5CR3A

Crystal structure of staphylococcal nuclease variant delta+phs v104e/l125e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIAAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLERKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V104E/L125E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cr3A00
1SNMA 5ISRA 4WRDA 4N9TA 4ODGA 4K5VA 4KY6A 3SXHA 1STBA 3OMCA 1EY8A 5C5LA 2F0DA 3TP7A 4F7XA 3D4WA 2F0SA 3SK6A 1SYDA 2PZWA 4IUNA 4KV6A 2EYOA 3OWFA 4MIUA 4PNYA 4ZUJA 3T16A 1EYAA 1KABA 2F3VA 2PW7A 2SNSA 3D8GA 5EKKA 3V2TA 3U9OA 1AEXA 3TP5A 4EQOA 3C1FA 2F0QA 4NKLA 5CV6A 5HGTA 4N9PA 2EYLA 3SHLA 5I6YA 2F0JA 5CGKA 1SNDA 1SNPA 1ENCA 2ENBA 4EVOA 1SYBA 5C4ZA 4PMCA 2EYJA 5IGDA 3P75A 4K8IA 4KY5A 5CV8A 4EQPA 1A2TA 1STHA 2F0GA 3SK5A 5C5MA 1JOOA 2F0FA 1EY4A 2OEOA 1SNOA 4K2LA 3S9WA 1JOQA 1F2YA 4IZ8A 2EYPA 2F0VA 4K2KA 5E1FA 5F2DA 2F0IA 4G57A 4KTAA 4HMIA 4LAAA 4TRDA 4OL7A 1A3VA 5NUCA 4B9WA 3QOJA 2F0OA 2M00A 3BDLA 2EXZA 2NUCA 3MXPA 4K6DA 3SK4A 5CC4A 5K5PA 2F0KA 2HQEA 4ID6A 3E5SA 5CV5A 2F0UA 2LKVA 5IGCA 5IGFA 2SNMA 1ENAA 5CV9A 3HEJA 3ITPA 5C3XA 5I9PA 4RKBA 2EY1A 2F0EA 3BDCA 1NSNS 1STYA 2F0LA 3H6MA 3NK9A 4H7BA 5KRUA 5KYLA 5J39A 1JORA 3OSOA 4QF4A 2EY2A 4KJNA 1A2UA 3MHBA 1TQOA 2OF1A 3MZ5A 5C4HA 2F0HA 3EVQA 4DU9A 4ME5A 4YIJA 4DGZA 3DHQA 5IIFA 2PZUA 3TP6A 1KAAA 4I65A 4HTHA 1IHZA 3NXWA 1EQVA 3TP8A 1A3TA 1NUCA 1TR5A 2EYHA 2EYMA 1KDBA 1RKNA 2QDBA 1F2ZA 1KDAA 5IOCA 1EZ8A 2PYKA 4DFAA 1U9RA 3R3OA 1KDCA 5J22A 1EY7A 1SNCA 3NP8A 5C3WA 2F0WA 3HZXA 3C1EA 4NDXA 1SYCA 1SYFA 4PMBA 2F0NA 3DMUA 3MVVA 5JOBA 1EYCA 1SYGA 2PQEA 3RUZA 1SNQA 3SR1A 4KJOA 4EQNA 5KYIA 3QB3A 4DF7A 3PMFA 1TT2A 4F8MA 2RDFA 4KHVA 5KIXA 4ZQ3A 5DAUA 5IGBA 5M9OA 5KEEA 3EROA 5DEHA 3D6CA 4ZUIA 4WORA 3LX0A 3T13A 5IGEA 4B9XA 2RBMA 2F0PA 2WACA 1EY5A 5JAVA 4RKLA 2PZTA 5KGUA 1EY9A 1EY0A 4R8NA 3EJIA 4KY7A 4E6IA 5E3FA 5EGTA 2KQ3A 4K14A 5EKLA 5CR3A 4QB4A 4NP5A 4QMGA 4J6HA 5IODA 3TMEA 5CV7A 2OXPA 3OMGA 3D4DA 1EZ6A 3NHHA 4KD3A 1STAA 1STNA 2SOBA 1STGA 5HURA 3MEHA 5IGGA 4KD4A 2F3WA 2PW5A 3VA5A 2RKSA 2F0MA 2F0TA 1A3UA 3ERQA 4J1MA 4K5WA 3QOLA 1JOKA 4S3SA 2EYFA 4K5XA 3P1HA 3NQTA 4K8JA 5CV4A 2EY6A 5I9OA 4HMJA 2O4XA 3NUCA 5I6WA 1II3A 2EY5A 4NMZA 1F2MA 5J1ZA 1EY6A 5C6AA 2KHSA 3SK8A 1SYEA 4IALA 1EYDA
chains in the Genus database with same CATH superfamily
1NMGA 4GLXA 2R61A 1X65A 2OCEA 4A3KH 2E2JB 5C5LA 5M5XB 1L1OB 1XX8A 1E1TA 4JBKA 1IW7C 2WKDA 3C46A 1ICFB 4OIKA 2PZWA 1VQHA 3D8GA 1SE8A 1I50H 1DOLA 5FKAC 2Y0SG 1QWYA 5GAEC 2Q8IB 2BE5C 1B1ZA 1VQFA 1MJCA 1FGUA 4A3JG 5JJLA 1BBWA 1LLRD 4WJ3M 3S16B 1E22A 1BR9A 2F4VL 1JQYD 1PYWD 4PZ7A 3GV6A 1F77A 3TBIB 2IT1A 5CV9A 1Y8PB 1VQBA 1HR0W 2F0EA 4OX9L 4L6TB 4FF4A 5C44H 1ICWA 4IOAA 4C2MH 2KJXA 3MHBA 4GN3B 4DK3C 3DHQA 1S4ZA 3TP6A 2JA7B 4DV0Q 3NBIA 1D5MC 1N32L 1GHJA 2QA4A 1HPCA 4RWSC 1WJJA 1Q81C 4YCWA 3HG9A 3IFTA 4OHJA 2N8NA 1E1OA 1TY0A 3KBGA 4BWGB 2TSSA 2RDGA 2R3ZA 3D6CA 3I7FA 3K81C 1SXTA 5JPMC 4C3IB 1FNVA 3L9AX 2ZJRA 4RKLA 3PV0A 5FLXE 1XNQL 4FF2A 3CD6A 2K1BA 3TEHB 5HGQA 1OXSC 2R92H 4BBRB 1N8RC 4UAIA 3F2UA 3E6ZX 4JI5L 1IL8A 1HTPA 4FVMA 3I73A 2DUDA 1CTMA 4A3IB 2ZJQA 2E2DC 2R7ZG 1QE6A 3QR8A 1DOMA 4C3JH 3GTMH 4HJAA 1AZQA 1Y69U 3GTPH 3J80L 2UXCQ 5C6AA 2CW0D 2K5HA 4JI7L 2VUMB 5FO9B 4N9TA 4AYBE 2JA8H 3CP0A 4DV2Q 1O7ZA 2PCFB 5T1IA 1I3QH 2KENA 4MIUA 4UY8C 1WCMB 1KXLA 2HDMA 1WFQA 4FO2A 1L2FA 2R7FA 1YI2A 2HHHL 4YHHQ 1HXYD 3RNUA 3I4NG 1TWHH 2JN4A 1CSPA 3D6WA 4X66Q 5C4ZA 4DR4Q 1VF5C 1J5EL 3SK5A 3CF5A 3PGZA 1F2YA 3H09A 1EIYB 4V190 2F0VA 1O80A 3HOWH 1STEA 1PXUA 1VQIA 4HSVA 4A3DB 2M00A 1B44D 3PO2H 2F0KA 1V9PA 4CKCA 2RF4A 3RZDH 4DXFA 4HIDA 1SE2A 3KYHC 1E24A 2MJ8A 5ELBA 1WD0A 2YU9H 4OIJA 1VQCA 1PZKD 2RSNA 3BZCA 2L5TA 4F87A 1GHKA 4NW2A 2K14A 1WTVA 2Y0SB 1IBKQ 3N52A 4FP5D 1YBYA 4EX5A 1IHZA 2RSOA 3W5OA 3GTJB 5IWAQ 1Q1BA 2Q8TA 4CDEC 3SDZA 4JW0A 4DAYB 2NB0A 1NE3A 3K58A 4A3JB 2IX1A 4FF3A 4NDXA 1X55A 1SYGA 1TIID 1VQ8A 1E7ZA 3HOUH 4JV5L 3PIO3 3OOCA 4H02A 3J81E 1K83H 1E2VA 5M5YB 2XIWA 3UDXA 4DR7L 4K0KL 2IX3A 2K50A 3CC4A 3QO2A 4AIMA 2GVBA 2ATWA 3MAQA 2Z6KA 2EE1A 3VYTA 5CBAE 2OXPA 4GKJL 5DM63 2NN6H 2ZXRA 3TREA 1HFNA 1UE1A 3QOLA 3W1GA 4QL5A 5CORA 5FK9C 4LUZA 3K57A 4HMJA 5I6WA 3NUCA 1I4QA 1II3A 3OIPA 1YZ6A 4CJ0B 1HR0L 5K36G 4DV6L 2MO1A 3S2DB 2A5HA 4WRDA 4A3BG 1Q8IA 3I91A 1EY8A 1KNEA 1LACA 1JJCB 4OELB 1A0IA 3RZOH 2EYOA 1FGBD 1U4LA 5JVH3 4DV4L 5EKKA 4JI1L 4JOIA 2K5DA 4LF7L 3KF8B 5KNCA 5I6YA 3HKZG 2ENBA 2B63H 1ET9A 1A2TA 1STHA 5C5MA 4K2LA 3FVQA 3D4RA 2PO4A 3H3VC 5FLXL 4DAVA 1NY4A 2R7ZB 4LUOA 1DYQA 4QY7A 4YY3L 1RIPA 2ICEC 5E4WC 4GN4B 2D0PA 4Q5VA 3S14B 1NTGA 5IGCA 5IGFA 5CV5A 2NVQB 4UP9A 3JAME 1HNXQ 1V1QA 1BKBA 4IJLA 3T4AC 3M4OH 5IYDG 3S2HB 3M9BA 2JA9A 1N34L 3ND9A 2HDLA 4ME5A 2B2TA 1R4QB 2PZUA 4MTKA 3MFYA 4HSPA 3I4NB 5C4XG 2NN6I 1NNXA 2A1AA 1GUWA 3EIVA 2PI2A 1I6VC 5DLQE 4FF1A 2E2IH 3NELA 3CCEA 4DV7Q 4PMBA 4CKBA 3BJUA 1VQNA 4A3KG 4IFDH 3RLNA 4EQNA 4X64Q 2JA6H 3FKIH 1FYCA 1Q7YC 1N9WA 1V1PA 3U9SA 2DY8A 5KEEA 4WORA 1OXXK 2C9OA 4ALPA 1P16A 5IT9E 3DWPA 3KBXA 1TWCH 3BVGA 3E9HA 2KBNA 2HD3A 5IY0A 1C4QA 2JK8A 3R2IA 4LW1A 1OTCA 4ILWA 2B39A 3D4DA 5GROA 3IKJA 3K5OA 2D5DA 2WAQE 3NHHA 5D14A 2NBFA 2YTVA 4A75A 3A8KE 2F52A 2FMCA 3VYRA 1TS3A 2UUCQ 2NVTB 1JB3A 2F03A 4FNFA 4DNTB 2KCTA 2WB1E 1IZ6A 4WJWA 1I5FA 1QILA 1EOTA 3E9IA 1YVCA 3NWSA 3M4PA 5FJ8G 2F0DA 2AKWB 3GTGH 4DV0L 2L55A 3RD4A 2EIFA 5EKIA 3CKIB 1Z47A 1GUGA 3T16A 3DEOA 1KABA 4JG2A 3S1RH 4BY1H 4EQOA 2D0OA 2BCOA 4DR2L 1HJPA 1L0YB 3H91A 1SMXA 3HOYH 3EQLC 5D65A 3J81L 4ABNA 1SYBA 1S72A 2ID0A 2LXJA 2F0FA 2NVXB 2IW3A 3S9WA 2Q2HA 1RTOA 4PG3A 1IYUA 3A54A 4YWMA 4K2KA 1X3FA 2E8GA 1HNZQ 2CH4A 1E0BA 1F9RA 3NBHB 3A8JE 2LKVA 4X3KA 4LF8Q 1PHJA 4JK1C 1ENAA 4B3RQ 2AHOB 4A3BB 1LTLA 2AUKA 1WTRA 4R4TA 2F0LA 4TKOB 1Q82C 1A62A 1PH2A 2K03A 4AQYQ 2EY2A 1K8OA 1TQOA 2OF1A 3URYA 2ZTEA 1BDOA 1D2BA 4AH6A 2FXQA 3PQIA 3HKZB 4RFBA 2ZM6Q 4C3JG 2UXCL 1LTID 1TR5A 1TWGH 1O7IA 2DGYA 2B2VC 3CRLC 2JSOA 4JI5Q 1M4VA 4A3CH 4DV2L 3PUVA 2JA8G 1EIFA 4APVA 3OHXC 2K5NA 4M1UB 1EYGA 4YHHL 1SRUA 2DNCA 4BA1I 3T13A 1C7YA 4DR4L 2JP1A 1CZGA 2VQEQ 1J6QA 1KIXA 3WDNA 5EKLA 4BXXH 1SROA 2E76C 5C3EH 3GTLH 2PNHA 1LABA 3HOWG 3GTKH 3JAML 1K0RA 1SFOB 4IPGA 5C4XB 4MN3A 1PA6A 1L0WA 4JYAL 3PO2G 3PIPA 2BDOA 4C3HH 1I6HB 1GKHA 3K7AH 3NTIA 4GNXB 5IYBH 4A3KB 2CHBD 1JWMD 4ZAIA 4FYDA 3H94A 3I4MH 2XTIA 1CKMA 1A8VA 1CQVA 2DN8A 1YEZA 4IALA 5ELFA 5J3BA 2B8GA 4OO1G 3TP7A 4CGYB 4HIMA 3UDFA 4KKSA 1B3AA 2PI2E 3SK6A 2IL8A 3CMEA 1SYDA 3HKSA 3SVMA 3OIQA 5IWAL 3EA6A 3A8IE 3PO3H 2F3VA 2SNSA 1Z9FA 4HJ8A 4L5QA 2XVSA 2ZJPA 1XJVA 4A93G 4OWWB 3QWNA 1UNSA 1NR4A 2B2UC 3K5MA 4HIKA 5IT9L 2Z0SA 4ZK9B 3HS0C 4KN7C 1QVGA 3KF6B 4H13C 1ESRA 2BA1A 5CC4A 1QJOA 5T1GA 2WV6D 4JPBW 4GOPB 4DR3Q 3I72A 5C44B 5JEAG 4C2MB 1OXTA 1PTOD 5CBEE 2IWHA 1VQ5A 2P5ZX 4XT1B 4DR7Q 4FXKC 2R93H 2NN6G 4K0KQ 2NVYH 1AZPA 3K0YA 5D3IB 4X6AH 3HOZG 4X3TA 4L5SA 3AQQA 4LFBQ 2HUGA 4L8JA 4P71A 2HCIA 3TDQA 3S17H 4KMUC 3K5LA 1B9NA 1S5ED 4O2DA 3NQIA 4P2CB 5I2YA 1N36L 1RKNA 2XRQD 5COYA 2PMZE 4LF6Q 1PFNA 1U9RA 1K73C 5FO7B 1CFMA 4PMWA 3MVVA 3L0OA 5C0XJ 1YJNA 2K32A 3G71A 3H3VH 3FP9A 1TT2A 2EXDA 4A3LH 2MHVA 2RDFA 2ZXPA 3P20A 4A3GG 3BZKA 1GXDC 2QEXA 3NSWA 2K01A 3PF4A 2M2LA 3NENA 4RGOS 2EPBA 1M90C 4KK7A 1AFPA 5JJZA 1MHWC 5IODA 4NPSA 1BOSA 2HCCA 1LTAD 3S1NB 4DUZQ 1EZ6A 5TSSA 4LF7Q 3I70A 4C3JB 3GTMB 3LWEA 4OWTB 4HAEA 4KD4A 4UPAA 3VA5A 3CCUA 2F0MA 3P7JA 4XIGS 4JI4Q 1XPUA 4J15A 4L63B 1F9SA 1ASYA 2JA8B 3KDFB 1TWAB 3I4LA 4ODGA 4CBVA 1WTPA 4EQ5A 1DXMA 1JC7A 3KLWA 2SDFA 1TS2A 3U9OA 3TP5A 3C1FA 2EYLA 2WP8J 4DAPA 3T1HQ 4QCLA 4PMCA 3I55A 4X64L 4K8IA 3HOWB 2CWAA 4B3MQ 4ZKCB 1JOQA 2WINB 1PZID 2JA6G 5G3LF 2ICIA 1MBYA 2D2CC 2O2LD 2LMCB 2A69C 3FKIG 5M3MG 3PO2B 4M8AA 4PQXA 3RZDB 4WFN3 3FPUB 2RQXA 4POGA 2TMPA 4K6DA 3H3VI 4IUQA 4JC0A 1B70B 2YU9B 3KF8A 2O5JC 4P75A 1AN8A 1MSGA 1NSNS 1PTOC 1CUKA 1S5DD 2YYZA 3BDOA 1JCKB 3MA2B 4KJNA 1G8ZD 4DUYQ 4A3FH 1XMQQ 2UUCL 3WOEA 4RGMA 2VQFL 4ZLTF 1X6OA 2O5IC 1SE4A 4YIJA 3M3YH 2Z8LA 4DR5Q 1A15A 4A93B 1U4MA 1TS4A 4MZ9A 1NUCA 2Z4IA 2LS01 3HOUB 2NZHA 2F0WA 1SYCA 2VW9A 3CCJA 1K83B 1SNQA 4IURA 1X3GA 5KIXA 2DJGC 3K0XA 2R7DA 4A3EH 4A3MH 4UHVA 3SEBA 1VF7A 2K7VA 5JAVA 1R9TB 4POFA 2A19A 5KNDA 1VQEA 3EJIA 1HZAA 3TQYA 1PH9A 3ZYYX 3G4SA 4QB4A 3MC0B 3TZDA 1UE5A 4RG1A 4X65L 3HOZB 1D6EC 2H4OA 2KCMA 1I4XA 1PFSA 3OMGA 3VR6A 4DR2Q 1HNZL 1EOVA 2Q2TA 3CCRA 4RA8A 1EWHA 4LF8L 4B3RL 4MNOA 3UDIA 4HEDA 3UE1A 1JWSD 3R8BA 5I9OA 3A5ZB 1XTDA 2AQ3B 3U4ZA 4P74A 1EY6A 5FLMH 4AQYL 1A63A 2KHSA 2RHSB 3GTOH 1VQLA 4A3GB 