5CR3A

Crystal structure of staphylococcal nuclease variant delta+phs v104e/l125e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIAAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLERKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V104E/L125E at cryogenic temperature
rcsb
molecule keywords Thermonuclease
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cr3A00
2PQEA 4PNYA 4S3SA 1EY5A 2F0KA 2F0MA 2EXZA 2PW5A 3EVQA 1SNQA 2QDBA 4K6DA 4KV6A 4NDXA 1SNMA 2PZTA 4EVOA 3MEHA 2EYFA 2EYOA 4K14A 4QB4A 3RUZA 3LX0A 3TMEA 2O4XA 3U9OA 4PMCA 5KRUA 2F0SA 2KHSA 5C3XA 2SOBA 5E3FA 2F3WA 5C4HA 5I9PA 5IIFA 3SHLA 3T16A 4EQNA 1NUCA 5C6AA 5CC4A 1A3VA 4E6IA 4KD4A 4F8MA 5IODA 3SK5A 4IUNA 5HURA 1RKNA 4QMGA 5EKLA 1STBA 4N9TA 5CV4A 4ZQ3A 4KD3A 3OSOA 4HMIA 4KY7A 4HMJA 4KY5A 5IOCA 2PW7A 3H6MA 3HEJA 3OMGA 4NMZA 2F0IA 1F2YA 3PMFA 5C5MA 5IGBA 5C4ZA 3MHBA 4QF4A 1SYBA 3VA5A 3NQTA 1SYDA 2OF1A 4R8NA 3TP5A 2F0EA 4B9XA 5DEHA 2KQ3A 2EY2A 1A2TA 1STAA 2RBMA 1SNOA 5KGUA 4K5WA 2EYJA 4NP5A 1EYDA 3SXHA 3ITPA 2F0UA 2F3VA 3HZXA 5CV7A 4K5VA 3QB3A 1IHZA 2EYLA 3NXWA 2PZUA 4KY6A 4KTAA 5JOBA 2EYMA 3TP7A 4ME5A 2HQEA 1F2ZA 4DFAA 2RDFA 4KJOA 4I65A 5IGGA 1SYFA 1ENCA 2F0HA 5J22A 3R3OA 2F0FA 1SYGA 5C3WA 1EY8A 1A3TA 1SYCA 3T13A 4K8IA 2EYHA 3SK4A 4DGZA 2EY5A 4RKLA 3MVVA 3D8GA 4K2KA 3OWFA 4OL7A 4H7BA 2F0DA 3EJIA 1JORA 1SNDA 3E5SA 3SK6A 1EQVA 2ENBA 2F0LA 2F0JA 3BDLA 4G57A 5CV6A 5DAUA 2SNMA 2F0WA 5KYIA 1STGA 4K5XA 3NK9A 3D4DA 1STYA 2F0GA 3DMUA 1EYAA 4DU9A 5J1ZA 2NUCA 5CV5A 2F0TA 1SYEA 5M9OA 3MXPA 2RKSA 1EZ6A 3C1FA 5E1FA 3P1HA 4MIUA 4ZUJA 1KABA 4KJNA 4ZUIA 5KEEA 1SNCA 3ERQA 1TT2A 2PYKA 2LKVA 3D4WA 3OMCA 2SNSA 1A2UA 4WRDA 4YIJA 3SK8A 1KAAA 3NP8A 4EQPA 1KDAA 4K8JA 4IALA 3P75A 1EZ8A 4PMBA 5KYLA 4TRDA 1TR5A 5ISRA 1EY9A 3TP6A 5IGCA 4DF7A 2F0VA 3C1EA 1F2MA 4IZ8A 3D6CA 5CR3A 2F0NA 4RKBA 1STHA 5EKKA 2EY6A 3TP8A 1NSNS 1STNA 4B9WA 5IGEA 3MZ5A 4WORA 5J39A 4EQOA 5F2DA 2WACA 4N9PA 2EY1A 3QOLA 5C5LA 1ENAA 2PZWA 4ID6A 5IGFA 1U9RA 1SNPA 5NUCA 2OEOA 2OXPA 1JOOA 3DHQA 5JAVA 1KDBA 3NHHA 5I9OA 1JOQA 1EY4A 1AEXA 1KDCA 4KHVA 3QOJA 5EGTA 5CGKA 4J6HA 5CV8A 2F0OA 4HTHA 1EY7A 1II3A 4J1MA 4LAAA 5IGDA 2EYPA 5CV9A 1EY6A 4K2LA 5KIXA 3S9WA 1A3UA 2M00A 1EYCA 3BDCA 3SR1A 5K5PA 4NKLA 2F0PA 4ODGA 3NUCA 4F7XA 2F0QA 3V2TA 5I6YA 5HGTA 1TQOA 5I6WA 3EROA 1EY0A 1JOKA
