5CR2A

E. coli mazf in complex with single strand dna substrate analog
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
VSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
molecule keywords Endoribonuclease MazF
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
total genus 24
structure length 111
sequence length 111
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cr2A00
4ME7A 4ELZC 4MZTA 5CQXA 2VUBA 1M1FA 1UB4A 5CCAA 4MZPA 3VUBA 5CO7A 5CKBA 5CR2A 2KMTA 3TCJA 5CK9A 2C06A 4VUBA 3JRZA 5HK0A 4OF1A 5HKCA 5DLOA 1X75C 1VUBA 3NFCA 4HKEA 4MDXA 5CKFA 1NE8A 5CKDA 5CQYA 3HPWA 4MZMA 2MF2A 5HK3A 3JSCA 5CKEA 3G7ZA 4ELYC 5CKHA
chains in the Genus database with same CATH superfamily
2XD0A 4B9XA 1FMVA 2D8JA 2RHZA 3OW2P 2FEIA 3VUBA 3D7SB 4OMMA 3OSSC 3UA7A 2CKKA 4HT8A 1JQQA 2PTKA 1OU9A 4WCIA 3OSVA 1HYOA 5GAOn 2CZ7B 2EJGA 2X3XD 2FRYA 1KC8C 4K11A 1WX6A 1JEGA 1NM7A 3VS4A 1R77A 3OYYA 3OBYA 2NYSA 5D7UA 1NYFA 3QG1A 4O5VA 2AK5A 3OYDA 1OU8A 2JXBA 2QTXA 2VVKA 4C0FA 2Z0WA 1CKBA 2LMJA 2GQVA 1NPPA 5J26A 2E12A 3LH5A 2O01E 3EG3A 5GAMh 2ZPIB 1MUZA 4C0DC 1G2BA 2QQSA 2EYQA 4IIMA 4RTUA 1K73C 1VQKQ 3M4GA 2K6DA 5A0LA 3PGGA 4J9BA 3GNGA 1Y96A 3JCMW 2D6FA 1K9MR 2KXDA 4C5GA 4E7JA 2F2VA 1VQ7A 2JMCA 1B34A 1BIAA 1BU1A 2Y90A 3HRUA 4PJOG 3CXCS 3FJPA 1XJWB 2EQMA 2R5AA 1FXXA 3KXTA 1GXIE 3JCMb 3DLLA 2PU9B 5CQXA 1T3LA 3NHNA 3TSZA 4E47A 2QYZA 3T9NA 4GY5A 1EIFA 2SRCA 2F1LA 1V76A 2EIFA 4VUBA 4BE1A 4RTZA 5GAOr 5GAN4 3ME9A 2XK0A 4FYXB 4E7KA 4M7DA 1KQSA 4JJDA 2LJ3A 2OTJA 3VJPA 2OJ2A 3EHQA 4BDZA 2J6FA 1RLQC 2DIGA 3JCMg 4DQ2A 1MV3A 4M4ZA 4L59A 2O31A 1TOVA 1UGQB 3M0SA 3JCMe 4M78E 1FMKA 1OZ3A 2PVDB 3JCMV 2RK1A 1K76A 5D6WA 1ZBXA 3PMTA 2G3RA 2K3XA 4DA4A 1TSFA 2FZCB 1OYXA 3JCMd 3OW2S 3PIOA 1E7OA 1WJSA 2K5FA 1VQ7T 3RMSA 2DRKA 2PVOB 3MO8A 3THKA 1U5SA 1X27A 2ESWA 3G6EQ 4FT4A 4JLGA 2XDBA 4PJOC 3Q1JA 4HXJA 5LJ5j 2BE9B 3LGFA 1QKXA 3TREA 2KY9A 1HXDA 4JS5A 3MEUA 4AFZC 4LUDA 1OPKA 2DK3A 4RTWA 1NLPC 2LJ0A 1U8RA 4RG2A 3OYFA 3HKSA 4C0DB 4A63B 4OGEA 1KQ1A 1SEMA 3E19A 3C94A 2QA4Q 4C8QG 3OYJA 3CC7T 4J9GA 2L0AA 2V8IA 2OTJT 1PKTA 4OB0B 5IHNA 4KGVB 3S3OA 2D0NA 2ZCFB 1AWWA 2X9HA 2CT4A 2XG8D 1SSHA 1KG1A 4OF1A 1AD5A 2LQNA 3TSWA 3BDUA 2LJ1A 2NLUA 4ATOA 2EYWA 3P8HA 4XK8E 1NJIU 2CUBA 2EQJA 2LNVA 2E1HA 1PRLC 1TUGB 4N0AC 4FIBA 1Q81U 4PJOD 3OA6A 4X1VA 3CMAA 3VS5A 3GIBA 2X3WD 2HQXA 3INZA 2HD0A 3G7ZA 1PD1A 2MAMA 1X2KA 1I81A 2DL3A 4HCZA 3H6ZA 4JRQA 5GJVB 3CMEQ 1TUDA 1W6XA 1GCQC 1EFNA 2LCLA 4RUGA 2ENMA 1ABQA 1N6AA 4XTXA 2GF7A 4UC4A 1MMGA 2DO3A 2DJQA 2KGTA 3L2ZA 5LJ5f 4C8QC 3OYHA 2K5IA 2VGMA 3EG9B 4JZ4A 1SHFA 4NL2A 3CCSA 2R57A 2RQWA 2I2LA 2E65A 1TU0B 2ATCB 2CDTA 4JJNK 3SHWA 5CR2A 3URGA 1BCMA 1UUEA 3LLRA 3LWHA 1D1AA 2LQ8A 4PLIA 1YJ9A 4FSXA 5CAIA 2E64A 4ZNXA 1VQ4A 4OMLA 4PJOB 4JUVA 1JBMA 3ZL7C 4PL6A 2BKDN 2DKGA 1IHWA 1KHIA 1S1NA 3NFCA 1VQ5A 5KYNA 3G4SA 3H0HA 1TTHB 3VRYA 1QW1A 3CMAT 2AHJB 3VS3A 4M78A 2FZKB 2MYSA 4BACA 4X9DA 5FROA 2JTFA 4ZGDB 3A8HB 4PJOF 1WA7A 3EGDB 4Z89A 2HL3A 3GNFB 2W10A 3WVEB 4F7UF 2G6FX 2DBKA 1Q95G 3UATA 5GAN6 4L6V5 4DEXA 4M75D 3EFOB 1Y57A 2DXCA 1UGSB 4JLIA 4HT9A 5I2SA 4KT0E 1XTDA 1VQMA 4GLKA 1O9SA 4EMKA 3CCST 1K0XA 4HCCA 1WZOA 5D6YA 3L2QA 3A1PA 2HBPA 1YWOA 2RD1A 3UPUA 2CH4W 5LJ5g 2JN0A 5GAMj 1VA7A 1HJDA 4J7IA 1BI3A 2RJDA 2DNUA 3NMZC 3BW1A 2CGHA 2LX7A 2DXTA 3O5ZA 3OYIA 1WHGA 1YJ9T 1K8AU 5CVIA 1UEBA 5LJ5h 2OTLQ 5LJ5e 4C92E 1UJ0A 3JB9G 1VQ4T 4Y28E 3QWXX 5KYXA 1G8XA 2M02A 4FW1A 3RESA 1NBEB 1N8RR 2I0NA 4OB2B 1Q86U 1TH7A 1A0NB 1ZA1B 2KSSA 2YRDA 1VQ5T 2HEQA 3G4ST 1I8FA 3EG2A 3RDVA 3TQ7P 4R55A 1R8OB 4BE0A 3UT1A 4F16A 1ZA2B 2DPPB 4P5NA 4C8QB 4XU0A 3QYHB 1VQNA 4FW2A 3M0PA 1KQ2A 2DAQA 3QHSA 4CC7A 1JXOA 2ABLA 3JAME 5LJ3j 4J83A 2ROLA 3CCQA 3M9QA 1KD1U 4FCYA 1YCYA 4LD9K 2X4YA 2LRQA 1M8VA 4R56A 1VQ7Q 4KH0B 2CH4A 4ZGEB 2JM8A 1J3TA 3FRNA 3VRZA 1VQMT 3E9GA 2EQKA 2EPDA 3I55A 1W1FA 4M75F 1UGVA 3MP6A 3ZFJA 4KRTA 4BDYA 2L3SA 2M16A 2KDSA 1YIJA 2EGAA 3OYGA 5KYUA 4E7LA 3M56A 4ANJA 2YRVA 2K7AA 4RTTA 3FB9A 2OX7A 1M1GA 4FYYB 2IPOB 1WQ7A 2Y4YA 5A0DA 1ZSZC 3HFNA 1QCOA 3QWYA 3NTKA 2L3QA 2ZGWA 3CC7Q 2CP5A 3NPFA 2DTIA 3X20B 4J5YA 2NUTA 2OTJQ 2ED1A 3CBPA 2MK5A 1O75A 5KH6A 1M90R 2A08A 2F5TX 4QVCA 2DD4A 2WSCE 2CREA 3EH2A 2KRNA 1U1TA 3DKMA 2DXUA 1VQNT 1YJWA 2CP3A 1IZ6A 4IURA 4IUTA 2DEUA 1G5VA 2QQRA 4FYVB 2QTVA 3OYAA 1KQSS 1V1CA 5ECAA 3CCQT 4HA8A 2E10A 2IVWA 3MKDA 1WXUA 1UHFA 3M59A 1LJOA 1JJ2A 2KAFA 5C6SA 3M0RA 5GANj 1AVZC 3I55T 3V8JA 4CC4B 5LJ3f 1ZLMA 2IG0A 4HVUA 1MV0B 4E7IA 2HQHA 3RR6A 4ME7A 4ELZC 4N4HA 5GMKi 2EQIA 3PTAA 1YIJT 2DETA 1Q82R 3QDFA 3RERA 5A0GA 2MIOA 3JRZA 2YLBA 1H3HA 2L8DA 4XTZA 3M53A 4QQ6A 2KYMA 1WXBA 2QGGA 4OMOA 2L3RA 2MF2A 2MWPA 5GJWB 1M1KR 3QUIA 2PUKB 3HP9A 4C5HA 2M9UA 3GF5A 2L3PA 3QJ6A 3P8DA 4XU1A 1R0BG 4J7FA 2CSQA 4XU3A 5IN1A 3BFMA 1T0JA 2C0IA 2J06A 1YJNA 2ZPBB 4C92A 2JS0A 1JO8A 1G3TA 3VYGA 2XI9A 2E5QA 1RAHB 1TWBA 5GAMg 1ABOA 1YJWT 2HDAA 4FM4B 1D0XA 2QQBA 1YHQA 1RAGB 3ULRB 2COZA 5KYWB 5FWBA 5GAMe 2A3LA 1OPLA 2DA9A 3G71A 3S3MA 4LUEA 1VOMA 4OMNA 2GFAA 2A7YA 3GPLA 2P4RA 4M77G 2GTOA 2JS2A 4J9HA 2BIVA 4M78G 3SWNC 2XHCA 5CIUA 1NJIC 5GAMd 1Q7YU 3RIRA 3JB9J 1ZHIA 2XDDA 3CMAQ 3OB9A 2YUOA 3R6OA 1WI7A 2PNIA 1ZSZB 1Q81C 4HCBA 1UJYA 1WHHA 1BI2A 1KC8R 2HBWA 2QEXA 2XDPA 6AT1B 4A54A 1TS9A 1RUWA 2V8KA 1OZ2A 3MEWA 4QVDA 2A36A 4AG1C 2J6KA 1QVGA 4XTVA 3RBBB 4LE9A 5GANf 5I22A 3MP8A 2CT3A 1GCPA 2QASA 5LJ3h 3DLMA 5LJ3e 2RJEA 5IAYA 4LDWA 5GAOp 2XU8A 5EC7A 2LQKA 3C95A 1T3SA 3CCSQ 2YWWA 3LW5E 2JW4A 2LZ6B 4LDXA 1MMDA 3OS0A 3LGLA 3X25B 1GFCA 1VQOA 1YJNT 4LD6A 3ZBDA 1K73R 3FDRA 1WDXA 5GAN7 2XMFA 3PT9A 4FU6A 2D8HA 1RAFB 4CC2A 4KGZB 1YJ9Q 2DLPA 2RHYA 4Q5WA 3VKIA 4ZTFA 1W2BA 4QT7A 1YHQT 5GAOm 1SRLA 1VQ4Q 3PVQA 2O4XB 2JM9A 3GOXA 2HCKA 3G71T 1MMAA 5GAN8 2E6ZA 5KCHA 4E6RA 3OMGA 3VUZA 2L5QA 4M77C 1X6GA 2JZ2A 4M78C 1VQ5Q 3G4SQ 2RA2A 2JTEA 4NOYA 2OAUA 1WLPB 2P0QA 1AWJA 2HNIA 3L42A 4EMHA 1DJ7B 2DERA 3NTHA 4WF2A 3LH0A 3EGXA 2QEXT 1YI2A 2DL4A 3FEOA 4RTYA 4E7SA 1H3ZA 3OS5A 2GFUA 3CBMA 2FHDA 1OV3A 2P84A 1RAIB 3M0UA 3JB9I 2LNHB 3HHTB 3UDCA 1Y71A 5KE3A 2EW3A 2GCXA 4FL6A 2FYKA 3H0IA 4J6WA 1QCFA 1QQJA 2DVJA 2H3JA 3CD6Q 2HQEA 2EKOA 1Y7XA 4EMKC 2JUFA 4A4FA 1JU5C 2RNAA 3HFOA 3SEMA 3C12A 3MCAB 4Z88A 