1HTLD 3M85A 4R1JA 1BCPD 1PYSB 2ZM6L 2N88A 3N6RA 4ZUJA 4XQQA 1CZWA 2HIXA 4ZYSA 1B9MA 3SHLA 5C4JB 3HOVG 1SNDA 3KLRA 2C35B 3X3NA 1BXTA 4DXGA 3HOXG 3RN2A 4A3CG 3VR2A 2MFIA 4KY5A 5BR8Q 4EQPA 1IKMA 4DK1A 4DV5Q 2Y0SE 4U673 1SNOA 2AQ1B 1KTKA 2G9HD 4IZ8A 1M1KC 3NE5B 1DZ1A 2UUBQ 3V05A 1PRTB 1X32A 2VQEL 1WTXA 3IFDA 2F0OA 2M9VA 2NUCA 3BG3A 4IN3A 5H1SE 1UE7A 4BXXG 4PV1C 5C3EG 5KYLA 5CYUA 2KHJA 5ELCA 2ZTDA 2EJMA 3SE0A 5IIFA 3GTQH 4I65A 2VY3A 1A3TA 1DCZA 2ZTCA 5IYBG 2X6GA 3NBHA 4YWKA 3OPOA 2PYKA 1KDCA 1MSHA 3J7ZC 2JA6B 3FKIB 1I4PA 3C1EA 5M3MB 3RUZA 1E3PA 4JYAQ 4DK0A 2XRSD 3SR1A 1G51A 1LTTD 4BBSH 3PO3G 4ZQ3A 5M9OA 1LT3D 2EQSA 3OWEB 4XQJA 3KOJA 1RODA 5LMUL 3G7LA 2PZTA 5M3FH 3AMUA 3J7AV 2C5CA 1H9RA 1Y1WH 1C48A 4U68A 2FJ2A 4MTNA 5LMNQ 1HQRD 4J6HA 1QNUA 2E2JH 5CV7A 1X3EA 5M5XH 1IBLQ 4LJZC 3MEFA 1QNKA 2YTYA 1HCZA 4DR3L 3ERQA 4J1MA 4R8IA 2I0QA 2N3SA 4I7AA 1PV4A 1I4GA 3GTGB 2VZAA 3DWQA 3PUZA 5ISRA 1ML0D 4K5VA 4KY6A 4LFBL 4AYBB 3D4WA 3I90A 2YTXA 4BY1B 1BCPC 1HZBA 1Y1VG 1LTGD 1KLUD 2Q2IA 1TWFH 2FFKB 4TVAB 1EYAA 1BQQT 2J4XA 2ZT9C 4LF6L 4LF9Q 5CGKA 4GLAC 4GNXA 1D5ZC 5M5WB 3P75A 4QIWB 3CU7A 1EL0A 1JOOA 1GUOA 2IHEA 2N55A 2CFMA 3Q8DA 4A3LG 2IJ0A 1N36Q 4TRDA 5BN4A 3LGJA 3QOJA 5BN3A 1CHQD 1AE3A 1H95A 3CMAA 1CT1D 1YNND 4RGNA 4DUZL 3K80C 1WYDA 5L37A 2EOTA 3H6MA 4GLVB 3GP7A 4A4IA 4QF4A 1X3PA 3VDYA 1VQ7A 1VQAA 3A5UA 4JI4L 3PIOA 4YCUA 1TWGB 3EVQA 1WI5A 3KF6A 3FEWX 3HOVB 4X62Q 2UUAQ 2WAQG 3HOXB 3TP8A 1Q8KA 2JYOA 2EYMA 1KDBA 1F2ZA 1H9MA 5IOCA 1EZ8A 3R3OA 4GOPA 1B3QA 3RN5A 2L9HA 1MIUA 5CMDA 4KJOA 2JA5H 4DV3L 3DWAA 1WOCA 1WVLA 1PRTF 1HZCA 3EROA 1CKNA 4XXEA 4A3IH 2E5LQ 3T1HL 2UU9Q 1G6PA 5C3EB 1WTHA 5LMNW 2KCCA 5KGUA 1JB7A 1EY0A 1EY9A 2K6AA 3OYYA 4B3ML 4E6IA 4ZKBB 3GTKB 1LT6D 1YNXA 5CR3A 1PTOH 2I5LX 3CW2C 3H0GG 3T56B 4OEMB 5EJWA 2YV5A 2JJQA 1VQMA 1VQ6A 3FMCA 2BDNA 3MEHA 1TU2B 1WCMH 1NJIC 3QG1A 2LSSA 3CQZB 2UXBQ 3NQTA 1EFID 1GM5A 2AQ2B 4K6LA 1JT8A 2DJFC 4DUYL 1XMQL 3SK8A 1SYEA 1EQRA 5EBDA 2MO0A 2XN9C 4A3FG 2J7ZA 3PO3B 3ER0A 4DN4M 2RCNA 4JBJA 4DR5L 3CHBD 4LF4Q 1HFGA 4A3DH 2ASBA 1AEXA 4IUVA 5JPNC 4N9PA 1ENCA 1GD7A 2VB3X 3L7ZC 5AFWA 3E3XA 2EYJA 4WJ4A 2VQFQ 3KDFA 3S15H 1HH2P 2OEOA 1Z6HA 2Z6KC 4DNIA 1WTWA 2EYPA 1VCIA 1FJGQ 3M7NA 1TVXA 5ELOA 5C44G 3I8ZA 3UE0A 3I2ZA 1VMCA 2KHIA 1D1IA 3A7AB 1BBUA 3J80i 1B7YB 1XPOA 1J8IA 4A3JH 1YNNC 2NVYB 4PZ6A 3ITPA 4KKUA 5KRUA 3C2PA 4RH6A 1Y1VB 3FHWA 1QZGA 1CHPD 1H9KA 3S17B 1XXGA 1QCBD 1CA6A 2F0HA 4DU9A 2KCNA 4LWCA 4DKAC 1DONA 5C0XH 4QUFA 2RVLA 4DR6L 3GV3A 4X65Q 4JOIC 4IFDI 1V8QA 3A74A 2K5VA 2KEDA 5FLMG 3U58A 1CA5A 1KC8C 2UXDL 2VL6A 3GQBA 3NP8A 4XDXA 1QZHA 2Z1CA 4KHPQ 1VQOA 3HFZB 3BU2A 2MPMA 5JEAJ 1I4RA 2R92G 3UDGA 1MJEA 2F3IA 4RGTA 2OQKA 5IGEA 1Z7TA 4B9XA 3NTHA 5BR8L 3D3RA 2FINB 1SLJA 4DV5L 2SEBD 3JC66 3W2DA 1RDPD 1KRSA 2XWBB 2UUBL 4NXMQ 2G9DA 1HUNA 2VXWA 2MGSA 1EEFD 2WAQB 5HURA 3M4YA 3ONAB 3VYUA 3R93A 2B2TC 4DPGA 4HCEA 2Q8RE 3CCQA 1BUVT 1QB5D 1YITA 4CKEA 1SAPA 2NZ1D 1NCVA 1EYDA 1NAPA 1W6JA 2B2WA 1LV9A 1U5KA 2R7ZH 4IPDA 1G2SA 1A6XA 2AUJD 2H5XA 4CDCC 4BS9A 3V2TA 1DM0B 1PH6A 4NKLA 4ULLA 4G7OC 3S1MB 3BZDB 1EFWA 3G48A 2NVQH 1FNWA 4Y7NH 3OTOQ 2L1BA 3H0GB 5IGDA 5CV8A 1F9PA 3GD7A 5C0XI 2F0GA 1S5CD 4NXNL 5AJ3Q 1EIHA 1L0XB 3S24A 4BBSG 5E1FA 2BA0A 3S2HH 4B3TL 4QGUA 5JJIA 3TSSA 5LL6S 1UE6A 3QIAA 5I4DA 1YJ9A 3U4VA 1CQFA 4Z9CB 4L5RC 5K5PA 4BA2I 1I50B 1YHAA 5LMNL 1VMPA 1JR0D 1YHQA 2BH2A 3STBD 1IBLL 5C3XA 5I9PA 2PQAB 4RKBA 1MI2A 4A3FB 2RA4A 3NK9A 5J39A 2B2YA 2NZOA 5LMUQ 2OT2A 5I2XA 3HOUG 3D31A 3CC2A 3GDEA 2A69D 4DA2A 3J7A5 4GS3A 4HTHA 1D1KA 2B3GA 3KJPA 1RL2A 5GAGC 4V0BA 2OQ0A 1P8LA 3MFGA 4ME3A 3MXNB 5EPLA 2EDGA 1EYCA 1KQSA 1Y8NB 2PNRC 1JE4A 4LFAQ 4HIOA 4HN7A 3QB3A 4JI6Q 4F8MA 4LF9L 2DY7A 4KHVA 1U4PA 1L1OC 4Y52H 4C56C 2NVTH 1SE3A 3FDTA 1CKNB 3HP3A 4OGQC 4BY7H 2JEBI 1B8AA 4LK1C 5E3FA 3RMHA 1JJ2A 1JE5A 5BN5A 3PCOB 4DAMA 1EU4A 4RCOA 1LM0A 1Y14B 1O78A 1VQKA 4G4KA 3OW7A 1HHVA 2CVRA 3P1HA 5KNBA 3GTOB 2CH4W 2O4XA 1TS5A 2Z4HA 1AP0A 5A35A 2R92B 2N49A 3H15A 3J7YW 1KAWA 2B63G 2A6HD 4F7XA 3HGBA 4CJ1B 4X62L 2UUAL 3W3AA 1GUTA 4CDFC 3CCVA 1N33Q 1Y8OB 3L3OC 4ZCKA 2HQLA 1ASZA 5K36H 2K4KA 2F0JA 3DXJC 3A7LA 1KHIA 1S3OA 3GTPB 1V43A 2OTJA 3MWYW 4H0LC 1HRJA 1SJED 2E2HH 4MHEA 4CHTB 1RJTA 5JVG3 2QF7A 2JA5G 2NTSA 5F2DA 2E5LL 3VA7A 5DM73 1I3QB 1PFMA 1XMOQ 2X6LA 4HMIA 2UU9L 4JI2Q 2K33A 2HQEA 1PH5A 2L12A 3CC7A 3K7UC 1TWHB 4GZYC 3STBC 4DV3Q 3MXGA 2A68C 1VQJA 2EY1A 2JQOA 2HT1A 3GTQB 4IFDG 4XYOA 1HA5A 2UXBL 1B53A 3K8AA 5FOBB 1EWIA 3NXWA 3J81i 3LNNA 4DFAA 5LL6X 5C3WA 1BVSA 1RHPA 5IYDH 5JOBA 4BBSB 2F0NA 1SEBD 4HJ9A 4LF4L 4IJHA 1SFOH 4JI3Q 2A74C 5C4XH 4LF5L 4I7ZC 1Y1WB 2D9UA 3TS2A 2F0PA 1EY5A 3KK7A 4G7HC 4XQNA 4LMQD 4O0AA 2JEAI 4K14A 5IE8A 4QMGA 2BH8A 1Q86C 1FJGL 1VDZA 1K0SA 1SR3A 1LUZA 1F9QA 4EGVA 4RAUC 1X3QA 2CKZB 3I3CA 1IBMQ 2MUYA 3ULPA 1D5XC 2AWOA 4P72A 4AYBG 2XWJB 4BY1G 1QVCA 3WWVA 3HOYG 1G291 2QDLA 2NWGA 1TWFB 1HZ9A 1DJRD 3U50C 2A6HC 4F88A 2XGTA 1G2TA 4DK6C 5C0XG 1K9MC 1M8AA 4KHPL 1QUQB 3TRZA 4JI8Q 2A6ED 1X54A 4TQUS 1SMYD 5FJ8H 3CCSA 3Q0AA 1H9JA 4JVZA 1B2TA 1K8MA 2HIVA 3JAMi 3KJOA 2J0TD 1ENFA 4DR6Q 4G57A 3RZOB 4KTAA 3T1YL 1FVIA 1TXYA 5E7NA 2UXDQ 3M7GA 1PH4A 2F0UA 2IHFA 3PUXA 4NXML 3S1QH 2B63B 3G6EA 4HJ7A 1ILQA 2IX0A 3O13A 1ONLA 3OSOA 5ELNA 2MP1A 2IY5B 1A2UA 1SSOA 4RHSA 4XTCS 3MZ5A 4HR7B 1J9OA 5IP9H 3HRZC 5EAYA 4DGZA 2V1CC 4P73A 1B4OA 2K05A 4R4OA 1VQPA 4DR1Q 4O1NA 4B3SQ 3NWTA 2IPKD 2EVBA 2JE6I 5IP7H 2JA5B 1SYFA 2L15A 2PQEA 2QW7A 3MXUA 3S1NH 5KYIA 3M4OB 4DF7A 1XPRA 3PMFA 4HCSA 3M4QA 2MQHA 2L0CA 2B29A 3IRBA 5IGBA 5DEHA 4JI0Q 1EQQA 3OTOL 2RBMA 1LYLA 1PTOB 1PDQA 3AEVA 2A73B 4C3HG 5AJ3L 4KY7A 1XTCD 2E2IB 1JICA 1TWAH 2KEEA 4NP5A 2BOSA 3I4MG 4JCVE 3TS0A 1S5BD 4N8FA 1LT4D 2PW5A 1H9SB 5IYCH 4X3SA 4K5WA 4KKTA 3CCLA 4QIWE 1JOKA 4Q0FA 2EYFA 4NXNQ 1PH8A 4K8JA 4CDDC 1TWCB 4NMZA 1Q3LA 1IXRA 4B3TQ 1KLGD 3NEMA 4JBMA 3OMCA 3J80c 4XT3B 3DLLA 2WIIB 1HNWQ 1G91A 2G5DA 5ELDA 3PUYA 2KVMA 2A8VA 2DNEA 3A55A 1RD9D 3S15B 1YHBA 1PH7A 4OO1H 2A6EC 1HQMC 2QEJC 4LFAL 1K28A 4JI6L 1SMYC 1C0AA 3IL8A 4C1NI 3Q23A 1PVOA 1Q90A 2F0IA 3I4OA 1XNRQ 1FNUA 2R93G 4OL7A 3S16H 4QQBX 3MXPA 3S1RB 4A93H 5GADC 2K52A 4BY7G 3HOYB 1D7QA 2GVAA 2VNUD 3DM1A 5A2QE 4R4QA 4H7BA 2E75C 3ERSX 2LY7A 3FPPA 4HJ5A 1W2BA 5LHY1 5G3LD 5C4HA 1AW7A 4IPHA 1LO5D 2X69A 1KAAA 3AYHB 3MTSA 1PFBA 3W1BA 1ESFA 2R6GA 5JEAH 1I94L 2K28A 1R9TH 2NYZD 1DOKA 1K8GA 1CKOA 3E0JA 1IL2A 1LTSD 1SDFA 2JA7H 1ZEQX 5J22A 3F8TA 2PQAA 4LNQA 3HOZH 1IYVA 1N33L 2ES2A 1UWVA 1LTRD 3KFUA 4OWXB 3EBEA 3VYSA 5DNFA 3T53B 2CW0C 1K8AC 2EJGC 4JBWA 4RHRA 3F2DA 5EGTA 2KQ3A 4C1NK 4C3IH 1UEAB 4A3GH 1XMOL 3TMEA 1SBBB 3MXNA 4LFCQ 3DUZA 1DGSA 3FRPB 4OO1I 4LUVA 2I5MX 4JI2L 2WB1G 4BBRH 1X9NA 2F3WA 1QVFA 3ULJA 2KUMA 2RDHA 4NB3A 5C4JH 4GKKQ 3F2BA 1HUMA 2EZVA 1F2MA 1GUSA 3GTLB 1SNMA 3SXHA 2H1EA 2PPBC 1STBA 1EU3A 2KECA 2F4IA 2VUMH 4YWLA 4KI0A 1SN8A 4DV1Q 4IUNA 4KV6A 3OWFA 1YNJD 2MNAA 3AFPA 2AWNA 2KA7A 1PH1A 3PSIA 2PW7A 4Y7NB 4C3HB 2B2VA 5HGTA 2F0QA 3K7AB 4DNRB 1K3BC 2I5HA 3Q22A 1PTOF 1IYJB 4L5TA 3I4MB 3GO5A 4JI3L 3AB9A 1EY4A 1HA6A 1AE2A 1TY2A 4LAAA 2GA4B 1O7YA 5FLXc 1VQ9A 3SK4A 3Q24A 1MGSA 4KHZA 1BCPB 1STYA 4LF5Q 4KN4C 2K04A 5M3MH 3ULLA 1IBML 3E0EA 4GN5A 2XSCA 4OXPA 1BO0A 1CSQA 2LXKA 3HKZE 1UEBA 2OTLA 2EYHA 4A3EG 4A3MG 1KDAA 4A76A 3RR5A 3GTJH 1W3SA 4G7ZC 4N8X1 4GNXC 5EBCA 2R93B 2VB2X 1VQGA 3CPFA 2QILA 1RCVD 4PZ8A 4BY7B 1EIGA 2RCFA 4JI8L 4ZUIA 2CQAA 2F4VQ 3LX0A 2L4NA 2WACA 2CQOA 5M5YH 2B2UA 1EUJA 1ZXTA 3DEPA 5EQ0A 1XYIA 2WKCA 1GUNA 4IUTA 4KLKA 4KD3A 4OX9Q 1STAA 2SOBA 1STGA 5A2QL 5JJKA 2I46A 2RKSA 3I56A 2K5WA 3VR5A 1ZYRD 3PF5A 1VQDA 3CRKC 1TKWB 3RLFA 1NR2A 5J1ZA 4R4IA 1D8LA 5M5WH 1WTQA 1L1OA 3T1YQ 1N32Q 1CM9A 4H44C 1KNAA 4YCVA 4GOPC 3OW2A 5EPJA 3CCMA 4UP7A 5IP9G 3S2DH 2V4DA 1FD7D 1T9HA 3KLSA 5ELEA 2D62A 5D3DA 1CI3M 1YNJC 3T51B 4DR1L 3UI2A 3PIP3 4B3SL 5CV6A 2E2HB 1OO9B 2F1MA 1T5EA 3X3MA 3K59A 1NMFA 5IP7G 2GN5A 1G6ZA 2CCZA 5E4XA 2KOLA 3KUPA 1XNQQ 3D0FA 2WB1B 3J81c 3CXCA 1KL9A 4JI0L 2FMMA 5HY6A 1EQTA 4QJFA 5EPKA 5NUCA 1LTBD 1BNZA 4B9WA 3HOVH 4FXDA 3HOXH 1VS0A 1F2LA 2K5QA 4ID6A 3E5SA 2K75A 2SNMA 1MKHA 1QUQA 3BS1A 1I4HA 3S14H 3BDCA 3R2TA 1AH9A 1IKLA 3K5NA 5FO8B 4JI7Q 4O42A 4X66L 4FDBA 3CAMA 1KD1C 5IYCG 4B08A 1EQVA 1Q46A 1RF2D 2QDBA 3NPPA 3I4NH 2HHHQ 5M3FG 1SNCA 3DMUA 1HNWL 4RMFA 5GQOA 1Y1WG 3SGIA 4UDUC 2A68D 1E2ZA 1J5EQ 1V1OA 1O7LA 3M3YB 5DAUA 3CPWA 1X56A 1B50A 3J7AF 4IFDJ 3CQZH 3BYYB 1JMCA 1GO3E 3Q6SA 4R8NA 4IPCA 2B8FA 1IBKL 1QOHA 4ZRZA 1R4PB 1XNRL 1BCPF 1PLFA 3F1ZA 1BBXC 1STNA 1RTNA 5IGGA 1YIJA 4A3EB 4A3MB 1A3UA 3JAMc 1ET6A 1PRTD 1ZYRC 4K5XA 1ILPA 2EY6A 1JJGA 3AFQA 1JWUD 3AU7A 2L11A 4J8QA 1IW7D 3BVZA 1EEID 2F0SA 3F2CA 3NTKA 1S40A 3QJYA 4PNYA 1S5FD 4UP8A 3ICEA 3EN2A 4JV5Q 4QUCA 1H9SA 3WOFA 1FR3A 2JA7G 1SNPA 3VR4A 4CJ2C 4EVOA 2BE5D 2FHTA 1PH3A 1Q12A 1Y1VH 2Z9HA 2OWOA 3V96A 1I94Q 3L2PA 3TZUA 1NBWA 1WD1A 3DM3A 5IT9c 2NVXH 3J81j 1A3VA 1Q1EA 2I07B 4GKJQ 1W6KA 1SJHD 3BDLA 2EXZA 1U4RA 3S1QB 1FL0A 1U0LA 1DD2A 1T5XD 4C3IG 1CK1A 4LFCL 3HEJA 2VS1A 2JXMB 3B6YA 1JORA 1PYBA 4TSSA 1PZJD 4IUPA 4A3BH 1HR0Q 3G6JB 2N78A 4BBRG 4DV6Q 1V1PB 1UAPA 2B2WC 1C9OA 3K6OA 3J80E 4GKKL 1WTOA 4DAYA 3LWUA 3EFXD 4DV4Q 4IO9A 1OXUA 4JI1Q 4A3IG 1QG7A 1KRTA 1C8CA 1GVPA 3RLOA 1EY7A 1ZKOA 3HZXA 4IOCA 1K3RA 4DV1L 2Q2UA 4FXGC 2VUMG 4XYQA 2QCPX 3TN2A 1HNXL 3PUWA 2QGQA 3IAYA 1LT5D 2CWPA 2RHQB 2LFNA 4YY3Q 1WCMG 3KLSX 2XNAC 5GAHC 3A56A 3C3LA 2AMCB 2ZXOA 2Z6BA 4R9WA 3VR3A 1OXVA 4R4CA 1GJXA 3ND8A 2QKIC 2NTTA 1EWCA 1E2WA 1YJWA 2PMZB 3ZJYC 2B2YC 4DV7L 3BYTB 1XWEA 2F0TA 1PMRA 1BF4A 4IQZA 4RCNA 4IUUA 4S3SA 1N34Q 1UUPA 1PRTC 5M3FB 3S1MH 5CV4A 1MD2D 4OONA 4A3DG 1GOZA 2ALYB 2EY5A 2E74C 3A0JA 3BVMA 3H0GH 1I6HH 4X3UA 2EJFC 1VQ4A 2WFWA