chains in the Genus database with same CATH superfamily
1AE3A 5DM63 3KF8B 2JA8B 1YNJC 4PZ6A 3EVQA 1KLUD 2LMCB 3PF4A 1PH1A 1E2WA 4B3ML 5KNDA 1GOZA 1ZKOA 2WV6D 1Q8KA 1WD1A 2LFNA 3N52A 1VF7A 2WB1G 1LABA 3OW2A 5AJ3L 1K8OA 4XYOA 5ELNA 1QVFA 4X65Q 5CC4A 4F8MA 4JBKA 2VQFQ 3CXCA 1RKNA 4QMGA 1WTXA 1B2TA 5GADC 5AFWA 3Q8DA 4KD3A 3CCJA 4UP7A 4F88A 4MTKA 5COYA 4KI0A 4B3SL 2K04A 1PA6A 2AMCB 1SYBA 1I50H 4I7ZC 4R8NA 1NMFA 2GN5A 4CBVA 1ASYA 2RBMA 4K5WA 5FO9B 3I70A 2NVXH 3NXWA 3DWAA 2PZUA 2WFWA 3IFTA 4X62L 2I5MX 4OO1G 4DV4Q 2EE1A 3S2HH 3GD7A 4HAEA 3F2UA 1SYGA 1SDFA 1WTVA 1BBXC 2VUMB 5LMNL 2Z6KA 4A3IG 4LF7Q 3I8ZA 3MFGA 1O7ZA 2HIVA 1VQHA 3KJOA 4IQZA 1WYDA 2JE6I 1J9OA 2RKSA 4MIUA 3K5MA 5D14A 4KJNA 4LFBL 3Q22A 4JI6L 3CMAA 3M4YA 4IPHA 1EZ8A 3H3VH 3M4OB 3RZOB 1X6OA 4OX9Q 2VY3A 5T1GA 2VB3X 2F4IA 4ABNA 1ML0D 1YVCA 1TWGB 1SMYD 1DGSA 4A3FB 2WACA 2EY1A 4G4KA 1SNPA 2O5JC 1TWCB 2CKZB 5LL6X 2ZJRA 1V1OA 2B2YC 5EAYA 1XX8A 4P74A 3S14H 5I9OA 5GAGC 4AYBE 4A3GH 1EY7A 2ES2A 4LNQA 1N32Q 4A3JH 4R8IA 1I4PA 3BDCA 4DV3Q 2PI2E 2K28A 4MTNA 5C4JB 1VCIA 2DN8A 4L5QA 1D1KA 3BZCA 2DUDA 2PMZB 1LTLA 2PW5A 2QDBA 1PHJA 3PO2H 1B3AA 3CCEA 3CHBD 2N49A 2EDGA 2VXWA 4K14A 5ELFA 2EYOA 3GTLH 4B3RQ 4JOIC 1QG7A 1VQOA 4FP5D 2ZTDA 3OYYA 1PZJD 5C0XJ 4C1NI 4EQNA 4E6IA 1C9OA 2L4NA 1UEAB 1YZ6A 2DY7A 2LSSA 4HR7B 4IFDG 2FXQA 3KLRA 1X32A 1H95A 1WTPA 1XPOA 4DK0A 1TWAH 3UE1A 3AFQA 2MO1A 3TZUA 3OMGA 4UDUC 3J7AV 2BA1A 4YCVA 3I4NH 4HSPA 3IAYA 3NQTA 4ZKBB 4Q5VA 5HY6A 2JA5B 2JYOA 1A2TA 4IFDJ 4CKCA 2JA6H 5I2XA 3M3YB 1MBYA 2JA8G 4CDDC 1WCMG 2EYMA 1IW7C 1F2ZA 1S5ED 3DM1A 2R92B 5C4XH 3BDOA 4JI2L 5M3MH 1I50B 3CPWA 1ENCA 1CSPA 5IYBG 2EYHA 4RGTA 4FXGC 2E74C 3TN2A 3RD4A 1CK1A 3I90A 3S1QB 1OXTA 2JA9A 4BS9A 1VQBA 1H9RA 2B2TA 4DA2A 