5CR3A

Crystal structure of staphylococcal nuclease variant delta+phs v104e/l125e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIAAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLERKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V104E/L125E at cryogenic temperature
rcsb
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cr3A00
1EYDA 2F0FA 3QB3A 4RKLA 1JOOA 3SHLA 3TMEA 5IGFA 4K14A 1JORA 3EJIA 2M00A 4NP5A 1A2TA 1EY4A 4K5VA 4KJOA 4ZUIA 3T13A 5KYIA 2EYLA 4K6DA 1KDCA 4PNYA 2EXZA 5IOCA 5I6WA 3QOJA 4S3SA 1EY5A 3D6CA 3MZ5A 2KQ3A 3NHHA 4N9PA 1EQVA 1F2YA 2NUCA 3ITPA 4YIJA 2KHSA 4EQNA 3HZXA 4B9XA 3MXPA 1ENCA 1A3UA 2PZUA 4OL7A 4TRDA 5EKKA 3SK6A 1JOQA 1EY9A 2F3VA 1EZ8A 2WACA 2EYJA 2F0LA 1KAAA 5DEHA 5J22A 5KIXA 1NSNS 4NKLA 5I6YA 2F0GA 4IUNA 2F0SA 1EY0A 1EY7A 1KDBA 1STNA 2RDFA 3OWFA 4NDXA 3SR1A 5ISRA 5IIFA 2F0KA 1NUCA 3TP7A 2PYKA 5I9OA 3SK4A 5CV6A 4E6IA 5KYLA 4I65A 5IGGA 5C4ZA 2RBMA 1F2ZA 1EYAA 2EY5A 3OSOA 2EYMA 1RKNA 1SNPA 2F0OA 2OXPA 3E5SA 1JOKA 4PMCA 3BDCA 5C5MA 2PW7A 4F8MA 1STAA 4K2LA 5IGBA 1IHZA 3QOLA 4K2KA 2PQEA 2SOBA 4EVOA 1SYDA 2O4XA 4ME5A 1KDAA 1SYGA 2ENBA 4ODGA 2QDBA 2F3WA 2OEOA 3U9OA 4DF7A 4KD4A 5HURA 2F0HA 3HEJA 5C4HA 3D4DA 2EY1A 4KJNA 5M9OA 2F0TA 4HMJA 4QB4A 2F0DA 2RKSA 3EROA 5I9PA 4NMZA 2LKVA 2PZWA 3V2TA 4ID6A 1SNDA 4KY6A 5EKLA 3H6MA 5C5LA 4DU9A 4K5WA 4WRDA 3ERQA 5CV8A 5C3XA 5KEEA 4K5XA 4H7BA 5C6AA 4HMIA 3NQTA 5IGCA 2F0EA 3NXWA 1EYCA 3D8GA 5JAVA 4KTAA 3EVQA 5J1ZA 5E3FA 2F0IA 3DMUA 5NUCA 5IGEA 2EY6A 2PZTA 3OMGA 1II3A 1SYBA 4KD3A 4J6HA 4KHVA 4RKBA 4ZUJA 4PMBA 3S9WA 1TR5A 3P75A 2F0WA 1SNOA 5EGTA 3C1EA 4J1MA 1EY8A 5JOBA 4EQPA 2F0QA 2SNMA 1SNQA 3DHQA 3TP5A 2OF1A 3VA5A 5HGTA 3NK9A 2F0UA 2F0PA 1EZ6A 5C3WA 4DGZA 1STBA 3LX0A 1ENAA 4DFAA 3P1HA 3MHBA 5CGKA 3NP8A 4QF4A 1SYCA 2F0VA 3D4WA 3PMFA 3OMCA 5E1FA 1A2UA 3C1FA 3SK5A 5CV7A 5CV5A 1SNMA 1U9RA 2HQEA 1SYFA 3MVVA 1SNCA 2EYOA 5DAUA 3SK8A 2SNSA 3SXHA 5KGUA 3TP6A 5CC4A 4QMGA 5CV4A 5F2DA 5IODA 1STHA 1STGA 4K8IA 2EYHA 4KY7A 2F0NA 4K8JA 4LAAA 4EQOA 5CV9A 2F0MA 5K5PA 4G57A 4ZQ3A 3NUCA 4KV6A 5J39A 5KRUA 1A3TA 3TP8A 3BDLA 3R3OA 1STYA 4MIUA 4R8NA 5CR3A 2EY2A 4KY5A 2PW5A 2F0JA 2EYFA 4IALA 1A3VA 1EY6A 2EYPA 1F2MA 4HTHA 4WORA 3RUZA 4B9WA 4F7XA 1TQOA 3MEHA 1TT2A 4IZ8A 3T16A 5IGDA 1AEXA 4N9TA 1SYEA 1KABA
chains in the Genus database with same CATH superfamily
5EBCA 3QB3A 4RKLA 3T4AC 2IX0A 2JEAI 1O80A 1XTDA 4DNRB 3JAMi 4K6DA 1SR3A 4S3SA 1UEBA 5JPNC 4DUZQ 1F2YA 2LXKA 3ULLA 4OWWB 1TWCH 2JEBI 1I4HA 2H1EA 3FKIG 2G9DA 3H3VC 2E2IH 2YYZA 2CKZB 5I6YA 5K36G 2XRQD 3PF4A 1CA6A 4H02A 1E22A 2V1CC 2YU9B 1BR9A 4YCVA 2ASBA 2AQ2B 1U4RA 4IURA 3VA7A 3KLSA 1JR0D 1VQCA 2N78A 3E5SA 1FNVA 1EYGA 1ILPA 1DZ1A 4YWMA 5C0XI 1WCMG 4A3BG 1Q90A 3K59A 5FLXc 3IFDA 1IXRA 1PV4A 4QB4A 2CVRA 2UXBQ 1IBML 3L9AX 1U4LA 4LF9Q 1DD2A 4ZKCB 4A3GH 1QOHA 2GA4B 1HNXQ 3DEOA 3H0GH 2WIIB 1RTNA 4H0LC 4HN7A 1EYCA 5JAVA 1JWMD 4GKJQ 3S2DB 3KDFA 1PRTB 2EY6A 2PZTA 1K73C 2M9VA 4JI6Q 2BE5C 3M4OH 2JN4A 4LF6L 4A3DB 2SNMA 4A3MH 4KN7C 1CSQA 2NVQH 5C3WA 3UDFA 5ELEA 3GP7A 3P1HA 3U9SA 4C56C 4DK0A 1O78A 4K0KQ 4XYOA 3ZYYX 2SDFA 1SMYC 4TQUS 3STBD 4QMGA 3ND8A 3MXUA 2UUBQ 1GUGA 1XPOA 1VQ7A 2FHTA 2XRSD 3HKZE 1NE3A 2HHHL 4ZQ3A 2UUAQ 1U5KA 5IT9E 4DV6Q 2VUMH 5LMNL 2LSSA 3UE0A 1GUWA 3Q24A 2PW5A 4MTKA 2NB0A 4F7XA 1VQPA 1KLUD 1Q8KA 4FF2A 3NBIA 5LHY1 1EEFD 1Y14B 4DV2Q 3T1YL 2UU9Q 1FNUA 4A3DG 1KABA 3I4NB 5AFWA 1WTPA 5C0XJ 3M4PA 3HRZC 1A2TA 2JA7H 2KQ3A 4HAEA 4B9XA 4TRDA 1PHJA 3I73A 3K5MA 2F0LA 1TS4A 4GLVB 1G2TA 3ICEA 3K7AB 2N55A 4JI7L 5M3MG 1KDBA 4A3JH 3GTKH 1PVOA 3KF8A 5I9OA 1MSHA 3RMHA 5CV6A 1B1ZA 1Y1VH 3LNNA 3S24A 4DV7L 1ASZA 2RDHA 3K0XA 4K2LA 1MKHA 1RDPD 2XSCA 5C44B 2Z6KC 3D4RA 1ML0D 2QDBA 2OEOA 4KD4A 4A3KB 4B3RQ 2KOLA 2MFIA 1HR0L 4U673 3K81C 3S15H 5I9PA 3PO3B 5FKAC 1RODA 4C3HH 1D7QA 5FJ8H 4KKTA 1YZ6A 3HOYB 1SRUA 1B50A 4YHHQ 4H7BA 5IGCA 3NQTA 2K5DA 2F0EA 2DN8A 3X3MA 1UE1A 2G5DA 1NTGA 2A6HD 4A3CG 2G9HD 1II3A 1EIFA 1A0IA 1GOZA 3P75A 3CU7A 1ET6A 3H94A 1SNQA 4DAMA 4DK6C 1XNQL 2K7VA 5C3EH 2F0PA 1Q82C 1A63A 2IY5B 4A3KG 4GNXB 1WTQA 5M5XB 4PZ7A 1RHPA 4N8FA 1PYBA 1SNMA 4LF4L 3OW7A 2F4VQ 3MXNB 3OHXC 5D3DA 1NAPA 1STGA 4X3TA 3HOYG 2CH4A 3OIQA 1YHQA 3J7A5 4FNFA 3M3YH 4ZKBB 5EPJA 4CKCA 3VR6A 1SAPA 1EOVA 1LT5D 3VR5A 1PTOD 3CCMA 4OELB 4HIKA 1MSGA 1UAPA 1IBLL 1C48A 1LTAD 1IW7D 4MTNA 2AQ3B 4IJLA 1VQDA 1LM0A 1D6EC 1PZKD 5JPMC 3K58A 2HQLA 2IL8A 1TU2B 2XIWA 1RTOA 3CHBD 3EA6A 2EYLA 5CBEE 1RF2D 4FXKC 4GLXA 4DR5L 1EQVA 2Z1CA 4EQNA 2HIXA 5CORA 2FXQA 2B2WC 2CW0C 4JPBW 1EY9A 4DV5Q 2MO0A 3I4MB 2E2JH 4DV4L 1YNJD 1FYCA 4NKLA 1H9MA 1HNZL 4R4OA 1NBWA 2Y0SE 1TIID 2F0KA 1IYUA 1S5FD 3G7LA 3S1MB 1I4XA 5IGGA 1B9NA 4DR7Q 4JI1L 2B2TA 5CBAE 3M7GA 4JI0L 4PMCA 2L11A 3PV0A 4R8IA 2PQEA 1XMQQ 2FMMA 5COYA 1HA6A 4HCEA 4FYDA 1SE2A 1SN8A 4NB3A 1N36Q 2F0DA 3W1BA 1FGUA 1YITA 5JJZA 3EBEA 4DR4L 4TKOB 4JI3Q 2WINB 3P20A 4WRDA 2B2UA 1WCMH 4AH6A 3I4MG 3J80L 1G91A 5DLQE 1H9SB 2BA0A 3NWSA 2Z9HA 4DN4M 1PH3A 1W6JA 2H4OA 1G51A 4JI8L 3CCVA 3U4VA 2QEJC 1X32A 5BN5A 4QQBX 2L9HA 3CCUA 4DUYL 2UXCQ 3ERSX 1B44D 1TR5A 2ZJRA 5KNBA 1IZ6A 2F1MA 3S1NB 3I8ZA 3MAQA 4DV1Q 4OGQC 4X65L 3CC7A 1Y8NB 1PH1A 4DV0Q 5M5WB 3HP3A 1WTXA 3VR3A 2A73B 2GVBA 2Q8TA 4HEDA 4HCSA 2VQFL 1K8GA 1L2FA 5KGUA 4DXGA 3CCLA 1L0YB 1CHQD 1S5ED 2EPBA 1HRJA 1E24A 1XNRQ 4LAAA 1Q86C 4EQOA 3A74A 5ELCA 1TWCB 1N34Q 4YCUA 4LK1C 4R8NA 2X6GA 1U4MA 2EY2A 1TXYA 1K8AC 1J8IA 3E0EA 2F3IA 3X3NA 5J3BA 4LFAL 2R7DA 2R7ZB 1K83H 1X55A 2QW7A 5IGDA 4WJ3M 2B2YC 1OO9B 3R93A 1IKMA 1N32Q 3T13A 3MFGA 2EXZA 3OTOL 2ZTDA 1D5MC 4CKBA 4RGOS 3S16H 5CMDA 3TS0A 1V1QA 4B3SL 1YEZA 1M1KC 3SK6A 1GUOA 2WACA 4Y7NH 3AFPA 4B3ML 4A3FH 3L0OA 3B6YA 3F2BA 4H44C 4FF1A 3GTJH 1STNA 4V190 2O5IC 4A3GB 3GV6A 5T1IA 3TP7A 3DWAA 3SK4A 3STBC 2QKIC 3H0GB 1N9WA 1O7YA 3IFTA 3TREA 4X64L 3J81L 2NYZD 2JA6H 1F2ZA 2OCEA 3D0FA 5C5MA 1G291 4CJ0B 5FO9B 1GM5A 4BY1H 3QOLA 4BBSG 3G4SA 2E5LL 3I4OA 4ODGA 1O7LA 3NWTA 2F0HA 4JBMA 5IYCH 3M4OB 3RN2A 1XJVA 2LMCB 2RKSA 4A3MB 2NVQB 4JI2Q 2ATWA 4HSPA 3RZOH 1I94L 4DKAC 1SNDA 2N88A 1R9TH 4X3UA 4F88A 1HNWQ 1WTWA 1J5EL 2R7FA 4X3KA 1W6KA 2VW9A 1B8AA 1I50H 1OXXK 4JI4Q 3PGZA 2RF4A 4XQJA 4JV5L 2VUMB 1VQKA 5IT9L 5HY6A 1DOLA 2QILA 1EIYB 1JICA 3AMUA 4OEMB 1HCZA 1X3QA 2MP1A 2F0VA 1AW7A 2L55A 1UE7A 1WTHA 3C1FA 2DJGC 2LFNA 1U9RA 3OWEB 3KF6B 3CCEA 4GNXC 3J80i 1YBYA 3CF5A 2JA7B 1QILA 4DR1Q 3BJUA 1SE3A 2RCNA 2DJFC 2XNAC 1B53A 1CKNB 1HH2P 2JA9A 3S14H 3NBHB 2K4KA 4HJ9A 2Y0SG 4HJ8A 2RCFA 1TT2A 2QDLA 3GTKB 3HFZB 1AEXA 4G7OC 4IO9A 1MJEA 3EIVA 1EYDA 2QF7A 1JQYD 3RLOA 1BVSA 1Y1VB 2VUMG 2C9OA 2A6HC 2BH2A 4IUVA 3I4LA 1EY4A 1F9PA 4KJOA 4AYBE 5KYIA 1QZHA 2A8VA 3U58A 4YCWA 4N9PA 2KBNA 4OL7A 5EKKA 4UP7A 1CM9A 4A3LG 2NWGA 5J22A 3S15B 1CQFA 1DM0B 1X65A 5C4JH 1SSOA 3VYRA 2UXDQ 4C3HB 3UDGA 4ME3A 1KRSA 4O1NA 1BCPD 3LGJA 3LWUA 4XQNA 3K57A 1JOKA 3BDCA 4A3JG 3KLWA 2VQEL 3CCSA 2K33A 1HPCA 2I07B 1PTOC 1ZKOA 1SJED 4L63B 4QUFA 4AQYQ 1IW7C 2K5WA 3HG9A 2A68D 3FPPA 3QO2A 1ICFB 5AJ3Q 3QIAA 1SBBB 2TSSA 3TQYA 1M4VA 3H6MA 2EXDA 5C5LA 4JYAL 1CZGA 2GN5A 1G2SA 5LL6S 3NE5B 3J7YW 4WJ4A 5I2XA 1HTLD 3ER0A 1A6XA 4GLAC 2MPMA 1AZPA 2D2CC 3J81i 3DUZA 3C2PA 4C3HG 5E3FA 5IGEA 4NXMQ 5FJ8G 3D31A 3IAYA 5DM63 3FVQA 1YNJC 2WAQB 1BCPB 1Q8IA 1X56A 2E2HH 1HZAA 4TSSA 4BBRG 4LFBL 4JBKA 3JC66 3SXHA 1HZCA 5C3EG 2VNUD 1X3EA 3TP6A 4JW0A 4RCOA 4CGYB 4K8IA 1WI5A 3UI2A 2Z4HA 4ALPA 4XT1B 2KHIA 4K8JA 4G57A 4X66Q 1Z9FA 5KRUA 2ZXRA 1HHVA 3J81j 1S4ZA 4IALA 2K28A 4DAVA 1LUZA 2HCIA 2BCOA 4XQQA 1Y8PB 1EY8A 2ZT9C 5C4XH 1IKLA 3SHLA 1TWFH 3PUXA 3FKIB 3M4YA 4GNXA 2K5NA 5I6WA 3D6CA 3I91A 2NUCA 1L0XB 1ENCA 2Q8IB 4CDCC 2N3SA 3BDOA 1XYIA 4RA8A 2KUMA 1NSNS 2C35B 3EN2A 1MI2A 4CDFC 1U0LA 2JP1A 4X3SA 1WCMB 2IJ0A 4A3BB 4C2MH 4IOCA 4QIWE 3VYUA 3BG3A 1XPUA 4DR2L 2WV6D 2O4XA 4PV1C 1KDAA 1Y69U 4NW2A 3SGIA 1M8AA 1LTTD 3HEJA 4V0BA 1AH9A 3D4DA 3AYHB 2PI2E 3KLRA 5HGQA 3VYTA 4K5WA 2Z8LA 1PH5A 4BBSH 5C3XA 1LTGD 4K5XA 1X3FA 1PRTF 4KTAA 4DUZL 3CD6A 2BDOA 4G7HC 2EJMA 4RHRA 1VQ4A 3JAMc 4GS3A 1K8OA 1CKMA 4QL5A 3MTSA 3VA5A 4I7ZC 1VQMA 5JVG3 1EZ6A 5IYDH 5IP7H 1SDFA 2L1BA 3LX0A 5GAEC 4DAPA 1K83B 4O0AA 3GTMB 1JCKB 3OMCA 3J81E 2RSOA 2YTXA 4AYBG 3A56A 4RCNA 1QNKA 3ULPA 4R4QA 2JA8G 2R93H 4M1UB 1EQRA 1TWHB 3QG1A 2IX3A 1H9SA 4KV6A 5J39A 4CDDC 1X3GA 1FL0A 1U4PA 1M90C 4LF6Q 4Y7NB 4KK7A 4LF9L 4A3FB 3RUZA 2ICIA 2EZVA 1HNXL 1N8RC 3PCOB 3MEHA 3GTJB 3T16A 4RGTA 1F9SA 1PA6A 2EVBA 3L3OC 3TMEA 4GKJL 4DAYB 4HIOA 2HCCA 5IOCA 4YY3Q 4HIMA 2PMZE 1IBKL 4JI6L 1IL8A 3A0JA 3MXPA 1RIPA 2B8FA 5M3MB 1YVCA 1E7ZA 1EZ8A 