C;  3J81 E;  4DBQ A;  1K73 C;  5GAN 3;  2GQI A;  2GTJ A;  5CKF A;  4DOV A;  1EX4 A;  3I55 Q;  1B07 A;  2RH2 A;  1ABO A;  5CO7 A;  3IQL A;  3UPU A;  3CC4 Q;  1Q81 U;  4RTY A;  2D0N A;  2QA4 Q;  1NG2 A;  2NUT B;  3KBG A;  4KBM B;  3CXC S;  1YJW A;  1OU9 A;  2PQW A;  4M75 A;  4XTZ A;  2CZ1 B;  1K8A R;  1M1K R;  5LJ3 f;  5FRM A;  3CC7 T;  1BYM A;  1AHJ B;  1MUZ A;  1ZBX A;  4LN2 A;  2VUB A;  5HY6 A;  4C8Q A;  3CPF A;  5A0D A;  1WGS A;  3VS7 A;  1RAE B;  2OX7 A;  2HSP A;  2ZPF B;  2MIO A;  2CP5 A;  3FRN A;  2CS7 A;  2CDT A;  2LC4 A;  1YIJ T;  1YN8 A;  2CSQ A;  2V8K A;  3CMA A;  2L8D A;  1SEM A;  2ECZ A;  2P0K A;  1JJ2 A;  2QAZ A;  3M0S A;  4LDY A;  5CQX A;  2L89 A;  1IHV A;  2OTL A;  1NM7 A;  1YJ9 T;  3A8G B;  2DTO A;  1Y07 A;  5CIU A;  2KRO A;  4Y91 A;  1VIE A;  2MK5 A;  1G8X A;  5IHK A;  1JEG A;  3FEO A;  3HFO A;  5FWB A;  2L3P A;  5M9O A;  2OI3 A;  1XTD A;  1N8R C;  1VIF A;  4X34 A;  3NTI A;  2MAM A;  1JBM A;  3OY9 A;  5LJ3 e;  2HCK A;  2M51 A;  1Q82 U;  3MP8 A;  2KXD A;  4PJJ A;  3ZFJ A;  3VJP A;  3H0F A;  2Y4X A;  1RAC B;  2O31 A;  1A0N B;  1ABQ A;  1BCO A;  4XAX B;  4RTZ A;  1WQW A;  1YWP A;  1YJW T;  3R6O A;  3UWN A;  1M8V A;  1OQK A;  4JUV A;  3P8H A;  3ER0 A;  2XU8 A;  1ZA1 B;  2MWO A;  4NS5 A;  4Y92 A;  5DLO A;  5D7U A;  2CZ7 B;  2DL4 A;  4UC4 A;  4J9D A;  3G7Z A;  1NEG A;  2LMJ A;  5IH2 A;  1JO8 A;  1G5V A;  2Z0W A;  1BI0 A;  2LTO A;  5DM7 R;  5GMK j;  2FEI A;  4A4H A; 
#chains in the Genus database with same CATH homology
 3BW1 A;  4M7A C;  4ZN1 A;  3VUB A;  2LNV A;  5IAY A;  3DB3 A;  3FB9 A;  1Q86 U;  2K3Y A;  3V7C A;  2DD5 A;  3CMA T;  5J39 A;  4J7I A;  1BKB A;  1QP2 A;  1VQ9 A;  1KD1 C;  2WSF E;  2E5Q A;  5GAM d;  4J83 A;  3V8J A;  4BE1 A;  4A4G A;  4L6V 5;  3JAM E;  1GXI E;  1VQO A;  2OTL T;  4F7U A;  4HA8 A;  1M90 C;  5GAN h;  3MEV A;  2QQA A;  1M4Z A;  3OYD A;  2VGN A;  4KT0 E;  4J5Y A;  4C5H A;  2YLC A;  4ZGE B;  2OAU A;  5GAN j;  5LJ3 j;  3OSS C;  