3S16B 2NWGA 3TS2A 4B3TQ 3S1RH 1UE6A 4LUVA 4BA2I 5KEEA 2PQAB 3D4WA 5BR8L 2JA7G 4A3CG 3GQBA 3NSWA 1KDAA 1K3BC 4A3MH 2QEJC 3RLNA 1ENFA 3H0GB 4X3TA 3CCLA 1YITA 2A74C 3J7AF 1PRTD 5D3DA 3NPPA 1QWYA 5IGFA 2UUAQ 2CW0C 2CFMA 1A63A 4JI4Q 2NB0A 1DOKA 1WTOA 2KA7A 4LMQD 1VQ7A 1E0BA 4A4IA 4Y52H 5K36G 1RD9D 3UDXA 3QOJA 4DNIA 1YHQA 1N32L 4J1MA 4L5RC 2NN6G 2Y0SB 4K2LA 5M5WB 1N33Q 1V8QA 5I6YA 1JE5A 5J3BA 2PQEA 3TEHB 2O2LD 4G7HC 2ZTEA 4AQYQ 4B3RL 2K32A 1VQ6A 1AFPA 2XRQD 1EQQA 4DK1A 4P73A 2BE5D 3AQQA 1PRTF 2A6HC 3F2DA 4A3FG 1OXSC 1BCPB 1WTRA 4RCOA 3FDTA 2M2LA 3PO2B 4DNRB 1ZEQX 1VQJA 2JP1A 1VQ9A 3GTLB 4KY7A 4A93B 3EBEA 1QCBD 3MHBA 1YHBA 2ID0A 3T51B 4LF8Q 4DV5Q 3A0JA 1SYDA 1KTKA 3K7AH 1J5EL 1STAA 2PO4A 4JBWA 4GNXC 1P8LA 4ME3A 1NR2A 3SXHA 1CKMA 4O2DA 4H13C 1ET9A 1SJED 4IURA 4KTAA 3SVMA 2HQEA 2D0OA 2Q2HA 3H3VI 1HQMC 1E2ZA 1W6JA 2VQEQ 1FNUA 4I65A 3I4NB 1QZGA 1V9PA 4LFAL 3R3OA 3D0FA 1A3TA 3NBHB 4IUQA 4HIDA 2FHTA 5IYDH 2L55A 1ESRA 3TDQA 3JAMc 2BDOA 1VQ4A 4TVAB 2JK8A 1XPUA 2WIIB 5L37A 2C9OA 2SNMA 2E5LQ 2Z6KC 4DU9A 1LYLA 5M3MB 4C2MH 1JQYD 1JICA 2AHOB 2E75C 3HP3A 3ERQA 2JA5G 3PF5A 5K5PA 4YIJA 3SK8A 4KHPQ 4DK3C 2H1EA 4GN3B 4O42A 1TR5A 1PH7A 5IGCA 1V1PA 2LY7A 3I7FA 4ZAIA 2C5CA 1S5BD 2YU9H 1I4QA 3S1RB 3VA7A 1EFID 3QOLA 2UXDL 2UUAL 3CQZH 1XWEA 3NELA 1HA5A 5NUCA 5JAVA 5LMNW 4JV5Q 4XT3B 4A3MB 3R93A 3VDYA 3HOUH 4CJ2C 1HRJA 1EUJA 1N33L 3GV6A 2F0QA 2K4KA 4B08A 1JOKA 2K1BA 5A35A 4WJ3M 2ZJQA 4GZYC 1E7ZA 5FJ8H 2K75A 3HOZH 1ESFA 3I2ZA 4KKTA 1PTOD 4DAPA 1A62A 1Y8NB 3C46A 2ZXRA 4JI8Q 3U9OA 4YWLA 5C3XA 5ELBA 1X3FA 1WI5A 4WJ4A 5C6AA 3GO5A 3T1YQ 1Q8IA 1HQRD 4KD4A 4H44C 3JAML 4LF6L 1O80A 1J6QA 4DR5Q 4GLXA 1UEBA 2D0PA 4XQNA 3CCUA 5E4WC 1N9WA 3HFZB 3HKZE 1QJOA 4QJFA 4QUCA 2Y0SG 4LF8L 4DV5L 4AYBB 4NXNQ 1PV4A 1ZXTA 2F0EA 3D6WA 3MTSA 1SFOH 1GUGA 2EYJA 1ICWA 4ZRZA 4P71A 2AWOA 2E2JB 1AH9A 5JOBA 3VYRA 4LF4L 1SBBB 3S2DB 2VQEL 4DFAA 1XMQL 3E0EA 4A3JG 3TRZA 1E22A 2EOTA 1X65A 5GAHC 3K7AB 3OTOQ 4K8IA 3CD6A 4FF2A 3MXNA 1OXXK 1L0XB 4OELB 2RQXA 4PQXA 2PPBC 3K6OA 3PO2G 