1CK1A 3I90A 5DEHA 3A7AB 1UE6A 1MGSA 3QR8A 1EY7A 3BVGA 4K0KL 2NBFA 1R9TB 3OWFA 1NCVA 4CBVA 4EQ5A 3PIPA 4A3FG 4FXDA 1SNPA 1KAWA 2O2LD 4A3LH 3K8AA 4EVOA 1PFNA 4OWXB 4IPDA 2UUAL 5TSSA 1AN8A 4IQZA 2JA6G 1LLRD 4DV6L 2N8NA 5IWAQ 5T1GA 2I5LX 2NTTA 3E0JA 1QVCA 4BY1G 4B3TQ 2PZWA 4DV2L 4O2DA 2UU9L 3S1QH 3CRLC 5IYCG 3F2DA 2FMCA 3HOWG 5C6AA 1HR0W 2VL6A 2VY3A 2NVTH 1H9KA 4O42A 5BR8Q 3GTQH 4GKKL 3I72A 3K5LA 1HR0Q 1A62A 3C1EA 2K50A 3FHWA 2Q2IA 3HOZH 1VQNA 5EKIA 1STEA 4GN4B 1STBA 4DGZA 1N33Q 1I4PA 1BCPC 1JWUD 2PNHA 3MHBA 4P73A 2ALYB 5FLXE 2FFKB 3A8KE 3PUWA 5I2YA 1I4RA 3K7UC 2HQEA 1GD7A 3NTHA 5A2QE 3R8BA 1Q1EA 3HS0C 5CV4A 5F2DA 3FEWX 1E1OA 3KLSX 1YHBA 4B3RL 2A68C 4UDUC 4BBRH 4MIUA 3M7NA 4R4CA 3CQZB 4HTHA 1Q7YC 2EYPA 3CW2C 5G3LF 3J7AV 3G71A 4J15A 1A15A 4YHHL 5IGFA 1HQRD 2R3ZA 3A8IE 2A6ED 4LF4Q 1YI2A 3G6JB 4PNYA 2VB2X 1UWVA 1EY5A 3NHHA 2KVMA 2UUCQ 3TZDA 1EU3A 1A3UA 3IRBA 3KF6A 1F9RA 1DXMA 3PF5A 1TWAH 2EOTA 1A8VA 1BOSA 1V1OA 2RDFA 2ZTEA 1B3QA 5ISRA 4OHJA 3IL8A 1CKNA 1Z47A 2F4VL 2KHJA 3NBHA 4F8MA 2EJFC 3HOVH 1PMRA 1MBYA 5KNCA 1HFNA 5FO7B 2Z6BA 2EY1A 1ESFA 2B39A 2E8GA 3FDTA 4LF7Q 1BBXC 4IPCA 3E9HA 3NEMA 2PMZB 1E2VA 3HKZB 1KXLA 3J7AF 3A8JE 4F87A 4RAUC 4H13C 2F4IA 1PTOB 2J0TD 4XXEA 2ZXPA 4UY8C 5M5YH 4KHVA 2KENA 4ZYSA 3KOJA 4ZK9B 3PIOA 1LTBD 4N8X1 4IFDG 5HGTA 3GDEA 5ELFA 2MUYA 2WP8J 3FMCA 3L7ZC 4DFAA 3CAMA 2FINB 4LJZC 1KD1C 2KEEA 4OX9Q 4DR7L 1WVLA 5C4XB 2JA5H 5IY0A 1SROA 1TWGH 3V05A 1CKOA 1E2WA 1TWFB 4A3EH 5FLMG 2SNSA 1LTSD 3R2IA 2EJGC 3KJOA 1XMQL 3I7FA 4LW1A 1B3AA 5M3FH 1BF4A 3HKZG 1B4OA 2K32A 2QCPX 1IL2A 1JT8A 4JCVE 4IUTA 2Z6KA 4C3IH 4Y52H 4CKEA 3HOXH 5JJKA 3A54A 4JI3L 3T1HQ 2JA8H 4IZ8A 3RZDH 2OQ0A 4J8QA 4A3IH 5LMUQ 2KCTA 3S1RH 1KL9A 2J7ZA 3E3XA 4C2MB 4JK1C 4L5RC 3EJIA 4K5VA 1X9NA 3SE0A 1BXTA 1TY2A 4OXPA 2QGQA 2UXCL 5C4XG 1WOCA 1JWSD 4DV1L 4DXFA 2K5HA 2E2IB 4OIJA 4NPSA 4PMWA 2XVSA 3W5OA 3KUPA 4P74A 2YU9H 1MIUA 3RN5A 4BBSB 4MZ9A 3KK7A 3E9IA 2PNRC 4A93G 1OXUA 1W3SA 2R61A 1RKNA 5GAHC 2JSOA 4RFBA 4KI0A 4BA2I 3AEVA 1XNRL 1IHZA 1VQEA 2D62A 4G7ZC 3U9OA 2F3WA 3CKIB 1N34L 4NXNQ 3DM3A 4L5QA 1DCZA 2Q2UA 2PQAB 4XIGS 5L37A 4DV3Q 1SE4A 2YTYA 2LKVA 2ZXOA 4ID6A 3S17H 1PZJD 1B70B 2MNAA 1K0SA 5KEEA 1HZBA 3MXGA 4X64Q 1NMGA 1N32L 3NXWA 3GTOH 3S2DH 3BVZA 5CYUA 3TEHB 4IFDI 1JJ2A 4POFA 2R93B 1JJGA 1ET9A 2D9UA 4JI5Q 1S3OA 1VQLA 1JE5A 4CJ2C 1C4QA 2VXWA 4EQPA 2IT1A 4X62L 4ULLA 2ZM6L 2B2WA 3HOWH 2WB1E 1C8CA 1KLGD 1SYCA 1AP0A 1VQ8A 1S5BD 1SXTA 1VMCA 1QG7A 2DY7A 1SYFA 4IJHA 3SK8A 2A74C 2TMPA 4DA2A 4LFCQ 2KEDA 2IPKD 5IYDG 1EIHA 5IP7G 5IODA 1VCIA 3H09A 2HD3A 1LACA 2Y0SB 5H1SE 1E3PA 4QCLA 1A3TA 4DNTB 1Q1BA 4JV5Q 1CSPA 1STYA 4HSVA 1R4PB 2KJXA 4JI2L 1FJGQ 2R93G 4TVAB 5A35A 2F0JA 1A3VA 4WORA 2L12A 5D3IB 4B9WA 3F8TA 1HNWL 1X3PA 5ELOA 3DWPA 3I4NH 4HJAA 1KNEA 1DOKA 1PH7A 2B63H 3E6ZX 2LY7A 3TSSA 4K14A 2BDNA 3CCJA 1JC7A 1SEBD 4JI4L 3QOJA 3K0YA 1S40A 3MZ5A 3EQLC 2D5DA 4RGNA 2KHSA 1CI3M 3RLFA 1ASYA 4LF5Q 3C46A 3CPWA 3CRKC 1YJ9A 2F3VA 4Z9CB 1AE2A 4C3JG 2F0GA 1CA5A 1XMOQ 3PUYA 3K80C 3S1QB 4A3JB 2ES2A 1CUKA 3GTLH 4IFDJ 2NVYH 5KYLA 1I6VC 2EY5A 2F0OA 2AHOB 4DR1L 5C44H 2NVTB 4CJ1B 2JYOA 4BXXH 3GTQB 1SYDA 4ME5A 2ENBA 2I0QA 1Y8OB 3J80c 2NZHA 1EU4A 1PYWD 3W2DA 5C4HA 4YWKA 4M8AA 4DAYA 3PO3H 2B2VC 3V96A 1C7YA 3SDZA 3HOZB 3ONAB 1MD2D 1LT4D 2A6EC 1VQHA 1FR3A 1K9MC 2ICEC 2LS01 5FLXL 5IYBH 1WTVA 1VQFA 4R1JA 2B2YA 1K8MA 3PQIA 4OO1G 3OIPA 1LTRD 5A2QL 4BWGB 4QY7A 1V1PB 5FK9C 4EX5A 4HIDA 1QE6A 1BCPF 1PDQA 4PMBA 1QVGA 1HQMC 1BUVT 3PSIA 2B29A 4J1MA 4KMUC 4DR3Q 4BBRB 3TP5A 1HJPA 1NMFA 1F9QA 4PG3A 3PUZA 1PFSA 5C3EB 2E76C 4QF4A 4JYAQ 4RGMA 4R9WA 3UDIA 3BZKA 2DNEA 2CCZA 2CQAA 1HFGA 2EIFA 1SNCA 3HOZG 1EOTA 3MC0B 4DR6Q 2PO4A 4IFDH 2R92H 1FNWA 2E74C 5D65A 4AQYL 3M3YB 1GXDC 3R3OA 1ESRA 5AJ3L 1YJNA 1CQVA 1TWAB 1QNUA 1EY6A 5FLMH 2BH8A 5E4XA 3RLNA 1VQ6A 4LF8Q 4PZ8A 1RL2A 4R4IA 4A4IA 5IP9H 4UPAA 2IWHA 1ICWA 1VQJA 3KYHC 2K01A 5ELNA 4ZUIA 4NXML 2IHEA 2SEBD 1D1KA 1KDCA 1NR2A 1P16A 3ND9A 3SEBA 3U4ZA 2PZUA 1MHWC 1R4QB 3PO2H 2NTSA 4K6LA 1VQIA 2E2JB 4MHEA 4IUQA 1GVPA 3S1MH 1YHAA 1PYSB 4UAIA 5BN3A 2K5VA 2F52A 1I6HH 2GVAA 3M9BA 2WKCA 2PW7A 1WD0A 3D3RA 4KHPQ 2AUJD 2XTIA 5M5YB 2K05A 2K75A 4RH6A 2M2LA 1YNND 3KFUA 1MJCA 3HOVG 3NENA 4HR7B 4A93H 2Z0SA 1G6PA 3V2TA 4OO1I 2E2DC 4IUPA 2HIVA 1Q46A 2A69D 2D0OA 3OYYA 5CV8A 1HUMA 4LUZA 2P5ZX 5IT9c 2I5HA 3D8GA 2WKDA 2OT2A 5NUCA 4IPGA 5GADC 3TDQA 1KC8C 1SMXA 4RKBA 3S9WA 3S1NH 3A5ZB 5FO8B 1E1TA 2F0WA 2YTVA 2OF1A 3M4QA 4XT3B 4AYBB 2F0UA 4C3IB 5I4DA 1GJXA 4ZCKA 2JA8B 3TRZA 4P72A 5JEAG 3PMFA 3Q22A 1J9OA 2EE1A 3G6EA 4A3IB 3Q0AA 1PH9A 5DAUA 4DK3C 3S1RB 2EYOA 2A19A 3UE1A 4GOPB 3OPOA 2K03A 1ZYRD 3G48A 2NVXH 3P7JA 2EYHA 1H95A 4JBJA 2JA5G 1QCBD 4A3EG 3TBIB 2KCMA 1Q81C 1P8LA 2R7ZH 5M3FG 1I4QA 1IBMQ 1PRTD 2L5TA 3GTGH 1HXYD 4X6AH 1LV9A 2ID0A 3UDXA 2VB3X 2BA1A 4JG2A 4LNQA 1H9JA 4KKSA 1LO5D 4C3IG 3HOXG 1X6OA 4UHVA 3MFYA 1OXTA 1K3RA 3ITPA 3MA2B 4A3IG 4PZ6A 1KTKA 3S16B 5D14A 2UXBL 1PH2A 1QUQB 2F0SA 4CDEC 3S17B 4LUOA 5IIFA 4JOIC 4IPHA 4E6IA 2AMCB 4ZRZA 2L4NA 1EEID 1DYQA 2JA6B 3GTOB 3CPFA 2NN6G 4FXGC 4KHZA 3H3VH 5LMNW 2O5JC 4C3JH 4BY1B 1WFQA 3AU7A 1ZXTA 3I2ZA 3NPPA 4DF7A 1IBKQ 2HHHQ 4DNIA 1JMCA 3QWNA 4KJNA 1D2BA 1EFWA 3VR4A 1TY0A 5LMNQ 1VQAA 3HOWB 4NMZA 5GROA 2YV5A 3RZOB 3SVMA 3RZDB 1WJJA 1V43A 3MEFA 3T1YQ 4RHSA 1XPRA 1EL0A 2K14A 3OOCA 4YY3L 1D8LA 2UUBL 3EVQA 1RJTA 2K52A 1I50B 1SYBA 4KD3A 4ZUJA 1UE5A 1JB7A 4HJ7A 1SNOA 5EGTA 2B3GA 3DHQA 1F77A 1UEAB 1ENAA 1BO0A 2DY8A 3NP8A 5CGKA 3CCQA 4OO1H 4JI7Q 2B2TC 3D4WA 1B2TA 2CHBD 2PQAA 2B63B 3SK5A 1I3QH 2KCCA 2AQ1B 5CV7A 4DV7Q 1PH8A 4L5SA 1VF5C 3FRPB 3HKSA 1VQGA 5CC4A 1GUNA 3A55A 3KBXA 4APVA 4GKKQ 2A5HA 2A1AA 5CV9A 2F0MA 2QEXA 1YIJA 2MHVA 1C9OA 5IWAL 1G6ZA 1Q12A 3BDLA 1LYLA 1EFID 4IN3A 4BY7H 4QIWB 4B3TL 4KY5A 1AE3A 2EYFA 1JORA 2B2UC 3S14B 3DEPA 3FP9A 3F2CA 3JAME 2L15A 2OWOA 1QZGA 1SYEA 3GTLB 1FVIA 2NVYB 4WJWA 3T51B 1KQSA 3BYYB 5BR8L 1S72A 4DPGA 4POGA 3I4NG 3MWYW 2B63G 4UP9A 3NTIA 3RD4A 1H9RA 4IOAA 5KIXA 1N33L 1B7YB 2NN6I 1XNQQ 1GUSA 1PH4A 4NDXA 3AB9A 4JBWA 3TZUA 5C4JB 1NUCA 3CMEA 5DM73 2AKWB 3WDNA 1JB3A 1E2ZA 1SLJA 5IGBA 5JEAJ 5BN4A 3Q6SA 4K2KA 5C0XH 5G3LD 1SYGA 2RA4A 3T53B 2KA7A 1O7IA 2QA4A 3GTPH 3NQIA 5E7NA 5M9OA 1XWEA 3N52A 3AFQA 5C44G 2JK8A 4BXXG 3A7LA 1EWCA 1IBLQ 1VQ9A 4B08A 1KIXA 1L1OB 4ILWA 3T56B 3PO3G 4JOIA 4HMIA 1PTOF 5E4WC 2ZJPA 2EQSA 1SFOH 1OTCA 2UUCL 4KLKA 2R92B 4DR5Q 2ZTCA 1QJOA 5IYBG 5JJIA 1K28A 3S2HH 2F0QA 4HJ5A 5JJLA 4DV4Q 2OTJA 1Y1WH 1QVFA 3HOUH 4GZYC 1HNZQ 1X54A 2E2HB 1EQTA 2K1BA 1A2UA 4JVZA 4GN5A 4OIKA 1T5EA 3MVVA 1VQ5A 1E0BA 1CFMA 4JI1Q 2Q2TA 4JI0Q 1SE8A 1ZEQX 2JQOA 3F1ZA 1YNNC 4KY7A 3PIP3 4GOPC 2F0NA 5K5PA 1OXSC 2BOSA 5GAGC 4DV5L 5JEAH 3PO2B 5ELDA 3RNUA 2A69C 1EWIA 1BKBA 4LF7L 1DJRD 1TS5A 5KNDA 1V1PA 2X69A 2R92G 4DR4Q 2B8GA 2WFWA 3M85A 1TKWB 1JOOA 2AWOA 3FKIH 1TS3A 1I6HB 4WFN3 2PPBC 5K36H 1SJHD 3O13A 1GHJA 3D6WA 4JI8Q 3GO5A 1GHKA 3HZXA 4P71A 5IP9G 1JOQA 4DUYQ 1BBUA 2AUKA 1HZ9A 1N36L 4PQXA 3QJYA 2XWBB 4X65Q 1VQOA 4A93B 4IUNA 1VDZA 4L6TB 1I5FA 3FPUB 4OX9L 3KDFB 4A3BH 2PYKA 3PO2G 1DGSA 1ZYRC 3EFXD 2OXPA 2VQFQ 2RHQB 1EWHA 2RVLA 1T9HA 1VMPA 1EQQA 1DOMA 1JE4A 1PRTC 2F0TA 2I46A 3T1HL 2JJQA 4DV0L 1WTRA 5EAYA 3RR5A 2NN6H 4LFAQ 5EKLA 2MGSA 5LMUL 1GO3E 2E75C 1HTPA 1KRTA 4LWCA 1LT3D 5LL6X 2HDMA 4L8JA 1D5ZC 3CC2A 3DMUA 2NVXB 2L0CA 3OMGA 3OTOQ 3WWVA 1XXGA 4RMFA 4RG1A 4B3SQ 5JOBA 1BNZA 3W3AA 4MNOA 4B3MQ 2CFMA 3GTGB 3GTMH 4MN3A 3DWQA 4L5TA 3W1GA 4FF4A 4GN3B 5E1FA 3OW2A 3KBGA 5EQ0A 1TWHH 3GQBA 4OONA 4NXNL 2E5LQ 3K5NA 2MJ8A 3KF8B 1CZWA 4A3DH 1VF7A 4DV3L 4ABNA 4X62Q 1T5XD 2ZM6Q 1O7ZA 2MQHA 5DNFA 4LMQD 1JJCB 4QUCA 4CHTB 2NZOA 1I94Q 3CP0A 3H91A 4EGVA 2F0FA 2WAQE 1J5EQ 1LTID 3PUVA 2RSNA 5EPLA 2CQOA 2Z4IA 2R7ZG 5EBDA 5EPKA 2NZ1D 4JI5L 2JE6I 3CXCA 4C3JB 4YIJA 5M3MH 1CHPD 4OWTB 4DK1A 1UNSA 2R6GA 4GOPA 4FP5D 1LT6D 1KAAA 3F2UA 4R4TA 2BE5D 1EY0A 1FGBD 3SR1A 2F03A 5GQOA 3PIO3 3BVMA 4LFCL 3A5UA 1Z7TA 5C4ZA 2RBMA 2Q2HA 4Q0FA 1EYAA 3OSOA 2EYMA 4ZAIA 4FVMA 1SMYD 4Q5VA 4A3GG 1STAA 2RQXA 2SOBA 3H0GG 2AWNA 3U50C 1Z6HA 1CTMA 2C5CA 1S5DD 1FJGL 4HMJA 1S5CD 1NR4A 2CWAA 3K7AH 1KHIA 1RCVD 2JXMB 3NELA 3Q8DA 4P75A 3K6OA 4LUVA 4KY6A 4A3CH 3WOFA 1IYVA 4DU9A 1LABA 1QWYA 4XDXA 1ONLA 4G4KA 4A3MG 1I3QB 1QB5D 2IW3A 1QUQA 4UP8A 2DNCA 3BYTB 1XTCD 1L1OC 2KECA 5J1ZA 1V9PA 1BBWA 5JVH3 4XTCS 3R2TA 5IE8A 4LF5L 2RHSB 2PCFB 4A3KH 4BS9A 1VS0A 1NY4A 1EUJA 1AZQA 3I56A 4BY7B 3BS1A 3NK9A 1XMOL 2K04A 4C1NK 3NSWA 3HOYH 1UUPA 2I5MX 4AIMA 3JAML 1GKHA 1TVXA 2K6AA 1CT1D 3VYSA 3KJPA 4IUUA 4XYQA 2VQEQ 3VDYA 3H15A 3TP8A 2JA7G 3CQZH 5CR3A 4FO2A 2HT1A 3NTKA 1VQBA 3GV3A 4QJFA 1TQOA 4FDBA 4JC0A 3WOEA 2UXDL 1OXVA 2MO1A 5M5XH 4P2CB 4N9TA 1V8QA 4BY7G 4ZLTF 2N49A 1ENFA 3IKJA 3LWEA 2M00A 1F2LA 4NP5A 3ZJYC 2CWPA 2RDGA 3ULJA 1NJIC 3DLLA 2IX1A 1TS2A 1Y1VG 2XWJB 2ZJQA 4FF3A 2K5QA 2OQKA 4DR3L 3GTPB 3TS2A 2D0PA 1J6QA 2XN9C 2HDLA 4I7AA 1IYJB 2EYJA 5FOBB 1FD7D 1Q3LA 3TN2A 1G8ZD 4QGUA 3BZDB 2HUGA 3I55A 4I65A 2Q8RE 4LFBQ 1C0AA 4RWSC 1WTOA 4DR6L 2EDGA 2WB1B 3N6RA 1EIGA 3H3VI 3HOVB 1SFOB 3CC4A 1D5XC 3CCRA 1PFMA 2DUDA 5HURA 1XX8A 1L0WA 3BZCA 2VS1A 3J81c 2H5XA 3I4MH 2PI2A 3S2HB 1PXUA 3EROA 4C1NI 3VR2A 5C0XG 1WYDA 3L2PA 2X6LA 4KN4C 1HUNA 4LF8L 1Y1WB 3HOUB 1BQQT 1LTLA 1K3BC 5ELBA 3I70A 3C3LA 1PFBA 4A76A 1PTOH 1ILQA 1I4GA 3Q23A 2F0IA 3HGBA 2OTLA 1K0RA 1D1IA 1PZID 4J6HA 4X66L 4YWLA 4BA1I 1NNXA 3K5OA 4A75A 2WB1G 2CW0D 3J7ZC 3AQQA 1RD9D 2WAQG 3J80E 1YNXA 2VZAA 1PH6A 3DM1A 2LXJA 5CV5A 1PLFA 5EJWA 3I3CA 2JA5B 1B9MA 2KCNA 1TWGB 2CH4W 2IHFA 4A3EB 1Y1WG 3HOUG 3GD7A 4KHPL 1STHA 4DR2Q 3DXJC 1BDOA 4U68A 1L1OA 1W2BA 5M3FB 1YJWA 3NUCA 1HA5A 3MXNA 3BU2A 2DGYA 1KNAA 1GUTA 1WD1A 1AFPA 3URYA 1DONA 3CMAA 2XGTA 2J4XA 1F2MA 3HOXB 2B2VA 5M5WH 4KKUA 2V4DA 2FJ2A 3ERQA