5FW9A 1VQMQ 2DF6A 5GANg 2VXFA 2LT1A 2FL7A 2FG0A 4F7UE 3SWNB 1YWPA 4DBRA 3E2UA 1VQOT 2YSQA 5GANh 2LQWA 1XOVA 5GANe 2MOXA 4BI4A 2ZAEA 3M4YA 3OYEA 4IUQA 3SB2A 2HL5C 3M0QA 1U1SA 1VQPA 4PJMA 3JB9H 1K9MU 4MDWA 4M77D 3A8OB 4J9FA 1GL5A 2K3BA 1WYXA 2CP7A 2MPXC 2HSEB 1K8AC 2RN8A 1D1BA 3OYBA 2DXBA 5L8RE 1OQKA 4DEYA 2DBMA 4DBFA 3MPUB 1JJ2P 3VS6A 1RI9A 3EG1A 5IHKA 1Q86C 2JVVA 2HKNA 3V7RA 2WSFE 3M58A 3JV3A 3REBB 2VB6A 3J80E 1XQHA 1WJRA 3RKWA 3V8LA 3G1JA 3QZ5B 1VQNQ 2LT4A 2CZ6B 2L2PA 3P8BB 1YI2T 5I21A 1VYTA 1H8KA 1VQ6A 1M5Q1 1W4SA 2KE9A 3I56A 2DIQA 4QKUA 1C6VX 3CC2A 2KEAA 3CCQQ 4WTOB 1X43A 2E5KA 1ACMB 3WVDB 2RHUA 1EZZB 1QVFA 1I5LA 1KD1C 5FRMA 1VUBA 2EGCA 3MJXA 3I55Q 5HCKA 1WNLA 1OOTA 4ZN1A 2V26A 3O8VA 2AKLA 3RMQA 1D3BA 4M77B 3V8KA 4M78B 3CCUA 1QP3A 1GBQA 2DEQA 1P92A 2EYZA 4LDYA 1YIJQ 1LVKA 1QP2A 1KK7A 5DY9A 1VQPT 2YUQA 1RAEB 1HK9A 1NEGA 4J6XA 1NE8A 2RHXA 2P0PA 5CKEA 4C92G 3OS1A 2X35A 4M75E 3GP8A 1I5OB 4KULA 1UB4A 4M77F 2LX9A 3R6NA 2NUPA 4RCCA 1M2VA 4EMKB 1F1BB 2MWOA 1SG5A 4EMGA 1PCXA 4JDSA 2RK2A 1G3YA 4PLLA 1YJWQ 2VKNA 3CCEA 1VQ6T 4LNPA 2H8HA 3EFRA 5GMKm 3I56T 4OMFB 2FRWA 3CCLA 2JOYA 4EIKA 3OYKA 1JB0E 3CC2T 2M0YA 1RABB 5LL6S 5DLOA 4B9WA 1D0ZA 2A37A 2DILA 2E70A 4C8QD 2EWNA 2MMPA 1RAAB 1I0CA 2P0KA 3QJYA 3JCMX 3EG9A 2COYA 3PE0A 1YP5A 4TVRA 4M7AE 4IIOA 3QYGB 2DVEA 2J6OA 1KQSP 3CCUT 4OB3B 2FB7A 4E7HA 3MP1A 4A4KA 3QDRB 2DJZA 4N4GA 4Z02A 3CC4A 5CQYA 5FLXE 1JJ2S 4X9CA 3MHXA 2DX1A 2PVGB 4PJOA 3M5AA 3JCMP 1FYNA 1ZUKA 1Y0MA 1OX9A 4F7UA 2LTOA 1KIKA 4AFUC 4C92C 4M7DG 3N5BB 1AWXA 2X51A 1W70A 2V1QA 2LCSA 4LN2A 2KNBB 3J81E 3X24B 3S3NA 5LJ5d 1TG0A 3OQ5A 1SKUB 5IHIA 5HK3A 5GMKj 3WXMB 2DYBA 1JXMA 2RPNA 1H641 4EDUA 3I5SA 3CCET 1YCSB 1YHQQ 3EGDA 5EG2A 2ED0A 2EAYA 2RQVA 2GTJA 2DL5A 1X2QA 3CCLT 2K3YA 1D1CA 4XTWA 1OULA 1YITA 3DB3A 2XIDA 3QSUA 4KH1B 4PFPA 4MDXA 3A5ZB 4PNOA 3VS2A 4OVAA 3CPFA 2NUTB 1PKSA 1Q7YC 2LC4A 1CKAA 4C5IA 1WIEA 1RADB 3VV0A 3BE3A 2QEXQ 1N27A 1ZQ1A 4ZGJB 4JS4A 1PD0A 4A4HA 2RMOA 4C8QF 4N0AA 2FPFA 1WJQA 3PNWC 2OAWA 4RTVA 4C92D 4XTUA 4ZTJA 4Z8AA 3CC4T 2RI2A 2L89A 2K79A 4ORZA 1FWZA 1M30A 4E2FB 4L5GA 1LOJA 1ZSGA 1S72A 1UDLA 1N5ZA 3QO3A 4DOWA 2HSPA 4R0KA 2O88A 2NUZA 2RI3A 3EG0A 1Y07A 4PJNA 2KMTA 5HY6A 1BKBA 4M7DC 2CP0A 5J39A 2HKQB 4BUGA 1BIBA 4CI0C 2A0FB 4JPBW 1WGSA 1VQOQ 3H9NA 4XQ3A 3OBWA 2BZXA 1QVGS 2EBPA 3KUFA 5M9OA 2ZPHB 5IH2A 3MEVA 2KK4A 4HCKA 1VIFA 2K5LA 5CO7A 4M75A 2H3EB 1OX8A 2C0TA 4LDUA 3JCMQ 2RJFA 1YITT 3EFSA 2O9SA 4ELYC 5FRNA 3S6WA 3CCMA 4PKCC 3X26B 2LP5A 3A8MB 1W2BS 2QQ9A 4IUVA 2HZYA 1RACB 5GAOl 1X69A 4NS5A 4B6MA 4C92B 5HK0A 1YI2Q 5FWCA 3F70A 5L23A 1ZBJA 3HRTA 1R0CB 2CP6A 1N8RU 3E1SA 3KFVA 1M8MA 4M7DD 3PVLA 2M1HA 3JB9D 3LWIA 5IXFA 1N9RA 2DFUA 4NL3A 4M7AA 2VWFA 1S72T 1NLOC 1G3WA 1GFDA 1VYUA 1UTIA 2E4HA 5HKCA 2JNGA 4HVVA 1QCNA 5CKFA 4C92F 1AT1B 1I07A 1Y96B 2DRMA 1WFWA 2ECZA 2KT8A 1VQ9A 3V7SA 4AFQC 3PFSA 3SDZA 3HRSA 3OS2A 1VQPQ 1B34B 4LXCA 4XAXB 2RQUA 4HKEA 2EJFA 2CYZB 1K9MC 2KR3A 3CPWA 2E3HA 1IO6A 2OTLA 1H92A 2QXFA 3AHUA 5I11A 2HMAA 5KYYA 3HSBA 4C5EA 3JCMf 3OYNA 1MNDA 1CSKA 1B3QA 3CCMT 2YXYA 4RCBA 3ZEHA 4J9DA 3QXEB 3HTRA 4M7DB 1QWFA 1VQ6Q 1FMWA 3EAEA 3OY9A 2DL8A 2VGNA 1PM3A 1M4ZA 3I56Q 4FYWB 2DE0X 4QQGA 2M0OA 2DM1A 5GMKh 2BZ8A 5GMKe 3CC2Q 2KVQG 2J05A 4J8OA 3A8GB 4XTYA 2C06A 3JCMJ 2DD5A 1AOJA 1M90U 1QVPA 5DLQE 5LJ3g 2QI2A 1XNIA 1IGUA 1N9SA 4M7DF 3FLGA 4Y92A 1WXTA 3JB9F 4D6WA 3CCJA 1YNZA 3CCUQ 1YN8A 2DZ9A 1WHLA 1PWTA 1UE9A 3EGXB 1D09B 1KHCA 3L2VA 1VQ9T 4C0ZA 1HD3A 2PQWA 4IUPA 4OMPA 3A98A 4F7UG 5LJ3d 1NJIR 2KBTA 1QVFS 3UWNA 1AHJB 5KYWA 2R58A 1BYMA 5IT9E 3VS0A 2GQIA 2LDMA 1Q81R 2OTLT 4PJLA 1NYGA 3H0FA 4JRPA 3M54A 4D8DA 4HVWA 8ATCB 2FVUA 3L1AA 5CKBA 2GGRA 2XKOC 3AT1B 1VQ8A 1LCKA 2RF0A 3CC7A 1FX7A 3TVTA 4RMOA 4GBQA 1Q82U 4BI8B 1ZSZA 1AEYA 2FO0A 2YLCA 4MMKA 3CCEQ 1EX4A 3KBGA 4FSSA 3CCRA 1KSWA 2OI3A 1VQLA 4MZPA 1M1KU 1SF9A 3H8ZA 5AYFA 3JCMc 3CCLQ 3JCMh 2JJ9A 4M77E 4J6YA 3I9QA 3L2RA 2K4YA 2EQUA 4C0GA 1V29B 4RTXA 1IRXA 3U23A 3RKYA 5AT1B 3CCVA 2ZPGB 3PMIA 3A8LB 2WACA 2RI5A 5GMKl 1IREB 1HSQA 3PIPA 3REAB 1B7TA 5GAN3 3GBQA 4CC3A 3QBYA 3CCJT 2K2VA 1UECA 2RQTA 4AFSC 4PJOE 1NPRA 2KRMA 4DOVA 2DMOA 4Y91A 3CC4Q 1E6HA 2PZ1A 2YHTA 4PJJA 5GAN2 2O4XA 2MCNA 1C1AA 5CCAA 3RKXA 5FU7C 2NWMA 2QGFB 1KC8U 1Z9QA 2R5MA 4OB1B 4M78D 4OGCA 1LNXA 2EYYA 2K9GA 1BCOA 3RUXA 5GANd 3C4SA 1X01A 1BI1A 2O2OA 1BB9A 1VQ8T 3HPWA 1QWEA 4M75G 3M0TA 1ZX6A 1D3BB 1UGPB 2A28A 1PC0A 2CP2A 4F14A 1M2OA 3DB4A 2YRCA 4PK4A 2BE7D 2EVRA 2XICA 3CCRT 1K0SA 3QIIA 2K2MA 1VQLT 2KYBA 1PSEA 4KBMB 4QQDA 1YITQ 3C0CA 2CSIA 1M3AA 3OYCA 3QZ9B 1WHKA 3JSCA 4F17A 1PHTA 5J3BA 5KCOA 2CZ1B 4PFOA 1K73U 2F2XA 1BBZA 5KE2A 1T0HA 3FIFA 3CCVT 3CXCA 2D1XA 2D0QB 1IHVA 4JRKA 1UG1A 2NUPB 4DBHA 1M2VB 1VQKA 3EGUA 3MEAA 2VYTA 1X6OA 4A4GA 2P4TA 2C0OA 2QDYB 3SWNA 1K8AR 2M51A 2YUPA 2KQWA 1SPKA 2ROTA 4J9IA 4AG2C 4M7AG 2DTOA 1SRMA 2DZCA 2ZZDA 2SEMA 3M55A 1OI1A 1M9SA 2VV5A 2VUBA 5D6XA 1RLPC 1PRMC 1QMCA 4QW2A 3SD4A 3CPWP 3QPHA 2RH2A 1Q86R 1AZEA 1S72Q 2X4JA 1IGQA 2PUOB 2QG9B 4PFZA 4MMLA 3CBOA 3VS1A 1MGQA 3X28B 4C8QE 3FC3A 4BI3A 1C0MA 4M75C 1M3BA 2B86A 2X4XA 3CQTA 3OMCA 3VYHB 1M1FA 4OP0A 3META 4A53A 1Z9ZA 4M78F 4BB7A 2EKHA 2AT1B 1KJWA 4X34A 1AWOA 2COWA 2EGEA 2VXEA 2X4WA 3OYLA 2FPEA 4JJBA 5FU6C 4BE2A 1KD1R 2B8AA 3L2UA 1UHCA 3NTIA 4XU2A 3OW2A 4JRIA 5C0MA 3E9FA 2GBQA 2HAXA 1LPLA 1QVGP 1TUCA 4F7UB 3GLXA 3CCMQ 1JRIA 3BDLA 4KUDK 1WHJA 4LDVA 5KYXB 4CRIA 4DBQA 2AKKA 2RM4A 5FU7B 2VASA 1VQKT 2DTHA 1X6BA 2JT4A 3FJ5A 1YFNA 2YUNA 4AMCA 3HL8A 4E7ZA 4M77A 1PSFA 3M57A 2AZSA 1B07A 3NGPA 4IKFA 4AT1B 5GAOq 4M7AC 1BK2A 2CZ0B 1G83A 4JZ3A 4BY6C 2IIMA 3G6EA 2RJCA 3BY7A 4KGXB 1N8RC 2MI6A 1SSFA 2EYXA 1W2BP 8AT1B 4N4IA 2BTTA 3CD6A 2E6NA 1I4K1 3OYMA 3TEEA 2RO0A 2KXCA 5GAN5 2V1RA 4ESRA 1K1ZA 4F04B 2WSEE 1KFZA 3LX7A 4ZN3A 2YDLA 2LVMA 1BI0A 3ASKA 1VQ9Q 1RL2A 1UGRB 3CEYA 2QA4A 4BD3A 4YTLA 1YJNQ 1ARKA 2RHIA 1OEBA 2RB6A 1AZGB 3H41A 5KYUB 2GNCA 5A2QE 4V2SA 3G71Q 1NZ9A 5DM7R 2E41A 2D9TA 2EFIA 1QLYA 4II1A 3VS7A 1U3OA 2BUDA 2F5KA 4M7AD 4J9CA 3EFOA 1MNEA 2CS7A 4EPCA 5CKHA 2KROA 4MZTA 3CPWS 1PG5B 2ZPFB 3QKJA 1NG2A 4M75B 2W0ZA 2J7IA 4IUUA 1PNJA 5CK9A 1WHMA 3G6ET 1E6GA 5I2MA 1GRIA 2LCCA 5FU6B 2QDLA 3CD6T 2CUDA 3EH1A 1M90C 1TXQA 1MMNA 2BZYA 1ZUUA 3CMEA 3UF4A 2DYIA 3CCJQ 1YBYA 3I5RA 3EHRA 1RI0A 3TU4K 2QA4T 4FT2A 1GCQA 1GBRA 2KRSA 2FZGB 2RQRA 2FPDA 4C8QA 4QVZA 2QK0A 1Q7YR 3UA6A 9ATCB 4M7DE 2DL7A 4M7AB 4O6JA 3TCJA 2F69A 2YT6A 2KI7A 4BY6B 1X75C 1WQWA 1D0YA 1UFFA 3CXCP 1IB8A 1VQ8Q 2AZVA 3ER0A 1VYVA 5GAMf 4MZMA 4RG8A 2JMAA 1QVFP 1NEBA 3IQLA 3L2WA 2EJ9A 4RKUE 3SFMA 4OMQA 2O9VA 1Q82C 3LYIA 2VC8A 2KT1A 1K4US 3CCRQ 1SHGA 4JJCA 1ZUYA 1VQLQ 3J7AF 4D8KA 2F2WA 1VIEA 4KUIA 2JTMA 3RNJA 4M7AF 2QQAA 1K9AA 3VU3C 1M1KC 1G3SA 2V8JA 3I35A 1QKWA 2AIRB 1M27C 1I1JA 3CCVQ 5KYYB 1U06A 1M3CA 7AT1B 4J9EA 5IXBA 2ZPEB 3CMET 3V7CA 2E3IA 2QAZA 1WPYA 4GLMA 5CKDA 2Y4XA 4A4EA 1MHNA 2K57A 1IXDA