chains in the Genus database with same CATH topology
2R61A 2E2JB 5C5LA 5M5XB 1XX8A 1IW7C 2WKDA 3C46A 4OIKA 2PZWA 3D8GA 1DOLA 5FKAC 1QWYA 2Q8IB 2BE5C 1B1ZA 1LLRD 3S16B 1BR9A 1JQYD 1PYWD 3GV6A 1F77A 3TBIB 2IT1A 5CV9A 1Y8PB 2F0EA 4L6TB 4FF4A 1ICWA 2KJXA 3MHBA 3DHQA 1S4ZA 3TP6A 2JA7B 3NBIA 1D5MC 1GHJA 1HPCA 4RWSC 3HG9A 3IFTA 4OHJA 1TY0A 3KBGA 4BWGB 2TSSA 2RDGA 2R3ZA 3D6CA 1SXTA 5JPMC 4C3IB 1FNVA 3L9AX 4RKLA 3PV0A 5FLXE 4FF2A 2K1BA 1OXSC 4BBRB 4UAIA 3F2UA 3E6ZX 1IL8A 1HTPA 4FVMA 3I73A 1CTMA 4A3IB 2E2DC 1QE6A 1DOMA 1AZQA 1Y69U 3J80L 5C6AA 2CW0D 2VUMB 5FO9B 4N9TA 1O7ZA 2PCFB 5T1IA 4MIUA 1WCMB 2HDMA 4FO2A 1HXYD 3D6WA 5C4ZA 1VF5C 3SK5A 1F2YA 3H09A 4V190 2F0VA 1O80A 1STEA 1PXUA 4HSVA 4A3DB 2M00A 1B44D 2F0KA 4CKCA 4DXFA 1SE2A 2MJ8A 5ELBA 1WD0A 4OIJA 1PZKD 2RSNA 2L5TA 4F87A 1GHKA 4NW2A 1WTVA 2Y0SB 3N52A 4FP5D 1IHZA 2RSOA 3GTJB 1Q1BA 2Q8TA 3SDZA 3K58A 2NB0A 4A3JB 2IX1A 4FF3A 4NDXA 1SYGA 1TIID 3PIO3 3OOCA 3J81E 5M5YB 1E2VA 2XIWA 2IX3A 3QO2A 3MAQA 2EE1A 3VYTA 5CBAE 2OXPA 5DM63 2NN6H 2ZXRA 1HFNA 3QOLA 5CORA 5FK9C 3K57A 4HMJA 5I6WA 3NUCA 1I4QA 1II3A 3OIPA 4CJ0B 5K36G 3S2DB 2A5HA 4WRDA 1Q8IA 3I91A 1EY8A 1KNEA 1LACA 2EYOA 1FGBD 1U4LA 5JVH3 5EKKA 2K5DA 5KNCA 5I6YA 2ENBA 1ET9A 1A2TA 1STHA 5C5MA 4K2LA 3FVQA 3D4RA 2PO4A 3H3VC 5FLXL 4DAVA 2R7ZB 1DYQA 2ICEC 5E4WC 4Q5VA 3S14B 5IGCA 5IGFA 5CV5A 2NVQB 3JAME 3T4AC 3S2HB 3ND9A 2HDLA 4ME5A 2B2TA 1R4QB 2PZUA 3MFYA 4HSPA 3I4NB 2NN6I 1GUWA 1I6VC 4FF1A 4PMBA 4CKBA 4IFDH 4EQNA 1FYCA 1V1PA 3U9SA 2DY8A 5KEEA 4WORA 1OXXK 2C9OA 5IT9E 3DWPA 3KBXA 3BVGA 1C4QA 3R2IA 4ILWA 2B39A 3D4DA 3IKJA 3K5OA 2D5DA 3NHHA 5D14A 2NBFA 3A8KE 2FMCA 3VYRA 1TS3A 2NVTB 1JB3A 2F03A 4FNFA 4DNTB 4WJWA 1QILA 1EOTA 3NWSA 2F0DA 2L55A 3RD4A 5EKIA 3CKIB 1Z47A 1GUGA 3T16A 3DEOA 1KABA 4EQOA 2BCOA 3H91A 1L0YB 3EQLC 5D65A 3J81L 4ABNA 1SYBA 2ID0A 2F0FA 2NVXB 2IW3A 3S9WA 1RTOA 1IYUA 3A54A 4K2KA 1E0BA 1F9RA 3A8JE 2LKVA 4X3KA 4JK1C 1ENAA 4A3BB 2AUKA 1WTRA 2F0LA 4TKOB 2K03A 2EY2A 1K8OA 1TQOA 2OF1A 3URYA 1BDOA 1D2BA 3HKZB 4RFBA 4C3JG 1LTID 1TR5A 2B2VC 3CRLC 2JSOA 1M4VA 3PUVA 3OHXC 4M1UB 2DNCA 4BA1I 3T13A 2JP1A 1CZGA 3WDNA 5EKLA 2E76C 1LABA 3JAML 1SFOB 5C4XB 4MN3A 2BDOA 1I6HB 3NTIA 4A3KB 2CHBD 1JWMD 4ZAIA 4FYDA 3H94A 1CQVA 4IALA 2DN8A 5ELFA 2B8GA 4OO1G 3TP7A 4CGYB 4KKSA 1B3AA 3SK6A 2IL8A 1SYDA 3SVMA 3OIQA 3EA6A 3A8IE 2F3VA 2SNSA 2XVSA 3QWNA 1UNSA 1NR4A 2B2UC 3K5MA 5IT9L 4ZK9B 3HS0C 4KN7C 4H13C 1ESRA 2BA1A 5CC4A 1QJOA 5T1GA 2WV6D 3I72A 5C44B 5JEAG 4C2MB 1OXTA 1PTOD 5CBEE 2IWHA 4XT1B 4FXKC 2NN6G 1AZPA 3K0YA 5D3IB 4X3TA 2HUGA 4L8JA 2HCIA 3TDQA 4KMUC 3K5LA 1B9NA 1S5ED 4P2CB 5I2YA 3NQIA 1RKNA 2XRQD 5COYA 1PFNA 1U9RA 5FO7B 1CFMA 4PMWA 3MVVA 5C0XJ 2K32A 1TT2A 2MHVA 2RDFA 2ZXPA 3P20A 1GXDC 3NSWA 2K01A 2M2LA 4RGOS 2EPBA 4KK7A 1AFPA 5JJZA 5IODA 1BOSA 2HCCA 1LTAD 3S1NB 1EZ6A 5TSSA 3I70A 4C3JB 3GTMB 3LWEA 4HAEA 4KD4A 3VA5A 2F0MA 3P7JA 4XIGS 4L63B 1F9SA 2JA8B 1TWAB 3I4LA 4ODGA 4CBVA 1WTPA 1DXMA 1JC7A 2SDFA 1TS2A 3U9OA 3TP5A 3C1FA 2EYLA 2WP8J 4DAPA 4QCLA 4PMCA 4K8IA 3HOWB 4ZKCB 1JOQA 2WINB 1PZID 5G3LF 2ICIA 1MBYA 2D2CC 2O2LD 2LMCB 2A69C 3PO2B 4M8AA 4PQXA 3RZDB 4WFN3 3FPUB 2RQXA 2TMPA 4K6DA 4IUQA 2YU9B 3KF8A 2O5JC 1AN8A 1MSGA 1NSNS 1PTOC 1S5DD 2YYZA 3BDOA 1JCKB 3MA2B 4KJNA 1G8ZD 3WOEA 4RGMA 4ZLTF 2O5IC 1SE4A 4YIJA 2Z8LA 4A93B 1A15A 1U4MA 1TS4A 1NUCA 2Z4IA 2LS01 3HOUB 2F0WA 1SYCA 1K83B 1SNQA 4IURA 5KIXA 3SEBA 1VF7A 2K7VA 5JAVA 1R9TB 5KNDA 3EJIA 3ZYYX 4QB4A 3MC0B 3TZDA 3HOZB 1D6EC 2H4OA 1I4XA 3VR6A 3OMGA 4RA8A 1EWHA 4HEDA 1JWSD 3R8BA 5I9OA 2AQ3B 1EY6A 2KHSA 4A3GB 1HTLD 3M85A 1BCPD 2N88A 3N6RA 4ZUJA 4XQQA 1CZWA 4ZYSA 1B9MA 3SHLA 5C4JB 1SNDA 3KLRA 3X3NA 1BXTA 4DXGA 3VR2A 4KY5A 4EQPA 1IKMA 4DK1A 4U673 1SNOA 2AQ1B 1KTKA 2G9HD 4IZ8A 3NE5B 1DZ1A 3V05A 1PRTB 1X32A 1WTXA 3IFDA 2F0OA 2M9VA 2NUCA 3BG3A 4IN3A 4PV1C 5KYLA 5CYUA 5ELCA 2EJMA 3SE0A 5IIFA 4I65A 1A3TA 1DCZA 2X6GA 3NBHA 3OPOA 2PYKA 1KDCA 1MSHA 2JA6B 3FKIB 1I4PA 3C1EA 5M3MB 3RUZA 4DK0A 2XRSD 3SR1A 1LTTD 4ZQ3A 5M9OA 1LT3D 3OWEB 4XQJA 1RODA 3G7LA 2PZTA 3AMUA 3J7AV 2C5CA 1H9RA 1C48A 4U68A 2FJ2A 1HQRD 4J6HA 1QNUA 5CV7A 4LJZC 1QNKA 1HCZA 3ERQA 4J1MA 4R8IA 1I4GA 3GTGB 3DWQA 3PUZA 5ISRA 1ML0D 4K5VA 4KY6A 4AYBB 3D4WA 3I90A 4BY1B 1BCPC 1LTGD 1KLUD 2FFKB 1EYAA 1BQQT 2J4XA 2ZT9C 5CGKA 1D5ZC 5M5WB 3P75A 4QIWB 3CU7A 1EL0A 1JOOA 1GUOA 2N55A 2IJ0A 4TRDA 5BN4A 3QOJA 5BN3A 1CHQD 1CT1D 1YNND 4RGNA 2EOTA 3H6MA 3GP7A 4QF4A 1X3PA 1TWGB 3EVQA 3FEWX 3HOVB 3HOXB 3TP8A 2JYOA 2EYMA 1KDBA 1F2ZA 1H9MA 5IOCA 1EZ8A 3R3OA 2L9HA 5CMDA 4KJOA 3DWAA 1WVLA 1PRTF 3EROA 4XXEA 5C3EB 2KCCA 5KGUA 1EY0A 1EY9A 2K6AA 4E6IA 4ZKBB 3GTKB 1LT6D 5CR3A 1PTOH 3T56B 5EJWA 3FMCA 2BDNA 3MEHA 1TU2B 3QG1A 3CQZB 3NQTA 1EFID 2AQ2B 4K6LA 3SK8A 1SYEA 5EBDA 2XN9C 2J7ZA 3PO3B 4DN4M 3CHBD 1HFGA 1AEXA 4IUVA 5JPNC 4N9PA 1ENCA 2VB3X 3L7ZC 5AFWA 2EYJA 2OEOA 1Z6HA 1WTWA 2EYPA 1VCIA 3M7NA 1TVXA 3I8ZA 1VMCA 1D1IA 3A7AB 1J8IA 1YNNC 2NVYB 3ITPA 4KKUA 5KRUA 3C2PA 4RH6A 1Y1VB 1CHPD 1H9KA 3S17B 1XXGA 1QCBD 1CA6A 2F0HA 4DU9A 2KCNA 1DONA 5C0XH 4QUFA 2RVLA 3GV3A 4IFDI 1V8QA 2KEDA 1CA5A 3GQBA 3NP8A 4XDXA 2Z1CA 2MPMA 5JEAJ 1I4RA 4RGTA 5IGEA 1Z7TA 4B9XA 3NTHA 3D3RA 2FINB 2SEBD 3W2DA 1RDPD 2XWBB 2G9DA 1HUNA 2VXWA 2MGSA 1EEFD 2WAQB 5HURA 3M4YA 3ONAB 3VYUA 3R93A 2B2TC 4HCEA 2Q8RE 1BUVT 1QB5D 4CKEA 1SAPA 2NZ1D 1NCVA 1EYDA 1NAPA 1W6JA 2B2WA 1LV9A 1A6XA 1G2SA 2AUJD 4BS9A 3V2TA 1DM0B 4NKLA 4ULLA 4G7OC 3S1MB 3BZDB 1FNWA 2L1BA 3H0GB 5IGDA 5CV8A 1F9PA 3GD7A 5C0XI 2F0GA 1S5CD 1EIHA 1L0XB 5E1FA 2BA0A 3TSSA 5LL6S 3QIAA 5I4DA 1CQFA 4Z9CB 5K5PA 4BA2I 1I50B 1VMPA 1JR0D 5C3XA 5I9PA 4RKBA 4A3FB 1MI2A 2RA4A 3NK9A 5J39A 2B2YA 2OT2A 5I2XA 3D31A 2A69D 4DA2A 4HTHA 1D1KA 4V0BA 3MFGA 5EPLA 2EDGA 1EYCA 1Y8NB 2PNRC 1JE4A 4HN7A 3QB3A 4F8MA 2DY7A 4KHVA 1U4PA 4C56C 1SE3A 3FDTA 3HP3A 4OGQC 2JEBI 3RMHA 4LK1C 5E3FA 5BN5A 1EU4A 4RCOA 1O78A 4G4KA 3OW7A 1HHVA 2CVRA 3P1HA 5KNBA 3GTOB 2O4XA 2Z4HA 1TS5A 1AP0A 5A35A 2R92B 3J7YW 2A6HD 4F7XA 3HGBA 4CJ1B 3W3AA 1GUTA 1Y8OB 3L3OC 5K36H 3DXJC 2F0JA 3A7LA 3GTPB 1V43A 3MWYW 4H0LC 1HRJA 1SJED 4MHEA 4CHTB 1RJTA 5JVG3 2QF7A 2NTSA 5F2DA 3VA7A 5DM73 1I3QB 1PFMA 2X6LA 4HMIA 2K33A 2HQEA 2L12A 4GZYC 1TWHB 3MXGA 2A68C 2EY1A 3GTQB 4IFDG 4XYOA 1HA5A 1B53A 5FOBB 3NXWA 3LNNA 4DFAA 5LL6X 5C3WA 1RHPA 5JOBA 4BBSB 2F0NA 1SEBD 2A74C 4I7ZC 1Y1WB 2D9UA 2F0PA 1EY5A 3KK7A 4G7HC 4XQNA 4LMQD 2JEAI 4K14A 4QMGA 1VDZA 1F9QA 4EGVA 4RAUC 1X3QA 3I3CA 2MUYA 1D5XC 2AWOA 2XWJB 1G291 2NWGA 1TWFB 1DJRD 2A6HC 4F88A 1G2TA 5C0XG 1M8AA 2A6ED 4TQUS 1SMYD 3Q0AA 1H9JA 1B2TA 1K8MA 2J0TD 1ENFA 4G57A 3RZOB 4KTAA 3M7GA 2F0UA 3PUXA 2B63B 1ILQA 2IX0A 3O13A 1ONLA 3OSOA 2MP1A 1A2UA 1SSOA 4RHSA 4XTCS 3MZ5A 4HR7B 1J9OA 3HRZC 4DGZA 1B4OA 2K05A 4O1NA 3NWTA 2IPKD 2EVBA 2JE6I 2JA5B 1SYFA 2PQEA 3MXUA 5KYIA 3M4OB 4DF7A 3PMFA 4HCSA 2L0CA 5IGBA 5DEHA 2RBMA 1PTOB 1PDQA 2A73B 4C3HG 4KY7A 1XTCD 2E2IB 1JICA 2KEEA 4NP5A 2BOSA 1S5BD 1LT4D 2PW5A 1H9SB 4X3SA 4K5WA 4KKTA 1JOKA 4Q0FA 2EYFA 4K8JA 1TWCB 4NMZA 1Q3LA 1KLGD 3OMCA 4XT3B 2WIIB 1G91A 5ELDA 3PUYA 2KVMA 2DNEA 3A55A 1RD9D 3S15B 4OO1H 2A6EC 1HQMC 2QEJC 1SMYC 3IL8A 4C1NI 3Q23A 1Q90A 2F0IA 1FNUA 4OL7A 3MXPA 3S1RB 3HOYB 2VNUD 3DM1A 5A2QE 4H7BA 2E75C 2LY7A 3FPPA 5LHY1 5G3LD 5C4HA 1AW7A 1LO5D 2X69A 1KAAA 3MTSA 1PFBA 1ESFA 2R6GA 5JEAH 2K28A 2NYZD 1DOKA 3E0JA 1LTSD 1SDFA 1ZEQX 5J22A 1IYVA 1LTRD 3VYSA 5DNFA 3T53B 