4A3BH 1C4QA 2E5LL 4DUZQ 3HOVH 4P75A 4A93G 1LTRD 3BJUA 3ND8A 1WFQA 5LMUQ 1EWIA 1QVCA 3P1HA 2B2TC 2EJMA 3NQIA 4IUVA 3M4QA 1PTOB 4R9WA 1H9JA 4YHHQ 4KHPL 2QKIC 1CQVA 5JPNC 3P75A 3GV3A 3U4VA 1FR3A 1LT6D 2G9DA 5C0XH 2EQSA 1N36Q 4IZ8A 1KC8C 1U4PA 2VB2X 3KK7A 4C2MB 2UUBQ 4RGNA 3I4NG 1B8AA 1XNRQ 1X54A 2I46A 1K3RA 1KD1C 1R9TH 3K0XA 3V05A 4BBRB 3GTJB 4J8QA 2JA6G 1AEXA 1CSQA 1D7QA 3RN5A 1SE4A 2KCNA 2ALYB 3IL8A 1L1OB 1LM0A 1EY6A 1A3UA 2B3GA 1EYCA 2YU9B 3W1GA 5C4XG 3EN2A 5M3MG 5I6WA 3NK9A 1TWFH 2B8GA 2L11A 1MKHA 3KBGA 1YJ9A 2F0KA 3I3CA 2F0MA 3W5OA 4DR1L 3S1NH 3K80C 1B1ZA 1LTGD 5IT9E 1UE1A 1FNWA 1PRTC 3HOUB 4JI8L 1RCVD 1L0WA 1YNXA 1IKMA 3PUVA 3SE0A 1A3VA 1D6EC 4A76A 4YY3L 3RMHA 1G51A 1PH6A 3HOZB 2RHSB 2FFKB 4AH6A 3OSOA 2JEBI 4A3MG 1SSOA 4MNOA 2Q8IB 2IX3A 4BWGB 3UI2A 2JQOA 5FKAC 4NXNL 1HH2P 3AU7A 4C3HH 3KBXA 4B3MQ 1XPRA 1X55A 4KLKA 2AUKA 5KNCA 3FMCA 1SLJA 3BU2A 5IP7H 5AJ3Q 3K57A 1CTMA 2IY5B 3TZDA 2A6ED 2FMCA 3V96A 4GOPA 1PMRA 4A3IB 5J22A 1M1KC 4JVZA 1YNND 1KAWA 2BDNA 3T13A 1F77A 3I4MH 1F9RA 2EY5A 4RKLA 1CFMA 4B3SQ 4DR2L 1SNDA 2KENA 2L0CA 1EFWA 5CMDA 5GAEC 3LNNA 3P20A 1G2SA 3VR3A 2NUCA 5CV5A 2F0TA 1H9KA 5D65A 1VQEA 4OIKA 2YYZA 4R4TA 4AYBG 5FLXc 4X62Q 4ZK9B 3JAME 1A2UA 2MJ8A 1LACA 4OONA 3TP6A 4X66L 4A3BB 3CCSA 3HOVB 5IGEA 2QF7A 3BZDB 3MZ5A 4WORA 1I3QB 2UUBL 2AUJD 1XNRL 4GOPB 4OO1I 2H4OA 2OEOA 2R7ZH 1MSHA 1B7YB 4ZLTF 4RH6A 1GKHA 3B6YA 4TKOB 5EGTA 3ND9A 4J6HA 4LFCQ 1A6XA 3Q6SA 3A7AB 4FXKC 2M00A 4IN3A 4DR3Q 3OWEB 3T1HQ 1EY0A 3A74A 1PZID 1I6HB 1Z6HA 1EIHA 1R9TB 3R2TA 5IYDG 5C44H 5M3FB 2MPMA 1G91A 3FEWX 2EYFA 4IPGA 1B4OA 1BXTA 2K33A 2HDLA 4KKUA 1TS5A 3K81C 2G9HD 3VYTA 1TWFB 2ICEC 1GHKA 3S1NB 2XNAC 1JT8A 1G8ZD 4JK1C 1GJXA 3RN2A 3BVZA 4HMJA 1LV9A 1LUZA 1HZ9A 5IYCH 4OWTB 3S17H 5FLXL 1IXRA 1VQGA 1BF4A 1WCMB 4PZ8A 4N8FA 2KJXA 4QCLA 1ZYRD 1JE4A 1RJTA 2EJGC 1Y69U 1JWSD 3WWVA 4BXXH 2WAQE 1PZKD 4HIKA 1M90C 3HOYH 5C0XI 3HOUG 2BH8A 1K83H 5H1SE 2Q2TA 2TSSA 1IBLQ 5C3WA 3RLOA 5M5XH 4XIGS 4GN4B 1EU4A 1C0AA 2E2HH 5FJ8G 3HOZG 1Z47A 2F0JA 1HZAA 2KHIA 