chains in the Genus database with same CATH topology
2XD0A 4R55A 4M78B 3CCUA 1QP3A 1R8OB 3KBGA 2DEQA 4BE0A 1P92A 4LDYA 3UT1A 4B9XA 3CCRA 2RHZA 2DPPB 4P5NA 1QP2A 4MZPA 4C8QB 1VQLA 3VUBA 1M1KU 4XU0A 3QYHB 1VQNA 3H8ZA 3OSSC 5AYFA 3JCMc 2CKKA 3JCMh 4HT8A 5DY9A 1VQPT 1KQ2A 2DAQA 4M77E 3QHSA 3OSVA 4J6YA 3L2RA 2K4YA 2EQUA 4C0GA 5GAOn 1V29B 3JAME 1HK9A 2CZ7B 4J6XA 1NE8A 2RHXA 5LJ3j 3RKYA 2EJGA 4J83A 3CCQA 1KC8C 2P0PA 3M9QA 5CKEA 3CCVA 4C92G 2ZPGB 3OS1A 2X35A 1KD1U 3PMIA 3OYYA 4M75E 3OBYA 3GP8A 3A8LB 1YCYA 2WACA 4KULA 4LD9K 1UB4A 2LRQA 2RI5A 2X4YA 2LX9A 4M77F 5GMKl 1M8VA 1IREB 4R56A 3PIPA 4ZGEB 4RCCA 3QG1A 4O5VA 4EMKB 5GAN3 2MWOA 3FRNA 3OYDA 3QBYA 3CCJT 2K2VA 1VQMT 3E9GA 2EQKA 2QTXA 3I55A 4EMGA 4C0FA 4M75F 4JDSA 2RK2A 4PJOE 1G3YA 4PLLA 1NPRA 3MP6A 3ZFJA 2GQVA 1NPPA 4DOVA 4Y91A 5J26A 2E12A 3CCEA 1VQ6T 2O01E 3EFRA 5GMKm 4BDYA 2M16A 5GAMh 3I56T 2YHTA 4OMFB 2KDSA 1YIJA 2ZPIB 3OYGA 5GAN2 4E7LA 3M56A 2O4XA 4C0DC 3CCLA 2JOYA 2QQSA 2EYQA 2YRVA 3RKXA 1JB0E 5CCAA 3OYKA 3CC2T 5FU7C 3FB9A 5LL6S 1KC8U 1M1GA 1WQ7A 2R5MA 4OB1B 4M78D 2Y4YA 1LNXA 4OGCA 5A0DA 5DLOA 1K73C 3RUXA 4B9WA 3HFNA 3M4GA 3C4SA 5GANd 1X01A 1BI1A 2E70A 4C8QD 1VQ8T 3NTKA 2EWNA 2MMPA 5A0LA 3PGGA 3HPWA 2ZGWA 4M75G 3JCMX 2P0KA 1Y96A 3GNGA 3QJYA 3JCMW 2D6FA 1D3BB 2DTIA 3X20B 4J5YA 4C5GA 4E7JA 3CBPA 1UGPB 4TVRA 4M7AE 1VQ7A 1O75A 3DB4A 5KH6A 3QYGB 2DVEA 2F5TX 4QVCA 2DD4A 3CCUT 1B34A 2WSCE 1BIAA 2XICA 3QIIA 4OB3B 3CCRT 2FB7A 2Y90A 3HRUA 3DKMA 1U1TA 1VQLT 2DXUA 4PJOG 1VQNT 3CXCS 1PSEA 4KBMB 1YJWA 3FJPA 4E7HA 2EQMA 2R5AA 1FXXA 3MP1A 4QQDA 4A4KA 1IZ6A 3QDRB 3KXTA 2DJZA 4IURA 4IUTA 4N4GA 1G5VA 1GXIE 4Z02A 3CC4A 2QQRA 5CQYA 3JCMb 3DLLA 5FLXE 1JJ2S 4X9CA 3MHXA 3OYCA 3QZ9B 3JSCA 2PVGB 4PJOA 5J3BA 3M5AA 3JCMP 5KCOA 3OYAA 2PU9B 2CZ1B 1KQSS 4F7UA 1K73U 5KE2A 3CCQT 4HA8A 5CQXA 3FIFA 2E10A 2LTOA 2IVWA 3CCVT 4M7DG 4C92C 3CXCA 4E47A 2D0QB 3N5BB 4JRKA 3T9NA 4GY5A 1EIFA 1VQKA 2EIFA 3M59A 2VYTA 3MEAA 1LJOA 4VUBA 4BE1A 1X6OA 4A4GA 1JJ2A 2KAFA 2P4TA 5GAOr 5C6SA 5GAN4 3ME9A 2XK0A 4E7KA 4M7DA 3J81E 2QDYB 3SWNA 5GANj 1KQSA 3X24B 3S3NA 3I55T 5LJ5d 3V8JA 2KQWA 3OQ5A 5LJ3f 2OTJA 3VJPA 5HK3A 4BDZA 5GMKj 4M7AG 2IG0A 3WXMB 2DTOA 2DZCA 2ZZDA 4E7IA 1H641 4ME7A 4EDUA 2DIGA 4ELZC 3M55A 3CCET 3JCMg 4DQ2A 4N4HA 1OI1A 1M9SA 2VV5A 5GMKi 2VUBA 3PTAA 5D6XA 5EG2A 2EAYA 4QW2A 3SD4A 1YIJT 4L59A 3QPHA 1UGQB 2RH2A 2X4JA 3CCLT 3RERA 2K3YA 4XTWA 5A0GA 3JCMe 3JRZA 2YLBA 1YITA 3DB3A 2PUOB 3GPLA 2XIDA 2L8DA 4XTZA 4MMLA 3QSUA 3CBOA 3M53A 4QQ6A 1MGQA 4M78E 4MDXA 3X28B 1OZ3A 2PVDB 3JCMV 3A5ZB 2L3RA 2RK1A 5D6WA 2MF2A 4PNOA 1ZBXA 3PMTA 2MWPA 4C8QE 2G3RA 3QUIA 2PUKB 4OVAA 2K3XA 3HP9A 4C5HA 3FC3A 4DA4A 3CPFA 4BI3A 2M9UA 1OYXA 3GF5A 3JCMd 4M75C 3OW2S 3QJ6A 2X4XA 3P8DA 4XU1A 3OMCA 3PIOA 1Q7YC 4J7FA 3VYHB 1M1FA 2LC4A 1WJSA 4OP0A 3META 4A53A 2K5FA 4C5IA 1VQ7T 3VV0A 4M78F 4XU3A 1N27A 5IN1A 1ZQ1A 3RMSA 3BFMA 4BB7A 2PVOB 3MO8A 4X34A 4ZGJB 1YJNA 4JS4A 2ZPBB 4C92A 2VXEA 4A4HA 2X4WA 4FT4A 4C8QF 3OYLA 4N0AA 1G3TA 1WJQA 5FU6C 3VYGA 2XI9A 4BE2A 2B8AA 2E5QA 5GAMg 4JLGA 3L2UA 2XDBA 3NTIA 4XU2A 3OW2A 4PJOC 1YJWT 3PNWC 3Q1JA 4JRIA 4FM4B 5LJ5j 5C0MA 2QQBA 4C92D 4XTUA 1YHQA 4ZTJA 3LGFA 3CC4T 2RI2A 3E9FA 2L89A 1FWZA 3TREA 2KY9A 5GAMe 2HAXA 1HXDA 4F7UB 4L5GA 1LOJA 3GLXA 2A3LA 4JS5A 3G71A 3MEUA 1S72A 2DK3A 3QO3A 3S3MA 4DOWA 1JRIA 3BDLA 1U8RA 2RI3A 2GFAA 2A7YA 1Y07A 5HY6A 2KMTA 4LDVA 4M77G 1BKBA 3HKSA 4RG2A 3OYFA 4C0DB 4M7DC 2BIVA 4M78G 3SWNC 2XHCA 4OGEA 1KQ1A 4CRIA 2RM4A 5CIUA 1NJIC 5FU7B 5J39A 3E19A 4BUGA 1VQKT 5GAMd 1BIBA 3C94A 1Q7YU 2DTHA 4CI0C 3RIRA 4C8QG 3JB9J 1ZHIA 2XDDA 1WGSA 3OB9A 3OYJA 3R6OA 3HL8A 4XQ3A 4M77A 3OBWA 3CC7T 1PSFA 3M57A 1QVGS 1Q81C 4HCBA 4IKFA 3KUFA 5M9OA 2V8IA 1BI2A 2ZPHB 5GAOq 2OTJT 4M7AC 4OB0B 2QEXA 2XDPA 2CZ0B 2KK4A 1VIFA 3MEVA 4A54A 4BY6C 2K5LA 2V8KA 3S3OA 5CO7A 4M75A 3G6EA 1OZ2A 2ZCFB 3MEWA 2RJCA 4QVDA 3BY7A 2XG8D 1N8RC 2MI6A 1SSFA 1KG1A 4OF1A 4N4IA 1QVGA 4XTVA 4LDUA 3JCMQ 2RJFA 3CD6A 5GANf 2E6NA 1YITT 1I4K1 3MP8A 3BDUA 3OYMA 3TEEA 3EFSA 2NLUA 2RO0A 4ATOA 5GAN5 3P8HA 4XK8E 4ELYC 5LJ3h 5FRNA 3S6WA 3DLMA 5LJ3e 1NJIU 2RJEA 2EQJA 4LDWA 5IAYA 5GAOp 2WSEE 3CCMA 2XU8A 2LNVA 2E1HA 4PKCC 3LX7A 2LQKA 3X26B 4ZN3A 3C95A 2LVMA 3A8MB 1BI0A 2QQ9A 3ASKA 3LW5E 1RL2A 4IUVA 4N0AC 4FIBA 1UGRB 3CEYA 1Q81U 4PJOD 2QA4A 5GAOl 4NS5A 4C92B 3OA6A 5HK0A 4LDXA 3OS0A 3F70A 3LGLA 3X25B 4BD3A 3CMAA 4YTLA 1VQOA 1YJNT 4LD6A 3GIBA 3ZBDA 2HQXA 3FDRA 2RHIA 5GAN7 3HRTA 3PT9A 3INZA 4FU6A 2HD0A 3G7ZA 1N8RU 3VKIA 2RHYA 4Q5WA 2MAMA 2RB6A 3E1SA 4ZTFA 1W2BA 1I81A 4HCZA 1YHQT 4M7DD 5GAOm 2M1HA 3H6ZA 3JB9D 3LWIA 1N9RA 2O4XB 4NL3A 4JRQA 5A2QE 3GOXA 4M7AA 1S72T 3G71T 4V2SA 1NZ9A 5DM7R 2E41A 1G3WA 5GAN8 2E6ZA 5KCHA 5HKCA 2JNGA 2D9TA 2EFIA 2LCLA 3OMGA 4KUDK 3VUZA 2L5QA 1N6AA 4M77C 4II1A 2JZ2A 2GF7A 4UC4A 4XTXA 4M78C 5CKFA 2BUDA 2F5KA 4C92F 4M7AD 2DO3A 2CS7A 2RA2A 3L2ZA 4NOYA 5LJ5f 4C8QC 3OYHA 2K5IA 4EPCA 1Y96B 5CKHA 2OAUA 2VGMA 2P0QA 2HNIA 4EMHA 3L42A 4MZTA 4NL2A 3CPWS 1DJ7B 3CCSA 2R57A 1VQ9A 2ZPFB 2I2LA 3QKJA 3V7SA 2E65A 3NTHA 3PFSA 4WF2A 3LH0A 3SDZA 3HRSA 4M75B 2QEXT 4JJNK 5CR2A 3OS2A 3FEOA 4IUUA 1B34B 5CK9A 3OS5A 1YI2A 1H3ZA 3URGA 2GFUA 3G6ET 4XAXB 3CBMA 2FHDA 5I2MA 3LLRA 3LWHA 4HKEA 3JB9I 2EJFA 2LQ8A 3HHTB 3UDCA 1Y71A 2CYZB 5KE3A 1K9MC 2GCXA 4FL6A 4PLIA 2FYKA 2LCCA 3CPWA 1YJ9A 1W2BS 4J6WA 2OTLA 5FU6B 2QXFA 4FSXA 5CAIA 2H3JA 3AHUA 3CD6T 2E64A 1VQ4A 2HQEA 2EKOA 1M90C 1Y7XA 4EMKC 4PJOB 2JUFA 4JUVA 3HSBA 1JBMA 4A4FA 4C5EA 3HFOA 3JCMf 3C12A 3OYNA 4PL6A 2BKDN 3CMEA 3MCAB 2DKGA 3CCMT 1YBYA 1RI0A 1KHIA 3TU4K 