2CW0C 2EJGC 4JBWA 4RHRA 5EGTA 2KQ3A 4C1NK 1UEAB 3TMEA 1SBBB 3MXNA 3DUZA 3FRPB 4OO1I 2F3WA 2KUMA 2RDHA 1HUMA 2EZVA 1F2MA 1GUSA 3GTLB 1SNMA 3SXHA 2H1EA 2PPBC 1STBA 1EU3A 2KECA 2F4IA 4KI0A 4IUNA 4KV6A 3OWFA 1YNJD 2AWNA 2KA7A 2PW7A 4Y7NB 4C3HB 2B2VA 5HGTA 2F0QA 3K7AB 4DNRB 3Q22A 1PTOF 3I4MB 3GO5A 3AB9A 1EY4A 1HA6A 1TY2A 4LAAA 2GA4B 1O7YA 3SK4A 3Q24A 1MGSA 4KHZA 1BCPB 1STYA 4KN4C 2K04A 2XSCA 1BO0A 2EYHA 1KDAA 4G7ZC 5EBCA 2R93B 2VB2X 2QILA 1RCVD 4BY7B 1EIGA 4ZUIA 2CQAA 3LX0A 2L4NA 2WACA 2B2UA 1ZXTA 3DEPA 5EQ0A 1XYIA 2WKCA 1GUNA 4IUTA 4KD3A 1STAA 2SOBA 1STGA 5A2QL 2I46A 2RKSA 2K5WA 3VR5A 1ZYRD 3CRKC 1TKWB 3RLFA 1NR2A 5J1ZA 1WTQA 1CM9A 4H44C 1KNAA 5EPJA 2V4DA 1FD7D 5ELEA 3KLSA 2D62A 5D3DA 1CI3M 1YNJC 3T51B 3UI2A 3PIP3 5CV6A 2E2HB 1OO9B 2F1MA 1T5EA 3X3MA 3K59A 1G6ZA 5E4XA 2KOLA 3KUPA 2WB1B 2FMMA 1EQTA 5EPKA 5NUCA 1LTBD 1BNZA 4B9WA 4FXDA 1F2LA 2K5QA 4ID6A 3E5SA 2SNMA 3BS1A 1I4HA 3BDCA 3R2TA 1IKLA 3K5NA 5FO8B 4O42A 4B08A 1EQVA 1RF2D 2QDBA 3NPPA 1SNCA 3DMUA 4UDUC 2A68D 1E2ZA 1V1OA 1O7LA 3M3YB 5DAUA 1B50A 3J7AF 4IFDJ 3BYYB 3Q6SA 4R8NA 2B8FA 1QOHA 4ZRZA 1R4PB 1BCPF 1PLFA 1BBXC 1STNA 1RTNA 5IGGA 4A3EB 4A3MB 1A3UA 1ET6A 1PRTD 1ZYRC 4K5XA 1ILPA 2EY6A 1JWUD 3AU7A 2L11A 4J8QA 1IW7D 3BVZA 1EEID 2F0SA 3NTKA 3QJYA 4PNYA 1S5FD 4QUCA 1H9SA 3WOFA 1FR3A 1SNPA 3VR4A 4CJ2C 4EVOA 2BE5D 2FHTA 1Q12A 3V96A 3TZUA 1WD1A 1A3VA 1Q1EA 2I07B 1W6KA 1SJHD 3BDLA 2EXZA 1U4RA 3S1QB 1DD2A 1T5XD 4C3IG 1CK1A 3HEJA 2JXMB 1JORA 4TSSA 1PZJD 4IUPA 3G6JB 1V1PB 1UAPA 2B2WC 3K6OA 3J80E 1WTOA 4DAYA 3LWUA 3EFXD 1OXUA 1QG7A 1C8CA 1EY7A 1ZKOA 3HZXA 4FXGC 4XYQA 2QCPX 3TN2A 3PUWA 3IAYA 1LT5D 2LFNA 3KLSX 2XNAC 3C3LA 3A56A 2ZXOA 4R9WA 3VR3A 1OXVA 1GJXA 3ND8A 2QKIC 2NTTA 1EWCA 1E2WA 2PMZB 2B2YC 3BYTB 1XWEA 2F0TA 1PMRA 1BF4A 4IQZA 4RCNA 4IUUA 4S3SA 1UUPA 1PRTC 5M3FB 5CV4A 1MD2D 1GOZA 2EY5A 3BVMA 2E74C 4X3UA 2EJFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNM A;  5ISR A;  4WRD A;  4N9T A;  4ODG A;  4K5V A;  4KY6 A;  3SXH A;  1STB A;  3OMC A;  1EY8 A;  5C5L A;  2F0D A;  3TP7 A;  4F7X A;  3D4W A;  2F0S A;  3SK6 A;  1SYD A;  2PZW A;  4IUN A;  4KV6 A;  2EYO A;  3OWF A;  4MIU A;  4PNY A;  4ZUJ A;  3T16 A;  1EYA A;  1KAB A;  2F3V A;  2PW7 A;  2SNS A;  3D8G A;  5EKK A;  3V2T A;  3U9O A;  1AEX A;  3TP5 A;  4EQO A;  3C1F A;  2F0Q A;  4NKL A;  5CV6 A;  5HGT A;  4N9P A;  2EYL A;  3SHL A;  5I6Y A;  2F0J A;  5CGK A;  1SND A;  1SNP A;  1ENC A;  2ENB A;  4EVO A;  1SYB A;  5C4Z A;  4PMC A;  2EYJ A;  5IGD A;  3P75 A;  4K8I A;  4KY5 A;  5CV8 A;  4EQP A;  1A2T A;  1STH A;  2F0G A;  3SK5 A;  5C5M A;  1JOO A;  2F0F A;  1EY4 A;  2OEO A;  1SNO A;  4K2L A;  3S9W A;  1JOQ A;  1F2Y A;  4IZ8 A;  2EYP A;  2F0V A;  4K2K A;  5E1F A;  5F2D A;  2F0I A;  4G57 A;  4KTA A;  4HMI A;  4LAA A;  4TRD A;  4OL7 A;  1A3V A;  5NUC A;  4B9W A;  3QOJ A;  2F0O A;  2M00 A;  3BDL A;  2EXZ A;  2NUC A;  3MXP A;  4K6D A;  3SK4 A;  5CC4 A;  5K5P A;  2F0K A;  2HQE A;  4ID6 A;  3E5S A;  5CV5 A;  2F0U A;  2LKV A;  5IGC A;  5IGF A;  2SNM A;  1ENA A;  5CV9 A;  3HEJ A;  3ITP A;  5C3X A;  5I9P A;  4RKB A;  2EY1 A;  2F0E A;  3BDC A;  1NSN S;  1STY A;  2F0L A;  3H6M A;  3NK9 A;  4H7B A;  5KRU A;  5KYL A;  5J39 A;  1JOR A;  3OSO A;  4QF4 A;  2EY2 A;  4KJN A;  1A2U A;  3MHB A;  1TQO A;  2OF1 A;  3MZ5 A;  5C4H A;  2F0H A;  3EVQ A;  4DU9 A;  4ME5 A;  4YIJ A;  4DGZ A;  3DHQ A;  5IIF A;  2PZU A;  3TP6 A;  1KAA A;  4I65 A;  4HTH A;  1IHZ A;  3NXW A;  1EQV A;  3TP8 A;  1A3T A;  1NUC A;  1TR5 A;  2EYH A;  2EYM A;  1KDB A;  1RKN A;  2QDB A;  1F2Z A;  1KDA A;  5IOC A;  1EZ8 A;  2PYK A;  4DFA A;  1U9R A;  3R3O A;  1KDC A;  5J22 A;  1EY7 A;  1SNC A;  3NP8 A;  5C3W A;  2F0W A;  3HZX A;  3C1E A;  4NDX A;  1SYC A;  1SYF A;  4PMB A;  2F0N A;  3DMU A;  3MVV A;  5JOB A;  1EYC A;  1SYG A;  2PQE A;  3RUZ A;  1SNQ A;  3SR1 A;  4KJO A;  4EQN A;  5KYI A;  3QB3 A;  4DF7 A;  3PMF A;  1TT2 A;  4F8M A;  2RDF A;  4KHV A;  5KIX A;  4ZQ3 A;  5DAU A;  5IGB A;  5M9O A;  5KEE A;  3ERO A;  5DEH A;  3D6C A;  4ZUI A;  4WOR A;  3LX0 A;  3T13 A;  5IGE A;  4B9X A;  2RBM A;  2F0P A;  2WAC A;  1EY5 A;  5JAV A;  4RKL A;  2PZT A;  5KGU A;  1EY9 A;  1EY0 A;  4R8N A;  3EJI A;  4KY7 A;  4E6I A;  5E3F A;  5EGT A;  2KQ3 A;  4K14 A;  5EKL A;  5CR3 A;  4QB4 A;  4NP5 A;  4QMG A;  4J6H A;  5IOD A;  3TME A;  5CV7 A;  2OXP A;  3OMG A;  3D4D A;  1EZ6 A;  3NHH A;  4KD3 A;  1STA A;  1STN A;  2SOB A;  1STG A;  5HUR A;  3MEH A;  5IGG A;  4KD4 A;  2F3W A;  2PW5 A;  3VA5 A;  2RKS A;  2F0M A;  2F0T A;  1A3U A;  3ERQ A;  4J1M A;  4K5W A;  3QOL A;  1JOK A;  4S3S A;  2EYF A;  4K5X A;  3P1H A;  3NQT A;  4K8J A;  5CV4 A;  2EY6 A;  5I9O A;  4HMJ A;  2O4X A;  3NUC A;  5I6W A;  1II3 A;  2EY5 A;  4NMZ A;  1F2M A;  5J1Z A;  1EY6 A;  5C6A A;  2KHS A;  3SK8 A;  1SYE A;  4IAL A;  1EYD A; 
#chains in the Genus database with same CATH topology
 1NMG A;  4GLX A;  2R61 A;  1X65 A;  2OCE A;  4A3K H;  2E2J B;  5C5L A;  5M5X B;  1L1O B;  1XX8 A;  1E1T A;  4JBK A;  1IW7 C;  2WKD A;  3C46 A;  1ICF B;  4OIK A;  2PZW A;  1VQH A;  3D8G A;  1SE8 A;  1I50 H;  1DOL A;  5FKA C;  2Y0S G;  1QWY A;  5GAE C;  2Q8I B;  2BE5 C;  1B1Z A;  1VQF A;  1MJC A;  1FGU A;  4A3J G;  5JJL A;  1BBW A;  1LLR D;  4WJ3 M;  3S16 B;  1E22 A;  1BR9 A;  2F4V L;  1JQY D;  1PYW D;  4PZ7 A;  3GV6 A;  1F77 A;  3TBI B;  2IT1 A;  5CV9 A;  1Y8P B;  1VQB A;  1HR0 W;  2F0E A;  4OX9 L;  4L6T B;  4FF4 A;  5C44 H;  1ICW A;  4IOA A;  4C2M H;  2KJX A;  3MHB A;  4GN3 B;  4DK3 C;  3DHQ A;  1S4Z A;  3TP6 A;  2JA7 B;  4DV0 Q;  3NBI A;  1D5M C;  1N32 L;  1GHJ A;  2QA4 A;  1HPC A;  4RWS C;  1WJJ A;  1Q81 C;  4YCW A;  3HG9 A;  3IFT A;  4OHJ A;  2N8N A;  1E1O A;  1TY0 A;  3KBG A;  4BWG B;  2TSS A;  2RDG A;  2R3Z A;  3D6C A;  3I7F A;  3K81 C;  1SXT A;  5JPM C;  4C3I B;  1FNV A;  3L9A X;  2ZJR A;  4RKL A;  3PV0 A;  5FLX E;  1XNQ L;  4FF2 A;  3CD6 A;  2K1B A;  3TEH B;  5HGQ A;  1OXS C;  2R92 H;  4BBR B;  1N8R C;  4UAI A;  3F2U A;  3E6Z X;  4JI5 L;  1IL8 A;  1HTP A;  4FVM A;  3I73 A;  2DUD A;  1CTM A;  4A3I B;  2ZJQ A;  2E2D C;  2R7Z G;  1QE6 A;  3QR8 A;  1DOM A;  4C3J H;  3GTM H;  4HJA A;  1AZQ A;  1Y69 U;  3GTP H;  3J80 L;  2UXC Q;  5C6A A;  2CW0 D;  2K5H A;  4JI7 L;  2VUM B;  5FO9 B;  4N9T A;  4AYB E;  2JA8 H;  3CP0 A;  4DV2 Q;  1O7Z A;  2PCF B;  5T1I A;  1I3Q H;  2KEN A;  4MIU A;  4UY8 C;  1WCM B;  1KXL A;  2HDM A;  1WFQ A;  4FO2 A;  1L2F A;  2R7F A;  1YI2 A;  2HHH L;  4YHH Q;  1HXY D;  3RNU A;  3I4N G;  1TWH H;  2JN4 A;  1CSP A;  3D6W A;  4X66 Q;  5C4Z A;  4DR4 Q;  1VF5 C;  1J5E L;  3SK5 A;  3CF5 A;  3PGZ A;  1F2Y A;  3H09 A;  1EIY B;  4V19 0;  2F0V A;  1O80 A;  3HOW H;  1STE A;  1PXU A;  1VQI A;  4HSV A;  4A3D B;  2M00 A;  1B44 D;  3PO2 H;  2F0K A;  1V9P A;  4CKC A;  2RF4 A;  3RZD H;  4DXF A;  4HID A;  1SE2 A;  3KYH C;  1E24 A;  2MJ8 A;  5ELB A;  1WD0 A;  2YU9 H;  4OIJ A;  1VQC A;  1PZK D;  2RSN A;  3BZC A;  2L5T A;  4F87 A;  1GHK A;  4NW2 A;  2K14 A;  1WTV A;  2Y0S B;  1IBK Q;  3N52 A;  4FP5 D;  1YBY A;  4EX5 A;  1IHZ A;  2RSO A;  3W5O A;  3GTJ B;  5IWA Q;  1Q1B A;  2Q8T A;  4CDE C;  3SDZ A;  4JW0 A;  4DAY B;  2NB0 A;  1NE3 A;  3K58 A;  4A3J B;  2IX1 A;  4FF3 A;  4NDX A;  1X55 A;  1SYG A;  1TII D;  1VQ8 A;  1E7Z A;  3HOU H;  4JV5 L;  3PIO 3;  3OOC A;  4H02 A;  3J81 E;  1K83 H;  1E2V A;  5M5Y B;  2XIW A;  3UDX A;  4DR7 L;  4K0K L;  2IX3 A;  2K50 A;  3CC4 A;  3QO2 A;  4AIM A;  2GVB A;  2ATW A;  3MAQ A;  2Z6K A;  2EE1 A;  3VYT A;  5CBA E;  2OXP A;  4GKJ L;  5DM6 3;  2NN6 H;  2ZXR A;  3TRE A;  1HFN A;  1UE1 A;  3QOL A;  3W1G A;  4QL5 A;  5COR A;  5FK9 C;  4LUZ A;  3K57 A;  4HMJ A;  5I6W A;  3NUC A;  1I4Q A;  1II3 A;  3OIP A;  1YZ6 A;  4CJ0 B;  1HR0 L;  5K36 G;  4DV6 L;  2MO1 A;  3S2D B;  2A5H A;  4WRD A;  4A3B G;  1Q8I A;  3I91 A;  1EY8 A;  1KNE A;  1LAC A;  1JJC B;  4OEL B;  1A0I A;  3RZO H;  2EYO A;  1FGB D;  1U4L A;  5JVH 3;  4DV4 L;  5EKK A;  4JI1 L;  4JOI A;  2K5D A;  4LF7 L;  3KF8 B;  5KNC A;  5I6Y A;  3HKZ G;  2ENB A;  2B63 H;  1ET9 A;  1A2T A;  1STH A;  5C5M A;  4K2L A;  3FVQ A;  3D4R A;  2PO4 A;  3H3V C;  5FLX L;  4DAV A;  1NY4 A;  2R7Z B;  4LUO A;  1DYQ A;  4QY7 A;  4YY3 L;  1RIP A;  2ICE C;  5E4W C;  4GN4 B;  2D0P A;  4Q5V A;  3S14 B;  1NTG A;  5IGC A;  5IGF A;  5CV5 A;  2NVQ B;  4UP9 A;  3JAM E;  1HNX Q;  1V1Q A;  1BKB A;  4IJL A;  3T4A C;  3M4O H;  5IYD G;  3S2H B;  3M9B A;  2JA9 A;  1N34 L;  3ND9 A;  2HDL A;  4ME5 A;  2B2T A;  1R4Q B;  