1IKLA 5DAUA 1YIJA 1MJCA 1K0SA 2JA7B 3URYA 4IJLA 1LT4D 2CQAA 4R1JA 3FKIH 4IFDI 4DUYQ 1SMXA 5G3LD 5M5YH 2PYKA 3HKZB 4WFN3 2E76C 2YV5A 1SJHD 5FO7B 3D3RA 4JI2Q 3KOJA 1HNXL 2IX1A 1SAPA 1CA5A 2XTIA 1D1IA 1EWCA 2Z1CA 5EKKA 3TREA 5A2QL 1TWHH 2HCCA 1I94Q 5T1IA 1EEID 2A1AA 1S72A 4GLAC 1HUMA 3DHQA 2R93H 3K7UC 5FK9C 4LFCL 1Y1VH 1QZHA 1BDOA 2F0OA 3FVQA 3K5OA 4HTHA 1X3EA 3E3XA 3BYTB 1BKBA 1Q1BA 3W3AA 3UE0A 5BR8Q 4DR3L 3T1HL 4Y7NH 1BBUA 4JI0L 5G3LF 1E1TA 2KECA 1GUOA 3PUYA 1SNMA 2JSOA 1EIGA 1ICFB 4QB4A 5ELEA 4A3BG 2F0SA 2KHSA 4GNXB 1LTAD 1IYUA 2RF4A 3HOVG 3T16A 4CJ0B 1GUTA 1L0YB 2N88A 4C3IH 3RNUA 3I56A 3S1MB 5EKLA 1VMCA 3K8AA 2B2WC 5CBEE 4HIMA 5C0XG 4JI3Q 2TMPA 4NPSA 4Z9CB 2ASBA 2A68D 4R4CA 2OWOA 1N8RC 1Q1EA 5DEHA 1K73C 1X3QA 2NN6I 2F3VA 3ITPA 4K6LA 1ET6A 4K5VA 1VQ5A 1S40A 5M3FG 2A5HA 3HOXH 2HIXA 3K59A 2JJQA 2BH2A 1IBLL 5EBCA 2F0FA 3STBD 1TU2B 2A69C 2LXJA 4FDBA 2PQAA 3BDLA 4OHJA 4IJHA 4IOCA 3HOYB 3DMUA 1VQNA 3TBIB 1J5EQ 1K83B 1RDPD 2KVMA 1EZ6A 4DUYL 4NB3A 1P16A 1CM9A 2ATWA 1TT2A 1D8LA 2MHVA 1C48A 2E2HB 4HN7A 3G48A 4R4OA 3U50C 2CWAA 4FXDA 2FJ2A 4DF7A 4LFAQ 1VQMA 3D6CA 5CR3A 2HHHL 1HZCA 3TP8A 1X9NA 1NSNS 3EIVA 3OIPA 3FKIB 1PYSB 3DXJC 1LTSD 3LWUA 4XTCS 4YWMA 5FLXE 1I94L 2B2VC 2Q8RE 2NVXB 1ENAA 5M5YB 3I4LA 2N8NA 4C3HG 1GHJA 1JOOA 1BCPD 2XWBB 1KDBA 4FF1A 3NHHA 1HUNA 1UAPA 1EY4A 3A55A 1KRTA 5IP7G 3S2HB 1U4MA 1RTOA 3PCOB 2K05A 1FJGL 4JBMA 5TSSA 4P72A 2VS1A 4BBSH 1D5ZC 3A56A 2XRSD 3HKZG 2HUGA 4NXML 3I4MG 2L1BA 2I5HA 1EWHA 4V0BA 2B2UA 4QIWB 2UXDQ 3L9AX 3LX0A 2E2IH 3MXGA 4PMCA 5BN5A 1E3PA 1KQSA 2B63H 1MHWC 4Y7NB 1IL2A 1EIFA 3A8KE 3EA6A 3ZYYX 2MUYA 1KIXA 2Z8LA 3IFDA 4LUZA 1BCPF 5CV4A 1BVSA 3K0YA 1Z7TA 4JI3L 3T4AC 1EOTA 2D62A 4QF4A 1W6KA 5IY0A 2K03A 5A2QE 3S14B 2OF1A 3TP5A 3S24A 1OO9B 2SDFA 2QILA 3D4RA 3VR4A 4A3GB 2IJ0A 4C3IB 1NNXA 1AN8A 4A3JB 4FF4A 2R7ZG 4ULLA 3NBHA 2WP8J 3AMUA 1IHZA 4LF9Q 1S3OA 1YEZA 4LF6Q 2XSCA 4X64L 1EY8A 1A0IA 1SR3A 3J80i 4OL7A 4UP9A 5DM73 4H7BA 3EJIA 2J0TD 3KF6B 5C44G 1B9NA 4A3KH 1IL8A 1XYIA 3QWNA 2VNUD 1JJGA 4KN7C 