3NFCA 5GANg 1VQ5A 2VXFA 3G4SA 4RCBA 2LT1A 3ZEHA 2QA4T 2FL7A 3QXEB 4M7DB 4FT2A 4F7UE 1QW1A 3SWNB 3CMAT 2AHJB 3EAEA 1VQOT 3OY9A 2VGNA 1M4ZA 5GANh 1XOVA 5GANe 4M78A 4BACA 4QQGA 4X9DA 4BI4A 5FROA 2JTFA 4ZGDB 2M0OA 3M4YA 3OYEA 5GMKh 4IUQA 3A8HB 5GMKe 3SB2A 4C8QA 1U1SA 1VQPA 4QVZA 2KVQG 4PJOF 1K9MU 3JB9H 3GNFB 4M77D 4MDWA 3A8OB 4M7DE 4J8OA 4M7AB 3A8GB 4O6JA 4XTYA 3TCJA 3WVEB 4F7UF 2F69A 2C06A 3JCMJ 2DD5A 1M90U 1QVPA 4BY6B 1X75C 1WQWA 1K8AC 3OYBA 5DLQE 5GAN6 4L6V5 2QI2A 5LJ3g 2DXBA 3ER0A 1XNIA 5L8RE 5GAMf 4M75D 4MZMA 4RG8A 1N9SA 2DXCA 4M7DF 1UGSB 3FLGA 3JB9F 3L2WA 4JLIA 2EJ9A 4RKUE 3SFMA 5I2SA 4HT9A 1Q86C 2JVVA 4KT0E 3V7RA 4D6WA 2WSFE 1XTDA 3M58A 3LYIA 2VC8A 3CCJA 4GLKA 1VQMA 1O9SA 4EMKA 1Q82C 2DZ9A 3J80E 1XQHA 1WJRA 3CCST 1VQ9T 3RKWA 1KHCA 3L2VA 3V8LA 4C0ZA 2PQWA 3QZ5B 3J7AF 4IUPA 4HCCA 4KUIA 1VIEA 2LT4A 5D6YA 2CZ6B 3P8BB 4F7UG 3L2QA 1YI2T 2JTMA 5I21A 4M7AF 2QQAA 1VQ6A 1M5Q1 5LJ3d 2HBPA 2RD1A 3UPUA 1W4SA 3VU3C 5LJ5g 3I56A 1M1KC 1G3SA 2JN0A 2V8JA 5GAMj 1QVFS 2DIQA 3UWNA 1AHJB 4J7IA 1BI3A 2R58A 2RJDA 1BYMA 3BW1A 2CGHA 2DXTA 5IT9E 3OYIA 3CC2A 1YJ9T 2LDMA 1K8AU 5CVIA 2OTLT 1UEBA 5LJ5h 5LJ5e 4C92E 3WVDB 3JB9G 4JRPA 1VQ4T 3M54A 2RHUA 4Y28E 2FVUA 3L1AA 5CKBA 1QVFA 2XKOC 2ZPEB 1I5LA 1KD1C 3CMET 3V7CA 3RESA 1VQ8A 5FRMA 1VUBA 3CC7A 4OB2B 1Q86U 1FX7A 1TH7A 1WPYA 1WNLA 4RMOA 2KSSA 1Q82U 5CKDA 4BI8B 4ZN1A 1VQ5T 2Y4XA 3O8VA 2YLCA 4A4EA 3G4ST 1I8FA 1MHNA 2K57A 3RMQA 1D3BA 4MMKA 4M77B 3V8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME7 A;  4ELZ C;  4MZT A;  5CQX A;  2VUB A;  1M1F A;  1UB4 A;  5CCA A;  4MZP A;  3VUB A;  5CO7 A;  5CKB A;  5CR2 A;  2KMT A;  3TCJ A;  5CK9 A;  2C06 A;  4VUB A;  3JRZ A;  5HK0 A;  4OF1 A;  5HKC A;  5DLO A;  1X75 C;  1VUB A;  3NFC A;  4HKE A;  4MDX A;  5CKF A;  1NE8 A;  5CKD A;  5CQY A;  3HPW A;  4MZM A;  2MF2 A;  5HK3 A;  3JSC A;  5CKE A;  3G7Z A;  4ELY C;  5CKH A; 
#chains in the Genus database with same CATH topology
 2XD0 A;  4B9X A;  1FMV A;  2D8J A;  2RHZ A;  3OW2 P;  2FEI A;  3VUB A;  3D7S B;  4OMM A;  3OSS C;  3UA7 A;  2CKK A;  4HT8 A;  1JQQ A;  2PTK A;  1OU9 A;  4WCI A;  3OSV A;  1HYO A;  5GAO n;  2CZ7 B;  2EJG A;  2X3X D;  2FRY A;  1KC8 C;  4K11 A;  1WX6 A;  1JEG A;  1NM7 A;  3VS4 A;  1R77 A;  3OYY A;  3OBY A;  2NYS A;  5D7U A;  1NYF A;  3QG1 A;  4O5V A;  2AK5 A;  3OYD A;  1OU8 A;  2JXB A;  2QTX A;  2VVK A;  4C0F A;  2Z0W A;  1CKB A;  2LMJ A;  2GQV A;  1NPP A;  5J26 A;  2E12 A;  3LH5 A;  2O01 E;  3EG3 A;  5GAM h;  2ZPI B;  1MUZ A;  4C0D C;  1G2B A;  2QQS A;  2EYQ A;  4IIM A;  4RTU A;  1K73 C;  1VQK Q;  3M4G A;  2K6D A;  5A0L A;  3PGG A;  4J9B A;  3GNG A;  1Y96 A;  3JCM W;  2D6F A;  1K9M R;  2KXD A;  4C5G A;  4E7J A;  2F2V A;  1VQ7 A;  2JMC A;  1B34 A;  1BIA A;  1BU1 A;  2Y90 A;  3HRU A;  4PJO G;  3CXC S;  3FJP A;  1XJW B;  2EQM A;  2R5A A;  1FXX A;  3KXT A;  1GXI E;  3JCM b;  3DLL A;  2PU9 B;  5CQX A;  1T3L A;  3NHN A;  3TSZ A;  4E47 A;  2QYZ A;  3T9N A;  4GY5 A;  1EIF A;  2SRC A;  2F1L A;  1V76 A;  2EIF A;  4VUB A;  4BE1 A;  4RTZ A;  5GAO r;  5GAN 4;  3ME9 A;  2XK0 A;  4FYX B;  4E7K A;  4M7D A;  1KQS A;  4JJD A;  2LJ3 A;  2OTJ A;  3VJP A;  2OJ2 A;  3EHQ A;  4BDZ A;  2J6F A;  1RLQ C;  2DIG A;  3JCM g;  4DQ2 A;  1MV3 A;  4M4Z A;  4L59 A;  2O31 A;  1TOV A;  1UGQ B;  3M0S A;  3JCM e;  4M78 E;  1FMK A;  1OZ3 A;  2PVD B;  3JCM V;  2RK1 A;  1K76 A;  5D6W A;  1ZBX A;  3PMT A;  2G3R A;  2K3X A;  4DA4 A;  1TSF A;  2FZC B;  1OYX A;  3JCM d;  3OW2 S;  3PIO A;  1E7O A;  1WJS A;  2K5F A;  1VQ7 T;  3RMS A;  2DRK A;  2PVO B;  3MO8 A;  3THK A;  1U5S A;  1X27 A;  2ESW A;  3G6E Q;  4FT4 A;  4JLG A;  2XDB A;  4PJO C;  3Q1J A;  4HXJ A;  5LJ5 j;  2BE9 B;  3LGF A;  1QKX A;  3TRE A;  2KY9 A;  1HXD A;  4JS5 A;  3MEU A;  4AFZ C;  4LUD A;  1OPK A;  2DK3 A;  4RTW A;  1NLP C;  2LJ0 A;  1U8R A;  4RG2 A;  3OYF A;  3HKS A;  4C0D B;  4A63 B;  4OGE A;  1KQ1 A;  1SEM A;  3E19 A;  3C94 A;  2QA4 Q;  4C8Q G;  3OYJ A;  3CC7 T;  4J9G A;  2L0A A;  2V8I A;  2OTJ T;  1PKT A;  4OB0 B;  5IHN A;  4KGV B;  3S3O A;  2D0N A;  2ZCF B;  1AWW A;  2X9H A;  2CT4 A;  2XG8 D;  1SSH A;  1KG1 A;  4OF1 A;  1AD5 A;  2LQN A;  3TSW A;  3BDU A;  2LJ1 A;  2NLU A;  4ATO A;  2EYW A;  3P8H A;  4XK8 E;  1NJI U;  2CUB A;  2EQJ A;  2LNV A;  2E1H A;  1PRL C;  1TUG B;  4N0A C;  4FIB A;  1Q81 U;  4PJO D;  3OA6 A;  4X1V A;  3CMA A;  3VS5 A;  3GIB A;  2X3W D;  2HQX A;  3INZ A;  2HD0 A;  3G7Z A;  1PD1 A;  2MAM A;  1X2K A;  1I81 A;  2DL3 A;  4HCZ A;  3H6Z A;  4JRQ A;  5GJV B;  3CME Q;  1TUD A;  1W6X A;  1GCQ C;  1EFN A;  2LCL A;  4RUG A;  2ENM A;  1ABQ A;  1N6A A;  4XTX A;  2GF7 A;  4UC4 A;  1MMG A;  2DO3 A;  2DJQ A;  2KGT A;  3L2Z A;  5LJ5 f;  4C8Q C;  3OYH A;  2K5I A;  2VGM A;  3EG9 B;  4JZ4 A;  1SHF A;  4NL2 A;  3CCS A;  2R57 A;  2RQW A;  2I2L A;  2E65 A;  1TU0 B;  2ATC B;  2CDT A;  4JJN K;  3SHW A;  5CR2 A;  3URG A;  1BCM A;  1UUE A;  3LLR A;  3LWH A;  1D1A A;  2LQ8 A;  4PLI A;  1YJ9 A;  4FSX A;  5CAI A;  2E64 A;  4ZNX A;  1VQ4 A;  4OML A;  4PJO B;  4JUV A;  1JBM A;  3ZL7 C;  4PL6 A;  2BKD N;  2DKG A;  1IHW A;  1KHI A;  1S1N A;  3NFC A;  1VQ5 A;  5KYN A;  3G4S A;  3H0H A;  1TTH B;  3VRY A;  1QW1 A;  3CMA T;  2AHJ B;  3VS3 A;  4M78 A;  2FZK B;  2MYS A;  4BAC A;  4X9D A;  5FRO A;  2JTF A;  4ZGD B;  3A8H B;  4PJO F;  1WA7 A;  3EGD B;  4Z89 A;  2HL3 A;  3GNF B;  2W10 A;  3WVE B;  4F7U F;  2G6F X;  2DBK A;  1Q95 G;  3UAT A;  5GAN 6;  4L6V 5;  4DEX A;  4M75 D;  3EFO B;  1Y57 A;  2DXC A;  1UGS B;  4JLI A;  4HT9 A;  5I2S A;  4KT0 E;  1XTD A;  1VQM A;  4GLK A;  1O9S A;  4EMK A;  3CCS T;  1K0X A;  4HCC A;  1WZO A;  5D6Y A;  3L2Q A;  3A1P A;  2HBP A;  1YWO A;  2RD1 A;  3UPU A;  2CH4 W;  5LJ5 g;  2JN0 A;  5GAM j;  1VA7 A;  1HJD A;  4J7I A;  1BI3 A;  2RJD A;  2DNU A;  3NMZ C;  3BW1 A;  2CGH A;  2LX7 A;  2DXT A;  3O5Z A;  3OYI A;  1WHG A;  1YJ9 T;  1K8A U;  5CVI A;  1UEB A;  5LJ5 h;  2OTL Q;  5LJ5 e;  4C92 E;  1UJ0 A;  3JB9 G;  1VQ4 T;  4Y28 E;  3QWX X;  5KYX A;  1G8X A;  2M02 A;  4FW1 A;  3RES A;  1NBE B;  1N8R R;  2I0N A;  4OB2 B;  1Q86 U;  1TH7 A;  1A0N B;  1ZA1 B;  2KSS A;  2YRD A;  1VQ5 T;  2HEQ A;  3G4S T;  1I8F A;  3EG2 A;  