1EIF A;  4ZTF A;  3PMT A;  2MF2 A;  1MGQ A;  5A0G A;  2M1H A;  3NTH A;  3M57 A;  4YTL A;  4HKE A;  2P0Q A;  1G3S A;  4JDS A;  1WJS A;  4QQ6 A;  2FVU A;  5EG2 A;  2RHU A;  5KE2 A;  1K8A U;  1M1K U;  2X4W A;  3JCM f;  2LCL A;  5GAO m;  3FDR A;  3QKJ A;  4M7D E;  1QVF S;  3QYH B;  3I55 T;  4PJO D;  5GAN d;  4GLK A;  3CCR A;  3BFM A;  2RK1 A;  3A8M B;  5CKH A;  1BI3 A;  3OYF A;  4CRI A;  1R8O B;  2K57 A;  3OYC A;  1S72 T;  1KC8 C;  3CC4 T;  3M5A A;  3E1S A;  4PJO A;  2K2V A;  2QQB A;  3CPW S;  3PMI A;  4PKC C;  5I2S A;  2JVV A;  5KCO A;  2GQV A;  2E65 A;  2FHD A;  2FL7 A;  1RI0 A;  4X9D A;  1BI1 A;  4BY6 B;  5DLQ E;  2M0O A;  4B9X A;  4XTY A;  4M78 D;  1Y96 A;  3SDZ A;  3OW2 S;  3WXM B;  2EYQ A;  1HXD A;  4A4E A;  2P4T A;  5CAI A;  3M58 A;  3CME A;  3CCJ T;  1Q7Y C;  1WPY A;  3OS1 A;  2E41 A;  4M78 A;  5GAN 8;  5GAN 4;  4M77 D;  3ZEH A;  3MHX A;  5FU6 B;  3RER A;  2IVW A;  4QQD A;  2R5A A;  4XU0 A;  3PTA A;  4BI8 B;  3TEE A;  5LJ5 h;  5GAN g;  3N5B B;  4OB2 B;  3Q1J A;  3OS2 A;  1I5L A;  2DAQ A;  3C4S A;  2EQM A;  3OSV A;  3X26 B;  5GMK m;  4M77 A;  4Z02 A;  5LJ5 j;  4BDZ A;  3QG1 A;  5FRO A;  5GAO l;  1FWZ A;  3HSB A;  1VQ7 A;  1Y71 A;  4J7F A;  2DO3 A;  3JSC A;  2JTM A;  2RA2 A;  1JB0 E;  3LW5 E;  4C92 F;  4PLL A;  2R57 A;  2BUD A;  3EFR A;  5GAN 5;  1YHQ A;  2LVM A;  2JN0 A;  4PJO C;  4M7D C;  4F7U F;  5LJ5 d;  4C0F A;  2CKK A;  2QDY B;  1QVG S;  2PVG B;  1N9S A;  1UGQ B;  3A8H B;  1YBY A;  3QO3 A;  4KUI A;  4ZGJ B;  2QEX A;  2XDD A;  3JCM c;  3I56 T;  3MEW A;  3CXC A;  1I8F A;  4IUR A;  5AYF A;  2DTH A;  4ATO A;  2XDB A;  3BY7 A;  4IUP A;  4M75 F;  1TH7 A;  5CQY A;  5GAM e;  4FIB A;  2RJF A;  3GNG A;  3OYL A;  1VQ9 T;  2O4X B;  2ZGW A;  3HRT A;  2PVD B;  4C92 G;  4N0A C;  1K73 U;  4OMF B;  2X35 A;  4XU3 A;  4GY5 A;  4DA4 A;  1RL2 A;  2E6Z A;  1B34 B;  2VYT A;  3CCV A;  3QHS A;  4EMG A;  4ZTJ A;  1VQM A;  4HCB A;  2RHX A;  4IUQ A;  1PSF A;  3GOX A;  2JOY A;  5GMK l;  