chains in the Genus database with same CATH topology
5EBCA 3QB3A 4RKLA 3T4AC 2IX0A 2JEAI 1O80A 4DNRB 4K6DA 4S3SA 5JPNC 1F2YA 2JEBI 1I4HA 2H1EA 3H3VC 2G9DA 2YYZA 5I6YA 5K36G 2XRQD 1CA6A 2YU9B 1BR9A 2AQ2B 1U4RA 4IURA 3VA7A 3KLSA 1JR0D 3E5SA 1FNVA 1ILPA 1DZ1A 5C0XI 1Q90A 3K59A 3IFDA 4QB4A 2CVRA 3L9AX 1U4LA 1DD2A 4ZKCB 1QOHA 2GA4B 3DEOA 2WIIB 1RTNA 4H0LC 4HN7A 1EYCA 5JAVA 1JWMD 3S2DB 1PRTB 2EY6A 2PZTA 2M9VA 2BE5C 4A3DB 2SNMA 4KN7C 5C3WA 5ELEA 3GP7A 3P1HA 3U9SA 4C56C 4DK0A 1O78A 4XYOA 3ZYYX 2SDFA 1SMYC 4TQUS 4QMGA 3ND8A 3MXUA 1GUGA 2FHTA 2XRSD 4ZQ3A 5IT9E 1GUWA 3Q24A 2PW5A 4F7XA 2NB0A 1KLUD 4FF2A 3NBIA 5LHY1 1EEFD 1FNUA 1KABA 3I4NB 5AFWA 1WTPA 5C0XJ 3HRZC 1A2TA 2KQ3A 4HAEA 4B9XA 4TRDA 3I73A 3K5MA 2F0LA 1TS4A 1G2TA 3K7AB 2N55A 1KDBA 3KF8A 5I9OA 1MSHA 3RMHA 5CV6A 1B1ZA 3LNNA 2RDHA 4K2LA 1RDPD 2XSCA 5C44B 3D4RA 1ML0D 2QDBA 2OEOA 4KD4A 4A3KB 2KOLA 4U673 5I9PA 3PO3B 5FKAC 1RODA 4KKTA 3HOYB 1B50A 4H7BA 5IGCA 3NQTA 2K5DA 2F0EA 2DN8A 3X3MA 2A6HD 2G9HD 1II3A 1GOZA 3P75A 3CU7A 1ET6A 3H94A 1SNQA 2K7VA 2F0PA 1WTQA 5M5XB 1RHPA 1SNMA 3OW7A 3OHXC 5D3DA 1NAPA 1STGA 4X3TA 3OIQA 4FNFA 4ZKBB 5EPJA 4CKCA 3VR6A 1SAPA 1LT5D 3VR5A 1PTOD 1MSGA 1UAPA 1C48A 1LTAD 1IW7D 2AQ3B 3K58A 1D6EC 1PZKD 5JPMC 2IL8A 1TU2B 2XIWA 1RTOA 3CHBD 3EA6A 2EYLA 5CBEE 1RF2D 4FXKC 1EQVA 2Z1CA 4EQNA 5CORA 2B2WC 2CW0C 1EY9A 3I4MB 1YNJD 1FYCA 4NKLA 1H9MA 1TIID 2F0KA 1IYUA 1S5FD 3G7LA 3S1MB 1I4XA 5IGGA 1B9NA 2B2TA 5CBAE 3M7GA 4PMCA 2L11A 3PV0A 4R8IA 2PQEA 2FMMA 5COYA 1HA6A 4HCEA 4FYDA 1SE2A 2F0DA 5JJZA 4TKOB 2WINB 3P20A 4WRDA 2B2UA 3J80L 1G91A 1H9SB 2BA0A 3NWSA 4DN4M 1W6JA 2H4OA 2QEJC 1X32A 5BN5A 2L9HA 1B44D 1TR5A 5KNBA 2F1MA 3S1NB 3I8ZA 3MAQA 4OGQC 1Y8NB 5M5WB 3HP3A 1WTXA 3VR3A 2A73B 2Q8TA 4HEDA 4HCSA 5KGUA 4DXGA 1L0YB 1CHQD 1S5ED 2EPBA 1HRJA 4LAAA 4EQOA 5ELCA 1TWCB 4LK1C 4R8NA 2X6GA 1U4MA 2EY2A 1J8IA 3X3NA 2R7ZB 5IGDA 2B2YC 1OO9B 3R93A 1IKMA 3T13A 3MFGA 2EXZA 1D5MC 4CKBA 4RGOS 5CMDA 3SK6A 1GUOA 2WACA 4H44C 4FF1A 1STNA 4V190 2O5IC 4A3GB 3GV6A 5T1IA 3TP7A 3DWAA 3SK4A 1O7YA 2QKIC 3H0GB 3IFTA 3J81L 2NYZD 1F2ZA 5C5MA 1G291 4CJ0B 5FO9B 3QOLA 4ODGA 1O7LA 3NWTA 2F0HA 3M4OB 2LMCB 2RKSA 4A3MB 2NVQB 4HSPA 1SNDA 2N88A 4X3UA 4F88A 1WTWA 4X3KA 1W6KA 1OXXK 4XQJA 2VUMB 5IT9L 1DOLA 2QILA 1JICA 3AMUA 1HCZA 1X3QA 2MP1A 2F0VA 1AW7A 2L55A 3C1FA 2LFNA 1U9RA 3OWEB 2JA7B 1QILA 1SE3A 2XNAC 1B53A 1TT2A 3GTKB 1AEXA 4G7OC 1EYDA 2QF7A 1JQYD 1Y1VB 2C9OA 2A6HC 4IUVA 3I4LA 1EY4A 1F9PA 4KJOA 5KYIA 4N9PA 4OL7A 5EKKA 1CM9A 2NWGA 5J22A 3S15B 1CQFA 1DM0B 1SSOA 3VYRA 4C3HB 4O1NA 1BCPD 3LWUA 4XQNA 3K57A 1JOKA 3BDCA 2K33A 1HPCA 2I07B 1PTOC 1ZKOA 1SJED 4L63B 4QUFA 1IW7C 2K5WA 3HG9A 2A68D 3FPPA 3QO2A 3QIAA 1SBBB 2TSSA 1M4VA 3H6MA 5C5LA 1CZGA 5LL6S 1G2SA 3NE5B 3J7YW 5I2XA 1HTLD 1A6XA 2MPMA 1AZPA 2D2CC 3DUZA 3C2PA 4C3HG 5E3FA 5IGEA 3D31A 3IAYA 5DM63 3FVQA 1YNJC 2WAQB 1BCPB 1Q8IA 4TSSA 3SXHA 2VNUD 3TP6A 4RCOA 4CGYB 4K8IA 3UI2A 2Z4HA 4XT1B 4K8JA 4G57A 5KRUA 2ZXRA 1HHVA 1S4ZA 4IALA 2K28A 4DAVA 2HCIA 2BCOA 4XQQA 1Y8PB 1EY8A 2ZT9C 1IKLA 3SHLA 3PUXA 3FKIB 3M4YA 5I6WA 3D6CA 3I91A 2NUCA 1L0XB 1ENCA 2Q8IB 3BDOA 1XYIA 4RA8A 2KUMA 1NSNS 1MI2A 2JP1A 4X3SA 1WCMB 2IJ0A 4A3BB 3VYUA 3BG3A 2WV6D 2O4XA 4PV1C 1KDAA 1Y69U 4NW2A 1M8AA 1LTTD 3HEJA 4V0BA 3D4DA 3KLRA 3VYTA 4K5WA 2Z8LA 5C3XA 1LTGD 4K5XA 1PRTF 4KTAA 2BDOA 4G7HC 2EJMA 4RHRA 1K8OA 3MTSA 3VA5A 4I7ZC 5JVG3 1EZ6A 1SDFA 2L1BA 3LX0A 4DAPA 1K83B 3GTMB 1JCKB 3OMCA 3J81E 2RSOA 3A56A 4RCNA 1QNKA 4M1UB 1TWHB 3QG1A 2IX3A 1H9SA 4KV6A 5J39A 1U4PA 4Y7NB 4KK7A 4A3FB 3RUZA 2ICIA 2EZVA 3MEHA 3GTJB 3T16A 4RGTA 1F9SA 2EVBA 3L3OC 3TMEA 2HCCA 5IOCA 1IL8A 3MXPA 2B8FA 5M3MB 1EZ8A 1CK1A 3I90A 5DEHA 3A7AB 1MGSA 1EY7A 3BVGA 2NBFA 1R9TB 3OWFA 1NCVA 4CBVA 4FXDA 1SNPA 2O2LD 4EVOA 1PFNA 5TSSA 1AN8A 4IQZA 1LLRD 5T1GA 2NTTA 3E0JA 2PZWA 3CRLC 2FMCA 5C6AA 1H9KA 4O42A 3I72A 3K5LA 3C1EA 5EKIA 1STEA 4DGZA 1STBA 1I4PA 1BCPC 1JWUD 3MHBA 5FLXE 2FFKB 5I2YA 3A8KE 3PUWA 1I4RA 2HQEA 3NTHA 5A2QE 3R8BA 1Q1EA 3HS0C 5CV4A 5F2DA 3FEWX 3KLSX 2A68C 4UDUC 4MIUA 3M7NA 3CQZB 4HTHA 2EYPA 5G3LF 3J7AV 1A15A 5IGFA 1HQRD 2R3ZA 3A8IE 2A6ED 3G6JB 4PNYA 2VB2X 1EY5A 3NHHA 2KVMA 3TZDA 1EU3A 1A3UA 1F9RA 1DXMA 2EOTA 1BOSA 1V1OA 2RDFA 5ISRA 4OHJA 3IL8A 1Z47A 3NBHA 4F8MA 2EJFC 1PMRA 1MBYA 5KNCA 1HFNA 5FO7B 2EY1A 1ESFA 2B39A 3FDTA 1BBXC 2PMZB 1E2VA 3HKZB 3J7AF 3A8JE 4F87A 4RAUC 4H13C 2F4IA 1PTOB 2J0TD 4XXEA 2ZXPA 4KHVA 4ZYSA 4ZK9B 1LTBD 4IFDG 5HGTA 5ELFA 2MUYA 2WP8J 3FMCA 3L7ZC 4DFAA 4LJZC 2FINB 2KEEA 1WVLA 5C4XB 3V05A 1E2WA 1TWFB 2SNSA 1LTSD 3R2IA 2EJGC 1B3AA 1BF4A 1B4OA 2K32A 2QCPX 4IUTA 4CKEA 3A54A 4IZ8A 4J8QA 2J7ZA 4C2MB 4JK1C 3EJIA 4K5VA 3SE0A 1BXTA 1TY2A 1JWSD 4DXFA 2E2IB 4OIJA 4PMWA 2XVSA 3KUPA 4BBSB 3KK7A 2PNRC 1OXUA 2R61A 1RKNA 2JSOA 4RFBA 4KI0A 4BA2I 1IHZA 2D62A 4G7ZC 3U9OA 2F3WA 3CKIB 1DCZA 4XIGS 1SE4A 2LKVA 2ZXOA 4ID6A 1PZJD 5KEEA 3MXGA 3NXWA 3BVZA 5CYUA 4IFDI 2R93B 1ET9A 2D9UA 4CJ2C 1C4QA 2VXWA 4EQPA 2IT1A 4ULLA 2B2WA 1C8CA 1KLGD 1SYCA 1AP0A 1S5BD 1SXTA 1VMCA 1QG7A 2DY7A 1SYFA 3SK8A 2A74C 2TMPA 4DA2A 2KEDA 2IPKD 1EIHA 5IODA 1VCIA 3H09A 1LACA 2Y0SB 4QCLA 1A3TA 4DNTB 1Q1BA 1STYA 4HSVA 1R4PB 2KJXA 5A35A 2F0JA 1A3VA 4WORA 2L12A 5D3IB 4B9WA 1X3PA 3DWPA 1KNEA 1DOKA 3E6ZX 2LY7A 3TSSA 4K14A 2BDNA 1JC7A 1SEBD 3QOJA 3K0YA 3MZ5A 3EQLC 2D5DA 4RGNA 2KHSA 1CI3M 3RLFA 3C46A 3CRKC 2F3VA 4Z9CB 4C3JG 2F0GA 1CA5A 3PUYA 3S1QB 4A3JB 4IFDJ 5KYLA 1I6VC 2EY5A 2F0OA 2NVTB 4CJ1B 2JYOA 3GTQB 1SYDA 4ME5A 2ENBA 1Y8OB 1EU4A 1PYWD 3W2DA 5C4HA 4M8AA 4DAYA 2B2VC 3V96A 3SDZA 3HOZB 3ONAB 1MD2D 1LT4D 2A6EC 1FR3A 2ICEC 2LS01 5FLXL 1WTVA 2B2YA 1K8MA 4OO1G 3OIPA 1LTRD 5A2QL 4BWGB 1V1PB 5FK9C 1QE6A 1BCPF 1PDQA 4PMBA 1HQMC 1BUVT 4KMUC 4J1MA 4BBRB 3TP5A 1F9QA 3PUZA 5C3EB 2E76C 4QF4A 4RGMA 4R9WA 2DNEA 2CQAA 1HFGA 1SNCA 1EOTA 3MC0B 2PO4A 4IFDH 1FNWA 2E74C 5D65A 3M3YB 1GXDC 3R3OA 1ESRA 1CQVA 1TWAB 1QNUA 1EY6A 5E4XA 2IWHA 1ICWA 2K01A 4ZUIA 2SEBD 1D1KA 1KDCA 1NR2A 3ND9A 3SEBA 2PZUA 1R4QB 2NTSA 4K6LA 2E2JB 4MHEA 4IUQA 4UAIA 5BN3A 2WKCA 2PW7A 1WD0A 3D3RA 2AUJD 5M5YB 2K05A 4RH6A 2M2LA 1YNND 4HR7B 3V2TA 4OO1I 2E2DC 4IUPA 2A69D 5CV8A 1HUMA 3D8GA 2WKDA 2OT2A 5NUCA 3TDQA 4RKBA 3S9WA 5FO8B 2F0WA 2OF1A 4XT3B 5I4DA 2F0UA 4AYBB 4C3IB 1GJXA 2JA8B 5JEAG 3PMFA 3Q22A 1J9OA 2EE1A 4A3IB 3Q0AA 5DAUA 3S1RB 2EYOA 3OPOA 2K03A 1ZYRD 3P7JA 2EYHA 1QCBD 3TBIB 1I4QA 1PRTD 2L5TA 1HXYD 1LV9A 2ID0A 2VB3X 2BA1A 1H9JA 4KKSA 1LO5D 4C3IG 3MFYA 1OXTA 3ITPA 3MA2B 1KTKA 3S16B 5D14A 2F0SA 3S17B 5IIFA 4E6IA 4ZRZA 2L4NA 1EEID 1DYQA 2JA6B 3GTOB 2NN6G 4FXGC 4KHZA 2O5JC 4BY1B 3AU7A 1ZXTA 3NPPA 4DF7A 3QWNA 4KJNA 1D2BA 3VR4A 1TY0A 3HOWB 4NMZA 3RZOB 3SVMA 3RZDB 1V43A 4RHSA 1EL0A 3OOCA 3EVQA 1RJTA 1I50B 1SYBA 4KD3A 4ZUJA 1SNOA 5EGTA 3DHQA 1F77A 1UEAB 1ENAA 1BO0A 5CGKA 2DY8A 3NP8A 4OO1H 2B2TC 3D4WA 1B2TA 2CHBD 2B63B 3SK5A 2AQ1B 2KCCA 5CV7A 1VF5C 3FRPB 5CC4A 1GUNA 3A55A 3KBXA 2A5HA 5CV9A 2F0MA 2MHVA 1G6ZA 1Q12A 3BDLA 1EFID 4IN3A 4QIWB 4KY5A 2EYFA 1JORA 2B2UC 3S14B 3DEPA 3JAME 1SYEA 3GTLB 2NVYB 4WJWA 3T51B 3BYYB 3MWYW 3NTIA 3RD4A 1H9RA 5KIXA 2NN6I 1GUSA 4NDXA 3AB9A 4JBWA 3TZUA 5C4JB 1NUCA 5DM73 3WDNA 1JB3A 1E2ZA 5IGBA 5JEAJ 5BN4A 3Q6SA 4K2KA 5C0XH 5G3LD 1SYGA 2RA4A 3T53B 2KA7A 3NQIA 5M9OA 1XWEA 3N52A 3A7LA 1EWCA 4B08A 4ILWA 3T56B 4HMIA 1PTOF 5E4WC 2R92B 1QJOA 2F0QA 4GZYC 2E2HB 1EQTA 2K1BA 1A2UA 4OIKA 1T5EA 