3RDV A;  3TQ7 P;  4R55 A;  1R8O B;  4BE0 A;  3UT1 A;  4F16 A;  1ZA2 B;  2DPP B;  4P5N A;  4C8Q B;  4XU0 A;  3QYH B;  1VQN A;  4FW2 A;  3M0P A;  1KQ2 A;  2DAQ A;  3QHS A;  4CC7 A;  1JXO A;  2ABL A;  3JAM E;  5LJ3 j;  4J83 A;  2ROL A;  3CCQ A;  3M9Q A;  1KD1 U;  4FCY A;  1YCY A;  4LD9 K;  2X4Y A;  2LRQ A;  1M8V A;  4R56 A;  1VQ7 Q;  4KH0 B;  2CH4 A;  4ZGE B;  2JM8 A;  1J3T A;  3FRN A;  3VRZ A;  1VQM T;  3E9G A;  2EQK A;  2EPD A;  3I55 A;  1W1F A;  4M75 F;  1UGV A;  3MP6 A;  3ZFJ A;  4KRT A;  4BDY A;  2L3S A;  2M16 A;  2KDS A;  1YIJ A;  2EGA A;  3OYG A;  5KYU A;  4E7L A;  3M56 A;  4ANJ A;  2YRV A;  2K7A A;  4RTT A;  3FB9 A;  2OX7 A;  1M1G A;  4FYY B;  2IPO B;  1WQ7 A;  2Y4Y A;  5A0D A;  1ZSZ C;  3HFN A;  1QCO A;  3QWY A;  3NTK A;  2L3Q A;  2ZGW A;  3CC7 Q;  2CP5 A;  3NPF A;  2DTI A;  3X20 B;  4J5Y A;  2NUT A;  2OTJ Q;  2ED1 A;  3CBP A;  2MK5 A;  1O75 A;  5KH6 A;  1M90 R;  2A08 A;  2F5T X;  4QVC A;  2DD4 A;  2WSC E;  2CRE A;  3EH2 A;  2KRN A;  1U1T A;  3DKM A;  2DXU A;  1VQN T;  1YJW A;  2CP3 A;  1IZ6 A;  4IUR A;  4IUT A;  2DEU A;  1G5V A;  2QQR A;  4FYV B;  2QTV A;  3OYA A;  1KQS S;  1V1C A;  5ECA A;  3CCQ T;  4HA8 A;  2E10 A;  2IVW A;  3MKD A;  1WXU A;  1UHF A;  3M59 A;  1LJO A;  1JJ2 A;  2KAF A;  5C6S A;  3M0R A;  5GAN j;  1AVZ C;  3I55 T;  3V8J A;  4CC4 B;  5LJ3 f;  1ZLM A;  2IG0 A;  4HVU A;  1MV0 B;  4E7I A;  2HQH A;  3RR6 A;  4ME7 A;  4ELZ C;  4N4H A;  5GMK i;  2EQI A;  3PTA A;  1YIJ T;  2DET A;  1Q82 R;  3QDF A;  3RER A;  5A0G A;  2MIO A;  3JRZ A;  2YLB A;  1H3H A;  2L8D A;  4XTZ A;  3M53 A;  4QQ6 A;  2KYM A;  1WXB A;  2QGG A;  4OMO A;  2L3R A;  2MF2 A;  2MWP A;  5GJW B;  1M1K R;  3QUI A;  2PUK B;  3HP9 A;  4C5H A;  2M9U A;  3GF5 A;  2L3P A;  3QJ6 A;  3P8D A;  4XU1 A;  1R0B G;  4J7F A;  2CSQ A;  4XU3 A;  5IN1 A;  3BFM A;  1T0J A;  2C0I A;  2J06 A;  1YJN A;  2ZPB B;  4C92 A;  2JS0 A;  1JO8 A;  1G3T A;  3VYG A;  2XI9 A;  2E5Q A;  1RAH B;  1TWB A;  5GAM g;  1ABO A;  1YJW T;  2HDA A;  4FM4 B;  1D0X A;  2QQB A;  1YHQ A;  1RAG B;  3ULR B;  2COZ A;  5KYW B;  5FWB A;  5GAM e;  2A3L A;  1OPL A;  2DA9 A;  3G71 A;  3S3M A;  4LUE A;  1VOM A;  4OMN A;  2GFA A;  2A7Y A;  3GPL A;  2P4R A;  4M77 G;  2GTO A;  2JS2 A;  4J9H A;  2BIV A;  4M78 G;  3SWN C;  2XHC A;  5CIU A;  1NJI C;  5GAM d;  1Q7Y U;  3RIR A;  3JB9 J;  1ZHI A;  2XDD A;  3CMA Q;  3OB9 A;  2YUO A;  3R6O A;  1WI7 A;  2PNI A;  1ZSZ B;  1Q81 C;  4HCB A;  1UJY A;  1WHH A;  1BI2 A;  1KC8 R;  2HBW A;  2QEX A;  2XDP A;  6AT1 B;  4A54 A;  1TS9 A;  1RUW A;  2V8K A;  1OZ2 A;  3MEW A;  4QVD A;  2A36 A;  4AG1 C;  2J6K A;  1QVG A;  4XTV A;  3RBB B;  4LE9 A;  5GAN f;  5I22 A;  3MP8 A;  2CT3 A;  1GCP A;  2QAS A;  5LJ3 h;  3DLM A;  5LJ3 e;  2RJE A;  5IAY A;  4LDW A;  5GAO p;  2XU8 A;  5EC7 A;  2LQK A;  3C95 A;  1T3S A;  3CCS Q;  2YWW A;  3LW5 E;  2JW4 A;  2LZ6 B;  4LDX A;  1MMD A;  3OS0 A;  3LGL A;  3X25 B;  1GFC A;  1VQO A;  1YJN T;  4LD6 A;  3ZBD A;  1K73 R;  3FDR A;  1WDX A;  5GAN 7;  2XMF A;  3PT9 A;  4FU6 A;  2D8H A;  1RAF B;  4CC2 A;  4KGZ B;  1YJ9 Q;  2DLP A;  2RHY A;  4Q5W A;  3VKI A;  4ZTF A;  1W2B A;  4QT7 A;  1YHQ T;  5GAO m;  1SRL A;  1VQ4 Q;  3PVQ A;  2O4X B;  2JM9 A;  3GOX A;  2HCK A;  3G71 T;  1MMA A;  5GAN 8;  2E6Z A;  5KCH A;  4E6R A;  3OMG A;  3VUZ A;  2L5Q A;  4M77 C;  1X6G A;  2JZ2 A;  4M78 C;  1VQ5 Q;  3G4S Q;  2RA2 A;  2JTE A;  4NOY A;  2OAU A;  1WLP B;  2P0Q A;  1AWJ A;  2HNI A;  3L42 A;  4EMH A;  1DJ7 B;  2DER A;  3NTH A;  4WF2 A;  3LH0 A;  3EGX A;  2QEX T;  1YI2 A;  2DL4 A;  3FEO A;  4RTY A;  4E7S A;  1H3Z A;  3OS5 A;  2GFU A;  3CBM A;  2FHD A;  1OV3 A;  2P84 A;  1RAI B;  3M0U A;  3JB9 I;  2LNH B;  3HHT B;  3UDC A;  1Y71 A;  5KE3 A;  2EW3 A;  2GCX A;  4FL6 A;  2FYK A;  3H0I A;  4J6W A;  1QCF A;  1QQJ A;  2DVJ A;  2H3J A;  3CD6 Q;  2HQE A;  2EKO A;  1Y7X A;  4EMK C;  2JUF A;  4A4F A;  1JU5 C;  2RNA A;  3HFO A;  3SEM A;  3C12 A;  3MCA B;  4Z88 A;  5FW9 A;  1VQM Q;  2DF6 A;  5GAN g;  2VXF A;  2LT1 A;  2FL7 A;  2FG0 A;  4F7U E;  3SWN B;  1YWP A;  4DBR A;  3E2U A;  1VQO T;  2YSQ A;  5GAN h;  2LQW A;  1XOV A;  5GAN e;  2MOX A;  4BI4 A;  2ZAE A;  3M4Y A;  3OYE A;  4IUQ A;  3SB2 A;  2HL5 C;  3M0Q A;  1U1S A;  1VQP A;  4PJM A;  3JB9 H;  1K9M U;  4MDW A;  4M77 D;  3A8O B;  4J9F A;  1GL5 A;  2K3B A;  1WYX A;  2CP7 A;  2MPX C;  2HSE B;  1K8A C;  2RN8 A;  1D1B A;  3OYB A;  2DXB A;  5L8R E;  1OQK A;  4DEY A;  2DBM A;  4DBF A;  3MPU B;  1JJ2 P;  3VS6 A;  1RI9 A;  3EG1 A;  5IHK A;  1Q86 C;  2JVV A;  2HKN A;  3V7R A;  2WSF E;  3M58 A;  3JV3 A;  3REB B;  2VB6 A;  3J80 E;  1XQH A;  1WJR A;  3RKW A;  3V8L A;  3G1J A;  3QZ5 B;  1VQN Q;  2LT4 A;  2CZ6 B;  2L2P A;  3P8B B;  1YI2 T;  5I21 A;  1VYT A;  1H8K A;  1VQ6 A;  1M5Q 1;  1W4S A;  2KE9 A;  3I56 A;  2DIQ A;  4QKU A;  1C6V X;  3CC2 A;  2KEA A;  3CCQ Q;  4WTO B;  1X43 A;  2E5K A;  1ACM B;  3WVD B;  2RHU A;  1EZZ B;  1QVF A;  1I5L A;  1KD1 C;  5FRM A;  1VUB A;  2EGC A;  3MJX A;  3I55 Q;  5HCK A;  1WNL A;  1OOT A;  4ZN1 A;  2V26 A;  3O8V A;  2AKL A;  3RMQ A;  1D3B A;  4M77 B;  3V8K A;  4M78 B;  3CCU A;  1QP3 A;  1GBQ A;  2DEQ A;  1P92 A;  2EYZ A;  4LDY A;  1YIJ Q;  1LVK A;  1QP2 A;  1KK7 A;  5DY9 A;  1VQP T;  2YUQ A;  1RAE B;  1HK9 A;  1NEG A;  4J6X A;  1NE8 A;  2RHX A;  2P0P A;  5CKE A;  4C92 G;  3OS1 A;  2X35 A;  4M75 E;  3GP8 A;  1I5O B;  4KUL A;  1UB4 A;  4M77 F;  2LX9 A;  3R6N A;  2NUP A;  4RCC A;  1M2V A;  4EMK B;  1F1B B;  2MWO A;  1SG5 A;  4EMG A;  1PCX A;  4JDS A;  2RK2 A;  1G3Y A;  4PLL A;  1YJW Q;  2VKN A;  3CCE A;  1VQ6 T;  4LNP A;  2H8H A;  3EFR A;  5GMK m;  3I56 T;  4OMF B;  2FRW A;  3CCL A;  2JOY A;  4EIK A;  3OYK A;  1JB0 E;  3CC2 T;  2M0Y A;  1RAB B;  5LL6 S;  5DLO A;  4B9W A;  1D0Z A;  2A37 A;  2DIL A;  2E70 A;  4C8Q D;  2EWN A;  2MMP A;  1RAA B;  1I0C A;  2P0K A;  3QJY A;  3JCM X;  3EG9 A;  2COY A;  3PE0 A;  1YP5 A;  4TVR A;  4M7A E;  4IIO A;  3QYG B;  2DVE A;  2J6O A;  1KQS P;  3CCU T;  4OB3 B;  2FB7 A;  4E7H A;  3MP1 A;  4A4K A;  3QDR B;  2DJZ A;  4N4G A;  4Z02 A;  3CC4 A;  5CQY A;  5FLX E;  1JJ2 S;  4X9C A;  3MHX A;  2DX1 A;  2PVG B;  4PJO A;  3M5A A;  3JCM P;  1FYN A;  