1IRE B;  3X24 B;  5A0L A;  2ZPG B;  1G3T A;  1H3Z A;  4C8Q F;  2QQS A;  4RCB A;  2EJF A;  4V2S A;  4PLI A;  5LJ5 g;  3CCS A;  3TRE A;  2JNG A;  2KSS A;  4E7J A;  3L42 A;  2RHY A;  3V8L A;  1YJN A;  3PGG A;  3OB9 A;  4M75 G;  3CC2 A;  1IZ6 A;  3CCE A;  3SFM A;  1NJI C;  2DIQ A;  5CR2 A;  2DJZ A;  3CCR T;  3O8V A;  5CVI A;  3V7S A;  1VQ8 A;  5D6Y A;  2F69 A;  3H8Z A;  4LD9 K;  1KQS A;  3QSU A;  2DD4 A;  2E70 A;  3L2V A;  3OBW A;  4EMK B;  3HHT B;  4LD6 A;  3RKW A;  4C0D C;  3S3M A;  1VQ5 A;  4C92 B;  4C8Q G;  1M5Q 1;  3OYM A;  3OA6 A;  4OB1 B;  5KH6 A;  1WJR A;  3CBM A;  2MI6 A;  2RO0 A;  4M77 F;  4N4I A;  2ZPE B;  5CCA A;  2D9T A;  1KC8 U;  3G4S A;  3UT1 A;  4ELZ C;  4F7U B;  4R55 A;  4QVC A;  1I4K 1;  4BE2 A;  1U8R A;  1VQN A;  2HBP A;  4RG2 A;  1KHI A;  1VQ6 A;  3RMQ A;  2HNI A;  4LDW A;  2XHC A;  5GAN 7;  3CME T;  2HQX A;  4JS4 A;  5I2M A;  4XK8 E;  3VUZ A;  3E9G A;  1X6O A;  4FT2 A;  3RMS A;  4X9C A;  2CGH A;  2RI3 A;  2XK0 A;  4L59 A;  4M75 B;  2NLU A;  2XI9 A;  3QZ9 B;  2KMT A;  3FJP A;  4XTX A;  3OYB A;  1OZ3 A;  1Q7Y U;  5GAO q;  5LJ3 h;  1XNI A;  3JCM h;  1JJ2 S;  3VV0 A;  2EWN A;  4C92 E;  3OYJ A;  3RIR A;  4A53 A;  4E7I A;  2DIG A;  1H64 1;  1W4S A;  1K9M C;  3GPL A;  1VQ7 T;  2KK4 A;  3QPH A;  3RKX A;  1LNX A;  3JRZ A;  3OYA A;  1XQH A;  2BKD N;  1Q82 C;  4C8Q B;  4MDW A;  2ZPB B;  3LLR A;  2VC8 A;  3M55 A;  3MET A;  2K3X A;  5HK0 A;  1WNL A;  2PVO B;  1VQP A;  4C5I A;  1YHQ T;  5GAM f;  4TVR A;  3WVD B;  4OB0 B;  3CCL T;  4BB7 A;  2PU9 B;  4JRI A;  1N6A A;  4J6W A;  1XOV A;  4M7A F;  2X4J A;  4OB3 B;  2QEX T;  3WVE B;  4M7D D;  4ME7 A;  4LDU A;  4LDX A;  5LJ3 d;  3JCM d;  3M4G A;  4M75 E;  4XQ3 A;  2KQW A;  3DB4 A;  1N27 A;  1Y7X A;  3S6W A;  2VXF A;  4B9W A;  3JB9 F;  4N4H A;  2ZZD A;  4RKU E;  4M7D A;  3GLX A;  2VV5 A;  4A54 A;  2QQ9 A;  1NPR A;  2A7Y A;  2G3R A;  1N8R U;  3LYI A;  2RJD A;  2X4X A;  4DOW A;  3CCQ A;  1W2B S;  4P5N A;  3JCM J;  4C5E