1PH2A 4DV2L 1XMOL 3MEFA 2LKVA 4IUPA 1TWAB 4LF4Q 5EPLA 1XMQQ 1YJNA 3GTOH 1E1OA 3X3MA 1IBML 3RZDH 5ISRA 5ELDA 4JG2A 3C1EA 4CKBA 3J80L 4HEDA 2JA6B 3OW7A 1Y1WH 2KCCA 5IYCG 4J15A 1M4VA 2X6LA 5CYUA 4JI5L 1FL0A 4EX5A 3TQYA 1U9RA 1G6PA 3GTPH 1FNVA 2MNAA 2QA4A 5C4XB 2XN9C 3VYSA 4FVMA 3EQLC 4BXXG 2EYPA 5CV9A 1H9SB 5KIXA 4HCSA 3UDIA 3ULPA 1U4RA 4YWKA 3HOYG 3VR6A 1ASZA 4DAYA 4PNYA 1EY5A 2BA0A 1ONLA 4RFBA 1KL9A 2MP1A 1NR4A 4DKAC 1DJRD 1K8MA 4UP8A 1NTGA 3PUXA 4UY8C 3FKIG 1EYGA 4BBSB 3OIQA 1HR0Q 1VQ8A 4WJWA 4HJ9A 3PO3H 1NMGA 5HURA 2JXMB 1QE6A 1DOLA 3BVGA 5IOCA 3TS0A 4K0KL 2PI2A 4NMZA 2B63B 4FYDA 3GTKH 4DR1Q 4CDFC 1R4PB 1SMYC 5KGUA 3E6ZX 3KDFB 4DAYB 1G291 2B29A 2R93G 4LF9L 3I55A 4KY6A 2K01A 1O7YA 3TP7A 4IO9A 1Q82C 1Y1VG 2RDFA 4YY3Q 5IGGA 1YNJD 2F0HA 2HD3A 2A73B 4RMFA 1U4LA 5DLQE 1SE2A 3E5SA 2BCOA 2A68C 1GVPA 2CHBD 4IUTA 2ZTCA 2H5XA 4ZUJA 4OWWB 1KABA 4DN4M 4A3LH 3KUPA 4BY1H 1CZGA 1PTOF 1KAAA 4A3GG 2QCPX 4C3IG 2R7FA 2OTJA 2IW3A 4ILWA 4PMBA 2K5VA 4A3KB 2VL6A 2CCZA 3STBC 2RA4A 2OTLA 3GTQH 1L1OA 4DR2Q 4ID6A 3T53B 3BS1A 1KLGD 3H3VC 3BVMA 2DJFC 2OXPA 2RDGA 5DNFA 3NWSA 4TQUS 2QGQA 4KHVA 3RZDB 4O0AA 4G7OC 5CV8A 5E4XA 3NTKA 3BG3A 4H02A 4DV6L 3CC7A 3HOXG 1TVXA 1WTQA 1J8IA 4QQBX 2IX0A 1B9MA 1PLFA 2AQ3B 1JR0D 4IPCA 4X66Q 3U4ZA 3ZJYC 2PZTA 1JJCB 1SXTA 1VDZA 3RUZA 3MXUA 4H0LC 3TMEA 3LGJA 2B2UC 1BCPC 1C7YA 1HNWQ 2GVBA 4RA8A 1HR0L 2WAQG 1VQCA 3OPOA 4U673 4DPGA 1LO5D 5LHY1 1STBA 2AQ1B 4N9TA 1Q12A 4DR4L 3F8TA 4DR7L 3CQZB 4KY5A 1UWVA 1SE8A 2PW7A 1FVIA 1FD7D 3A5ZB 1KXLA 2K50A 3VA5A 1PH9A 4L6TB 2EZVA 2J7ZA 3FP9A 2CH4W 3J81j 2PMZE 4TSSA 2F0UA 2EPBA 1CT1D 4BA1I 1S5CD 3E0JA 3DWPA 3ONAB 4KJOA 4X3UA 3A5UA 2OCEA 3WOFA 3SK4A 2EVBA 4BBSG 3E9HA 1HA6A 5JPMC 4DR6Q 1U0LA 1IZ6A 5CV6A 5KYIA 2JA8H 5ELOA 2RSOA 2AQ2B 2F0GA 1NE3A 1EYAA 1TS2A 3MWYW 5EPKA 2ZXPA 1O78A 4GKJL 2B63G 2RSNA 2KCMA 5IODA 2BE5C 4WRDA 2RVLA 2FMMA 2LS01 1D2BA 2EIFA 2GVAA 5BN4A 4JOIA 1SFOB 1STNA 2J4XA 2AWNA 5F2DA 4N9PA 1GUSA 4N8X1 2F03A 4BY1B 3CRLC 1WVLA 4XQJA 3DEPA 2F52A 2XVSA 3PV0A 1HNZQ 4A3CH 