2PZU A;  4MTK A;  3MFY A;  4HSP A;  3I4N B;  5C4X G;  2NN6 I;  1NNX A;  2A1A A;  1GUW A;  3EIV A;  2PI2 A;  1I6V C;  5DLQ E;  4FF1 A;  2E2I H;  3NEL A;  3CCE A;  4DV7 Q;  4PMB A;  4CKB A;  3BJU A;  1VQN A;  4A3K G;  4IFD H;  3RLN A;  4EQN A;  4X64 Q;  2JA6 H;  3FKI H;  1FYC A;  1Q7Y C;  1N9W A;  1V1P A;  3U9S A;  2DY8 A;  5KEE A;  4WOR A;  1OXX K;  2C9O A;  4ALP A;  1P16 A;  5IT9 E;  3DWP A;  3KBX A;  1TWC H;  3BVG A;  3E9H A;  2KBN A;  2HD3 A;  5IY0 A;  1C4Q A;  2JK8 A;  3R2I A;  4LW1 A;  1OTC A;  4ILW A;  2B39 A;  3D4D A;  5GRO A;  3IKJ A;  3K5O A;  2D5D A;  2WAQ E;  3NHH A;  5D14 A;  2NBF A;  2YTV A;  4A75 A;  3A8K E;  2F52 A;  2FMC A;  3VYR A;  1TS3 A;  2UUC Q;  2NVT B;  1JB3 A;  2F03 A;  4FNF A;  4DNT B;  2KCT A;  2WB1 E;  1IZ6 A;  4WJW A;  1I5F A;  1QIL A;  1EOT A;  3E9I A;  1YVC A;  3NWS A;  3M4P A;  5FJ8 G;  2F0D A;  2AKW B;  3GTG H;  4DV0 L;  2L55 A;  3RD4 A;  2EIF A;  5EKI A;  3CKI B;  1Z47 A;  1GUG A;  3T16 A;  3DEO A;  1KAB A;  4JG2 A;  3S1R H;  4BY1 H;  4EQO A;  2D0O A;  2BCO A;  4DR2 L;  1HJP A;  1L0Y B;  3H91 A;  1SMX A;  3HOY H;  3EQL C;  5D65 A;  3J81 L;  4ABN A;  1SYB A;  1S72 A;  2ID0 A;  2LXJ A;  2F0F A;  2NVX B;  2IW3 A;  3S9W A;  2Q2H A;  1RTO A;  4PG3 A;  1IYU A;  3A54 A;  4YWM A;  4K2K A;  1X3F A;  2E8G A;  1HNZ Q;  2CH4 A;  1E0B A;  1F9R A;  3NBH B;  3A8J E;  2LKV A;  4X3K A;  4LF8 Q;  1PHJ A;  4JK1 C;  1ENA A;  4B3R Q;  2AHO B;  4A3B B;  1LTL A;  2AUK A;  1WTR A;  4R4T A;  2F0L A;  4TKO B;  1Q82 C;  1A62 A;  1PH2 A;  2K03 A;  4AQY Q;  2EY2 A;  1K8O A;  1TQO A;  2OF1 A;  3URY A;  2ZTE A;  1BDO A;  1D2B A;  4AH6 A;  2FXQ A;  3PQI A;  3HKZ B;  4RFB A;  2ZM6 Q;  4C3J G;  2UXC L;  1LTI D;  1TR5 A;  1TWG H;  1O7I A;  2DGY A;  2B2V C;  3CRL C;  2JSO A;  4JI5 Q;  1M4V A;  4A3C H;  4DV2 L;  3PUV A;  2JA8 G;  1EIF A;  4APV A;  3OHX C;  2K5N A;  4M1U B;  1EYG A;  4YHH L;  1SRU A;  2DNC A;  4BA1 I;  3T13 A;  1C7Y A;  4DR4 L;  2JP1 A;  1CZG A;  2VQE Q;  1J6Q A;  1KIX A;  3WDN A;  5EKL A;  4BXX H;  1SRO A;  2E76 C;  5C3E H;  3GTL H;  2PNH A;  1LAB A;  3HOW G;  3GTK H;  3JAM L;  1K0R A;  1SFO B;  4IPG A;  5C4X B;  4MN3 A;  1PA6 A;  1L0W A;  4JYA L;  3PO2 G;  3PIP A;  2BDO A;  4C3H H;  1I6H B;  1GKH A;  3K7A H;  3NTI A;  4GNX B;  5IYB H;  4A3K B;  2CHB D;  1JWM D;  4ZAI A;  4FYD A;  3H94 A;  3I4M H;  2XTI A;  1CKM A;  1A8V A;  1CQV A;  2DN8 A;  1YEZ A;  4IAL A;  5ELF A;  5J3B A;  2B8G A;  4OO1 G;  3TP7 A;  4CGY B;  4HIM A;  3UDF A;  4KKS A;  1B3A A;  2PI2 E;  3SK6 A;  2IL8 A;  3CME A;  1SYD A;  3HKS A;  3SVM A;  3OIQ A;  5IWA L;  3EA6 A;  3A8I E;  3PO3 H;  2F3V A;  2SNS A;  1Z9F A;  4HJ8 A;  4L5Q A;  2XVS A;  2ZJP A;  1XJV A;  4A93 G;  4OWW B;  3QWN A;  1UNS A;  1NR4 A;  2B2U C;  3K5M A;  4HIK A;  5IT9 L;  2Z0S A;  4ZK9 B;  3HS0 C;  4KN7 C;  1QVG A;  3KF6 B;  4H13 C;  1ESR A;  2BA1 A;  5CC4 A;  1QJO A;  5T1G A;  2WV6 D;  4JPB W;  4GOP B;  4DR3 Q;  3I72 A;  5C44 B;  5JEA G;  4C2M B;  1OXT A;  1PTO D;  5CBE E;  2IWH A;  1VQ5 A;  2P5Z X;  4XT1 B;  4DR7 Q;  4FXK C;  2R93 H;  2NN6 G;  4K0K Q;  2NVY H;  1AZP A;  3K0Y A;  5D3I B;  4X6A H;  3HOZ G;  4X3T A;  4L5S A;  3AQQ A;  4LFB Q;  2HUG A;  4L8J A;  4P71 A;  2HCI A;  3TDQ A;  3S17 H;  4KMU C;  3K5L A;  1B9N A;  1S5E D;  4O2D A;  3NQI A;  4P2C B;  5I2Y A;  1N36 L;  1RKN A;  2XRQ D;  5COY A;  2PMZ E;  4LF6 Q;  1PFN A;  1U9R A;  1K73 C;  5FO7 B;  1CFM A;  4PMW A;  3MVV A;  3L0O A;  5C0X J;  1YJN A;  2K32 A;  3G71 A;  3H3V H;  3FP9 A;  1TT2 A;  2EXD A;  4A3L H;  2MHV A;  2RDF A;  2ZXP A;  3P20 A;  4A3G G;  3BZK A;  1GXD C;  2QEX A;  3NSW A;  2K01 A;  3PF4 A;  2M2L A;  3NEN A;  4RGO S;  2EPB A;  1M90 C;  4KK7 A;  1AFP A;  5JJZ A;  1MHW C;  5IOD A;  4NPS A;  1BOS A;  2HCC A;  1LTA D;  3S1N B;  4DUZ Q;  1EZ6 A;  5TSS A;  4LF7 Q;  3I70 A;  4C3J B;  3GTM B;  3LWE A;  4OWT B;  4HAE A;  4KD4 A;  4UPA A;  3VA5 A;  3CCU A;  2F0M A;  3P7J A;  4XIG S;  4JI4 Q;  1XPU A;  4J15 A;  4L63 B;  1F9S A;  1ASY A;  2JA8 B;  3KDF B;  1TWA B;  3I4L A;  4ODG A;  4CBV A;  1WTP A;  4EQ5 A;  1DXM A;  1JC7 A;  3KLW A;  2SDF A;  1TS2 A;  3U9O A;  3TP5 A;  3C1F A;  2EYL A;  2WP8 J;  4DAP A;  3T1H Q;  4QCL A;  4PMC A;  3I55 A;  4X64 L;  4K8I A;  3HOW B;  2CWA A;  4B3M Q;  4ZKC B;  1JOQ A;  2WIN B;  1PZI D;  2JA6 G;  5G3L F;  2ICI A;  1MBY A;  2D2C C;  2O2L D;  2LMC B;  2A69 C;  3FKI G;  5M3M G;  3PO2 B;  4M8A A;  4PQX A;  3RZD B;  4WFN 3;  3FPU B;  2RQX A;  4POG A;  2TMP A;  4K6D A;  3H3V I;  4IUQ A;  4JC0 A;  1B70 B;  2YU9 B;  3KF8 A;  2O5J C;  4P75 A;  1AN8 A;  1MSG A;  1NSN S;  1PTO C;  1CUK A;  1S5D D;  2YYZ A;  3BDO A;  1JCK B;  3MA2 B;  4KJN A;  1G8Z D;  4DUY Q;  4A3F H;  1XMQ Q;  2UUC L;  3WOE A;  4RGM A;  2VQF L;  4ZLT F;  1X6O A;  2O5I C;  1SE4 A;  4YIJ A;  3M3Y H;  2Z8L A;  4DR5 Q;  1A15 A;  4A93 B;  1U4M A;  1TS4 A;  4MZ9 A;  1NUC A;  2Z4I A;  2LS0 1;  3HOU B;  2NZH A;  2F0W A;  1SYC A;  2VW9 A;  3CCJ A;  1K83 B;  1SNQ A;  4IUR A;  1X3G A;  5KIX A;  2DJG C;  3K0X A;  2R7D A;  4A3E H;  4A3M H;  4UHV A;  3SEB A;  1VF7 A;  2K7V A;  5JAV A;  1R9T B;  4POF A;  2A19 A;  5KND A;  1VQE A;  3EJI A;  1HZA A;  3TQY A;  1PH9 A;  3ZYY X;  3G4S A;  4QB4 A;  3MC0 B;  3TZD A;  1UE5 A;  4RG1 A;  4X65 L;  3HOZ B;  1D6E C;  2H4O A;  2KCM A;  1I4X A;  1PFS A;  3OMG A;  3VR6 A;  4DR2 Q;  1HNZ L;  1EOV A;  2Q2T A;  3CCR A;  4RA8 A;  1EWH A;  4LF8 L;  4B3R L;  4MNO A;  3UDI A;  4HED A;  3UE1 A;  1JWS D;  3R8B A;  5I9O A;  3A5Z B;  1XTD A;  2AQ3 B;  3U4Z A;  4P74 A;  1EY6 A;  5FLM H;  4AQY L;  1A63 A;  2KHS A;  2RHS B;  3GTO H;  1VQL A;  4A3G B;  1HTL D;  3M85 A;  4R1J A;  1BCP D;  1PYS B;  2ZM6 L;  2N88 A;  3N6R A;  4ZUJ A;  4XQQ A;  1CZW A;  2HIX A;  4ZYS A;  1B9M A;  3SHL A;  5C4J B;  3HOV G;  1SND A;  3KLR A;  2C35 B;  3X3N A;  1BXT A;  4DXG A;  3HOX G;  3RN2 A;  4A3C G;  3VR2 A;  2MFI A;  4KY5 A;  5BR8 Q;  4EQP A;  1IKM A;  4DK1 A;  4DV5 Q;  2Y0S E;  4U67 3;  1SNO A;  2AQ1 B;  1KTK A;  2G9H D;  4IZ8 A;  1M1K C;  3NE5 B;  1DZ1 A;  2UUB Q;  3V05 A;  1PRT B;  1X32 A;  2VQE L;  1WTX A;  3IFD A;  2F0O A;  2M9V A;  2NUC A;  3BG3 A;  4IN3 A;  5H1S E;  1UE7 A;  4BXX G;  4PV1 C;  5C3E G;  5KYL A;  5CYU A;  2KHJ A;  5ELC A;  2ZTD A;  2EJM A;  3SE0 A;  5IIF A;  3GTQ H;  4I65 A;  2VY3 A;  1A3T A;  1DCZ A;  2ZTC A;  5IYB G;  2X6G A;  3NBH A;  4YWK A;  3OPO A;  2PYK A;  1KDC A;  1MSH A;  3J7Z C;  2JA6 B;  3FKI B;  1I4P A;  3C1E A;  5M3M B;  3RUZ A;  1E3P A;  4JYA Q;  4DK0 A;  2XRS D;  3SR1 A;  1G51 A;  1LTT D;  4BBS H;  3PO3 G;  4ZQ3 A;  5M9O A;  1LT3 D;  2EQS A;  3OWE B;  4XQJ A;  3KOJ A;  1ROD A;  5LMU L;  3G7L A;  2PZT A;  5M3F H;  3AMU A;  3J7A V;  2C5C A;  1H9R A;  1Y1W H;  1C48 A;  4U68 A;  2FJ2 A;  4MTN A;  5LMN Q;  1HQR D;  4J6H A;  1QNU A;  2E2J H;  5CV7 A;  1X3E A;  5M5X H;  1IBL Q;  4LJZ C;  3MEF A;  1QNK A;  2YTY A;  1HCZ A;  4DR3 L;  3ERQ A;  4J1M A;  4R8I A;  2I0Q A;  2N3S A;  4I7A A;  1PV4 A;  1I4G A;  3GTG B;  2VZA A;  3DWQ A;  3PUZ A;  5ISR A;  1ML0 D;  4K5V A;  4KY6 A;  4LFB L;  4AYB B;  3D4W A;  3I90 A;  2YTX A;  4BY1 B;  1BCP C;  1HZB A;  1Y1V G;  1LTG D;  1KLU D;  2Q2I A;  1TWF H;  2FFK B;  4TVA B;  1EYA A;  1BQQ T;  2J4X A;  2ZT9 C;  4LF6 L;  4LF9 Q;  5CGK A;  4GLA C;  4GNX A;  1D5Z C;  5M5W B;  3P75 A;  4QIW B;  3CU7 A;  1EL0 A;  1JOO A;  1GUO A;  2IHE A;  2N55 A;  2CFM A;  3Q8D A;  4A3L G;  2IJ0 A;  1N36 Q;  4TRD A;  5BN4 A;  3LGJ A;  3QOJ A;  5BN3 A;  1CHQ D;  1AE3 A;  1H95 A;  3CMA A;  1CT1 D;  1YNN D;  4RGN A;  4DUZ L;  3K80 C;  1WYD A;  5L37 A;  2EOT A;  3H6M A;  4GLV B;  3GP7 A;  4A4I A;  4QF4 A;  1X3P A;  3VDY A;  1VQ7 A;  1VQA A;  3A5U A;  4JI4 L;  3PIO A;  4YCU A;  1TWG B;  3EVQ A;  1WI5 A;  3KF6 A;  3FEW X;  3HOV B;  4X62 Q;  2UUA Q;  2WAQ G;  3HOX B;  3TP8 A;  1Q8K A;  2JYO A;  2EYM A;  1KDB A;  1F2Z A;  1H9M A;  5IOC A;  1EZ8 A;  3R3O A;  4GOP A;  1B3Q A;  3RN5 A;  2L9H A;  1MIU A;  5CMD A;  4KJO A;  2JA5 H;  4DV3 L;  3DWA A;  1WOC A;  1WVL A;  1PRT F;  1HZC A;  3ERO A;  1CKN A;  4XXE A;  4A3I H;  2E5L Q;  3T1H L;  2UU9 Q;  1G6P A;  5C3E B;  1WTH A;  5LMN W;  2KCC A;  5KGU A;  1JB7 A;  1EY0 A;  1EY9 A;  2K6A A;  3OYY A;  4B3M L;  4E6I A;  4ZKB B;  3GTK B;  1LT6 D;  1YNX A;  5CR3 A;  1PTO H;  2I5L X;  3CW2 C;  3H0G G;  3T56 B;  4OEM B;  5EJW A;  2YV5 A;  2JJQ A;  1VQM A;  1VQ6 A;  3FMC A;  2BDN A;  3MEH A;  1TU2 B;  1WCM H;  1NJI C;  3QG1 A;  2LSS A;  3CQZ B;  2UXB Q;  