A;  5GAN 6;  2RHI A;  2DXU A;  1KQ1 A;  2EAY A;  3RUX A;  2KVQ G;  4C8Q E;  3LWI A;  4BAC A;  1VQM T;  3SWN B;  3OYK A;  4MZM A;  4M77 B;  1KG1 A;  2RK2 A;  1UEB A;  1G3Y A;  4M7A G;  3L2Q A;  4JRQ A;  5C6S A;  3CCS T;  4N0A A;  3PIO A;  2GF7 A;  2L5Q A;  4BI3 A;  4E7L A;  1YI2 A;  3QII A;  5FU7 C;  5GAO p;  5LJ3 g;  3JCM g;  2KAF A;  3INZ A;  3JB9 G;  2DXC A;  3QJY A;  5FRN A;  1BIB A;  1YJN T;  1UGR B;  2WSE E;  4C92 C;  2K5L A;  3QUI A;  3CC2 T;  3CD6 A;  3CCE T;  1D3B A;  1LOJ A;  3PFS A;  3J7A F;  2FYK A;  1JRI A;  2LQK A;  4RG8 A;  3OS5 A;  1VQ8 T;  3QJ6 A;  5L8R E;  1O9S A;  1QVP A;  3MEA A;  2LT4 A;  2XDP A;  2ZPI B;  1UB4 A;  3A8O B;  4NL2 A;  4RMO A;  1VQ5 T;  4M77 E;  3P8D A;  1Q81 C;  2YRV A;  1QP3 A;  2F5T X;  3QDR B;  2CZ6 B;  4ZGD B;  5J3B A;  3G4S T;  5IN1 A;  1G3W A;  1KHC A;  1VQN T;  4EMH A;  3CBO A;  3FC3 A;  1VQ6 T;  4M7A B;  1BI2 A;  3E9F A;  3PNW C;  3JCM b;  2M9U A;  2EFI A;  3GIB A;  4EPC A;  2K4Y A;  4MMK A;  1K8A C;  4FM4 B;  2DPP B;  4EDU A;  3OYH A;  4XTW A;  3CCU A;  5A2Q E;  3GNF B;  5GMK e;  2QXF A;  1QVF A;  1ZQ1 A;  4ELY C;  1VQO T;  4OF1 A;  2XID A;  2DZC A;  2E10 A;  3QBY A;  4JLI A;  4QQG A;  3JCM W;  1KQ2 A;  2LCC A;  3TU4 K;  5IT9 E;  4FSX A;  1M1G A;  1PSE A;  2D0Q B;  4F7U G;  2DEQ A;  4E47 A;  3CC7 A;  4ZN3 A;  3JCM X;  1KD1 U;  3S3N A;  3V8K A;  2QQR A;  3KXT A;  3G71 A;  3CPW A;  1M90 U;  4PJO F;  2ZPH B;  4M7D F;  4RCC A;  2LRQ A;  4XTU A;  3HL8 A;  1NZ9 A;  2Y90 A;  3CC4 A;  1VQP T;  4KUD K;  4M7A E;  2EJ9 A;  5CK9 A;  5I21 A;  2EQU A;  3F70 A;  3H6Z A;  2DTI A;  5GAN e;  4OGE A;  3OW2 A;  3OMC A;  1M9S A;  4D6W A;  2EQK A;  3X28 B;  4BDY A;  2QA4 A;  3JB9 J;  1YIJ A;  4BY6 C;  3X25 B;  3HRU A;  3EFS A;  3ASK A;  2M16 A;  4M78 F;  3L2W A;  3FLG A;  3SWN C;  3P8B B;  4DQ2 A;  4J8O A;  2CZ0 B;  2XIC A;  3X20 B;  1UGP B;  3C94 A;  3CCQ T;  1U1S A;  2E64 A;  5FU6 C;  4PJO G;  2F5K A;  4C0Z A;  1YIT A;  2QTX A;  2C06 A;  