1ZUK A;  1Y0M A;  1OX9 A;  4F7U A;  2LTO A;  1KIK A;  4AFU C;  4C92 C;  4M7D G;  3N5B B;  1AWX A;  2X51 A;  1W70 A;  2V1Q A;  2LCS A;  4LN2 A;  2KNB B;  3J81 E;  3X24 B;  3S3N A;  5LJ5 d;  1TG0 A;  3OQ5 A;  1SKU B;  5IHI A;  5HK3 A;  5GMK j;  3WXM B;  2DYB A;  1JXM A;  2RPN A;  1H64 1;  4EDU A;  3I5S A;  3CCE T;  1YCS B;  1YHQ Q;  3EGD A;  5EG2 A;  2ED0 A;  2EAY A;  2RQV A;  2GTJ A;  2DL5 A;  1X2Q A;  3CCL T;  2K3Y A;  1D1C A;  4XTW A;  1OUL A;  1YIT A;  3DB3 A;  2XID A;  3QSU A;  4KH1 B;  4PFP A;  4MDX A;  3A5Z B;  4PNO A;  3VS2 A;  4OVA A;  3CPF A;  2NUT B;  1PKS A;  1Q7Y C;  2LC4 A;  1CKA A;  4C5I A;  1WIE A;  1RAD B;  3VV0 A;  3BE3 A;  2QEX Q;  1N27 A;  1ZQ1 A;  4ZGJ B;  4JS4 A;  1PD0 A;  4A4H A;  2RMO A;  4C8Q F;  4N0A A;  2FPF A;  1WJQ A;  3PNW C;  2OAW A;  4RTV A;  4C92 D;  4XTU A;  4ZTJ A;  4Z8A A;  3CC4 T;  2RI2 A;  2L89 A;  2K79 A;  4ORZ A;  1FWZ A;  1M30 A;  4E2F B;  4L5G A;  1LOJ A;  1ZSG A;  1S72 A;  1UDL A;  1N5Z A;  3QO3 A;  4DOW A;  2HSP A;  4R0K A;  2O88 A;  2NUZ A;  2RI3 A;  3EG0 A;  1Y07 A;  4PJN A;  2KMT A;  5HY6 A;  1BKB A;  4M7D C;  2CP0 A;  5J39 A;  2HKQ B;  4BUG A;  1BIB A;  4CI0 C;  2A0F B;  4JPB W;  1WGS A;  1VQO Q;  3H9N A;  4XQ3 A;  3OBW A;  2BZX A;  1QVG S;  2EBP A;  3KUF A;  5M9O A;  2ZPH B;  5IH2 A;  3MEV A;  2KK4 A;  4HCK A;  1VIF A;  2K5L A;  5CO7 A;  4M75 A;  2H3E B;  1OX8 A;  2C0T A;  4LDU A;  3JCM Q;  2RJF A;  1YIT T;  3EFS A;  2O9S A;  4ELY C;  5FRN A;  3S6W A;  3CCM A;  4PKC C;  3X26 B;  2LP5 A;  3A8M B;  1W2B S;  2QQ9 A;  4IUV A;  2HZY A;  1RAC B;  5GAO l;  1X69 A;  4NS5 A;  4B6M A;  4C92 B;  5HK0 A;  1YI2 Q;  5FWC A;  3F70 A;  5L23 A;  1ZBJ A;  3HRT A;  1R0C B;  2CP6 A;  1N8R U;  3E1S A;  3KFV A;  1M8M A;  4M7D D;  3PVL A;  2M1H A;  3JB9 D;  3LWI A;  5IXF A;  1N9R A;  2DFU A;  4NL3 A;  4M7A A;  2VWF A;  1S72 T;  1NLO C;  1G3W A;  1GFD A;  1VYU A;  1UTI A;  2E4H A;  5HKC A;  2JNG A;  4HVV A;  1QCN A;  5CKF A;  4C92 F;  1AT1 B;  1I07 A;  1Y96 B;  2DRM A;  1WFW A;  2ECZ A;  2KT8 A;  1VQ9 A;  3V7S A;  4AFQ C;  3PFS A;  3SDZ A;  3HRS A;  3OS2 A;  1VQP Q;  1B34 B;  4LXC A;  4XAX B;  2RQU A;  4HKE A;  2EJF A;  2CYZ B;  1K9M C;  2KR3 A;  3CPW A;  2E3H A;  1IO6 A;  2OTL A;  1H92 A;  2QXF A;  3AHU A;  5I11 A;  2HMA A;  5KYY A;  3HSB A;  4C5E A;  3JCM f;  3OYN A;  1MND A;  1CSK A;  1B3Q A;  3CCM T;  2YXY A;  4RCB A;  3ZEH A;  4J9D A;  3QXE B;  3HTR A;  4M7D B;  1QWF A;  1VQ6 Q;  1FMW A;  3EAE A;  3OY9 A;  2DL8 A;  2VGN A;  1PM3 A;  1M4Z A;  3I56 Q;  4FYW B;  2DE0 X;  4QQG A;  2M0O A;  2DM1 A;  5GMK h;  2BZ8 A;  5GMK e;  3CC2 Q;  2KVQ G;  2J05 A;  4J8O A;  3A8G B;  4XTY A;  2C06 A;  3JCM J;  2DD5 A;  1AOJ A;  1M90 U;  1QVP A;  5DLQ E;  5LJ3 g;  2QI2 A;  1XNI A;  1IGU A;  1N9S A;  4M7D F;  3FLG A;  4Y92 A;  1WXT A;  3JB9 F;  4D6W A;  3CCJ A;  1YNZ A;  3CCU Q;  1YN8 A;  2DZ9 A;  1WHL A;  1PWT A;  1UE9 A;  3EGX B;  1D09 B;  1KHC A;  3L2V A;  1VQ9 T;  4C0Z A;  1HD3 A;  2PQW A;  4IUP A;  4OMP A;  3A98 A;  4F7U G;  5LJ3 d;  1NJI R;  2KBT A;  1QVF S;  3UWN A;  1AHJ B;  5KYW A;  2R58 A;  1BYM A;  5IT9 E;  3VS0 A;  2GQI A;  2LDM A;  1Q81 R;  2OTL T;  4PJL A;  1NYG A;  3H0F A;  4JRP A;  3M54 A;  4D8D A;  4HVW A;  8ATC B;  2FVU A;  3L1A A;  5CKB A;  2GGR A;  2XKO C;  3AT1 B;  1VQ8 A;  1LCK A;  2RF0 A;  3CC7 A;  1FX7 A;  3TVT A;  4RMO A;  4GBQ A;  1Q82 U;  4BI8 B;  1ZSZ A;  1AEY A;  2FO0 A;  2YLC A;  4MMK A;  3CCE Q;  1EX4 A;  3KBG A;  4FSS A;  3CCR A;  1KSW A;  2OI3 A;  1VQL A;  4MZP A;  1M1K U;  1SF9 A;  3H8Z A;  5AYF A;  3JCM c;  3CCL Q;  3JCM h;  2JJ9 A;  4M77 E;  4J6Y A;  3I9Q A;  3L2R A;  2K4Y A;  2EQU A;  4C0G A;  1V29 B;  4RTX A;  1IRX A;  3U23 A;  3RKY A;  5AT1 B;  3CCV A;  2ZPG B;  3PMI A;  3A8L B;  2WAC A;  2RI5 A;  5GMK l;  1IRE B;  1HSQ A;  3PIP A;  3REA B;  1B7T A;  5GAN 3;  3GBQ A;  4CC3 A;  3QBY A;  3CCJ T;  2K2V A;  1UEC A;  2RQT A;  4AFS C;  4PJO E;  1NPR A;  2KRM A;  4DOV A;  2DMO A;  4Y91 A;  3CC4 Q;  1E6H A;  2PZ1 A;  2YHT A;  4PJJ A;  5GAN 2;  2O4X A;  2MCN A;  1C1A A;  5CCA A;  3RKX A;  5FU7 C;  2NWM A;  2QGF B;  1KC8 U;  1Z9Q A;  2R5M A;  4OB1 B;  4M78 D;  4OGC A;  1LNX A;  2EYY A;  2K9G A;  1BCO A;  3RUX A;  5GAN d;  3C4S A;  1X01 A;  1BI1 A;  2O2O A;  1BB9 A;  1VQ8 T;  3HPW A;  1QWE A;  4M75 G;  3M0T A;  1ZX6 A;  1D3B B;  1UGP B;  2A28 A;  1PC0 A;  2CP2 A;  4F14 A;  1M2O A;  3DB4 A;  2YRC A;  4PK4 A;  2BE7 D;  2EVR A;  2XIC A;  3CCR T;  1K0S A;  3QII A;  2K2M A;  1VQL T;  2KYB A;  1PSE A;  4KBM B;  4QQD A;  1YIT Q;  3C0C A;  2CSI A;  1M3A A;  3OYC A;  3QZ9 B;  1WHK A;  3JSC A;  4F17 A;  1PHT A;  5J3B A;  5KCO A;  2CZ1 B;  4PFO A;  1K73 U;  2F2X A;  1BBZ A;  5KE2 A;  1T0H A;  3FIF A;  3CCV T;  3CXC A;  2D1X A;  2D0Q B;  1IHV A;  4JRK A;  1UG1 A;  2NUP B;  4DBH A;  1M2V B;  1VQK A;  3EGU A;  3MEA A;  2VYT A;  1X6O A;  4A4G A;  2P4T A;  2C0O A;  2QDY B;  3SWN A;  1K8A R;  2M51 A;  2YUP A;  2KQW A;  1SPK A;  2ROT A;  4J9I A;  4AG2 C;  4M7A G;  2DTO A;  1SRM A;  2DZC A;  2ZZD A;  2SEM A;  3M55 A;  1OI1 A;  1M9S A;  2VV5 A;  2VUB A;  5D6X A;  1RLP C;  1PRM C;  1QMC A;  4QW2 A;  3SD4 A;  3CPW P;  3QPH A;  2RH2 A;  1Q86 R;  1AZE A;  1S72 Q;  2X4J A;  1IGQ A;  2PUO B;  2QG9 B;  4PFZ A;  4MML A;  3CBO A;  3VS1 A;  1MGQ A;  3X28 B;  4C8Q E;  3FC3 A;  4BI3 A;  1C0M A;  4M75 C;  1M3B A;  2B86 A;  2X4X A;  3CQT A;  3OMC A;  3VYH B;  1M1F A;  4OP0 A;  3MET A;  4A53 A;  1Z9Z A;  4M78 F;  4BB7 A;  2EKH A;  2AT1 B;  1KJW A;  4X34 A;  1AWO A;  2COW A;  2EGE A;  2VXE A;  2X4W A;  3OYL A;  2FPE A;  4JJB A;  5FU6 C;  4BE2 A;  1KD1 R;  2B8A A;  3L2U A;  1UHC A;  3NTI A;  4XU2 A;  3OW2 A;  4JRI A;  5C0M A;  3E9F A;  2GBQ A;  2HAX A;  1LPL A;  1QVG P;  1TUC A;  4F7U B;  3GLX A;  3CCM Q;  1JRI A;  3BDL A;  4KUD K;  1WHJ A;  4LDV A;  5KYX B;  4CRI A;  4DBQ A;  2AKK A;  2RM4 A;  5FU7 B;  2VAS A;  1VQK T;  2DTH A;  1X6B A;  2JT4 A;  3FJ5 A;  1YFN A;  2YUN A;  4AMC A;  3HL8 A;  4E7Z A;  4M77 A;  1PSF A;  3M57 A;  2AZS A;  1B07 A;  3NGP A;  4IKF A;  4AT1 B;  5GAO q;  4M7A C;  1BK2 A;  2CZ0 B;  1G83 A;  4JZ3 A;  4BY6 C;  2IIM A;  3G6E A;  2RJC A;  3BY7 A;  4KGX