2Q8TA 4NKLA 3GTQB 3VYUA 1JCKB 3MC0B 1HNXQ 1U5KA 2OT2A 2G5DA 2V1CC 1QILA 4KHZA 2VUMH 1DOMA 3S15H 2O4XA 4A3KG 3G6EA 2NVTH 3PGZA 1HNWL 1NUCA 5JJKA 3QG1A 4LK1C 1MGSA 3SK5A 4IUNA 4NW2A 1K8AC 4CDCC 2QW7A 1VQAA 2VZAA 4OEMB 4JI0Q 1F2YA 4RAUC 2CW0D 5C4ZA 2IT1A 1CHPD 1SRUA 5CBAE 3M4OH 1Y1WG 4B9XA 1EOVA 2I0QA 4MHEA 3CCVA 1CUKA 3HZXA 4A3FH 1OXUA 4RG1A 5JVG3 1TY2A 5JVH3 2RCNA 1TWCH 3H91A 2UU9Q 1F2LA 4L63B 2DGYA 1SYCA 4DGZA 4V190 2L12A 4JW0A 4DR6L 3U58A 3AEVA 1EQVA 3L0OA 4OGQC 1LT3D 3M7GA 1Q3LA 1K28A 3J7ZC 1RODA 3A54A 3K58A 1PTOC 3I72A 2HCIA 2K5NA 1IBKL 1SYEA 4HJ5A 3KJPA 3OMCA 1CZWA 1IYJB 1KNEA 2KBNA 1X3GA 4K8JA 1CHQD 3PO3G 4UAIA 4EQ5A 4C3HB 1Z9FA 2B8FA 3DUZA 2F0NA 4HCEA 1UE5A 5JJLA 4XXEA 3FPPA 3IKJA 3H94A 4GN5A 3C2PA 1K0RA 2NZOA 1AZQA 2Q2IA 2V4DA 1B70B 1L1OC 4POGA 1HNZL 2JA5H 5CORA 2K52A 3M3YH 3I4MB 3O13A 1HHVA 1YJWA 2UUCL 2F0PA 2MQHA 3G6JB 4RGOS 4B9WA 2IWHA 3HOWH 4A75A 1N34Q 2R6GA 1ILQA 4GNXA 2R92H 4HJ7A 1CKNB 2HHHQ 4K6DA 4LWCA 1SEBD 1GUWA 4CDEC 4XDXA 3S1QH 2SOBA 3NEMA 4DV0Q 5JEAH 1XJVA 1PYBA 1KNAA 3NBIA 5EPJA 4BY1G 3S16H 4A3LG 3GTGH 1X56A 1FJGQ 2X69A 3S15B 2E8GA 2ICIA 3HEJA 1QB5D 3UDGA 2F0IA 3PMFA 3CU7A 2R7ZB 5IGBA 3CF5A 2NVTB 4RWSC 3OHXC 5I2YA 1I4XA 4NXMQ 3H0GH 2EJFC 5IGDA 4X6AH 4BY7H 3BYYB 1X3PA 3SDZA 4U68A 3PUWA 1YI2A 2B39A 3KYHC 4R4IA 2MGSA 2EYLA 3CRKC 1STEA 3ER0A 2D2CC 2Z0SA 4XT1B 1WD0A 3Q23A 3CAMA 3G71A 2UU9L 4Q0FA 4UHVA 1EL0A 5C44B 1LTBD 1BQQT 2YTXA 3FHWA 5LL6S 1HR0W 1HTPA 4IOAA 2A8VA 5M5WH 2IPKD 1Y14B 1S5DD 1GUNA 2F0DA 1JORA 3SK6A 2HT1A 5C3EH 1UUPA 1STGA 5GROA 3CKIB 2LXKA 3D4DA 1MI2A 3VR2A 2R61A 2P5ZX 5M9OA 4L5TA 3C1FA 2UXCQ 5FOBB 1LLRD 2XWJB 2SNSA 3NP8A 3M9BA 4IALA 2K5QA 3S17B 5JJZA 4TRDA 1Q46A 1EY9A 4KKSA 1EEFD 5HGQA 2F0VA 4X64Q 2D5DA 3HG9A 2EY6A 1HZBA 4GOPC 1KHIA 2PZWA 4A93H 3D31A 3I91A 3NTHA 1F9QA 2ZXOA 3RR5A 1PH5A 3PUZA 2I5LX 4X65L 5FO8B 2UXBQ 5CGKA 2VQFL 4ALPA 4HJAA 2KOLA 4DV2Q 5M5XB 3N6RA 1XMOQ 4LJZC 1F9PA 1A8VA 2A6EC 4XYQA 1TQOA 3L7ZC 3ERSX 1GO3E 1IBMQ 1N34L 2K6AA 4LF5Q 2RHQB 2EXZA 4QY7A 1YNNC 4KV6A 