3MVVA 1E0BA 1CFMA 1ZEQX 1YNNC 4KY7A 3PIP3 2F0NA 5K5PA 1OXSC 2BOSA 5JEAH 3PO2B 5ELDA 2A69C 1DJRD 1TS5A 5KNDA 1V1PA 2X69A 2B8GA 3M85A 1TKWB 1JOOA 2AWOA 1TS3A 1I6HB 4WFN3 2PPBC 5K36H 1SJHD 3O13A 1GHJA 3D6WA 3GO5A 1GHKA 3HZXA 1JOQA 2AUKA 4PQXA 3QJYA 2XWBB 4A93B 4IUNA 1VDZA 4L6TB 3FPUB 2PYKA 1ZYRC 3EFXD 2OXPA 1EWHA 2RVLA 1VMPA 1DOMA 1JE4A 1PRTC 2F0TA 2I46A 1WTRA 2NN6H 5EKLA 2MGSA 2E75C 1HTPA 1LT3D 5LL6X 2HDMA 4L8JA 1D5ZC 3DMUA 2NVXB 2L0CA 3OMGA 1XXGA 5JOBA 1BNZA 3W3AA 3GTGB 4MN3A 3DWQA 4FF4A 5E1FA 3KBGA 5EQ0A 3GQBA 3K5NA 2MJ8A 1CZWA 1VF7A 4ABNA 1T5XD 1O7ZA 5DNFA 4LMQD 4QUCA 4CHTB 3H91A 4EGVA 2F0FA 1LTID 3PUVA 2RSNA 5EPLA 2Z4IA 5EBDA 5EPKA 2NZ1D 2JE6I 4C3JB 4YIJA 1CHPD 4DK1A 1UNSA 2R6GA 4FP5D 1LT6D 1KAAA 3F2UA 2BE5D 1EY0A 1FGBD 3SR1A 2F03A 3PIO3 3BVMA 1Z7TA 5C4ZA 2RBMA 4Q0FA 1EYAA 3OSOA 2EYMA 4ZAIA 4FVMA 1SMYD 4Q5VA 1STAA 2RQXA 2SOBA 2AWNA 1Z6HA 1CTMA 2C5CA 1S5DD 4HMJA 1S5CD 1NR4A 1RCVD 2JXMB 3K6OA 4KY6A 1IYVA 3WOFA 4DU9A 1LABA 1QWYA 4XDXA 1ONLA 4G4KA 1I3QB 1QB5D 2IW3A 2DNCA 3BYTB 1XTCD 2KECA 5J1ZA 5JVH3 4XTCS 3R2TA 2PCFB 4BS9A 1AZQA 4BY7B 3BS1A 3NK9A 2K04A 4C1NK 3NSWA 1UUPA 3JAML 1TVXA 2K6AA 1CT1D 3VYSA 4IUUA 4XYQA 3TP8A 5CR3A 4FO2A 3NTKA 3GV3A 1TQOA 3WOEA 1OXVA 4P2CB 4N9TA 1V8QA 4ZLTF 1ENFA 3IKJA 3LWEA 2M00A 1F2LA 4NP5A 2RDGA 2IX1A 1TS2A 2XWJB 4FF3A 2K5QA 3GTPB 2XN9C 2HDLA 2EYJA 5FOBB 1FD7D 1Q3LA 3TN2A 1G8ZD 3BZDB 2HUGA 4I65A 2Q8RE 4RWSC 1WTOA 2EDGA 2WB1B 3N6RA 1EIGA 3HOVB 1SFOB 1D5XC 1PFMA 5HURA 1XX8A 3S2HB 1PXUA 3EROA 4C1NI 3VR2A 5C0XG 2X6LA 4KN4C 1HUNA 1Y1WB 3HOUB 1BQQT 5ELBA 3I70A 3C3LA 1PFBA 1PTOH 1ILQA 1I4GA 3Q23A 2F0IA 3HGBA 1D1IA 1PZID 4J6HA 4BA1I 3K5OA 2CW0D 1RD9D 3J80E 3DM1A 5CV5A 1PLFA 5EJWA 3I3CA 2JA5B 1B9MA 2KCNA 1TWGB 4A3EB 3GD7A 1STHA 3DXJC 1BDOA 4U68A 5M3FB 3NUCA 1HA5A 3MXNA 1KNAA 1GUTA 1WD1A 1AFPA 3URYA 1DONA 2J4XA 1F2MA 3HOXB 2B2VA 4KKUA 2V4DA 2FJ2A 3ERQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYD A;  2F0F A;  3QB3 A;  4RKL A;  1JOO A;  3SHL A;  3TME A;  5IGF A;  4K14 A;  1JOR A;  3EJI A;  2M00 A;  4NP5 A;  1A2T A;  1EY4 A;  4K5V A;  4KJO A;  4ZUI A;  3T13 A;  5KYI A;  2EYL A;  4K6D A;  1KDC A;  4PNY A;  2EXZ A;  5IOC A;  5I6W A;  3QOJ A;  4S3S A;  1EY5 A;  3D6C A;  3MZ5 A;  2KQ3 A;  3NHH A;  4N9P A;  1EQV A;  1F2Y A;  2NUC A;  3ITP A;  4YIJ A;  2KHS A;  4EQN A;  3HZX A;  4B9X A;  3MXP A;  1ENC A;  1A3U A;  2PZU A;  4OL7 A;  4TRD A;  5EKK A;  3SK6 A;  1JOQ A;  1EY9 A;  2F3V A;  1EZ8 A;  2WAC A;  2EYJ A;  2F0L A;  1KAA A;  5DEH A;  5J22 A;  5KIX A;  1NSN S;  4NKL A;  5I6Y A;  2F0G A;  4IUN A;  2F0S A;  1EY0 A;  1EY7 A;  1KDB A;  1STN A;  2RDF A;  3OWF A;  4NDX A;  3SR1 A;  5ISR A;  5IIF A;  2F0K A;  1NUC A;  3TP7 A;  2PYK A;  5I9O A;  3SK4 A;  5CV6 A;  4E6I A;  5KYL A;  4I65 A;  5IGG A;  5C4Z A;  2RBM A;  1F2Z A;  1EYA A;  2EY5 A;  3OSO A;  2EYM A;  1RKN A;  1SNP A;  2F0O A;  2OXP A;  3E5S A;  1JOK A;  4PMC A;  3BDC A;  5C5M A;  2PW7 A;  4F8M A;  1STA A;  4K2L A;  5IGB A;  1IHZ A;  3QOL A;  4K2K A;  2PQE A;  2SOB A;  4EVO A;  1SYD A;  2O4X A;  4ME5 A;  1KDA A;  1SYG A;  2ENB A;  4ODG A;  2QDB A;  2F3W A;  2OEO A;  3U9O A;  4DF7 A;  4KD4 A;  5HUR A;  2F0H A;  3HEJ A;  5C4H A;  3D4D A;  2EY1 A;  4KJN A;  5M9O A;  2F0T A;  4HMJ A;  4QB4 A;  2F0D A;  2RKS A;  3ERO A;  5I9P A;  4NMZ A;  2LKV A;  2PZW A;  3V2T A;  4ID6 A;  1SND A;  4KY6 A;  5EKL A;  3H6M A;  5C5L A;  4DU9 A;  4K5W A;  4WRD A;  3ERQ A;  5CV8 A;  5C3X A;  5KEE A;  4K5X A;  4H7B A;  5C6A A;  4HMI A;  3NQT A;  5IGC A;  2F0E A;  3NXW A;  1EYC A;  3D8G A;  5JAV A;  4KTA A;  3EVQ A;  5J1Z A;  5E3F A;  2F0I A;  3DMU A;  5NUC A;  5IGE A;  2EY6 A;  2PZT A;  3OMG A;  1II3 A;  1SYB A;  4KD3 A;  4J6H A;  4KHV A;  4RKB A;  4ZUJ A;  4PMB A;  3S9W A;  1TR5 A;  3P75 A;  2F0W A;  1SNO A;  5EGT A;  3C1E A;  4J1M A;  1EY8 A;  5JOB A;  4EQP A;  2F0Q A;  2SNM A;  1SNQ A;  3DHQ A;  3TP5 A;  2OF1 A;  3VA5 A;  5HGT A;  3NK9 A;  2F0U A;  2F0P A;  1EZ6 A;  5C3W A;  4DGZ A;  1STB A;  3LX0 A;  1ENA A;  4DFA A;  3P1H A;  3MHB A;  5CGK A;  3NP8 A;  4QF4 A;  1SYC A;  2F0V A;  3D4W A;  3PMF A;  3OMC A;  5E1F A;  1A2U A;  3C1F A;  3SK5 A;  5CV7 A;  5CV5 A;  1SNM A;  1U9R A;  2HQE A;  1SYF A;  3MVV A;  1SNC A;  2EYO A;  5DAU A;  3SK8 A;  2SNS A;  3SXH A;  5KGU A;  3TP6 A;  5CC4 A;  4QMG A;  5CV4 A;  5F2D A;  5IOD A;  1STH A;  1STG A;  4K8I A;  2EYH A;  4KY7 A;  2F0N A;  4K8J A;  4LAA A;  4EQO A;  5CV9 A;  2F0M A;  5K5P A;  4G57 A;  4ZQ3 A;  3NUC A;  4KV6 A;  5J39 A;  5KRU A;  1A3T A;  3TP8 A;  3BDL A;  3R3O A;  1STY A;  4MIU A;  4R8N A;  5CR3 A;  2EY2 A;  4KY5 A;  2PW5 A;  2F0J A;  2EYF A;  4IAL A;  1A3V A;  1EY6 A;  2EYP A;  1F2M A;  4HTH A;  4WOR A;  3RUZ A;  4B9W A;  4F7X A;  1TQO A;  3MEH A;  1TT2 A;  4IZ8 A;  3T16 A;  5IGD A;  1AEX A;  4N9T A;  1SYE A;  1KAB A; 
#chains in the Genus database with same CATH topology
 5EBC A;  3QB3 A;  4RKL A;  3T4A C;  2IX0 A;  2JEA I;  1O80 A;  1XTD A;  4DNR B;  3JAM i;  4K6D A;  1SR3 A;  4S3S A;  1UEB A;  5JPN C;  4DUZ Q;  1F2Y A;  2LXK A;  3ULL A;  4OWW B;  1TWC H;  2JEB I;  1I4H A;  2H1E A;  3FKI G;  2G9D A;  3H3V C;  2E2I H;  2YYZ A;  2CKZ B;  5I6Y A;  5K36 G;  2XRQ D;  3PF4 A;  1CA6 A;  4H02 A;  1E22 A;  2V1C C;  2YU9 B;  1BR9 A;  4YCV A;  2ASB A;  2AQ2 B;  1U4R A;  4IUR A;  3VA7 A;  3KLS A;  1JR0 D;  1VQC A;  2N78 A;  3E5S A;  1FNV A;  1EYG A;  1ILP A;  1DZ1 A;  4YWM A;  5C0X I;  1WCM G;  4A3B G;  1Q90 A;  3K59 A;  5FLX c;  3IFD A;  1IXR A;  1PV4 A;  4QB4 A;  2CVR A;  2UXB Q;  1IBM L;  3L9A X;  1U4L A;  4LF9 Q;  1DD2 A;  4ZKC B;  4A3G H;  1QOH A;  2GA4 B;  1HNX Q;  3DEO A;  3H0G H;  2WII B;  1RTN A;  4H0L C;  4HN7 A;  1EYC A;  5JAV A;  1JWM D;  4GKJ Q;  3S2D B;  3KDF A;  1PRT B;  2EY6 A;  2PZT A;  1K73 C;  2M9V A;  4JI6 Q;  2BE5 C;  3M4O H;  2JN4 A;  4LF6 L;  4A3D B;  2SNM A;  4A3M H;  4KN7 C;  1CSQ A;  2NVQ H;  5C3W A;  3UDF A;  5ELE A;  3GP7 A;  3P1H A;  3U9S A;  4C56 C;  4DK0 A;  1O78 A;  4K0K Q;  4XYO A;  3ZYY X;  2SDF A;  1SMY C;  4TQU S;  3STB D;  4QMG A;  3ND8 A;  3MXU A;  2UUB Q;  1GUG A;  1XPO A;  1VQ7 A;  2FHT A;  2XRS D;  3HKZ E;  1NE3 A;  2HHH L;  4ZQ3 A;  2UUA Q;  1U5K A;  5IT9 E;  4DV6 Q;  2VUM H;  5LMN L;  2LSS A;  3UE0 A;  1GUW A;  3Q24 A;  2PW5 A;  4MTK A;  2NB0 A;  4F7X A;  1VQP A;  1KLU D;  1Q8K A;  4FF2 A;  3NBI A;  5LHY 1;  1EEF D;  1Y14 B;  4DV2 Q;  3T1Y L;  2UU9 Q;  1FNU A;  4A3D G;  1KAB A;  3I4N B;  5AFW A;  1WTP A;  5C0X J;  3M4P A;  3HRZ C;  1A2T A;  2JA7 H;  2KQ3 A;  4HAE A;  4B9X A;  4TRD A;  1PHJ A;  3I73 A;  3K5M A;  2F0L A;  1TS4 A;  4GLV B;  1G2T A;  3ICE A;  3K7A B;  2N55 A;  4JI7 L;  5M3M G;  1KDB A;  4A3J H;  3GTK H;  1PVO A;  3KF8 A;  5I9O A;  1MSH A;  3RMH A;  5CV6 A;  1B1Z A;  1Y1V H;  3LNN A;  3S24 A;  4DV7 L;  1ASZ A;  2RDH A;  3K0X A;  4K2L A;  1MKH A;  1RDP D;  2XSC A;  5C44 B;  2Z6K C;  3D4R A;  1ML0 D;  2QDB A;  2OEO A;  4KD4 A;  4A3K B;  4B3R Q;  2KOL A;  2MFI A;  1HR0 L;  4U67 3;  3K81 C;  3S15 H;  5I9P A;  3PO3 B;  5FKA C;  1ROD A;  4C3H H;  1D7Q A;  5FJ8 H;  4KKT A;  1YZ6 A;  3HOY B;  1SRU A;  1B50 A;  4YHH Q;  4H7B A;  5IGC A;  3NQT A;  2K5D A;  2F0E A;  2DN8 A;  3X3M A;  1UE1 A;  2G5D A;  1NTG A;  2A6H D;  4A3C G;  2G9H D;  1II3 A;  1EIF A;  1A0I A;  1GOZ A;  3P75 A;  3CU7 A;  1ET6 A;  3H94 A;  1SNQ A;  4DAM A;  4DK6 C;  1XNQ L;  2K7V A;  5C3E H;  2F0P A;  1Q82 C;  1A63 A;  2IY5 B;  4A3K G;  4GNX B;  1WTQ A;  5M5X B;  4PZ7 A;  1RHP A;  4N8F A;  1PYB A;  1SNM A;  4LF4 L;  3OW7 A;  2F4V Q;  3MXN B;  3OHX C;  5D3D A;  1NAP A;  1STG A;  4X3T A;  3HOY G;  2CH4 A;  3OIQ A;  1YHQ A;  3J7A 5;  4FNF A;  3M3Y H;  4ZKB B;  5EPJ A;  4CKC A;  3VR6 A;  1SAP A;  1EOV A;  1LT5 D;  3VR5 A;  1PTO D;  3CCM A;  4OEL B;  4HIK A;  1MSG A;  1UAP A;  1IBL L;  1C48 A;  1LTA D;  1IW7 D;  4MTN A;  2AQ3 B;  4IJL A;  1VQD A;  1LM0 A;  1D6E C;  1PZK D;  5JPM C;  3K58 A;  2HQL A;  2IL8 A;  1TU2 B;  2XIW A;  1RTO A;  3CHB D;  3EA6 A;  2EYL A;  5CBE E;  1RF2 D;  4FXK C;  4GLX A;  4DR5 L;  1EQV A;  2Z1C A;  4EQN A;  2HIX A;  5COR A;  2FXQ A;  2B2W C;  2CW0 C;  4JPB W;  1EY9 A;  4DV5 Q;  2MO0 A;  3I4M B;  2E2J H;  4DV4 L;  1YNJ D;  1FYC A;  4NKL A;  1H9M A;  1HNZ L;  4R4O A;  1NBW A;  2Y0S E;  1TII D;  2F0K A;  1IYU A;  1S5F D;  3G7L A;  3S1M B;  1I4X A;  5IGG A;  1B9N A;  4DR7 Q;  4JI1 L;  2B2T A;  5CBA E;  3M7G A;  4JI0 L;  4PMC A;  2L11 A;  3PV0 A;  4R8I A;  2PQE A;  1XMQ Q;  2FMM A;  5COY