B;  1N8R C;  2MI6 A;  1SSF A;  2EYX A;  1W2B P;  8AT1 B;  4N4I A;  2BTT A;  3CD6 A;  2E6N A;  1I4K 1;  3OYM A;  3TEE A;  2RO0 A;  2KXC A;  5GAN 5;  2V1R A;  4ESR A;  1K1Z A;  4F04 B;  2WSE E;  1KFZ A;  3LX7 A;  4ZN3 A;  2YDL A;  2LVM A;  1BI0 A;  3ASK A;  1VQ9 Q;  1RL2 A;  1UGR B;  3CEY A;  2QA4 A;  4BD3 A;  4YTL A;  1YJN Q;  1ARK A;  2RHI A;  1OEB A;  2RB6 A;  1AZG B;  3H41 A;  5KYU B;  2GNC A;  5A2Q E;  4V2S A;  3G71 Q;  1NZ9 A;  5DM7 R;  2E41 A;  2D9T A;  2EFI A;  1QLY A;  4II1 A;  3VS7 A;  1U3O A;  2BUD A;  2F5K A;  4M7A D;  4J9C A;  3EFO A;  1MNE A;  2CS7 A;  4EPC A;  5CKH A;  2KRO A;  4MZT A;  3CPW S;  1PG5 B;  2ZPF B;  3QKJ A;  1NG2 A;  4M75 B;  2W0Z A;  2J7I A;  4IUU A;  1PNJ A;  5CK9 A;  1WHM A;  3G6E T;  1E6G A;  5I2M A;  1GRI A;  2LCC A;  5FU6 B;  2QDL A;  3CD6 T;  2CUD A;  3EH1 A;  1M90 C;  1TXQ A;  1MMN A;  2BZY A;  1ZUU A;  3CME A;  3UF4 A;  2DYI A;  3CCJ Q;  1YBY A;  3I5R A;  3EHR A;  1RI0 A;  3TU4 K;  2QA4 T;  4FT2 A;  1GCQ A;  1GBR A;  2KRS A;  2FZG B;  2RQR A;  2FPD A;  4C8Q A;  4QVZ A;  2QK0 A;  1Q7Y R;  3UA6 A;  9ATC B;  4M7D E;  2DL7 A;  4M7A B;  4O6J A;  3TCJ A;  2F69 A;  2YT6 A;  2KI7 A;  4BY6 B;  1X75 C;  1WQW A;  1D0Y A;  1UFF A;  3CXC P;  1IB8 A;  1VQ8 Q;  2AZV A;  3ER0 A;  1VYV A;  5GAM f;  4MZM A;  4RG8 A;  2JMA A;  1QVF P;  1NEB A;  3IQL A;  3L2W A;  2EJ9 A;  4RKU E;  3SFM A;  4OMQ A;  2O9V A;  1Q82 C;  3LYI A;  2VC8 A;  2KT1 A;  1K4U S;  3CCR Q;  1SHG A;  4JJC A;  1ZUY A;  1VQL Q;  3J7A F;  4D8K A;  2F2W A;  1VIE A;  4KUI A;  2JTM A;  3RNJ A;  4M7A F;  2QQA A;  1K9A A;  3VU3 C;  1M1K C;  1G3S A;  2V8J A;  3I35 A;  1QKW A;  2AIR B;  1M27 C;  1I1J A;  3CCV Q;  5KYY B;  1U06 A;  1M3C A;  7AT1 B;  4J9E A;  5IXB A;  2ZPE B;  3CME T;  3V7C A;  2E3I A;  2QAZ A;  1WPY A;  4GLM A;  5CKD A;  2Y4X A;  4A4E A;  1MHN A;  2K57 A;  1IXD A; 
#chains in the Genus database with same CATH homology
 2XD0 A;  4R55 A;  4M78 B;  3CCU A;  1QP3 A;  1R8O B;  3KBG A;  2DEQ A;  4BE0 A;  1P92 A;  4LDY A;  3UT1 A;  4B9X A;  3CCR A;  2RHZ A;  2DPP B;  4P5N A;  1QP2 A;  4MZP A;  4C8Q B;  1VQL A;  3VUB A;  1M1K U;  4XU0 A;  3QYH B;  1VQN A;  3H8Z A;  3OSS C;  5AYF A;  3JCM c;  2CKK A;  3JCM h;  4HT8 A;  5DY9 A;  1VQP T;  1KQ2 A;  2DAQ A;  4M77 E;  3QHS A;  3OSV A;  4J6Y A;  3L2R A;  2K4Y A;  2EQU A;  4C0G A;  5GAO n;  1V29 B;  3JAM E;  1HK9 A;  2CZ7 B;  4J6X A;  1NE8 A;  2RHX A;  5LJ3 j;  3RKY A;  2EJG A;  4J83 A;  3CCQ A;  1KC8 C;  2P0P A;  3M9Q A;  5CKE A;  3CCV A;  4C92 G;  2ZPG B;  3OS1 A;  2X35 A;  1KD1 U;  3PMI A;  3OYY A;  4M75 E;  3OBY A;  3GP8 A;  3A8L B;  1YCY A;  2WAC A;  4KUL A;  4LD9 K;  1UB4 A;  2LRQ A;  2RI5 A;  2X4Y A;  2LX9 A;  4M77 F;  5GMK l;  1M8V A;  1IRE B;  4R56 A;  3PIP A;  4ZGE B;  4RCC A;  3QG1 A;  4O5V A;  4EMK B;  5GAN 3;  2MWO A;  3FRN A;  3OYD A;  3QBY A;  3CCJ T;  2K2V A;  1VQM T;  3E9G A;  2EQK A;  2QTX A;  3I55 A;  4EMG A;  4C0F A;  4M75 F;  4JDS A;  2RK2 A;  4PJO E;  1G3Y A;  4PLL A;  1NPR A;  3MP6 A;  3ZFJ A;  2GQV A;  1NPP A;  4DOV A;  4Y91 A;  5J26 A;  2E12 A;  3CCE A;  1VQ6 T;  2O01 E;  3EFR A;  5GMK m;  4BDY A;  2M16 A;  5GAM h;  3I56 T;  2YHT A;  4OMF B;  2KDS A;  1YIJ A;  2ZPI B;  3OYG A;  5GAN 2;  4E7L A;  3M56 A;  2O4X A;  4C0D C;  3CCL A;  2JOY A;  2QQS A;  2EYQ A;  2YRV A;  3RKX A;  1JB0 E;  5CCA A;  3OYK A;  3CC2 T;  5FU7 C;  3FB9 A;  5LL6 S;  1KC8 U;  1M1G A;  1WQ7 A;  2R5M A;  4OB1 B;  4M78 D;  2Y4Y A;  1LNX A;  4OGC A;  5A0D A;  5DLO A;  1K73 C;  3RUX A;  4B9W A;  3HFN A;  3M4G A;  3C4S A;  5GAN d;  1X01 A;  1BI1 A;  2E70 A;  4C8Q D;  1VQ8 T;  3NTK A;  2EWN A;  2MMP A;  5A0L A;  3PGG A;  3HPW A;  2ZGW A;  4M75 G;  3JCM X;  2P0K A;  1Y96 A;  3GNG A;  3QJY A;  3JCM W;  2D6F A;  1D3B B;  2DTI A;  3X20 B;  4J5Y A;  4C5G A;  4E7J A;  3CBP A;  1UGP B;  4TVR A;  4M7A E;  1VQ7 A;  1O75 A;  3DB4 A;  5KH6 A;  3QYG B;  2DVE A;  2F5T X;  4QVC A;  2DD4 A;  3CCU T;  1B34 A;  2WSC E;  1BIA A;  2XIC A;  3QII A;  4OB3 B;  3CCR T;  2FB7 A;  2Y90 A;  3HRU A;  3DKM A;  1U1T A;  1VQL T;  2DXU A;  4PJO G;  1VQN T;  3CXC S;  1PSE A;  4KBM B;  1YJW A;  3FJP A;  4E7H A;  2EQM A;  2R5A A;  1FXX A;  3MP1 A;  4QQD A;  4A4K A;  1IZ6 A;  3QDR B;  3KXT A;  2DJZ A;  4IUR A;  4IUT A;  4N4G A;  1G5V A;  1GXI E;  4Z02 A;  3CC4 A;  2QQR A;  5CQY A;  3JCM b;  3DLL A;  5FLX E;  1JJ2 S;  4X9C A;  3MHX A;  3OYC A;  3QZ9 B;  3JSC A;  2PVG B;  4PJO A;  5J3B A;  3M5A A;  3JCM P;  5KCO A;  3OYA A;  2PU9 B;  2CZ1 B;  1KQS S;  4F7U A;  1K73 U;  5KE2 A;  3CCQ T;  4HA8 A;  5CQX A;  3FIF A;  2E10 A;  2LTO A;  2IVW A;  3CCV T;  4M7D G;  4C92 C;  3CXC A;  4E47 A;  2D0Q B;  3N5B B;  4JRK A;  3T9N A;  4GY5 A;  1EIF A;  1VQK A;  2EIF A;  3M59 A;  2VYT A;  3MEA A;  1LJO A;  4VUB A;  4BE1 A;  1X6O A;  4A4G A;  1JJ2 A;  2KAF A;  2P4T A;  5GAO r;  5C6S A;  5GAN 4;  3ME9 A;  2XK0 A;  4E7K A;  4M7D A;  3J81 E;  2QDY B;  3SWN A;  5GAN j;  1KQS A;  3X24 B;  3S3N A;  3I55 T;  5LJ5 d;  3V8J A;  2KQW A;  3OQ5 A;  5LJ3 f;  2OTJ A;  3VJP A;  5HK3 A;  4BDZ A;  5GMK j;  4M7A G;  2IG0 A;  3WXM B;  2DTO A;  2DZC A;  2ZZD A;  4E7I A;  1H64 1;  4ME7 A;  4EDU A;  2DIG A;  4ELZ C;  3M55 A;  3CCE T;  3JCM g;  4DQ2 A;  4N4H A;  1OI1 A;  1M9S A;  2VV5 A;  5GMK i;  2VUB A;  3PTA A;  5D6X A;  5EG2 A;  2EAY A;  4QW2 A;  3SD4 A;  1YIJ T;  4L59 A;  3QPH A;  1UGQ B;  2RH2 A;  2X4J A;  3CCL T;  3RER A;  2K3Y A;  4XTW A;  5A0G A;  3JCM e;  3JRZ A;  2YLB A;  1YIT A;  3DB3 A;  2PUO B;  3GPL A;  2XID A;  2L8D A;  4XTZ A;  4MML A;  3QSU A;  3CBO A;  3M53 A;  4QQ6 A;  1MGQ A;  4M78 E;  4MDX A;  3X28 B;  1OZ3 A;  2PVD B;  3JCM V;  3A5Z B;  2L3R A;  2RK1 A;  5D6W A;  2MF2 A;  4PNO A;  1ZBX A;  3PMT A;  2MWP A;  4C8Q E;  2G3R A;  3QUI A;  2PUK B;  4OVA A;  2K3X A;  3HP9 A;  4C5H A;  3FC3 A;  4DA4 A;  3CPF A;  4BI3 A;  2M9U A;  1OYX A;  3GF5 A;  3JCM d;  4M75 C;  3OW2 S;  3QJ6 A;  2X4X A;  3P8D A;  4XU1 A;  3OMC A;  3PIO A;  1Q7Y C;  4J7F A;  3VYH B;  1M1F A;  2LC4 A;  1WJS A;  4OP0 A;  3MET A;  4A53 A;  2K5F A;  4C5I A;  1VQ7 T;  3VV0 A;  4M78 F;  4XU3 A;  1N27 A;  5IN1 A;  1ZQ1 A;  3RMS A;  3BFM A;  4BB7 A;  2PVO B;  