2GCX A;  5GAN 2;  1VQ4 A;  1VQL A;  2B8A A;  4HCZ A;  2R5M A;  3MP1 A;  4KUL A;  1YJ9 A;  5HK3 A;  2LT1 A;  3JB9 I;  4Q5W A;  4HT8 A;  2CYZ B;  4MML A;  2WSC E;  4BD3 A;  4J6X A;  2GFA A;  5HKC A;  4HCC A;  3UDC A;  1QVG A;  4JLG A;  4M78 G;  3LGL A;  2VXE A;  4OGC A;  3MCA B;  1MHN A;  5GAM h;  3OQ5 A;  3LWH A;  3DLM A;  5GAO n;  3G6E A;  3V7R A;  2ZCF B;  5LL6 S;  3CD6 T;  5GAM j;  2E6N A;  2HD0 A;  3GF5 A;  1WQ7 A;  4M77 G;  2MWP A;  2AHJ B;  4C92 D;  1BIA A;  3QXE B;  4QW2 A;  3J81 E;  1O75 A;  1ZHI A;  3I56 A;  2HQE A;  1K73 C;  3RES A;  5GAN 3;  4EMK A;  4F7U E;  3C12 A;  1N9R A;  2EIF A;  5CKF A;  5LJ5 e;  4C92 A;  4DOV A;  1VQK A;  1X01 A;  2D6F A;  3QYG B;  4M7D B;  4PJO B;  2OTJ A;  1U1T A;  2RH2 A;  3JB9 H;  5CO7 A;  5CKB A;  4R56 A;  1VUB A;  2X4Y A;  3UPU A;  4BUG A;  1Y96 B;  4IUV A;  4JRP A;  1Q81 U;  4BI4 A;  2QI2 A;  4M75 D;  3M4Y A;  5KE3 A;  2I2L A;  3OYN A;  4MZT A;  3PIP A;  4PNO A;  3CCU T;  4M78 B;  3KBG A;  4KBM B;  3CXC S;  3RKY A;  4VUB A;  3PT9 A;  1YJW A;  1M1F A;  4M75 A;  2PQW A;  3S3O A;  4XTZ A;  2R58 A;  3CCV T;  2CZ1 B;  1I81 A;  5C0M A;  5GAN f;  2DXB A;  4C8Q D;  3E19 A;  5LJ3 f;  3VYH B;  3L2U A;  4PJO E;  5FRM A;  2P0P A;  3CC7 T;  1BYM A;  3GP8 A;  1D3B B;  1AHJ B;  1ZBX A;  2RD1 A;  2VUB A;  4FT4 A;  5HY6 A;  2A3L A;  3G71 T;  3CCM A;  4WF2 A;  4JJN K;  3OYY A;  1WJQ A;  2LDM A;  3SB2 A;  2O01 E;  3LGF A;  4CI0 C;  5GAM g;  4C8Q A;  3CPF A;  5A0D A;  1OZ2 A;  1WGS A;  2EQJ A;  3KUF A;  4Y28 E;  4EMK C;  3NTK A;  2ZPF B;  3M54 A;  4E7H A;  2DXT A;  1V29 B;  3M59 A;  3M56 A;  1Q86 C;  3FRN A;  3FIF A;  4M78 E;  3VYG A;  2GFU A;  2QA4 T;  2CS7 A;  2WAC A;  3QZ5 B;  3HRS A;  2V8J A;  2LC4 A;  3TCJ A;  1YIJ T;  5CKD A;  2YHT A;  3MEU A;  4IUT A;  4QVZ A;  1UGS B;  3A5Z B;  4O6J A;  1OYX A;  4C0D B;  2XD0 A;  2IG0 A;  4A4K A;  4NL3 A;  2RI5 A;  3DLL A;  2V8K A;  3CMA A;  2L8D A;  2K5F A;  1NJI U;  3JCM V;  1KQS S;  4MDX A;  2P0K A;  