3NQT A;  1EFI D;  1GM5 A;  2AQ2 B;  4K6L A;  1JT8 A;  2DJF C;  4DUY L;  1XMQ L;  3SK8 A;  1SYE A;  1EQR A;  5EBD A;  2MO0 A;  2XN9 C;  4A3F G;  2J7Z A;  3PO3 B;  3ER0 A;  4DN4 M;  2RCN A;  4JBJ A;  4DR5 L;  3CHB D;  4LF4 Q;  1HFG A;  4A3D H;  2ASB A;  1AEX A;  4IUV A;  5JPN C;  4N9P A;  1ENC A;  1GD7 A;  2VB3 X;  3L7Z C;  5AFW A;  3E3X A;  2EYJ A;  4WJ4 A;  2VQF Q;  3KDF A;  3S15 H;  1HH2 P;  2OEO A;  1Z6H A;  2Z6K C;  4DNI A;  1WTW A;  2EYP A;  1VCI A;  1FJG Q;  3M7N A;  1TVX A;  5ELO A;  5C44 G;  3I8Z A;  3UE0 A;  3I2Z A;  1VMC A;  2KHI A;  1D1I A;  3A7A B;  1BBU A;  3J80 i;  1B7Y B;  1XPO A;  1J8I A;  4A3J H;  1YNN C;  2NVY B;  4PZ6 A;  3ITP A;  4KKU A;  5KRU A;  3C2P A;  4RH6 A;  1Y1V B;  3FHW A;  1QZG A;  1CHP D;  1H9K A;  3S17 B;  1XXG A;  1QCB D;  1CA6 A;  2F0H A;  4DU9 A;  2KCN A;  4LWC A;  4DKA C;  1DON A;  5C0X H;  4QUF A;  2RVL A;  4DR6 L;  3GV3 A;  4X65 Q;  4JOI C;  4IFD I;  1V8Q A;  3A74 A;  2K5V A;  2KED A;  5FLM G;  3U58 A;  1CA5 A;  1KC8 C;  2UXD L;  2VL6 A;  3GQB A;  3NP8 A;  4XDX A;  1QZH A;  2Z1C A;  4KHP Q;  1VQO A;  3HFZ B;  3BU2 A;  2MPM A;  5JEA J;  1I4R A;  2R92 G;  3UDG A;  1MJE A;  2F3I A;  4RGT A;  2OQK A;  5IGE A;  1Z7T A;  4B9X A;  3NTH A;  5BR8 L;  3D3R A;  2FIN B;  1SLJ A;  4DV5 L;  2SEB D;  3JC6 6;  3W2D A;  1RDP D;  1KRS A;  2XWB B;  2UUB L;  4NXM Q;  2G9D A;  1HUN A;  2VXW A;  2MGS A;  1EEF D;  2WAQ B;  5HUR A;  3M4Y A;  3ONA B;  3VYU A;  3R93 A;  2B2T C;  4DPG A;  4HCE A;  2Q8R E;  3CCQ A;  1BUV T;  1QB5 D;  1YIT A;  4CKE A;  1SAP A;  2NZ1 D;  1NCV A;  1EYD A;  1NAP A;  1W6J A;  2B2W A;  1LV9 A;  1U5K A;  2R7Z H;  4IPD A;  1G2S A;  1A6X A;  2AUJ D;  2H5X A;  4CDC C;  4BS9 A;  3V2T A;  1DM0 B;  1PH6 A;  4NKL A;  4ULL A;  4G7O C;  3S1M B;  3BZD B;  1EFW A;  3G48 A;  2NVQ H;  1FNW A;  4Y7N H;  3OTO Q;  2L1B A;  3H0G B;  5IGD A;  5CV8 A;  1F9P A;  3GD7 A;  5C0X I;  2F0G A;  1S5C D;  4NXN L;  5AJ3 Q;  1EIH A;  1L0X B;  3S24 A;  4BBS G;  5E1F A;  2BA0 A;  3S2H H;  4B3T L;  4QGU A;  5JJI A;  3TSS A;  5LL6 S;  1UE6 A;  3QIA A;  5I4D A;  1YJ9 A;  3U4V A;  1CQF A;  4Z9C B;  4L5R C;  5K5P A;  4BA2 I;  1I50 B;  1YHA A;  5LMN L;  1VMP A;  1JR0 D;  1YHQ A;  2BH2 A;  3STB D;  1IBL L;  5C3X A;  5I9P A;  2PQA B;  4RKB A;  1MI2 A;  4A3F B;  2RA4 A;  3NK9 A;  5J39 A;  2B2Y A;  2NZO A;  5LMU Q;  2OT2 A;  5I2X A;  3HOU G;  3D31 A;  3CC2 A;  3GDE A;  2A69 D;  4DA2 A;  3J7A 5;  4GS3 A;  4HTH A;  1D1K A;  2B3G A;  3KJP A;  1RL2 A;  5GAG C;  4V0B A;  2OQ0 A;  1P8L A;  3MFG A;  4ME3 A;  3MXN B;  5EPL A;  2EDG A;  1EYC A;  1KQS A;  1Y8N B;  2PNR C;  1JE4 A;  4LFA Q;  4HIO A;  4HN7 A;  3QB3 A;  4JI6 Q;  4F8M A;  4LF9 L;  2DY7 A;  4KHV A;  1U4P A;  1L1O C;  4Y52 H;  4C56 C;  2NVT H;  1SE3 A;  3FDT A;  1CKN B;  3HP3 A;  4OGQ C;  4BY7 H;  2JEB I;  1B8A A;  4LK1 C;  5E3F A;  3RMH A;  1JJ2 A;  1JE5 A;  5BN5 A;  3PCO B;  4DAM A;  1EU4 A;  4RCO A;  1LM0 A;  1Y14 B;  1O78 A;  1VQK A;  4G4K A;  3OW7 A;  1HHV A;  2CVR A;  3P1H A;  5KNB A;  3GTO B;  2CH4 W;  2O4X A;  1TS5 A;  2Z4H A;  1AP0 A;  5A35 A;  2R92 B;  2N49 A;  3H15 A;  3J7Y W;  1KAW A;  2B63 G;  2A6H D;  4F7X A;  3HGB A;  4CJ1 B;  4X62 L;  2UUA L;  3W3A A;  1GUT A;  4CDF C;  3CCV A;  1N33 Q;  1Y8O B;  3L3O C;  4ZCK A;  2HQL A;  1ASZ A;  5K36 H;  2K4K A;  2F0J A;  3DXJ C;  3A7L A;  1KHI A;  1S3O A;  3GTP B;  1V43 A;  2OTJ A;  3MWY W;  4H0L C;  1HRJ A;  1SJE D;  2E2H H;  4MHE A;  4CHT B;  1RJT A;  5JVG 3;  2QF7 A;  2JA5 G;  2NTS A;  5F2D A;  2E5L L;  3VA7 A;  5DM7 3;  1I3Q B;  1PFM A;  1XMO Q;  2X6L A;  4HMI A;  2UU9 L;  4JI2 Q;  2K33 A;  2HQE A;  1PH5 A;  2L12 A;  3CC7 A;  3K7U C;  1TWH B;  4GZY C;  3STB C;  4DV3 Q;  3MXG A;  2A68 C;  1VQJ A;  2EY1 A;  2JQO A;  2HT1 A;  3GTQ B;  4IFD G;  4XYO A;  1HA5 A;  2UXB L;  1B53 A;  3K8A A;  5FOB B;  1EWI A;  3NXW A;  3J81 i;  3LNN A;  4DFA A;  5LL6 X;  5C3W A;  1BVS A;  1RHP A;  5IYD H;  5JOB A;  4BBS B;  2F0N A;  1SEB D;  4HJ9 A;  4LF4 L;  4IJH A;  1SFO H;  4JI3 Q;  2A74 C;  5C4X H;  4LF5 L;  4I7Z C;  1Y1W B;  2D9U A;  3TS2 A;  2F0P A;  1EY5 A;  3KK7 A;  4G7H C;  4XQN A;  4LMQ D;  4O0A A;  2JEA I;  4K14 A;  5IE8 A;  4QMG A;  2BH8 A;  1Q86 C;  1FJG L;  1VDZ A;  1K0S A;  1SR3 A;  1LUZ A;  1F9Q A;  4EGV A;  4RAU C;  1X3Q A;  2CKZ B;  3I3C A;  1IBM Q;  2MUY A;  3ULP A;  1D5X C;  2AWO A;  4P72 A;  4AYB G;  2XWJ B;  4BY1 G;  1QVC A;  3WWV A;  3HOY G;  1G29 1;  2QDL A;  2NWG A;  1TWF B;  1HZ9 A;  1DJR D;  3U50 C;  2A6H C;  4F88 A;  2XGT A;  1G2T A;  4DK6 C;  5C0X G;  1K9M C;  1M8A A;  4KHP L;  1QUQ B;  3TRZ A;  4JI8 Q;  2A6E D;  1X54 A;  4TQU S;  1SMY D;  5FJ8 H;  3CCS A;  3Q0A A;  1H9J A;  4JVZ A;  1B2T A;  1K8M A;  2HIV A;  3JAM i;  3KJO A;  2J0T D;  1ENF A;  4DR6 Q;  4G57 A;  3RZO B;  4KTA A;  3T1Y L;  1FVI A;  1TXY A;  5E7N A;  2UXD Q;  3M7G A;  1PH4 A;  2F0U A;  2IHF A;  3PUX A;  4NXM L;  3S1Q H;  2B63 B;  3G6E A;  4HJ7 A;  1ILQ A;  2IX0 A;  3O13 A;  1ONL A;  3OSO A;  5ELN A;  2MP1 A;  2IY5 B;  1A2U A;  1SSO A;  4RHS A;  4XTC S;  3MZ5 A;  4HR7 B;  1J9O A;  5IP9 H;  3HRZ C;  5EAY A;  4DGZ A;  2V1C C;  4P73 A;  1B4O A;  2K05 A;  4R4O A;  1VQP A;  4DR1 Q;  4O1N A;  4B3S Q;  3NWT A;  2IPK D;  2EVB A;  2JE6 I;  5IP7 H;  2JA5 B;  1SYF A;  2L15 A;  2PQE A;  2QW7 A;  3MXU A;  3S1N H;  5KYI A;  3M4O B;  4DF7 A;  1XPR A;  3PMF A;  4HCS A;  3M4Q A;  2MQH A;  2L0C A;  2B29 A;  3IRB A;  5IGB A;  5DEH A;  4JI0 Q;  1EQQ A;  3OTO L;  2RBM A;  1LYL A;  1PTO B;  1PDQ A;  3AEV A;  2A73 B;  4C3H G;  5AJ3 L;  4KY7 A;  1XTC D;  2E2I B;  1JIC A;  1TWA H;  2KEE A;  4NP5 A;  2BOS A;  3I4M G;  4JCV E;  3TS0 A;  1S5B D;  4N8F A;  1LT4 D;  2PW5 A;  1H9S B;  5IYC H;  4X3S A;  4K5W A;  4KKT A;  3CCL A;  4QIW E;  1JOK A;  4Q0F A;  2EYF A;  4NXN Q;  1PH8 A;  4K8J A;  4CDD C;  1TWC B;  4NMZ A;  1Q3L A;  1IXR A;  4B3T Q;  1KLG D;  3NEM A;  4JBM A;  3OMC A;  3J80 c;  4XT3 B;  3DLL A;  2WII B;  1HNW Q;  1G91 A;  2G5D A;  5ELD A;  3PUY A;  2KVM A;  2A8V A;  2DNE A;  3A55 A;  1RD9 D;  3S15 B;  1YHB A;  1PH7 A;  4OO1 H;  2A6E C;  1HQM C;  2QEJ C;  4LFA L;  1K28 A;  4JI6 L;  1SMY C;  1C0A A;  3IL8 A;  4C1N I;  3Q23 A;  1PVO A;  1Q90 A;  2F0I A;  3I4O A;  1XNR Q;  1FNU A;  2R93 G;  4OL7 A;  3S16 H;  4QQB X;  3MXP A;  3S1R B;  4A93 H;  5GAD C;  2K52 A;  4BY7 G;  3HOY B;  1D7Q A;  2GVA A;  2VNU D;  3DM1 A;  5A2Q E;  4R4Q A;  4H7B A;  2E75 C;  3ERS X;  2LY7 A;  3FPP A;  4HJ5 A;  1W2B A;  5LHY 1;  5G3L D;  5C4H A;  1AW7 A;  4IPH A;  1LO5 D;  2X69 A;  1KAA A;  3AYH B;  3MTS A;  1PFB A;  3W1B A;  1ESF A;  2R6G A;  5JEA H;  1I94 L;  2K28 A;  1R9T H;  2NYZ D;  1DOK A;  1K8G A;  1CKO A;  3E0J A;  1IL2 A;  1LTS D;  1SDF A;  2JA7 H;  1ZEQ X;  5J22 A;  3F8T A;  2PQA A;  4LNQ A;  3HOZ H;  1IYV A;  1N33 L;  2ES2 A;  1UWV A;  1LTR D;  3KFU A;  4OWX B;  3EBE A;  3VYS A;  5DNF A;  3T53 B;  2CW0 C;  1K8A C;  2EJG C;  4JBW A;  4RHR A;  3F2D A;  5EGT A;  2KQ3 A;  4C1N K;  4C3I H;  1UEA B;  4A3G H;  1XMO L;  3TME A;  1SBB B;  3MXN A;  4LFC Q;  3DUZ A;  1DGS A;  3FRP B;  4OO1 I;  4LUV A;  2I5M X;  4JI2 L;  2WB1 G;  4BBR H;  1X9N A;  2F3W A;  1QVF A;  3ULJ A;  2KUM A;  2RDH A;  4NB3 A;  5C4J H;  4GKK Q;  3F2B A;  1HUM A;  2EZV A;  1F2M A;  1GUS A;  3GTL B;  1SNM A;  3SXH A;  2H1E A;  2PPB C;  1STB A;  1EU3 A;  2KEC A;  2F4I A;  2VUM H;  4YWL A;  4KI0 A;  1SN8 A;  4DV1 Q;  4IUN A;  4KV6 A;  3OWF A;  1YNJ D;  2MNA A;  3AFP A;  2AWN A;  2KA7 A;  1PH1 A;  3PSI A;  2PW7 A;  4Y7N B;  4C3H B;  2B2V A;  5HGT A;  2F0Q A;  3K7A B;  4DNR B;  1K3B C;  2I5H A;  3Q22 A;  1PTO F;  1IYJ B;  4L5T A;  3I4M B;  3GO5 A;  4JI3 L;  3AB9 A;  1EY4 A;  1HA6 A;  1AE2 A;  1TY2 A;  4LAA A;  2GA4 B;  1O7Y A;  5FLX c;  1VQ9 A;  3SK4 A;  3Q24 A;  1MGS A;  4KHZ A;  1BCP B;  1STY A;  4LF5 Q;  4KN4 C;  2K04 A;  5M3M H;  3ULL A;  1IBM L;  3E0E A;  4GN5 A;  2XSC A;  4OXP A;  1BO0 A;  1CSQ A;  2LXK A;  3HKZ E;  1UEB A;  2OTL A;  2EYH A;  4A3E G;  4A3M G;  1KDA A;  4A76 A;  3RR5 A;  3GTJ H;  1W3S A;  4G7Z C;  4N8X 1;  4GNX C;  5EBC A;  2R93 B;  2VB2 X;  1VQG A;  3CPF A;  2QIL A;  1RCV D;  4PZ8 A;  4BY7 B;  1EIG A;  2RCF A;  4JI8 L;  4ZUI A;  2CQA A;  2F4V Q;  3LX0 A;  2L4N A;  2WAC A;  2CQO A;  5M5Y H;  2B2U A;  1EUJ A;  1ZXT A;  3DEP A;  5EQ0 A;  1XYI A;  2WKC A;  1GUN A;  4IUT A;  4KLK A;  4KD3 A;  4OX9 Q;  1STA A;  2SOB A;  1STG A;  5A2Q L;  5JJK A;  2I46 A;  2RKS A;  3I56 A;  2K5W A;  3VR5 A;  1ZYR D;  