A;  1HA6 A;  4HCE A;  4FYD A;  1SE2 A;  1SN8 A;  4NB3 A;  1N36 Q;  2F0D A;  3W1B A;  1FGU A;  1YIT A;  5JJZ A;  3EBE A;  4DR4 L;  4TKO B;  4JI3 Q;  2WIN B;  3P20 A;  4WRD A;  2B2U A;  1WCM H;  4AH6 A;  3I4M G;  3J80 L;  1G91 A;  5DLQ E;  1H9S B;  2BA0 A;  3NWS A;  2Z9H A;  4DN4 M;  1PH3 A;  1W6J A;  2H4O A;  1G51 A;  4JI8 L;  3CCV A;  3U4V A;  2QEJ C;  1X32 A;  5BN5 A;  4QQB X;  2L9H A;  3CCU A;  4DUY L;  2UXC Q;  3ERS X;  1B44 D;  1TR5 A;  2ZJR A;  5KNB A;  1IZ6 A;  2F1M A;  3S1N B;  3I8Z A;  3MAQ A;  4DV1 Q;  4OGQ C;  4X65 L;  3CC7 A;  1Y8N B;  1PH1 A;  4DV0 Q;  5M5W B;  3HP3 A;  1WTX A;  3VR3 A;  2A73 B;  2GVB A;  2Q8T A;  4HED A;  4HCS A;  2VQF L;  1K8G A;  1L2F A;  5KGU A;  4DXG A;  3CCL A;  1L0Y B;  1CHQ D;  1S5E D;  2EPB A;  1HRJ A;  1E24 A;  1XNR Q;  4LAA A;  1Q86 C;  4EQO A;  3A74 A;  5ELC A;  1TWC B;  1N34 Q;  4YCU A;  4LK1 C;  4R8N A;  2X6G A;  1U4M A;  2EY2 A;  1TXY A;  1K8A C;  1J8I A;  3E0E A;  2F3I A;  3X3N A;  5J3B A;  4LFA L;  2R7D A;  2R7Z B;  1K83 H;  1X55 A;  2QW7 A;  5IGD A;  4WJ3 M;  2B2Y C;  1OO9 B;  3R93 A;  1IKM A;  1N32 Q;  3T13 A;  3MFG A;  2EXZ A;  3OTO L;  2ZTD A;  1D5M C;  4CKB A;  4RGO S;  3S16 H;  5CMD A;  3TS0 A;  1V1Q A;  4B3S L;  1YEZ A;  1M1K C;  3SK6 A;  1GUO A;  2WAC A;  4Y7N H;  3AFP A;  4B3M L;  4A3F H;  3L0O A;  3B6Y A;  3F2B A;  4H44 C;  4FF1 A;  3GTJ H;  1STN A;  4V19 0;  2O5I C;  4A3G B;  3GV6 A;  5T1I A;  3TP7 A;  3DWA A;  3SK4 A;  3STB C;  2QKI C;  3H0G B;  1N9W A;  1O7Y A;  3IFT A;  3TRE A;  4X64 L;  3J81 L;  2NYZ D;  2JA6 H;  1F2Z A;  2OCE A;  3D0F A;  5C5M A;  1G29 1;  4CJ0 B;  5FO9 B;  1GM5 A;  4BY1 H;  3QOL A;  4BBS G;  3G4S A;  2E5L L;  3I4O A;  4ODG A;  1O7L A;  3NWT A;  2F0H A;  4JBM A;  5IYC H;  3M4O B;  3RN2 A;  1XJV A;  2LMC B;  2RKS A;  4A3M B;  2NVQ B;  4JI2 Q;  2ATW A;  4HSP A;  3RZO H;  1I94 L;  4DKA C;  1SND A;  2N88 A;  1R9T H;  4X3U A;  4F88 A;  1HNW Q;  1WTW A;  1J5E L;  2R7F A;  4X3K A;  1W6K A;  2VW9 A;  1B8A A;  1I50 H;  1OXX K;  4JI4 Q;  3PGZ A;  2RF4 A;  4XQJ A;  4JV5 L;  2VUM B;  1VQK A;  5IT9 L;  5HY6 A;  1DOL A;  2QIL A;  1EIY B;  1JIC A;  3AMU A;  4OEM B;  1HCZ A;  1X3Q A;  2MP1 A;  2F0V A;  1AW7 A;  2L55 A;  1UE7 A;  1WTH A;  3C1F A;  2DJG C;  2LFN A;  1U9R A;  3OWE B;  3KF6 B;  3CCE A;  4GNX C;  3J80 i;  1YBY A;  3CF5 A;  2JA7 B;  1QIL A;  4DR1 Q;  3BJU A;  1SE3 A;  2RCN A;  2DJF C;  2XNA C;  1B53 A;  1CKN B;  1HH2 P;  2JA9 A;  3S14 H;  3NBH B;  2K4K A;  4HJ9 A;  2Y0S G;  4HJ8 A;  2RCF A;  1TT2 A;  2QDL A;  3GTK B;  3HFZ B;  1AEX A;  4G7O C;  4IO9 A;  1MJE A;  3EIV A;  1EYD A;  2QF7 A;  1JQY D;  3RLO A;  1BVS A;  1Y1V B;  2VUM G;  2C9O A;  2A6H C;  2BH2 A;  4IUV A;  3I4L A;  1EY4 A;  1F9P A;  4KJO A;  4AYB E;  5KYI A;  1QZH A;  2A8V A;  3U58 A;  4YCW A;  4N9P A;  2KBN A;  4OL7 A;  5EKK A;  4UP7 A;  1CM9 A;  4A3L G;  2NWG A;  5J22 A;  3S15 B;  1CQF A;  1DM0 B;  1X65 A;  5C4J H;  1SSO A;  3VYR A;  2UXD Q;  4C3H B;  3UDG A;  4ME3 A;  1KRS A;  4O1N A;  1BCP D;  3LGJ A;  3LWU A;  4XQN A;  3K57 A;  1JOK A;  3BDC A;  4A3J G;  3KLW A;  2VQE L;  3CCS A;  2K33 A;  1HPC A;  2I07 B;  1PTO C;  1ZKO A;  1SJE D;  4L63 B;  4QUF A;  4AQY Q;  1IW7 C;  2K5W A;  3HG9 A;  2A68 D;  3FPP A;  3QO2 A;  1ICF B;  5AJ3 Q;  3QIA A;  1SBB B;  2TSS A;  3TQY A;  1M4V A;  3H6M A;  2EXD A;  5C5L A;  4JYA L;  1CZG A;  2GN5 A;  1G2S A;  5LL6 S;  3NE5 B;  3J7Y W;  4WJ4 A;  5I2X A;  1HTL D;  3ER0 A;  1A6X A;  4GLA C;  2MPM A;  1AZP A;  2D2C C;  3J81 i;  3DUZ A;  3C2P A;  4C3H G;  5E3F A;  5IGE A;  4NXM Q;  5FJ8 G;  3D31 A;  3IAY A;  5DM6 3;  3FVQ A;  1YNJ C;  2WAQ B;  1BCP B;  1Q8I A;  1X56 A;  2E2H H;  1HZA A;  4TSS A;  4BBR G;  4LFB L;  4JBK A;  3JC6 6;  3SXH A;  1HZC A;  5C3E G;  2VNU D;  1X3E A;  3TP6 A;  4JW0 A;  4RCO A;  4CGY B;  4K8I A;  1WI5 A;  3UI2 A;  2Z4H A;  4ALP A;  4XT1 B;  2KHI A;  4K8J A;  4G57 A;  4X66 Q;  1Z9F A;  5KRU A;  2ZXR A;  1HHV A;  3J81 j;  1S4Z A;  4IAL A;  2K28 A;  4DAV A;  1LUZ A;  2HCI A;  2BCO A;  4XQQ A;  1Y8P B;  1EY8 A;  2ZT9 C;  5C4X H;  1IKL A;  3SHL A;  1TWF H;  3PUX A;  3FKI B;  3M4Y A;  4GNX A;  2K5N A;  5I6W A;  3D6C A;  3I91 A;  2NUC A;  1L0X B;  1ENC A;  2Q8I B;  4CDC C;  2N3S A;  3BDO A;  1XYI A;  4RA8 A;  2KUM A;  1NSN S;  2C35 B;  3EN2 A;  1MI2 A;  4CDF C;  1U0L A;  2JP1 A;  4X3S A;  1WCM B;  2IJ0 A;  4A3B B;  4C2M H;  4IOC A;  4QIW E;  3VYU A;  3BG3 A;  1XPU A;  4DR2 L;  2WV6 D;  2O4X A;  4PV1 C;  1KDA A;  1Y69 U;  4NW2 A;  3SGI A;  1M8A A;  1LTT D;  3HEJ A;  4V0B A;  1AH9 A;  3D4D A;  3AYH B;  2PI2 E;  3KLR A;  5HGQ A;  3VYT A;  4K5W A;  2Z8L A;  1PH5 A;  4BBS H;  5C3X A;  1LTG D;  4K5X A;  1X3F A;  1PRT F;  4KTA A;  4DUZ L;  3CD6 A;  2BDO A;  4G7H C;  2EJM A;  4RHR A;  1VQ4 A;  3JAM c;  4GS3 A;  1K8O A;  1CKM A;  4QL5 A;  3MTS A;  3VA5 A;  4I7Z C;  1VQM A;  5JVG 3;  1EZ6 A;  5IYD H;  5IP7 H;  1SDF A;  2L1B A;  3LX0 A;  5GAE C;  4DAP A;  1K83 B;  4O0A A;  3GTM B;  1JCK B;  3OMC A;  3J81 E;  2RSO A;  2YTX A;  4AYB G;  3A56 A;  4RCN A;  1QNK A;  3ULP A;  4R4Q A;  2JA8 G;  2R93 H;  4M1U B;  1EQR A;  1TWH B;  3QG1 A;  2IX3 A;  1H9S A;  4KV6 A;  5J39 A;  4CDD C;  1X3G A;  1FL0 A;  1U4P A;  1M90 C;  4LF6 Q;  4Y7N B;  4KK7 A;  4LF9 L;  4A3F B;  3RUZ A;  2ICI A;  2EZV A;  1HNX L;  1N8R C;  3PCO B;  3MEH A;  3GTJ B;  3T16 A;  4RGT A;  1F9S A;  1PA6 A;  2EVB A;  3L3O C;  3TME A;  4GKJ L;  4DAY B;  4HIO A;  2HCC A;  5IOC A;  4YY3 Q;  4HIM A;  2PMZ E;  1IBK L;  4JI6 L;  1IL8 A;  3A0J A;  3MXP A;  1RIP A;  2B8F A;  5M3M B;  1YVC A;  1E7Z A;  1EZ8 A;  1CK1 A;  3I90 A;  5DEH A;  3A7A B;  1UE6 A;  1MGS A;  3QR8 A;  1EY7 A;  3BVG A;  4K0K L;  2NBF A;  1R9T B;  3OWF A;  1NCV A;  4CBV A;  4EQ5 A;  3PIP A;  4A3F G;  4FXD A;  1SNP A;  1KAW A;  2O2L D;  4A3L H;  3K8A A;  4EVO A;  1PFN A;  4OWX B;  4IPD A;  2UUA L;  5TSS A;  1AN8 A;  4IQZ A;  2JA6 G;  1LLR D;  4DV6 L;  2N8N A;  5IWA Q;  5T1G A;  2I5L X;  2NTT A;  3E0J A;  1QVC A;  4BY1 G;  4B3T Q;  2PZW A;  4DV2 L;  4O2D A;  2UU9 L;  3S1Q H;  3CRL C;  5IYC G;  3F2D A;  2FMC A;  3HOW G;  5C6A A;  1HR0 W;  2VL6 A;  2VY3 A;  2NVT H;  1H9K A;  4O42 A;  5BR8 Q;  3GTQ H;  4GKK L;  3I72 A;  3K5L A;  1HR0 Q;  1A62 A;  3C1E A;  2K50 A;  3FHW A;  2Q2I A;  3HOZ H;  1VQN A;  5EKI A;  1STE A;  4GN4 B;  1STB A;  4DGZ A;  1N33 Q;  1I4P A;  1BCP C;  1JWU D;  2PNH A;  3MHB A;  4P73 A;  2ALY B;  5FLX E;  2FFK B;  3A8K E;  3PUW A;  5I2Y A;  1I4R A;  3K7U C;  2HQE A;  1GD7 A;  3NTH A;  5A2Q E;  3R8B A;  1Q1E A;  3HS0 C;  5CV4 A;  5F2D A;  3FEW X;  1E1O A;  3KLS X;  1YHB A;  4B3R L;  2A68 C;  4UDU C;  4BBR H;  4MIU A;  3M7N A;  4R4C A;  3CQZ B;  4HTH A;  1Q7Y C;  2EYP A;  3CW2 C;  5G3L F;  3J7A V;  3G71 A;  4J15 A;  1A15 A;  4YHH L;  5IGF A;  1HQR D;  2R3Z A;  3A8I E;  2A6E D;  4LF4 Q;  1YI2 A;  3G6J B;  4PNY A;  2VB2 X;  1UWV A;  1EY5 A;  3NHH A;  2KVM A;  2UUC Q;  3TZD A;  1EU3 A;  1A3U A;  3IRB A;  3KF6 A;  1F9R A;  1DXM A;  3PF5 A;  1TWA H;  2EOT A;  1A8V A;  1BOS A;  1V1O A;  2RDF A;  2ZTE A;  1B3Q A;  5ISR A;  4OHJ A;  3IL8 A;  1CKN A;  1Z47 A;  2F4V L;  2KHJ A;  3NBH A;  4F8M A;  2EJF C;  3HOV H;  1PMR A;  1MBY A;  5KNC A;  1HFN A;  5FO7 B;  2Z6B A;  2EY1 A;  1ESF A;  2B39 A;  2E8G A;  3FDT A;  4LF7 Q;  1BBX C;  4IPC A;  3E9H A;  3NEM A;  2PMZ B;  1E2V A;  3HKZ B;  1KXL A;  3J7A F;  3A8J E;  4F87 A;  4RAU C;  4H13 C;  2F4I A;  1PTO B;  2J0T D;  4XXE A;  2ZXP A;  4UY8 C;  5M5Y H;  4KHV A;  2KEN A;  4ZYS A;  3KOJ A;  4ZK9 B;  3PIO A;  1LTB D;  4N8X 1;  4IFD G;  5HGT A;  3GDE A;  5ELF A;  2MUY A;  2WP8 J;  3FMC A;  3L7Z C;  4DFA A;  3CAM A;  2FIN B;  4LJZ C;  1KD1 C;  2KEE A;  4OX9 Q;  4DR7 L;  1WVL A;  5C4X B;  2JA5 H;  5IY0 A;  1SRO A;  1TWG H;  3V05 A;  1CKO A;  1E2W A;  1TWF B;  4A3E H;  5FLM G;  2SNS A;  1LTS D;  3R2I A;  2EJG C;  3KJO A;  1XMQ L;  3I7F A;  4LW1 A;  1B3A A;  5M3F H;  1BF4 A;  3HKZ G;  1B4O A;  2K32 A;  2QCP X;  1IL2 A;  1JT8 A;  4JCV E;  4IUT A;  2Z6K A;  4C3I H;  4Y52 H;  4CKE A;  3HOX H;  5JJK A;  3A54 A;  4JI3 L;  3T1H Q;  2JA8 H;  4IZ8 A;  3RZD H;  2OQ0 A;  4J8Q A;  4A3I H;  5LMU Q;  2KCT A;  3S1R H;  1KL9 A;  2J7Z A;  3E3X A;  4C2M B;  4JK1 C;  4L5R C;  3EJI A;  4K5V A;  1X9N A;  3SE0 A;  1BXT A;  1TY2 A;  4OXP A;  2QGQ A;  2UXC L;  5C4X G;  1WOC A;  1JWS D;  4DV1 L;  4DXF A;  2K5H A;  2E2I B;  4OIJ A;  4NPS A;  4PMW A;  2XVS A;  3W5O A;  3KUP A;  4P74 A;  2YU9 H;  1MIU A;  3RN5 A;  