5J26 A;  4XU2 A;  1JJ2 A;  4LDY A;  1YIT T;  2RI2 A;  2L3R A;  2L89 A;  2RJC A;  4PL6 A;  5CQX A;  4A4F A;  4BE0 A;  1VQ4 T;  2DKG A;  4M75 C;  1VQL T;  2OTL A;  3MO8 A;  3SWN A;  2E12 A;  3A8G B;  3VU3 C;  3OMG A;  1YJ9 T;  4JRK A;  2DTO A;  2BIV A;  1Y07 A;  2EJG A;  5CIU A;  2K5I A;  2RM4 A;  4Y91 A;  1M1K C;  3URG A;  3L1A A;  4IUU A;  3AHU A;  3A8L B;  1VIE A;  5GAO r;  3L2R A;  2E1H A;  5D6W A;  5LJ5 f;  4C8Q C;  3FEO A;  3CBP A;  3HFO A;  1HK9 A;  5M9O A;  3OYI A;  2MMP A;  3G6E T;  3CCL A;  3SD4 A;  5FLX E;  2PUO B;  3HKS A;  1XTD A;  4JS5 A;  4FU6 A;  3OYE A;  3I55 A;  2LQ8 A;  3MP6 A;  3J80 E;  1OI1 A;  1N8R C;  1VIF A;  3ME9 A;  2PUK B;  4X34 A;  2RHZ A;  2VGM A;  3NTI A;  1S72 A;  1W2B A;  1X75 C;  2MAM A;  3NFC A;  1VQK T;  1JBM A;  2DZ9 A;  4NOY A;  3JCM Q;  3OY9 A;  4N4G A;  2DVE A;  1K9M U;  4M7A D;  2OTJ T;  4C0G A;  4OP0 A;  2V8I A;  5LJ3 e;  3JCM e;  4M78 C;  2LX9 A;  3OBY A;  4MZP A;  3BDU A;  2RB6 A;  4O5V A;  1Q82 U;  3HFN A;  3MP8 A;  3T9N A;  3JB9 D;  4XTV A;  3ZFJ A;  3LH0 A;  4M7A A;  4XU1 A;  1FXX A;  3VJP A;  1SSF A;  1NE8 A;  2Y4X A;  4M77 C;  3ZBD A;  3CCJ A;  2EKO A;  2H3J A;  3DKM A;  2Y4Y A;  2FB7 A;  4XAX B;  5CKE A;  2O4X A;  1WQW A;  1YCY A;  3M9Q A;  1YJW T;  3R6O A;  4M7D G;  4LDV A;  3EAE A;  1B34 A;  2KDS A;  3HPW A;  3C95 A;  3UWN A;  3HP9 A;  1M8V A;  4J6Y A;  1P92 A;  4JUV A;  3P8H A;  2JZ2 A;  4OVA A;  4II1 A;  3VKI A;  3L2Z A;  2YLB A;  3CEY A;  2HAX A;  3ER0 A;  2XU8 A;  3CCM T;  2MWO A;  1QW1 A;  4NS5 A;  5KCH A;  3BDL A;  4FL6 A;  5FU7 B;  2XG8 D;  5D6X A;  5DLO A;  1YI2 T;  3M53 A;  2DK3 A;  3OS0 A;  2CZ7 B;  4E7K A;  4UC4 A;  4QVD A;  4HT9 A;  5DY9 A;  3G7Z A;  2XKO C;  4L5G A;  2KY9 A;  5GMK h;  3JCM P;  1G5V A;  4C5G A;  5GMK i;  2JTF A;  4IKF A;  1BI0 A;  1DJ7 B;  1FX7 A;  2JUF A;  3OYG A;  2LTO A;  3LX7 A;  1LJO A;  2RJE A;  5DM7 R;  5GMK j;  1NPP A;  4A4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...