3PF5 A;  1VQD A;  3CRK C;  1TKW B;  3RLF A;  1NR2 A;  5J1Z A;  4R4I A;  1D8L A;  5M5W H;  1WTQ A;  1L1O A;  3T1Y Q;  1N32 Q;  1CM9 A;  4H44 C;  1KNA A;  4YCV A;  4GOP C;  3OW2 A;  5EPJ A;  3CCM A;  4UP7 A;  5IP9 G;  3S2D H;  2V4D A;  1FD7 D;  1T9H A;  3KLS A;  5ELE A;  2D62 A;  5D3D A;  1CI3 M;  1YNJ C;  3T51 B;  4DR1 L;  3UI2 A;  3PIP 3;  4B3S L;  5CV6 A;  2E2H B;  1OO9 B;  2F1M A;  1T5E A;  3X3M A;  3K59 A;  1NMF A;  5IP7 G;  2GN5 A;  1G6Z A;  2CCZ A;  5E4X A;  2KOL A;  3KUP A;  1XNQ Q;  3D0F A;  2WB1 B;  3J81 c;  3CXC A;  1KL9 A;  4JI0 L;  2FMM A;  5HY6 A;  1EQT A;  4QJF A;  5EPK A;  5NUC A;  1LTB D;  1BNZ A;  4B9W A;  3HOV H;  4FXD A;  3HOX H;  1VS0 A;  1F2L A;  2K5Q A;  4ID6 A;  3E5S A;  2K75 A;  2SNM A;  1MKH A;  1QUQ A;  3BS1 A;  1I4H A;  3S14 H;  3BDC A;  3R2T A;  1AH9 A;  1IKL A;  3K5N A;  5FO8 B;  4JI7 Q;  4O42 A;  4X66 L;  4FDB A;  3CAM A;  1KD1 C;  5IYC G;  4B08 A;  1EQV A;  1Q46 A;  1RF2 D;  2QDB A;  3NPP A;  3I4N H;  2HHH Q;  5M3F G;  1SNC A;  3DMU A;  1HNW L;  4RMF A;  5GQO A;  1Y1W G;  3SGI A;  4UDU C;  2A68 D;  1E2Z A;  1J5E Q;  1V1O A;  1O7L A;  3M3Y B;  5DAU A;  3CPW A;  1X56 A;  1B50 A;  3J7A F;  4IFD J;  3CQZ H;  3BYY B;  1JMC A;  1GO3 E;  3Q6S A;  4R8N A;  4IPC A;  2B8F A;  1IBK L;  1QOH A;  4ZRZ A;  1R4P B;  1XNR L;  1BCP F;  1PLF A;  3F1Z A;  1BBX C;  1STN A;  1RTN A;  5IGG A;  1YIJ A;  4A3E B;  4A3M B;  1A3U A;  3JAM c;  1ET6 A;  1PRT D;  1ZYR C;  4K5X A;  1ILP A;  2EY6 A;  1JJG A;  3AFQ A;  1JWU D;  3AU7 A;  2L11 A;  4J8Q A;  1IW7 D;  3BVZ A;  1EEI D;  2F0S A;  3F2C A;  3NTK A;  1S40 A;  3QJY A;  4PNY A;  1S5F D;  4UP8 A;  3ICE A;  3EN2 A;  4JV5 Q;  4QUC A;  1H9S A;  3WOF A;  1FR3 A;  2JA7 G;  1SNP A;  3VR4 A;  4CJ2 C;  4EVO A;  2BE5 D;  2FHT A;  1PH3 A;  1Q12 A;  1Y1V H;  2Z9H A;  2OWO A;  3V96 A;  1I94 Q;  3L2P A;  3TZU A;  1NBW A;  1WD1 A;  3DM3 A;  5IT9 c;  2NVX H;  3J81 j;  1A3V A;  1Q1E A;  2I07 B;  4GKJ Q;  1W6K A;  1SJH D;  3BDL A;  2EXZ A;  1U4R A;  3S1Q B;  1FL0 A;  1U0L A;  1DD2 A;  1T5X D;  4C3I G;  1CK1 A;  4LFC L;  3HEJ A;  2VS1 A;  2JXM B;  3B6Y A;  1JOR A;  1PYB A;  4TSS A;  1PZJ D;  4IUP A;  4A3B H;  1HR0 Q;  3G6J B;  2N78 A;  4BBR G;  4DV6 Q;  1V1P B;  1UAP A;  2B2W C;  1C9O A;  3K6O A;  3J80 E;  4GKK L;  1WTO A;  4DAY A;  3LWU A;  3EFX D;  4DV4 Q;  4IO9 A;  1OXU A;  4JI1 Q;  4A3I G;  1QG7 A;  1KRT A;  1C8C A;  1GVP A;  3RLO A;  1EY7 A;  1ZKO A;  3HZX A;  4IOC A;  1K3R A;  4DV1 L;  2Q2U A;  4FXG C;  2VUM G;  4XYQ A;  2QCP X;  3TN2 A;  1HNX L;  3PUW A;  2QGQ A;  3IAY A;  1LT5 D;  2CWP A;  2RHQ B;  2LFN A;  4YY3 Q;  1WCM G;  3KLS X;  2XNA C;  5GAH C;  3A56 A;  3C3L A;  2AMC B;  2ZXO A;  2Z6B A;  4R9W A;  3VR3 A;  1OXV A;  4R4C A;  1GJX A;  3ND8 A;  2QKI C;  2NTT A;  1EWC A;  1E2W A;  1YJW A;  2PMZ B;  3ZJY C;  2B2Y C;  4DV7 L;  3BYT B;  1XWE A;  2F0T A;  1PMR A;  1BF4 A;  4IQZ A;  4RCN A;  4IUU A;  4S3S A;  1N34 Q;  1UUP A;  1PRT C;  5M3F B;  3S1M H;  5CV4 A;  1MD2 D;  4OON A;  4A3D G;  1GOZ A;  2ALY B;  2EY5 A;  2E74 C;  3A0J A;  3BVM A;  3H0G H;  1I6H H;  4X3U A;  2EJF C;  1VQ4 A;  2WFW A; 
#chains in the Genus database with same CATH homology
 2R61 A;  2E2J B;  5C5L A;  5M5X B;  1XX8 A;  1IW7 C;  2WKD A;  3C46 A;  4OIK A;  2PZW A;  3D8G A;  1DOL A;  5FKA C;  1QWY A;  2Q8I B;  2BE5 C;  1B1Z A;  1LLR D;  3S16 B;  1BR9 A;  1JQY D;  1PYW D;  3GV6 A;  1F77 A;  3TBI B;  2IT1 A;  5CV9 A;  1Y8P B;  2F0E A;  4L6T B;  4FF4 A;  1ICW A;  2KJX A;  3MHB A;  3DHQ A;  1S4Z A;  3TP6 A;  2JA7 B;  3NBI A;  1D5M C;  1GHJ A;  1HPC A;  4RWS C;  3HG9 A;  3IFT A;  4OHJ A;  1TY0 A;  3KBG A;  4BWG B;  2TSS A;  2RDG A;  2R3Z A;  3D6C A;  1SXT A;  5JPM C;  4C3I B;  1FNV A;  3L9A X;  4RKL A;  3PV0 A;  5FLX E;  4FF2 A;  2K1B A;  1OXS C;  4BBR B;  4UAI A;  3F2U A;  3E6Z X;  1IL8 A;  1HTP A;  4FVM A;  3I73 A;  1CTM A;  4A3I B;  2E2D C;  1QE6 A;  1DOM A;  1AZQ A;  1Y69 U;  3J80 L;  5C6A A;  2CW0 D;  2VUM B;  5FO9 B;  4N9T A;  1O7Z A;  2PCF B;  5T1I A;  4MIU A;  1WCM B;  2HDM A;  4FO2 A;  1HXY D;  3D6W A;  5C4Z A;  1VF5 C;  3SK5 A;  1F2Y A;  3H09 A;  4V19 0;  2F0V A;  1O80 A;  1STE A;  1PXU A;  4HSV A;  4A3D B;  2M00 A;  1B44 D;  2F0K A;  4CKC A;  4DXF A;  1SE2 A;  2MJ8 A;  5ELB A;  1WD0 A;  4OIJ A;  1PZK D;  2RSN A;  2L5T A;  4F87 A;  1GHK A;  4NW2 A;  1WTV A;  2Y0S B;  3N52 A;  4FP5 D;  1IHZ A;  2RSO A;  3GTJ B;  1Q1B A;  2Q8T A;  3SDZ A;  3K58 A;  2NB0 A;  4A3J B;  2IX1 A;  4FF3 A;  4NDX A;  1SYG A;  1TII D;  3PIO 3;  3OOC A;  3J81 E;  5M5Y B;  1E2V A;  2XIW A;  2IX3 A;  3QO2 A;  3MAQ A;  2EE1 A;  3VYT A;  5CBA E;  2OXP A;  5DM6 3;  2NN6 H;  2ZXR A;  1HFN A;  3QOL A;  5COR A;  5FK9 C;  3K57 A;  4HMJ A;  5I6W A;  3NUC A;  1I4Q A;  1II3 A;  3OIP A;  4CJ0 B;  5K36 G;  3S2D B;  2A5H A;  4WRD A;  1Q8I A;  3I91 A;  1EY8 A;  1KNE A;  1LAC A;  2EYO A;  1FGB D;  1U4L A;  5JVH 3;  5EKK A;  2K5D A;  5KNC A;  5I6Y A;  2ENB A;  1ET9 A;  1A2T A;  1STH A;  5C5M A;  4K2L A;  3FVQ A;  3D4R A;  2PO4 A;  3H3V C;  5FLX L;  4DAV A;  2R7Z B;  1DYQ A;  2ICE C;  5E4W C;  4Q5V A;  3S14 B;  5IGC A;  5IGF A;  5CV5 A;  2NVQ B;  3JAM E;  3T4A C;  3S2H B;  3ND9 A;  2HDL A;  4ME5 A;  2B2T A;  1R4Q B;  2PZU A;  3MFY A;  4HSP A;  3I4N B;  2NN6 I;  1GUW A;  1I6V C;  4FF1 A;  4PMB A;  4CKB A;  4IFD H;  4EQN A;  1FYC A;  1V1P A;  3U9S A;  2DY8 A;  5KEE A;  4WOR A;  1OXX K;  2C9O A;  5IT9 E;  3DWP A;  3KBX A;  3BVG A;  1C4Q A;  3R2I A;  4ILW A;  2B39 A;  3D4D A;  3IKJ A;  3K5O A;  2D5D A;  3NHH A;  5D14 A;  2NBF A;  3A8K E;  2FMC A;  3VYR A;  1TS3 A;  2NVT B;  1JB3 A;  2F03 A;  4FNF A;  4DNT B;  4WJW A;  1QIL A;  1EOT A;  3NWS A;  2F0D A;  2L55 A;  3RD4 A;  5EKI A;  3CKI B;  1Z47 A;  1GUG A;  3T16 A;  3DEO A;  1KAB A;  4EQO A;  2BCO A;  3H91 A;  1L0Y B;  3EQL C;  5D65 A;  3J81 L;  4ABN A;  1SYB A;  2ID0 A;  2F0F A;  2NVX B;  2IW3 A;  3S9W A;  1RTO A;  1IYU A;  3A54 A;  4K2K A;  1E0B A;  1F9R A;  3A8J E;  2LKV A;  4X3K A;  4JK1 C;  1ENA A;  4A3B B;  2AUK A;  1WTR A;  2F0L A;  4TKO B;  2K03 A;  2EY2 A;  1K8O A;  1TQO A;  2OF1 A;  3URY A;  1BDO A;  1D2B A;  3HKZ B;  4RFB A;  4C3J G;  1LTI D;  1TR5 A;  2B2V C;  3CRL C;  2JSO A;  1M4V A;  3PUV A;  3OHX C;  4M1U B;  2DNC A;  4BA1 I;  3T13 A;  2JP1 A;  1CZG A;  3WDN A;  5EKL A;  2E76 C;  1LAB A;  3JAM L;  1SFO B;  5C4X B;  4MN3 A;  2BDO A;  1I6H B;  3NTI A;  4A3K B;  2CHB D;  1JWM D;  4ZAI A;  4FYD A;  3H94 A;  1CQV A;  4IAL A;  2DN8 A;  5ELF A;  2B8G A;  4OO1 G;  3TP7 A;  4CGY B;  4KKS A;  1B3A A;  3SK6 A;  2IL8 A;  1SYD A;  3SVM A;  3OIQ A;  3EA6 A;  3A8I E;  2F3V A;  2SNS A;  2XVS A;  3QWN A;  1UNS A;  1NR4 A;  2B2U C;  3K5M A;  5IT9 L;  4ZK9 B;  3HS0 C;  4KN7 C;  4H13 C;  1ESR A;  2BA1 A;  5CC4 A;  1QJO A;  5T1G A;  2WV6 D;  3I72 A;  5C44 B;  5JEA G;  4C2M B;  1OXT A;  1PTO D;  5CBE E;  2IWH A;  4XT1 B;  4FXK C;  2NN6 G;  1AZP A;  3K0Y A;  5D3I B;  4X3T A;  2HUG A;  4L8J A;  2HCI A;  3TDQ A;  4KMU C;  3K5L A;  1B9N A;  1S5E D;  4P2C B;  5I2Y A;  3NQI A;  1RKN A;  2XRQ D;  5COY A;  1PFN A;  1U9R A;  5FO7 B;  1CFM A;  4PMW A;  3MVV A;  5C0X J;  2K32 A;  1TT2 A;  2MHV A;  2RDF A;  2ZXP A;  3P20 A;  1GXD C;  3NSW A;  2K01 A;  2M2L A;  4RGO S;  2EPB A;  4KK7 A;  1AFP A;  5JJZ A;  5IOD A;  1BOS A;  2HCC A;  1LTA D;  3S1N B;  1EZ6 A;  5TSS A;  3I70 A;  4C3J B;  3GTM B;  3LWE A;  4HAE A;  4KD4 A;  3VA5 A;  2F0M A;  3P7J A;  4XIG S;  4L63 B;  1F9S A;  2JA8 B;  1TWA B;  3I4L A;  4ODG A;  4CBV A;  1WTP A;  1DXM A;  1JC7 A;  2SDF A;  1TS2 A;  3U9O A;  3TP5 A;  3C1F A;  2EYL A;  2WP8 J;  4DAP A;  4QCL A;  4PMC A;  4K8I A;  3HOW B;  4ZKC B;  1JOQ A;  2WIN B;  1PZI D;  5G3L F;  2ICI A;  1MBY A;  2D2C C;  2O2L D;  2LMC B;  2A69 C;  3PO2 B;  4M8A A;  4PQX A;  3RZD B;  4WFN 3;  3FPU B;  2RQX A;  2TMP A;  4K6D A;  4IUQ A;  2YU9 B;  3KF8 A;  2O5J C;  1AN8 A;  1MSG A;  1NSN S;  1PTO C;  1S5D D;  2YYZ A;  3BDO A;  1JCK B;  3MA2 B;  4KJN A;  1G8Z D;  3WOE A;  4RGM A;  4ZLT F;  2O5I C;  1SE4 A;  4YIJ A;  2Z8L A;  4A93 B;  1A15 A;  1U4M A;  1TS4 A;  1NUC A;  2Z4I A;  2LS0 1;  3HOU B;  2F0W A;  1SYC A;  1K83 B;  1SNQ A;  4IUR A;  5KIX A;  3SEB A;  1VF7 A;  2K7V A;  5JAV A;  1R9T B;  5KND A;  3EJI A;  3ZYY X;  4QB4 A;  3MC0 B;  3TZD A;  3HOZ B;  1D6E C;  2H4O A;  1I4X A;  3VR6 A;  3OMG A;  4RA8 A;  1EWH A;  4HED A;  1JWS D;  3R8B A;  5I9O A;  2AQ3 B;  1EY6 A;  2KHS A;  4A3G B;  1HTL D;  3M85 A;  1BCP