4BBS B;  4MZ9 A;  3KK7 A;  3E9I A;  2PNR C;  4A93 G;  1OXU A;  1W3S A;  2R61 A;  1RKN A;  5GAH C;  2JSO A;  4RFB A;  4KI0 A;  4BA2 I;  3AEV A;  1XNR L;  1IHZ A;  1VQE A;  2D62 A;  4G7Z C;  3U9O A;  2F3W A;  3CKI B;  1N34 L;  4NXN Q;  3DM3 A;  4L5Q A;  1DCZ A;  2Q2U A;  2PQA B;  4XIG S;  5L37 A;  4DV3 Q;  1SE4 A;  2YTY A;  2LKV A;  2ZXO A;  4ID6 A;  3S17 H;  1PZJ D;  1B70 B;  2MNA A;  1K0S A;  5KEE A;  1HZB A;  3MXG A;  4X64 Q;  1NMG A;  1N32 L;  3NXW A;  3GTO H;  3S2D H;  3BVZ A;  5CYU A;  3TEH B;  4IFD I;  1JJ2 A;  4POF A;  2R93 B;  1JJG A;  1ET9 A;  2D9U A;  4JI5 Q;  1S3O A;  1VQL A;  1JE5 A;  4CJ2 C;  1C4Q A;  2VXW A;  4EQP A;  2IT1 A;  4X62 L;  4ULL A;  2ZM6 L;  2B2W A;  3HOW H;  2WB1 E;  1C8C A;  1KLG D;  1SYC A;  1AP0 A;  1VQ8 A;  1S5B D;  1SXT A;  1VMC A;  1QG7 A;  2DY7 A;  1SYF A;  4IJH A;  3SK8 A;  2A74 C;  2TMP A;  4DA2 A;  4LFC Q;  2KED A;  2IPK D;  5IYD G;  1EIH A;  5IP7 G;  5IOD A;  1VCI A;  3H09 A;  2HD3 A;  1LAC A;  2Y0S B;  5H1S E;  1E3P A;  4QCL A;  1A3T A;  4DNT B;  1Q1B A;  4JV5 Q;  1CSP A;  1STY A;  4HSV A;  1R4P B;  2KJX A;  4JI2 L;  1FJG Q;  2R93 G;  4TVA B;  5A35 A;  2F0J A;  1A3V A;  4WOR A;  2L12 A;  5D3I B;  4B9W A;  3F8T A;  1HNW L;  1X3P A;  5ELO A;  3DWP A;  3I4N H;  4HJA A;  1KNE A;  1DOK A;  1PH7 A;  2B63 H;  3E6Z X;  2LY7 A;  3TSS A;  4K14 A;  2BDN A;  3CCJ A;  1JC7 A;  1SEB D;  4JI4 L;  3QOJ A;  3K0Y A;  1S40 A;  3MZ5 A;  3EQL C;  2D5D A;  4RGN A;  2KHS A;  1CI3 M;  3RLF A;  1ASY A;  4LF5 Q;  3C46 A;  3CPW A;  3CRK C;  1YJ9 A;  2F3V A;  4Z9C B;  1AE2 A;  4C3J G;  2F0G A;  1CA5 A;  1XMO Q;  3PUY A;  3K80 C;  3S1Q B;  4A3J B;  2ES2 A;  1CUK A;  3GTL H;  4IFD J;  2NVY H;  5KYL A;  1I6V C;  2EY5 A;  2F0O A;  2AHO B;  4DR1 L;  5C44 H;  2NVT B;  4CJ1 B;  2JYO A;  4BXX H;  3GTQ B;  1SYD A;  4ME5 A;  2ENB A;  2I0Q A;  1Y8O B;  3J80 c;  2NZH A;  1EU4 A;  1PYW D;  3W2D A;  5C4H A;  4YWK A;  4M8A A;  4DAY A;  3PO3 H;  2B2V C;  3V96 A;  1C7Y A;  3SDZ A;  3HOZ B;  3ONA B;  1MD2 D;  1LT4 D;  2A6E C;  1VQH A;  1FR3 A;  1K9M C;  2ICE C;  2LS0 1;  5FLX L;  5IYB H;  1WTV A;  1VQF A;  4R1J A;  2B2Y A;  1K8M A;  3PQI A;  4OO1 G;  3OIP A;  1LTR D;  5A2Q L;  4BWG B;  4QY7 A;  1V1P B;  5FK9 C;  4EX5 A;  4HID A;  1QE6 A;  1BCP F;  1PDQ A;  4PMB A;  1QVG A;  1HQM C;  1BUV T;  3PSI A;  2B29 A;  4J1M A;  4KMU C;  4DR3 Q;  4BBR B;  3TP5 A;  1HJP A;  1NMF A;  1F9Q A;  4PG3 A;  3PUZ A;  1PFS A;  5C3E B;  2E76 C;  4QF4 A;  4JYA Q;  4RGM A;  4R9W A;  3UDI A;  3BZK A;  2DNE A;  2CCZ A;  2CQA A;  1HFG A;  2EIF A;  1SNC A;  3HOZ G;  1EOT A;  3MC0 B;  4DR6 Q;  2PO4 A;  4IFD H;  2R92 H;  1FNW A;  2E74 C;  5D65 A;  4AQY L;  3M3Y B;  1GXD C;  3R3O A;  1ESR A;  5AJ3 L;  1YJN A;  1CQV A;  1TWA B;  1QNU A;  1EY6 A;  5FLM H;  2BH8 A;  5E4X A;  3RLN A;  1VQ6 A;  4LF8 Q;  4PZ8 A;  1RL2 A;  4R4I A;  4A4I A;  5IP9 H;  4UPA A;  2IWH A;  1ICW A;  1VQJ A;  3KYH C;  2K01 A;  5ELN A;  4ZUI A;  4NXM L;  2IHE A;  2SEB D;  1D1K A;  1KDC A;  1NR2 A;  1P16 A;  3ND9 A;  3SEB A;  3U4Z A;  2PZU A;  1MHW C;  1R4Q B;  3PO2 H;  2NTS A;  4K6L A;  1VQI A;  2E2J B;  4MHE A;  4IUQ A;  1GVP A;  3S1M H;  1YHA A;  1PYS B;  4UAI A;  5BN3 A;  2K5V A;  2F52 A;  1I6H H;  2GVA A;  3M9B A;  2WKC A;  2PW7 A;  1WD0 A;  3D3R A;  4KHP Q;  2AUJ D;  2XTI A;  5M5Y B;  2K05 A;  2K75 A;  4RH6 A;  2M2L A;  1YNN D;  3KFU A;  1MJC A;  3HOV G;  3NEN A;  4HR7 B;  4A93 H;  2Z0S A;  1G6P A;  3V2T A;  4OO1 I;  2E2D C;  4IUP A;  2HIV A;  1Q46 A;  2A69 D;  2D0O A;  3OYY A;  5CV8 A;  1HUM A;  4LUZ A;  2P5Z X;  5IT9 c;  2I5H A;  3D8G A;  2WKD A;  2OT2 A;  5NUC A;  4IPG A;  5GAD C;  3TDQ A;  1KC8 C;  1SMX A;  4RKB A;  3S9W A;  3S1N H;  3A5Z B;  5FO8 B;  1E1T A;  2F0W A;  2YTV A;  2OF1 A;  3M4Q A;  4XT3 B;  4AYB B;  2F0U A;  4C3I B;  5I4D A;  1GJX A;  4ZCK A;  2JA8 B;  3TRZ A;  4P72 A;  5JEA G;  3PMF A;  3Q22 A;  1J9O A;  2EE1 A;  3G6E A;  4A3I B;  3Q0A A;  1PH9 A;  5DAU A;  4DK3 C;  3S1R B;  2EYO A;  2A19 A;  3UE1 A;  4GOP B;  3OPO A;  2K03 A;  1ZYR D;  3G48 A;  2NVX H;  3P7J A;  2EYH A;  1H95 A;  4JBJ A;  2JA5 G;  1QCB D;  4A3E G;  3TBI B;  2KCM A;  1Q81 C;  1P8L A;  2R7Z H;  5M3F G;  1I4Q A;  1IBM Q;  1PRT D;  2L5T A;  3GTG H;  1HXY D;  4X6A H;  1LV9 A;  2ID0 A;  3UDX A;  2VB3 X;  2BA1 A;  4JG2 A;  4LNQ A;  1H9J A;  4KKS A;  1LO5 D;  4C3I G;  3HOX G;  1X6O A;  4UHV A;  3MFY A;  1OXT A;  1K3R A;  3ITP A;  3MA2 B;  4A3I G;  4PZ6 A;  1KTK A;  3S16 B;  5D14 A;  2UXB L;  1PH2 A;  1QUQ B;  2F0S A;  4CDE C;  3S17 B;  4LUO A;  5IIF A;  4JOI C;  4IPH A;  4E6I A;  2AMC B;  4ZRZ A;  2L4N A;  1EEI D;  1DYQ A;  2JA6 B;  3GTO B;  3CPF A;  2NN6 G;  4FXG C;  4KHZ A;  3H3V H;  5LMN W;  2O5J C;  4C3J H;  4BY1 B;  1WFQ A;  3AU7 A;  1ZXT A;  3I2Z A;  3NPP A;  4DF7 A;  1IBK Q;  2HHH Q;  4DNI A;  1JMC A;  3QWN A;  4KJN A;  1D2B A;  1EFW A;  3VR4 A;  1TY0 A;  5LMN Q;  1VQA A;  3HOW B;  4NMZ A;  5GRO A;  2YV5 A;  3RZO B;  3SVM A;  3RZD B;  1WJJ A;  1V43 A;  3MEF A;  3T1Y Q;  4RHS A;  1XPR A;  1EL0 A;  2K14 A;  3OOC A;  4YY3 L;  1D8L A;  2UUB L;  3EVQ A;  1RJT A;  2K52 A;  1I50 B;  1SYB A;  4KD3 A;  4ZUJ A;  1UE5 A;  1JB7 A;  4HJ7 A;  1SNO A;  5EGT A;  2B3G A;  3DHQ A;  1F77 A;  1UEA B;  1ENA A;  1BO0 A;  2DY8 A;  3NP8 A;  5CGK A;  3CCQ A;  4OO1 H;  4JI7 Q;  2B2T C;  3D4W A;  1B2T A;  2CHB D;  2PQA A;  2B63 B;  3SK5 A;  1I3Q H;  2KCC A;  2AQ1 B;  5CV7 A;  4DV7 Q;  1PH8 A;  4L5S A;  1VF5 C;  3FRP B;  3HKS A;  1VQG A;  5CC4 A;  1GUN A;  3A55 A;  3KBX A;  4APV A;  4GKK Q;  2A5H A;  2A1A A;  5CV9 A;  2F0M A;  2QEX A;  1YIJ A;  2MHV A;  1C9O A;  5IWA L;  1G6Z A;  1Q12 A;  3BDL A;  1LYL A;  1EFI D;  4IN3 A;  4BY7 H;  4QIW B;  4B3T L;  4KY5 A;  1AE3 A;  2EYF A;  1JOR A;  2B2U C;  3S14 B;  3DEP A;  3FP9 A;  3F2C A;  3JAM E;  2L15 A;  2OWO A;  1QZG A;  1SYE A;  3GTL B;  1FVI A;  2NVY B;  4WJW A;  3T51 B;  1KQS A;  3BYY B;  5BR8 L;  1S72 A;  4DPG A;  4POG A;  3I4N G;  3MWY W;  2B63 G;  4UP9 A;  3NTI A;  3RD4 A;  1H9R A;  4IOA A;  5KIX A;  1N33 L;  1B7Y B;  2NN6 I;  1XNQ Q;  1GUS A;  1PH4 A;  4NDX A;  3AB9 A;  4JBW A;  3TZU A;  5C4J B;  1NUC A;  3CME A;  5DM7 3;  2AKW B;  3WDN A;  1JB3 A;  1E2Z A;  1SLJ A;  5IGB A;  5JEA J;  5BN4 A;  3Q6S A;  4K2K A;  5C0X H;  5G3L D;  1SYG A;  2RA4 A;  3T53 B;  2KA7 A;  1O7I A;  2QA4 A;  3GTP H;  3NQI A;  5E7N A;  5M9O A;  1XWE A;  3N52 A;  3AFQ A;  5C44 G;  2JK8 A;  4BXX G;  3A7L A;  1EWC A;  1IBL Q;  1VQ9 A;  4B08 A;  1KIX A;  1L1O B;  4ILW A;  3T56 B;  3PO3 G;  4JOI A;  4HMI A;  1PTO F;  5E4W C;  2ZJP A;  2EQS A;  1SFO H;  1OTC A;  2UUC L;  4KLK A;  2R92 B;  4DR5 Q;  2ZTC A;  1QJO A;  5IYB G;  5JJI A;  1K28 A;  3S2H H;  2F0Q A;  4HJ5 A;  5JJL A;  4DV4 Q;  2OTJ A;  1Y1W H;  1QVF A;  3HOU H;  4GZY C;  1HNZ Q;  1X54 A;  2E2H B;  1EQT A;  2K1B A;  1A2U A;  4JVZ A;  4GN5 A;  4OIK A;  1T5E A;  3MVV A;  1VQ5 A;  1E0B A;  1CFM A;  4JI1 Q;  2Q2T A;  4JI0 Q;  1SE8 A;  1ZEQ X;  2JQO A;  3F1Z A;  1YNN C;  4KY7 A;  3PIP 3;  4GOP C;  2F0N A;  5K5P A;  1OXS C;  2BOS A;  5GAG C;  4DV5 L;  5JEA H;  3PO2 B;  5ELD A;  3RNU A;  2A69 C;  1EWI A;  1BKB A;  4LF7 L;  1DJR D;  1TS5 A;  5KND A;  1V1P A;  2X69 A;  2R92 G;  4DR4 Q;  2B8G A;  2WFW A;  3M85 A;  1TKW B;  1JOO A;  2AWO A;  3FKI H;  1TS3 A;  1I6H B;  4WFN 3;  2PPB C;  5K36 H;  1SJH D;  3O13 A;  1GHJ A;  3D6W A;  4JI8 Q;  3GO5 A;  1GHK A;  3HZX A;  4P71 A;  5IP9 G;  1JOQ A;  4DUY Q;  1BBU A;  2AUK A;  1HZ9 A;  1N36 L;  4PQX A;  3QJY A;  2XWB B;  4X65 Q;  1VQO A;  4A93 B;  4IUN A;  1VDZ A;  4L6T B;  1I5F A;  3FPU B;  4OX9 L;  3KDF B;  4A3B H;  2PYK A;  3PO2 G;  1DGS A;  1ZYR C;  3EFX D;  2OXP A;  2VQF Q;  2RHQ B;  1EWH A;  2RVL A;  1T9H A;  1VMP A;  1EQQ A;  1DOM A;  1JE4 A;  1PRT C;  2F0T A;  2I46 A;  3T1H L;  2JJQ A;  4DV0 L;  1WTR A;  5EAY A;  3RR5 A;  2NN6 H;  4LFA Q;  5EKL A;  2MGS A;  5LMU L;  1GO3 E;  2E75 C;  1HTP A;  1KRT A;  4LWC A;  1LT3 D;  5LL6 X;  2HDM A;  4L8J A;  1D5Z C;  3CC2 A;  3DMU A;  2NVX B;  2L0C A;  3OMG A;  3OTO Q;  3WWV A;  1XXG A;  4RMF A;  4RG1 A;  4B3S Q;  5JOB A;  1BNZ A;  3W3A A;  4MNO A;  4B3M Q;  2CFM A;  3GTG B;  3GTM H;  4MN3 A;  3DWQ A;  4L5T A;  3W1G A;  4FF4 A;  4GN3 B;  5E1F A;  3OW2 A;  3KBG A;  5EQ0 A;  1TWH H;  3GQB A;  4OON A;  4NXN L;  2E5L Q;  3K5N A;  2MJ8 A;  3KF8 B;  1CZW A;  4A3D H;  1VF7 A;  4DV3 L;  4ABN A;  4X62 Q;  1T5X D;  2ZM6 Q;  1O7Z A;  2MQH A;  5DNF A;  4LMQ D;  1JJC B;  