3MO8 A;  4X34 A;  4ZGJ B;  1YJN A;  4JS4 A;  2ZPB B;  4C92 A;  2VXE A;  4A4H A;  2X4W A;  4FT4 A;  4C8Q F;  3OYL A;  4N0A A;  1G3T A;  1WJQ A;  5FU6 C;  3VYG A;  2XI9 A;  4BE2 A;  2B8A A;  2E5Q A;  5GAM g;  4JLG A;  3L2U A;  2XDB A;  3NTI A;  4XU2 A;  3OW2 A;  4PJO C;  1YJW T;  3PNW C;  3Q1J A;  4JRI A;  4FM4 B;  5LJ5 j;  5C0M A;  2QQB A;  4C92 D;  4XTU A;  1YHQ A;  4ZTJ A;  3LGF A;  3CC4 T;  2RI2 A;  3E9F A;  2L89 A;  1FWZ A;  3TRE A;  2KY9 A;  5GAM e;  2HAX A;  1HXD A;  4F7U B;  4L5G A;  1LOJ A;  3GLX A;  2A3L A;  4JS5 A;  3G71 A;  3MEU A;  1S72 A;  2DK3 A;  3QO3 A;  3S3M A;  4DOW A;  1JRI A;  3BDL A;  1U8R A;  2RI3 A;  2GFA A;  2A7Y A;  1Y07 A;  5HY6 A;  2KMT A;  4LDV A;  4M77 G;  1BKB A;  3HKS A;  4RG2 A;  3OYF A;  4C0D B;  4M7D C;  2BIV A;  4M78 G;  3SWN C;  2XHC A;  4OGE A;  1KQ1 A;  4CRI A;  2RM4 A;  5CIU A;  1NJI C;  5FU7 B;  5J39 A;  3E19 A;  4BUG A;  1VQK T;  5GAM d;  1BIB A;  3C94 A;  1Q7Y U;  2DTH A;  4CI0 C;  3RIR A;  4C8Q G;  3JB9 J;  1ZHI A;  2XDD A;  1WGS A;  3OB9 A;  3OYJ A;  3R6O A;  3HL8 A;  4XQ3 A;  4M77 A;  3OBW A;  3CC7 T;  1PSF A;  3M57 A;  1QVG S;  1Q81 C;  4HCB A;  4IKF A;  3KUF A;  5M9O A;  2V8I A;  1BI2 A;  2ZPH B;  5GAO q;  2OTJ T;  4M7A C;  4OB0 B;  2QEX A;  2XDP A;  2CZ0 B;  2KK4 A;  1VIF A;  3MEV A;  4A54 A;  4BY6 C;  2K5L A;  2V8K A;  3S3O A;  5CO7 A;  4M75 A;  3G6E A;  1OZ2 A;  2ZCF B;  3MEW A;  2RJC A;  4QVD A;  3BY7 A;  2XG8 D;  1N8R C;  2MI6 A;  1SSF A;  1KG1 A;  4OF1 A;  4N4I A;  1QVG A;  4XTV A;  4LDU A;  3JCM Q;  2RJF A;  3CD6 A;  5GAN f;  2E6N A;  1YIT T;  1I4K 1;  3MP8 A;  3BDU A;  3OYM A;  3TEE A;  3EFS A;  2NLU A;  2RO0 A;  4ATO A;  5GAN 5;  3P8H A;  4XK8 E;  4ELY C;  5LJ3 h;  5FRN A;  3S6W A;  3DLM A;  5LJ3 e;  1NJI U;  2RJE A;  2EQJ A;  4LDW A;  5IAY A;  5GAO p;  2WSE E;  3CCM A;  2XU8 A;  2LNV A;  2E1H A;  4PKC C;  3LX7 A;  2LQK A;  3X26 B;  4ZN3 A;  3C95 A;  2LVM A;  3A8M B;  1BI0 A;  2QQ9 A;  3ASK A;  3LW5 E;  1RL2 A;  4IUV A;  4N0A C;  4FIB A;  1UGR B;  3CEY A;  1Q81 U;  4PJO D;  2QA4 A;  5GAO l;  4NS5 A;  4C92 B;  3OA6 A;  5HK0 A;  4LDX A;  3OS0 A;  3F70 A;  3LGL A;  3X25 B;  4BD3 A;  3CMA A;  4YTL A;  1VQO A;  1YJN T;  4LD6 A;  3GIB A;  3ZBD A;  2HQX A;  3FDR A;  2RHI A;  5GAN 7;  3HRT A;  3PT9 A;  3INZ A;  4FU6 A;  2HD0 A;  3G7Z A;  1N8R U;  3VKI A;  2RHY A;  4Q5W A;  2MAM A;  2RB6 A;  3E1S A;  4ZTF A;  1W2B A;  1I81 A;  4HCZ A;  1YHQ T;  4M7D D;  5GAO m;  2M1H A;  3H6Z A;  3JB9 D;  3LWI A;  1N9R A;  2O4X B;  4NL3 A;  4JRQ A;  5A2Q E;  3GOX A;  4M7A A;  1S72 T;  3G71 T;  4V2S A;  1NZ9 A;  5DM7 R;  2E41 A;  1G3W A;  5GAN 8;  2E6Z A;  5KCH A;  5HKC A;  2JNG A;  2D9T A;  2EFI A;  2LCL A;  3OMG A;  4KUD K;  3VUZ A;  2L5Q A;  1N6A A;  4M77 C;  4II1 A;  2JZ2 A;  2GF7 A;  4UC4 A;  4XTX A;  4M78 C;  5CKF A;  2BUD A;  2F5K A;  4C92 F;  4M7A D;  2DO3 A;  2CS7 A;  2RA2 A;  3L2Z A;  4NOY A;  5LJ5 f;  4C8Q C;  3OYH A;  2K5I A;  4EPC A;  1Y96 B;  5CKH A;  2OAU A;  2VGM A;  2P0Q A;  2HNI A;  4EMH A;  3L42 A;  4MZT A;  4NL2 A;  3CPW S;  1DJ7 B;  3CCS A;  2R57 A;  1VQ9 A;  2ZPF B;  2I2L A;  3QKJ A;  3V7S A;  2E65 A;  3NTH A;  3PFS A;  4WF2 A;  3LH0 A;  3SDZ A;  3HRS A;  4M75 B;  2QEX T;  4JJN K;  5CR2 A;  3OS2 A;  3FEO A;  4IUU A;  1B34 B;  5CK9 A;  3OS5 A;  1YI2 A;  1H3Z A;  3URG A;  2GFU A;  3G6E T;  4XAX B;  3CBM A;  2FHD A;  5I2M A;  3LLR A;  3LWH A;  4HKE A;  3JB9 I;  2EJF A;  2LQ8 A;  3HHT B;  3UDC A;  1Y71 A;  2CYZ B;  5KE3 A;  1K9M C;  2GCX A;  4FL6 A;  4PLI A;  2FYK A;  2LCC A;  3CPW A;  1YJ9 A;  1W2B S;  4J6W A;  2OTL A;  5FU6 B;  2QXF A;  4FSX A;  5CAI A;  2H3J A;  3AHU A;  3CD6 T;  2E64 A;  1VQ4 A;  2HQE A;  2EKO A;  1M90 C;  1Y7X A;  4EMK C;  4PJO B;  2JUF A;  4JUV A;  3HSB A;  1JBM A;  4A4F A;  4C5E A;  3HFO A;  3JCM f;  3C12 A;  3OYN A;  4PL6 A;  2BKD N;  3CME A;  3MCA B;  2DKG A;  3CCM T;  1YBY A;  1RI0 A;  1KHI A;  3TU4 K;  3NFC A;  5GAN g;  1VQ5 A;  2VXF A;  3G4S A;  4RCB A;  2LT1 A;  3ZEH A;  2QA4 T;  2FL7 A;  3QXE B;  4M7D B;  4FT2 A;  4F7U E;  1QW1 A;  3SWN B;  3CMA T;  2AHJ B;  3EAE A;  1VQO T;  3OY9 A;  2VGN A;  1M4Z A;  5GAN h;  1XOV A;  5GAN e;  4M78 A;  4BAC A;  4QQG A;  4X9D A;  4BI4 A;  5FRO A;  2JTF A;  4ZGD B;  2M0O A;  3M4Y A;  3OYE A;  5GMK h;  4IUQ A;  3A8H B;  5GMK e;  3SB2 A;  4C8Q A;  1U1S A;  1VQP A;  4QVZ A;  2KVQ G;  4PJO F;  1K9M U;  3JB9 H;  3GNF B;  4M77 D;  4MDW A;  3A8O B;  4M7D E;  4J8O A;  4M7A B;  3A8G B;  4O6J A;  4XTY A;  3TCJ A;  3WVE B;  4F7U F;  2F69 A;  2C06 A;  3JCM J;  2DD5 A;  1M90 U;  1QVP A;  4BY6 B;  1X75 C;  1WQW A;  1K8A C;  3OYB A;  5DLQ E;  5GAN 6;  4L6V 5;  2QI2 A;  5LJ3 g;  2DXB A;  3ER0 A;  1XNI A;  5L8R E;  5GAM f;  4M75 D;  4MZM A;  4RG8 A;  1N9S A;  2DXC A;  4M7D F;  1UGS B;  3FLG A;  3JB9 F;  3L2W A;  4JLI A;  2EJ9 A;  4RKU E;  3SFM A;  5I2S A;  4HT9 A;  1Q86 C;  2JVV A;  4KT0 E;  3V7R A;  4D6W A;  2WSF E;  1XTD A;  3M58 A;  3LYI A;  2VC8 A;  3CCJ A;  4GLK A;  1VQM A;  1O9S A;  4EMK A;  1Q82 C;  2DZ9 A;  3J80 E;  1XQH A;  1WJR A;  3CCS T;  1VQ9 T;  3RKW A;  1KHC A;  3L2V A;  3V8L A;  4C0Z A;  2PQW A;  3QZ5 B;  3J7A F;  4IUP A;  4HCC A;  4KUI A;  1VIE A;  2LT4 A;  5D6Y A;  2CZ6 B;  3P8B B;  4F7U G;  3L2Q A;  1YI2 T;  2JTM A;  5I21 A;  4M7A F;  2QQA A;  1VQ6 A;  1M5Q 1;  5LJ3 d;  2HBP A;  2RD1 A;  3UPU A;  1W4S A;  3VU3 C;  5LJ5 g;  3I56 A;  1M1K C;  1G3S A;  2JN0 A;  2V8J A;  5GAM j;  1QVF S;  2DIQ A;  3UWN A;  1AHJ B;  4J7I A;  1BI3 A;  2R58 A;  2RJD A;  1BYM A;  3BW1 A;  2CGH A;  2DXT A;  5IT9 E;  3OYI A;  3CC2 A;  1YJ9 T;  2LDM A;  1K8A U;  5CVI A;  2OTL T;  1UEB A;  5LJ5 h;  5LJ5 e;  4C92 E;  3WVD B;  3JB9 G;  4JRP A;  1VQ4 T;  3M54 A;  2RHU A;  4Y28 E;  2FVU A;  3L1A A;  5CKB A;  1QVF A;  2XKO C;  2ZPE B;  1I5L A;  1KD1 C;  3CME T;  3V7C A;  3RES A;  1VQ8 A;  5FRM A;  1VUB A;  3CC7 A;  4OB2 B;  1Q86 U;  1FX7 A;  1TH7 A;  1WPY A;  1WNL A;  4RMO A;  2KSS A;  1Q82 U;  5CKD A;  4BI8 B;  4ZN1 A;  1VQ5 T;  2Y4X A;  3O8V A;  2YLC A;  4A4E A;  3G4S T;  1I8F A;  1MHN A;  2K57 A;  3RMQ A;  1D3B A;  4MMK A;  4M77 B;  3V8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...