D;  2N88 A;  3N6R A;  4ZUJ A;  4XQQ A;  1CZW A;  4ZYS A;  1B9M A;  3SHL A;  5C4J B;  1SND A;  3KLR A;  3X3N A;  1BXT A;  4DXG A;  3VR2 A;  4KY5 A;  4EQP A;  1IKM A;  4DK1 A;  4U67 3;  1SNO A;  2AQ1 B;  1KTK A;  2G9H D;  4IZ8 A;  3NE5 B;  1DZ1 A;  3V05 A;  1PRT B;  1X32 A;  1WTX A;  3IFD A;  2F0O A;  2M9V A;  2NUC A;  3BG3 A;  4IN3 A;  4PV1 C;  5KYL A;  5CYU A;  5ELC A;  2EJM A;  3SE0 A;  5IIF A;  4I65 A;  1A3T A;  1DCZ A;  2X6G A;  3NBH A;  3OPO A;  2PYK A;  1KDC A;  1MSH A;  2JA6 B;  3FKI B;  1I4P A;  3C1E A;  5M3M B;  3RUZ A;  4DK0 A;  2XRS D;  3SR1 A;  1LTT D;  4ZQ3 A;  5M9O A;  1LT3 D;  3OWE B;  4XQJ A;  1ROD A;  3G7L A;  2PZT A;  3AMU A;  3J7A V;  2C5C A;  1H9R A;  1C48 A;  4U68 A;  2FJ2 A;  1HQR D;  4J6H A;  1QNU A;  5CV7 A;  4LJZ C;  1QNK A;  1HCZ A;  3ERQ A;  4J1M A;  4R8I A;  1I4G A;  3GTG B;  3DWQ A;  3PUZ A;  5ISR A;  1ML0 D;  4K5V A;  4KY6 A;  4AYB B;  3D4W A;  3I90 A;  4BY1 B;  1BCP C;  1LTG D;  1KLU D;  2FFK B;  1EYA A;  1BQQ T;  2J4X A;  2ZT9 C;  5CGK A;  1D5Z C;  5M5W B;  3P75 A;  4QIW B;  3CU7 A;  1EL0 A;  1JOO A;  1GUO A;  2N55 A;  2IJ0 A;  4TRD A;  5BN4 A;  3QOJ A;  5BN3 A;  1CHQ D;  1CT1 D;  1YNN D;  4RGN A;  2EOT A;  3H6M A;  3GP7 A;  4QF4 A;  1X3P A;  1TWG B;  3EVQ A;  3FEW X;  3HOV B;  3HOX B;  3TP8 A;  2JYO A;  2EYM A;  1KDB A;  1F2Z A;  1H9M A;  5IOC A;  1EZ8 A;  3R3O A;  2L9H A;  5CMD A;  4KJO A;  3DWA A;  1WVL A;  1PRT F;  3ERO A;  4XXE A;  5C3E B;  2KCC A;  5KGU A;  1EY0 A;  1EY9 A;  2K6A A;  4E6I A;  4ZKB B;  3GTK B;  1LT6 D;  5CR3 A;  1PTO H;  3T56 B;  5EJW A;  3FMC A;  2BDN A;  3MEH A;  1TU2 B;  3QG1 A;  3CQZ B;  3NQT A;  1EFI D;  2AQ2 B;  4K6L A;  3SK8 A;  1SYE A;  5EBD A;  2XN9 C;  2J7Z A;  3PO3 B;  4DN4 M;  3CHB D;  1HFG A;  1AEX A;  4IUV A;  5JPN C;  4N9P A;  1ENC A;  2VB3 X;  3L7Z C;  5AFW A;  2EYJ A;  2OEO A;  1Z6H A;  1WTW A;  2EYP A;  1VCI A;  3M7N A;  1TVX A;  3I8Z A;  1VMC A;  1D1I A;  3A7A B;  1J8I A;  1YNN C;  2NVY B;  3ITP A;  4KKU A;  5KRU A;  3C2P A;  4RH6 A;  1Y1V B;  1CHP D;  1H9K A;  3S17 B;  1XXG A;  1QCB D;  1CA6 A;  2F0H A;  4DU9 A;  2KCN A;  1DON A;  5C0X H;  4QUF A;  2RVL A;  3GV3 A;  4IFD I;  1V8Q A;  2KED A;  1CA5 A;  3GQB A;  3NP8 A;  4XDX A;  2Z1C A;  2MPM A;  5JEA J;  1I4R A;  4RGT A;  5IGE A;  1Z7T A;  4B9X A;  3NTH A;  3D3R A;  2FIN B;  2SEB D;  3W2D A;  1RDP D;  2XWB B;  2G9D A;  1HUN A;  2VXW A;  2MGS A;  1EEF D;  2WAQ B;  5HUR A;  3M4Y A;  3ONA B;  3VYU A;  3R93 A;  2B2T C;  4HCE A;  2Q8R E;  1BUV T;  1QB5 D;  4CKE A;  1SAP A;  2NZ1 D;  1NCV A;  1EYD A;  1NAP A;  1W6J A;  2B2W A;  1LV9 A;  1A6X A;  1G2S A;  2AUJ D;  4BS9 A;  3V2T A;  1DM0 B;  4NKL A;  4ULL A;  4G7O C;  3S1M B;  3BZD B;  1FNW A;  2L1B A;  3H0G B;  5IGD A;  5CV8 A;  1F9P A;  3GD7 A;  5C0X I;  2F0G A;  1S5C D;  1EIH A;  1L0X B;  5E1F A;  2BA0 A;  3TSS A;  5LL6 S;  3QIA A;  5I4D A;  1CQF A;  4Z9C B;  5K5P A;  4BA2 I;  1I50 B;  1VMP A;  1JR0 D;  5C3X A;  5I9P A;  4RKB A;  4A3F B;  1MI2 A;  2RA4 A;  3NK9 A;  5J39 A;  2B2Y A;  2OT2 A;  5I2X A;  3D31 A;  2A69 D;  4DA2 A;  4HTH A;  1D1K A;  4V0B A;  3MFG A;  5EPL A;  2EDG A;  1EYC A;  1Y8N B;  2PNR C;  1JE4 A;  4HN7 A;  3QB3 A;  4F8M A;  2DY7 A;  4KHV A;  1U4P A;  4C56 C;  1SE3 A;  3FDT A;  3HP3 A;  4OGQ C;  2JEB I;  3RMH A;  4LK1 C;  5E3F A;  5BN5 A;  1EU4 A;  4RCO A;  1O78 A;  4G4K A;  3OW7 A;  1HHV A;  2CVR A;  3P1H A;  5KNB A;  3GTO B;  2O4X A;  2Z4H A;  1TS5 A;  1AP0 A;  5A35 A;  2R92 B;  3J7Y W;  2A6H D;  4F7X A;  3HGB A;  4CJ1 B;  3W3A A;  1GUT A;  1Y8O B;  3L3O C;  5K36 H;  3DXJ C;  2F0J A;  3A7L A;  3GTP B;  1V43 A;  3MWY W;  4H0L C;  1HRJ A;  1SJE D;  4MHE A;  4CHT B;  1RJT A;  5JVG 3;  2QF7 A;  2NTS A;  5F2D A;  3VA7 A;  5DM7 3;  1I3Q B;  1PFM A;  2X6L A;  4HMI A;  2K33 A;  2HQE A;  2L12 A;  4GZY C;  1TWH B;  3MXG A;  2A68 C;  2EY1 A;  3GTQ B;  4IFD G;  4XYO A;  1HA5 A;  1B53 A;  5FOB B;  3NXW A;  3LNN A;  4DFA A;  5LL6 X;  5C3W A;  1RHP A;  5JOB A;  4BBS B;  2F0N A;  1SEB D;  2A74 C;  4I7Z C;  1Y1W B;  2D9U A;  2F0P A;  1EY5 A;  3KK7 A;  4G7H C;  4XQN A;  4LMQ D;  2JEA I;  4K14 A;  4QMG A;  1VDZ A;  1F9Q A;  4EGV A;  4RAU C;  1X3Q A;  3I3C A;  2MUY A;  1D5X C;  2AWO A;  2XWJ B;  1G29 1;  2NWG A;  1TWF B;  1DJR D;  2A6H C;  4F88 A;  1G2T A;  5C0X G;  1M8A A;  2A6E D;  4TQU S;  1SMY D;  3Q0A A;  1H9J A;  1B2T A;  1K8M A;  2J0T D;  1ENF A;  4G57 A;  3RZO B;  4KTA A;  3M7G A;  2F0U A;  3PUX A;  2B63 B;  1ILQ A;  2IX0 A;  3O13 A;  1ONL A;  3OSO A;  2MP1 A;  1A2U A;  1SSO A;  4RHS A;  4XTC S;  3MZ5 A;  4HR7 B;  1J9O A;  3HRZ C;  4DGZ A;  1B4O A;  2K05 A;  4O1N A;  3NWT A;  2IPK D;  2EVB A;  2JE6 I;  2JA5 B;  1SYF A;  2PQE A;  3MXU A;  5KYI A;  3M4O B;  4DF7 A;  3PMF A;  4HCS A;  2L0C A;  5IGB A;  5DEH A;  2RBM A;  1PTO B;  1PDQ A;  2A73 B;  4C3H G;  4KY7 A;  1XTC D;  2E2I B;  1JIC A;  2KEE A;  4NP5 A;  2BOS A;  1S5B D;  1LT4 D;  2PW5 A;  1H9S B;  4X3S A;  4K5W A;  4KKT A;  1JOK A;  4Q0F A;  2EYF A;  4K8J A;  1TWC B;  4NMZ A;  1Q3L A;  1KLG D;  3OMC A;  4XT3 B;  2WII B;  1G91 A;  5ELD A;  3PUY A;  2KVM A;  2DNE A;  3A55 A;  1RD9 D;  3S15 B;  4OO1 H;  2A6E C;  1HQM C;  2QEJ C;  1SMY C;  3IL8 A;  4C1N I;  3Q23 A;  1Q90 A;  2F0I A;  1FNU A;  4OL7 A;  3MXP A;  3S1R B;  3HOY B;  2VNU D;  3DM1 A;  5A2Q E;  4H7B A;  2E75 C;  2LY7 A;  3FPP A;  5LHY 1;  5G3L D;  5C4H A;  1AW7 A;  1LO5 D;  2X69 A;  1KAA A;  3MTS A;  1PFB A;  1ESF A;  2R6G A;  5JEA H;  2K28 A;  2NYZ D;  1DOK A;  3E0J A;  1LTS D;  1SDF A;  1ZEQ X;  5J22 A;  1IYV A;  1LTR D;  3VYS A;  5DNF A;  3T53 B;  2CW0 C;  2EJG C;  4JBW A;  4RHR A;  5EGT A;  2KQ3 A;  4C1N K;  1UEA B;  3TME A;  1SBB B;  3MXN A;  3DUZ A;  3FRP B;  4OO1 I;  2F3W A;  2KUM A;  2RDH A;  1HUM A;  2EZV A;  1F2M A;  1GUS A;  3GTL B;  1SNM A;  3SXH A;  2H1E A;  2PPB C;  1STB A;  1EU3 A;  2KEC A;  2F4I A;  4KI0 A;  4IUN A;  4KV6 A;  3OWF A;  1YNJ D;  2AWN A;  2KA7 A;  2PW7 A;  4Y7N B;  4C3H B;  2B2V A;  5HGT A;  2F0Q A;  3K7A B;  4DNR B;  3Q22 A;  1PTO F;  3I4M B;  3GO5 A;  3AB9 A;  1EY4 A;  1HA6 A;  1TY2 A;  4LAA A;  2GA4 B;  1O7Y A;  3SK4 A;  3Q24 A;  1MGS A;  4KHZ A;  1BCP B;  1STY A;  4KN4 C;  2K04 A;  2XSC A;  1BO0 A;  2EYH A;  1KDA A;  4G7Z C;  5EBC A;  2R93 B;  2VB2 X;  2QIL A;  1RCV D;  4BY7 B;  1EIG A;  4ZUI A;  2CQA A;  3LX0 A;  2L4N A;  2WAC A;  2B2U A;  1ZXT A;  3DEP A;  5EQ0 A;  1XYI A;  2WKC A;  1GUN A;  4IUT A;  4KD3 A;  1STA A;  2SOB A;  1STG A;  5A2Q L;  2I46 A;  2RKS A;  2K5W A;  3VR5 A;  1ZYR D;  3CRK C;  1TKW B;  3RLF A;  1NR2 A;  5J1Z A;  1WTQ A;  1CM9 A;  4H44 C;  1KNA A;  5EPJ A;  2V4D A;  1FD7 D;  5ELE A;  3KLS A;  2D62 A;  5D3D A;  1CI3 M;  1YNJ C;  3T51 B;  3UI2 A;  3PIP 3;  5CV6 A;  2E2H B;  1OO9 B;  2F1M A;  1T5E A;  3X3M A;  3K59 A;  1G6Z A;  5E4X A;  2KOL A;  3KUP A;  2WB1 B;  2FMM A;  1EQT A;  5EPK A;  5NUC A;  1LTB D;  1BNZ A;  4B9W A;  4FXD A;  1F2L A;  2K5Q A;  4ID6 A;  3E5S A;  2SNM A;  3BS1 A;  1I4H A;  3BDC A;  3R2T A;  1IKL A;  3K5N A;  5FO8 B;  4O42 A;  4B08 A;  1EQV A;  1RF2 D;  2QDB A;  3NPP A;  1SNC A;  3DMU A;  4UDU C;  2A68 D;  1E2Z A;  1V1O A;  1O7L A;  3M3Y B;  5DAU A;  1B50 A;  3J7A F;  4IFD J;  3BYY B;  3Q6S A;  4R8N A;  2B8F A;  1QOH A;  4ZRZ A;  1R4P B;  1BCP F;  1PLF A;  1BBX C;  1STN A;  1RTN A;  5IGG A;  4A3E B;  4A3M B;  1A3U A;  1ET6 A;  1PRT D;  1ZYR C;  4K5X A;  1ILP A;  2EY6 A;  1JWU D;  3AU7 A;  2L11 A;  4J8Q A;  1IW7 D;  3BVZ A;  1EEI D;  2F0S A;  3NTK A;  3QJY A;  4PNY A;  1S5F D;  4QUC A;  1H9S A;  3WOF A;  1FR3 A;  1SNP A;  3VR4 A;  4CJ2 C;  4EVO A;  2BE5 D;  2FHT A;  1Q12 A;  3V96 A;  3TZU A;  1WD1 A;  1A3V A;  1Q1E A;  2I07 B;  1W6K A;  1SJH D;  3BDL A;  2EXZ A;  1U4R A;  3S1Q B;  1DD2 A;  1T5X D;  4C3I G;  1CK1 A;  3HEJ A;  2JXM B;  1JOR A;  4TSS A;  1PZJ D;  4IUP A;  3G6J B;  1V1P B;  1UAP A;  2B2W C;  3K6O A;  3J80 E;  1WTO A;  4DAY A;  3LWU A;  3EFX D;  1OXU A;  1QG7 A;  1C8C A;  1EY7 A;  1ZKO A;  3HZX A;  4FXG C;  4XYQ A;  2QCP X;  3TN2 A;  3PUW A;  3IAY A;  1LT5 D;  2LFN A;  3KLS X;  2XNA C;  3C3L A;  3A56 A;  2ZXO A;  4R9W A;  3VR3 A;  1OXV A;  1GJX A;  3ND8 A;  2QKI C;  2NTT A;  1EWC A;  1E2W A;  2PMZ B;  2B2Y C;  3BYT B;  1XWE A;  2F0T A;  1PMR A;  1BF4 A;  4IQZ A;  4RCN A;  4IUU A;  4S3S A;  1UUP A;  1PRT C;  5M3F B;  5CV4 A;  1MD2 D;  1GOZ A;  2EY5 A;  3BVM A;  2E74 C;  4X3U A;  2EJF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...