4QUC A;  4CHT B;  2NZO A;  1I94 Q;  3CP0 A;  3H91 A;  4EGV A;  2F0F A;  2WAQ E;  1J5E Q;  1LTI D;  3PUV A;  2RSN A;  5EPL A;  2CQO A;  2Z4I A;  2R7Z G;  5EBD A;  5EPK A;  2NZ1 D;  4JI5 L;  2JE6 I;  3CXC A;  4C3J B;  4YIJ A;  5M3M H;  1CHP D;  4OWT B;  4DK1 A;  1UNS A;  2R6G A;  4GOP A;  4FP5 D;  1LT6 D;  1KAA A;  3F2U A;  4R4T A;  2BE5 D;  1EY0 A;  1FGB D;  3SR1 A;  2F03 A;  5GQO A;  3PIO 3;  3BVM A;  4LFC L;  3A5U A;  1Z7T A;  5C4Z A;  2RBM A;  2Q2H A;  4Q0F A;  1EYA A;  3OSO A;  2EYM A;  4ZAI A;  4FVM A;  1SMY D;  4Q5V A;  4A3G G;  1STA A;  2RQX A;  2SOB A;  3H0G G;  2AWN A;  3U50 C;  1Z6H A;  1CTM A;  2C5C A;  1S5D D;  1FJG L;  4HMJ A;  1S5C D;  1NR4 A;  2CWA A;  3K7A H;  1KHI A;  1RCV D;  2JXM B;  3NEL A;  3Q8D A;  4P75 A;  3K6O A;  4LUV A;  4KY6 A;  4A3C H;  3WOF A;  1IYV A;  4DU9 A;  1LAB A;  1QWY A;  4XDX A;  1ONL A;  4G4K A;  4A3M G;  1I3Q B;  1QB5 D;  2IW3 A;  1QUQ A;  4UP8 A;  2DNC A;  3BYT B;  1XTC D;  1L1O C;  2KEC A;  5J1Z A;  1V9P A;  1BBW A;  5JVH 3;  4XTC S;  3R2T A;  5IE8 A;  4LF5 L;  2RHS B;  2PCF B;  4A3K H;  4BS9 A;  1VS0 A;  1NY4 A;  1EUJ A;  1AZQ A;  3I56 A;  4BY7 B;  3BS1 A;  3NK9 A;  1XMO L;  2K04 A;  4C1N K;  3NSW A;  3HOY H;  1UUP A;  2I5M X;  4AIM A;  3JAM L;  1GKH A;  1TVX A;  2K6A A;  1CT1 D;  3VYS A;  3KJP A;  4IUU A;  4XYQ A;  2VQE Q;  3VDY A;  3H15 A;  3TP8 A;  2JA7 G;  3CQZ H;  5CR3 A;  4FO2 A;  2HT1 A;  3NTK A;  1VQB A;  3GV3 A;  4QJF A;  1TQO A;  4FDB A;  4JC0 A;  3WOE A;  2UXD L;  1OXV A;  2MO1 A;  5M5X H;  4P2C B;  4N9T A;  1V8Q A;  4BY7 G;  4ZLT F;  2N49 A;  1ENF A;  3IKJ A;  3LWE A;  2M00 A;  1F2L A;  4NP5 A;  3ZJY C;  2CWP A;  2RDG A;  3ULJ A;  1NJI C;  3DLL A;  2IX1 A;  1TS2 A;  1Y1V G;  2XWJ B;  2ZJQ A;  4FF3 A;  2K5Q A;  2OQK A;  4DR3 L;  3GTP B;  3TS2 A;  2D0P A;  1J6Q A;  2XN9 C;  2HDL A;  4I7A A;  1IYJ B;  2EYJ A;  5FOB B;  1FD7 D;  1Q3L A;  3TN2 A;  1G8Z D;  4QGU A;  3BZD B;  2HUG A;  3I55 A;  4I65 A;  2Q8R E;  4LFB Q;  1C0A A;  4RWS C;  1WTO A;  4DR6 L;  2EDG A;  2WB1 B;  3N6R A;  1EIG A;  3H3V I;  3HOV B;  1SFO B;  3CC4 A;  1D5X C;  3CCR A;  1PFM A;  2DUD A;  5HUR A;  1XX8 A;  1L0W A;  3BZC A;  2VS1 A;  3J81 c;  2H5X A;  3I4M H;  2PI2 A;  3S2H B;  1PXU A;  3ERO A;  4C1N I;  3VR2 A;  5C0X G;  1WYD A;  3L2P A;  2X6L A;  4KN4 C;  1HUN A;  4LF8 L;  1Y1W B;  3HOU B;  1BQQ T;  1LTL A;  1K3B C;  5ELB A;  3I70 A;  3C3L A;  1PFB A;  4A76 A;  1PTO H;  1ILQ A;  1I4G A;  3Q23 A;  2F0I A;  3HGB A;  2OTL A;  1K0R A;  1D1I A;  1PZI D;  4J6H A;  4X66 L;  4YWL A;  4BA1 I;  1NNX A;  3K5O A;  4A75 A;  2WB1 G;  2CW0 D;  3J7Z C;  3AQQ A;  1RD9 D;  2WAQ G;  3J80 E;  1YNX A;  2VZA A;  1PH6 A;  3DM1 A;  2LXJ A;  5CV5 A;  1PLF A;  5EJW A;  3I3C A;  2JA5 B;  1B9M A;  2KCN A;  1TWG B;  2CH4 W;  2IHF A;  4A3E B;  1Y1W G;  3HOU G;  3GD7 A;  4KHP L;  1STH A;  4DR2 Q;  3DXJ C;  1BDO A;  4U68 A;  1L1O A;  1W2B A;  5M3F B;  1YJW A;  3NUC A;  1HA5 A;  3MXN A;  3BU2 A;  2DGY A;  1KNA A;  1GUT A;  1WD1 A;  1AFP A;  3URY A;  1DON A;  3CMA A;  2XGT A;  2J4X A;  1F2M A;  3HOX B;  2B2V A;  5M5W H;  4KKU A;  2V4D A;  2FJ2 A;  3ERQ A; 
#chains in the Genus database with same CATH homology
 5EBC A;  3QB3 A;  4RKL A;  3T4A C;  2IX0 A;  2JEA I;  1O80 A;  4DNR B;  4K6D A;  4S3S A;  5JPN C;  1F2Y A;  2JEB I;  1I4H A;  2H1E A;  3H3V C;  2G9D A;  2YYZ A;  5I6Y A;  5K36 G;  2XRQ D;  1CA6 A;  2YU9 B;  1BR9 A;  2AQ2 B;  1U4R A;  4IUR A;  3VA7 A;  3KLS A;  1JR0 D;  3E5S A;  1FNV A;  1ILP A;  1DZ1 A;  5C0X I;  1Q90 A;  3K59 A;  3IFD A;  4QB4 A;  2CVR A;  3L9A X;  1U4L A;  1DD2 A;  4ZKC B;  1QOH A;  2GA4 B;  3DEO A;  2WII B;  1RTN A;  4H0L C;  4HN7 A;  1EYC A;  5JAV A;  1JWM D;  3S2D B;  1PRT B;  2EY6 A;  2PZT A;  2M9V A;  2BE5 C;  4A3D B;  2SNM A;  4KN7 C;  5C3W A;  5ELE A;  3GP7 A;  3P1H A;  3U9S A;  4C56 C;  4DK0 A;  1O78 A;  4XYO A;  3ZYY X;  2SDF A;  1SMY C;  4TQU S;  4QMG A;  3ND8 A;  3MXU A;  1GUG A;  2FHT A;  2XRS D;  4ZQ3 A;  5IT9 E;  1GUW A;  3Q24 A;  2PW5 A;  4F7X A;  2NB0 A;  1KLU D;  4FF2 A;  3NBI A;  5LHY 1;  1EEF D;  1FNU A;  1KAB A;  3I4N B;  5AFW A;  1WTP A;  5C0X J;  3HRZ C;  1A2T A;  2KQ3 A;  4HAE A;  4B9X A;  4TRD A;  3I73 A;  3K5M A;  2F0L A;  1TS4 A;  1G2T A;  3K7A B;  2N55 A;  1KDB A;  3KF8 A;  5I9O A;  1MSH A;  3RMH A;  5CV6 A;  1B1Z A;  3LNN A;  2RDH A;  4K2L A;  1RDP D;  2XSC A;  5C44 B;  3D4R A;  1ML0 D;  2QDB A;  2OEO A;  4KD4 A;  4A3K B;  2KOL A;  4U67 3;  5I9P A;  3PO3 B;  5FKA C;  1ROD A;  4KKT A;  3HOY B;  1B50 A;  4H7B A;  5IGC A;  3NQT A;  2K5D A;  2F0E A;  2DN8 A;  3X3M A;  2A6H D;  2G9H D;  1II3 A;  1GOZ A;  3P75 A;  3CU7 A;  1ET6 A;  3H94 A;  1SNQ A;  2K7V A;  2F0P A;  1WTQ A;  5M5X B;  1RHP A;  1SNM A;  3OW7 A;  3OHX C;  5D3D A;  1NAP A;  1STG A;  4X3T A;  3OIQ A;  4FNF A;  4ZKB B;  5EPJ A;  4CKC A;  3VR6 A;  1SAP A;  1LT5 D;  3VR5 A;  1PTO D;  1MSG A;  1UAP A;  1C48 A;  1LTA D;  1IW7 D;  2AQ3 B;  3K58 A;  1D6E C;  1PZK D;  5JPM C;  2IL8 A;  1TU2 B;  2XIW A;  1RTO A;  3CHB D;  3EA6 A;  2EYL A;  5CBE E;  1RF2 D;  4FXK C;  1EQV A;  2Z1C A;  4EQN A;  5COR A;  2B2W C;  2CW0 C;  1EY9 A;  3I4M B;  1YNJ D;  1FYC A;  4NKL A;  1H9M A;  1TII D;  2F0K A;  1IYU A;  1S5F D;  3G7L A;  3S1M B;  1I4X A;  5IGG A;  1B9N A;  2B2T A;  5CBA E;  3M7G A;  4PMC A;  2L11 A;  3PV0 A;  4R8I A;  2PQE A;  2FMM A;  5COY A;  1HA6 A;  4HCE A;  4FYD A;  1SE2 A;  2F0D A;  5JJZ A;  4TKO B;  2WIN B;  3P20 A;  4WRD A;  2B2U A;  3J80 L;  1G91 A;  1H9S B;  2BA0 A;  3NWS A;  4DN4 M;  1W6J A;  2H4O A;  2QEJ C;  1X32 A;  5BN5 A;  2L9H A;  1B44 D;  1TR5 A;  5KNB A;  2F1M A;  3S1N B;  3I8Z A;  3MAQ A;  4OGQ C;  1Y8N B;  5M5W B;  3HP3 A;  1WTX A;  3VR3 A;  2A73 B;  2Q8T A;  4HED A;  4HCS A;  5KGU A;  4DXG A;  1L0Y B;  1CHQ D;  1S5E D;  2EPB A;  1HRJ A;  4LAA A;  4EQO A;  5ELC A;  1TWC B;  4LK1 C;  4R8N A;  2X6G A;  1U4M A;  2EY2 A;  1J8I A;  3X3N A;  2R7Z B;  5IGD A;  2B2Y C;  1OO9 B;  3R93 A;  1IKM A;  3T13 A;  3MFG A;  2EXZ A;  1D5M C;  4CKB A;  4RGO S;  5CMD A;  3SK6 A;  1GUO A;  2WAC A;  4H44 C;  4FF1 A;  1STN A;  4V19 0;  2O5I C;  4A3G B;  3GV6 A;  5T1I A;  3TP7 A;  3DWA A;  3SK4 A;  1O7Y A;  2QKI C;  3H0G B;  3IFT A;  3J81 L;  2NYZ D;  1F2Z A;  5C5M A;  1G29 1;  4CJ0 B;  5FO9 B;  3QOL A;  4ODG A;  1O7L A;  3NWT A;  2F0H A;  3M4O B;  2LMC B;  2RKS A;  4A3M B;  2NVQ B;  4HSP A;  1SND A;  2N88 A;  4X3U A;  4F88 A;  1WTW A;  4X3K A;  1W6K A;  1OXX K;  4XQJ A;  2VUM B;  5IT9 L;  1DOL A;  2QIL A;  1JIC A;  3AMU A;  1HCZ A;  1X3Q A;  2MP1 A;  2F0V A;  1AW7 A;  2L55 A;  3C1F A;  2LFN A;  1U9R A;  3OWE B;  2JA7 B;  1QIL A;  1SE3 A;  2XNA C;  1B53 A;  1TT2 A;  3GTK B;  1AEX A;  4G7O C;  1EYD A;  2QF7 A;  1JQY D;  1Y1V B;  2C9O A;  2A6H C;  4IUV A;  3I4L A;  1EY4 A;  1F9P A;  4KJO A;  5KYI A;  4N9P A;  4OL7 A;  5EKK A;  1CM9 A;  2NWG A;  5J22 A;  3S15 B;  1CQF A;  1DM0 B;  1SSO A;  3VYR A;  4C3H B;  4O1N A;  1BCP D;  3LWU A;  4XQN A;  3K57 A;  1JOK A;  3BDC A;  2K33 A;  1HPC A;  2I07 B;  1PTO C;  1ZKO A;  1SJE D;  4L63 B;  4QUF A;  1IW7 C;  2K5W A;  3HG9 A;  2A68 D;  3FPP A;  3QO2 A;  3QIA A;  1SBB B;  2TSS A;  1M4V A;  3H6M A;  5C5L A;  1CZG A;  5LL6 S;  1G2S A;  3NE5 B;  3J7Y W;  5I2X A;  1HTL D;  1A6X A;  2MPM A;  1AZP A;  2D2C C;  3DUZ A;  3C2P A;  4C3H G;  5E3F A;  5IGE A;  3D31 A;  3IAY A;  5DM6 3;  3FVQ A;  1YNJ C;  2WAQ B;  1BCP B;  1Q8I A;  4TSS A;  3SXH A;  2VNU D;  3TP6 A;  4RCO A;  4CGY B;  4K8I A;  3UI2 A;  2Z4H A;  4XT1 B;  4K8J A;  4G57 A;  5KRU A;  2ZXR A;  1HHV A;  1S4Z A;  4IAL A;  2K28 A;  4DAV A;  2HCI A;  2BCO A;  4XQQ A;  1Y8P B;  1EY8 A;  2ZT9 C;  1IKL A;  3SHL A;  3PUX A;  3FKI B;  3M4Y A;  5I6W A;  3D6C A;  3I91 A;  2NUC A;  1L0X B;  1ENC A;  2Q8I B;  3BDO A;  1XYI A;  4RA8 A;  2KUM A;  1NSN S;  1MI2 A;  2JP1 A;  4X3S A;  1WCM B;  2IJ0 A;  4A3B B;  3VYU A;  3BG3 A;  2WV6 D;  2O4X A;  4PV1 C;  1KDA A;  1Y69 U;  4NW2 A;  1M8A A;  1LTT D;  3HEJ A;  4V0B A;  3D4D A;  3KLR A;  3VYT A;  4K5W A;  2Z8L A;  5C3X A;  1LTG D;  4K5X A;  1PRT F;  4KTA A;  2BDO A;  4G7H C;  2EJM A;  4RHR A;  1K8O A;  3MTS A;  3VA5 A;  4I7Z C;  5JVG 3;  1EZ6 A;  1SDF A;  2L1B A;  3LX0 A;  4DAP A;  1K83 B;  3GTM B;  1JCK B;  3OMC A;  3J81 E;  2RSO A;  3A56 A;  4RCN A;  1QNK A;  4M1U B;  1TWH B;  3QG1 A;  2IX3 A;  1H9S A;  4KV6 A;  5J39 A;  1U4P A;  4Y7N B;  4KK7 A;  4A3F B;  3RUZ A;  2ICI A;  2EZV A;  3MEH A;  3GTJ B;  3T16 A;  4RGT A;  1F9S A;  2EVB A;  3L3O C;  3TME A;  2HCC A;  5IOC A;  1IL8 A;  3MXP A;  2B8F A;  5M3M B;  1EZ8 A;  1CK1 A;  3I90 A;  5DEH A;  3A7A B;  1MGS A;  1EY7 A;  3BVG A;  2NBF A;  1R9T B;  3OWF A;  1NCV A;  4CBV A;  4FXD A;  1SNP A;  2O2L D;  4EVO A;  1PFN A;  5TSS A;  1AN8 A;  4IQZ A;  1LLR D;  5T1G A;  2NTT A;  3E0J A;  2PZW A;  3CRL C;  2FMC A;  5C6A A;  1H9K A;  4O42 A;  3I72 A;  3K5L A;  3C1E A;  5EKI A;  1STE A;  4DGZ A;  1STB A;  1I4P A;  1BCP C;  1JWU D;  3MHB A;  5FLX E;  2FFK B;  5I2Y A;  3A8K E;  3PUW A;  1I4R A;  2HQE A;  3NTH A;  5A2Q E;  3R8B A;  1Q1E A;  3HS0 C;  5CV4 A;  5F2D A;  3FEW X;  3KLS X;  2A68 C;  4UDU C;  4MIU A;  3M7N A;  3CQZ B;  4HTH A;  2EYP A;  5G3L F;  3J7A V;  1A15 A;  5IGF A;  1HQR D;  2R3Z A;  3A8I E;  2A6E D;  3G6J B;  4PNY A;  2VB2 X;  1EY5 A;  3NHH A;  2KVM A;  3TZD A;  1EU3 A;  1A3U A;  1F9R A;  1DXM A;  2EOT A;  1BOS A;  1V1O A;  2RDF A;  5ISR A;  4OHJ A;  3IL8 A;  1Z47 A;  3NBH A;  4F8M A;  2EJF C;  1PMR A;  1MBY A;  5KNC A;  1HFN A;  5FO7 B;  2EY1 A;  1ESF A;  2B39 A;  3FDT A;  1BBX C;  2PMZ B;  1E2V A;  3HKZ B;  3J7A F;  3A8J E;  4F87 A;  4RAU C;  4H13 C;  2F4I A;  1PTO B;  2J0T D;  4XXE A;  2ZXP A;  4KHV A;  4ZYS A;  4ZK9 B;  1LTB D;  4IFD G;  5HGT A;  5ELF A;  2MUY A;  2WP8 J;  3FMC A;  3L7Z C;  4DFA A;  4LJZ C;  2FIN B;  2KEE A;  1WVL A;  5C4X B;  3V05 A;  1E2W A;  1TWF B;  2SNS A;  1LTS D;  3R2I A;  2EJG C;  1B3A A;  1BF4 A;  1B4O A;  2K32 A;  2QCP X;  4IUT A;  4CKE A;  3A54 A;  4IZ8 A;  4J8Q A;  2J7Z A;  4C2M B;  4JK1 C;  3EJI A;  4K5V A;  3SE0 A;  1BXT A;  1TY2 A;  1JWS D;  4DXF A;  2E2I B;  4OIJ A;  4PMW A;  2XVS A;  3KUP A;  4BBS B;  3KK7 A;  2PNR C;  1OXU A;  2R61 A;  1RKN A;  2JSO A;  4RFB A;  4KI0 A;  4BA2 I;  1IHZ A;  2D62 A;  4G7Z C;  3U9O A;  2F3W A;  3CKI B;  1DCZ A;  4XIG S;  1SE4 A;  2LKV A;  2ZXO A;  4ID6 A;  1PZJ D;  5KEE A;  3MXG A;  3NXW A;  3BVZ A;  5CYU A;  4IFD I;  2R93 B;  1ET9 A;  2D9U A;  4CJ2 C;  1C4Q A;  2VXW A;  4EQP A;  2IT1 A;  4ULL A;  2B2W A;  1C8C A;  1KLG D;  1SYC A;  1AP0 A;  1S5B D;  1SXT A;  1VMC A;  1QG7 A;  2DY7 A;  1SYF A;  3SK8 A;  2A74 C;  2TMP A;  4DA2 A;  2KED A;  2IPK D;  1EIH A;  5IOD A;  1VCI A;  3H09 A;  1LAC A;  2Y0S B;  4QCL A;  1A3T A;  4DNT B;  1Q1B A;  1STY A;  4HSV A;  1R4P B;  2KJX A;  5A35 A;  2F0J A;  1A3V A;  4WOR A;  2L12 A;  5D3I B;  4B9W A;  1X3P A;  3DWP A;  1KNE A;  1DOK A;  3E6Z X;  2LY7 A;  3TSS A;  4K14 A;  2BDN A;  1JC7 A;  1SEB D;  3QOJ A;  3K0Y A;  3MZ5 A;  3EQL C;  2D5D A;  4RGN A;  2KHS A;  1CI3 M;  3RLF A;  3C46 A;  3CRK C;  2F3V A;  4Z9C B;  4C3J G;  2F0G A;  1CA5 A;  3PUY A;  3S1Q B;  4A3J B;  4IFD J;  5KYL A;  1I6V C;  2EY5 A;  2F0O A;  2NVT B;  4CJ1 B;  2JYO A;  3GTQ B;  1SYD A;  4ME5 A;  2ENB A;  1Y8O B;  1EU4 A;  1PYW D;  3W2D A;  5C4H A;  4M8A A;  4DAY A;  2B2V C;  3V96 A;  3SDZ A;  3HOZ B;  3ONA B;  1MD2 D;  1LT4 D;  2A6E C;  1FR3 A;  2ICE C;  2LS0 1;  5FLX L;  1WTV A;  2B2Y A;  1K8M A;  4OO1 G;  3OIP A;  1LTR D;  5A2Q L;  4BWG B;  1V1P B;  5FK9 C;  1QE6 A;  1BCP F;  1PDQ A;  4PMB A;  1HQM C;  1BUV T;  4KMU C;  4J1M A;  4BBR B;  3TP5 A;  1F9Q A;  3PUZ A;  5C3E B;  2E76 C;  4QF4 A;  4RGM A;  4R9W A;  2DNE A;  2CQA A;  1HFG A;  1SNC A;  1EOT A;  3MC0 B;  2PO4 A;  4IFD H;  1FNW A;  2E74 C;  5D65 A;  3M3Y B;  1GXD C;  3R3O A;  1ESR A;  1CQV A;  1TWA B;  1QNU A;  1EY6 A;  5E4X A;  2IWH A;  1ICW A;  2K01 A;  4ZUI A;  2SEB D;  1D1K A;  1KDC A;  1NR2 A;  3ND9 A;  3SEB A;  2PZU A;  1R4Q B;  2NTS A;  4K6L A;  2E2J B;  4MHE A;  4IUQ A;  4UAI A;  5BN3 A;  2WKC A;  2PW7 A;  1WD0 A;  3D3R A;  2AUJ D;  5M5Y B;  2K05 A;  4RH6 A;  2M2L A;  1YNN D;  4HR7 B;  3V2T A;  4OO1 I;  2E2D C;  4IUP A;  2A69 D;  5CV8 A;  1HUM A;  3D8G A;  2WKD A;  2OT2 A;  5NUC A;  3TDQ A;  4RKB A;  3S9W A;  5FO8 B;  2F0W A;  2OF1 A;  4XT3 B;  5I4D A;  2F0U A;  4AYB B;  4C3I B;  1GJX A;  2JA8 B;  5JEA G;  3PMF A;  3Q22 A;  1J9O A;  2EE1 A;  4A3I B;  3Q0A A;  5DAU A;  3S1R B;  2EYO A;  3OPO A;  2K03 A;  1ZYR D;  3P7J A;  2EYH A;  1QCB D;  3TBI B;  1I4Q A;  1PRT D;  2L5T A;  1HXY D;  1LV9 A;  2ID0 A;  2VB3 X;  2BA1 A;  1H9J A;  4KKS A;  1LO5 D;  4C3I G;  3MFY A;  1OXT A;  3ITP A;  3MA2 B;  1KTK A;  3S16 B;  5D14 A;  2F0S A;  3S17 B;  5IIF A;  4E6I A;  4ZRZ A;  2L4N A;  1EEI D;  1DYQ A;  2JA6 B;  3GTO B;  2NN6 G;  4FXG C;  4KHZ A;  2O5J C;  4BY1 B;  3AU7 A;  1ZXT A;  3NPP A;  4DF7 A;  3QWN A;  4KJN A;  1D2B A;  3VR4 A;  1TY0 A;  3HOW B;  4NMZ A;  3RZO B;  3SVM A;  3RZD B;  1V43 A;  4RHS A;  1EL0 A;  3OOC A;  3EVQ A;  1RJT A;  1I50 B;  1SYB A;  4KD3 A;  4ZUJ A;  1SNO A;  5EGT A;  3DHQ A;  1F77 A;  1UEA B;  1ENA A;  1BO0 A;  5CGK A;  2DY8 A;  3NP8 A;  4OO1 H;  2B2T C;  3D4W A;  1B2T A;  2CHB D;  2B63 B;  3SK5 A;  2AQ1 B;  2KCC A;  5CV7 A;  1VF5 C;  3FRP B;  5CC4 A;  1GUN A;  3A55 A;  3KBX A;  2A5H A;  5CV9 A;  2F0M A;  2MHV A;  1G6Z A;  1Q12 A;  3BDL A;  1EFI D;  4IN3 A;  4QIW B;  4KY5 A;  2EYF A;  1JOR A;  2B2U C;  3S14 B;  3DEP A;  3JAM E;  1SYE A;  3GTL B;  2NVY B;  4WJW A;  3T51 B;  3BYY B;  3MWY W;  3NTI A;  3RD4 A;  1H9R A;  5KIX A;  2NN6 I;  1GUS A;  4NDX A;  3AB9 A;  4JBW A;  3TZU A;  5C4J B;  1NUC A;  5DM7 3;  3WDN A;  1JB3 A;  1E2Z A;  5IGB A;  5JEA J;  5BN4 A;  3Q6S A;  4K2K A;  5C0X H;  5G3L D;  1SYG A;  2RA4 A;  3T53 B;  2KA7 A;  3NQI A;  5M9O A;  1XWE A;  3N52 A;  3A7L A;  1EWC A;  4B08 A;  4ILW A;  3T56 B;  4HMI A;  1PTO F;  5E4W C;  2R92 B;  1QJO A;  2F0Q A;  4GZY C;  2E2H B;  1EQT A;  2K1B A;  1A2U A;  4OIK A;  1T5E A;  3MVV A;  1E0B A;  1CFM A;  1ZEQ X;  1YNN C;  4KY7 A;  3PIP 3;  2F0N A;  5K5P A;  1OXS C;  2BOS A;  5JEA H;  3PO2 B;  5ELD A;  2A69 C;  1DJR D;  1TS5 A;  5KND A;  1V1P A;  2X69 A;  2B8G A;  3M85 A;  1TKW B;  1JOO A;  2AWO A;  1TS3 A;  1I6H B;  4WFN 3;  2PPB C;  5K36 H;  1SJH D;  3O13 A;  1GHJ A;  3D6W A;  3GO5 A;  1GHK A;  3HZX A;  1JOQ A;  2AUK A;  4PQX A;  3QJY A;  2XWB B;  4A93 B;  4IUN A;  1VDZ A;  4L6T B;  3FPU B;  2PYK A;  1ZYR C;  3EFX D;  2OXP A;  1EWH A;  2RVL A;  1VMP A;  1DOM A;  1JE4 A;  1PRT C;  2F0T A;  2I46 A;  1WTR A;  2NN6 H;  5EKL A;  2MGS A;  2E75 C;  1HTP A;  1LT3 D;  5LL6 X;  2HDM A;  4L8J A;  1D5Z C;  3DMU A;  2NVX B;  2L0C A;  3OMG A;  1XXG A;  5JOB A;  1BNZ A;  3W3A A;  3GTG B;  4MN3 A;  3DWQ A;  4FF4 A;  5E1F A;  3KBG A;  5EQ0 A;  3GQB A;  3K5N A;  2MJ8 A;  1CZW A;  1VF7 A;  4ABN A;  1T5X D;  1O7Z A;  5DNF A;  4LMQ D;  4QUC A;  4CHT B;  3H91 A;  4EGV A;  2F0F A;  1LTI D;  3PUV A;  2RSN A;  5EPL A;  2Z4I A;  5EBD A;  5EPK A;  2NZ1 D;  2JE6 I;  4C3J B;  4YIJ A;  1CHP D;  4DK1 A;  1UNS A;  2R6G A;  4FP5 D;  1LT6 D;  1KAA A;  3F2U A;  2BE5 D;  1EY0 A;  1FGB D;  3SR1 A;  2F03 A;  3PIO 3;  3BVM A;  1Z7T A;  5C4Z A;  2RBM A;  4Q0F A;  1EYA A;  3OSO A;  2EYM A;  4ZAI A;  4FVM A;  1SMY D;  4Q5V A;  1STA A;  2RQX A;  2SOB A;  2AWN A;  1Z6H A;  1CTM A;  2C5C A;  1S5D D;  4HMJ A;  1S5C D;  1NR4 A;  1RCV D;  2JXM B;  3K6O A;  4KY6 A;  1IYV A;  3WOF A;  4DU9 A;  1LAB A;  1QWY A;  4XDX A;  1ONL A;  4G4K A;  1I3Q B;  1QB5 D;  2IW3 A;  2DNC A;  3BYT B;  1XTC D;  2KEC A;  5J1Z A;  5JVH 3;  4XTC S;  3R2T A;  2PCF B;  4BS9 A;  1AZQ A;  4BY7 B;  3BS1 A;  3NK9 A;  2K04 A;  4C1N K;  3NSW A;  1UUP A;  3JAM L;  1TVX A;  2K6A A;  1CT1 D;  3VYS A;  4IUU A;  4XYQ A;  3TP8 A;  5CR3 A;  4FO2 A;  3NTK A;  3GV3 A;  1TQO A;  3WOE A;  1OXV A;  4P2C B;  4N9T A;  1V8Q A;  4ZLT F;  1ENF A;  3IKJ A;  3LWE A;  2M00 A;  1F2L A;  4NP5 A;  2RDG A;  2IX1 A;  1TS2 A;  2XWJ B;  4FF3 A;  2K5Q A;  3GTP B;  2XN9 C;  2HDL A;  2EYJ A;  5FOB B;  1FD7 D;  1Q3L A;  3TN2 A;  1G8Z D;  3BZD B;  2HUG A;  4I65 A;  2Q8R E;  4RWS C;  1WTO A;  2EDG A;  2WB1 B;  3N6R A;  1EIG A;  3HOV B;  1SFO B;  1D5X C;  1PFM A;  5HUR A;  1XX8 A;  3S2H B;  1PXU A;  3ERO A;  4C1N I;  3VR2 A;  5C0X G;  2X6L A;  4KN4 C;  1HUN A;  1Y1W B;  3HOU B;  1BQQ T;  5ELB A;  3I70 A;  3C3L A;  1PFB A;  1PTO H;  1ILQ A;  1I4G A;  3Q23 A;  2F0I A;  3HGB A;  1D1I A;  1PZI D;  4J6H A;  4BA1 I;  3K5O A;  2CW0 D;  1RD9 D;  3J80 E;  3DM1 A;  5CV5 A;  1PLF A;  5EJW A;  3I3C A;  2JA5 B;  1B9M A;  2KCN A;  1TWG B;  4A3E B;  3GD7 A;  1STH A;  3DXJ C;  1BDO A;  4U68 A;  5M3F B;  3NUC A;  1HA5 A;  3MXN A;  1KNA A;  1GUT A;  1WD1 A;  1AFP A;  3URY A;  1DON A;  2J4X A;  1F2M A;  3HOX B;  2B2V A;  4KKU A;  2V4D A;  2FJ2 A;  3ERQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...