4HJ8A 4DXGA 4HSVA 1JB7A 1EIYB 4JI5Q 3C3LA 4JCVE 5E3FA 4DV0L 3GDEA 3F2CA 4ZCKA 3JC66 2KEDA 4DV4L 4DAMA 2KHJA 3HOWB 2K5HA 2K7VA 1W2BA 2SEBD 3A8IE 1I4GA 1PYWD 1TWHB 1IYVA 3H6MA 1HFGA 1MSGA 1SROA 4LF7L 4OIJA 2R93B 3J81c 1VMPA 4JPBW 3CC4A 2EY2A 1WJJA 1Y1VB 2K5DA 2KUMA 3WDNA 2WB1E 2WKDA 2HDMA 1MD2D 5EKIA 3GTGB 3A8JE 3J80c 3KLSA 1D5XC 1OTCA 5EBDA 4XQQA 1V1QA 3KF6A 1G6ZA 2N3SA 4OX9L 2F1MA 3AB9A 4BY7B 1QUQA 2ZM6Q 1B44D 4A3DH 1VQDA 1TY0A 3HKSA 4RHRA 4C3JH 4L8JA 4PV1C 4K0KQ 4DNTB 2D9UA 1HXYD 4APVA 3AFPA 2ENBA 3DWQA 3KFUA 2F0WA 3CCQA 4K5XA 2Z9HA 3CP0A 2VUMG 2PNRC 5J1ZA 2UXCL 3BZKA 4DK6C 3CMEA 4A3EH 4KMUC 4ZUIA 5IT9c 4DV3L 1G2TA 3J81i 4PG3A 4HIOA 1FYCA 4OWXB 4JC0A 5C3EB 3NWTA 3SEBA 1RIPA 1F2MA 4OXPA 1PVOA 2CQOA 3PIO3 4X3SA 3VR5A 1AW7A 4EQOA 1CQFA 3EFXD 4DV7Q 4IUUA 4P2CB 1DYQA 1YBYA 3NE5B 1H9SA 1O7IA 2L9HA 3HS0C 3HOXB 1QUQB 3M7NA 1ZYRC 2WINB 2UXBL 1DXMA 1KDCA 2I07B 2L15A 3J81L 1PDQA 2E2JH 4ODGA 3NUCA 1Y8PB 4JBJA 3S2DH 3EROA 4LF5L 4R4QA 1LT5D 1RTNA 4S3SA 2IL8A 4EVOA 3H09A 1Q90A 3MEHA 2OQKA 2WAQB 2ZT9C 3DLLA 1MJEA 5FLMH 2NVQH 5KRUA 1DCZA 1TXYA 3ULLA 1PRTB 3SHLA 2JEAI 1NY4A 3HGBA 2PNHA 3SGIA 2AKWB 5D3IB 4FNFA 4DV6Q 2JN4A 1JJ2A 1PTOH 3NTIA 5JJIA 2Q2UA 3KDFA 5IP9H 4LUOA 4QL5A 2NVYH 3W1BA 5IT9L 1ILPA 2MFIA 1TS4A 4B3TL 1RF2D 4NP5A 3PSIA 4ZKCB 3WOEA 4CJ1B 1NAPA 2VW9A 1S5FD 4BBRH 3GTJH 3J7YW 4DXFA 3R2IA 4EGVA 3P7JA 2ZM6L 1RL2A 1JWMD 4DR4Q 1UNSA 3MA2B 3F2BA 4DR7Q 3D8GA 3HOWG 3OWFA 3K5LA 2E2IB 5IE8A 2R92G 1W3SA 1K8GA 1B53A 3GP7A 1HJPA 4JI4L 4JI7Q 2RDHA 3I4OA 3PIP3 3RLFA 2MO0A 5ELCA 4KK7A 3GTMH 3HRZC 2K5WA 4YCWA 4A3DB 3JAMi 4O1NA 4EQPA 5JEAG 4C3JB 3LWEA 5KNBA 1BNZA 1B3QA 2ZJPA 4L5SA 2Z6BA 1DM0B 4MZ9A 3I73A 1VQLA 4AQYL 1WTWA 3L2PA 4DV7L 1T5XD 5JEAJ 4A3EB 3E9IA 4C1NK 1JMCA 3H0GG 4BY7G 3MFYA 1I4HA 1NBWA 5I4DA 1V1PB 4OO1H 1H9MA 2KCTA 2IHEA 4GKJQ 2CVRA 1Q86C 2M9VA 1AE2A 1JWUD 5HGTA 1CI3M 1DD2A 3M4PA 4JI1Q 4A3IH 1PFBA 1PXUA 4UPAA 4PZ7A 1SNQA 2DY8A 2QDLA 3CPFA 1HPCA 1Y8OB 5IWAQ 1VQKA 1Q7YC 5C3EG 4IPDA 1CA6A 4C56C 3PIOA 1PH8A 2BOSA 1VF5C 1V43A 5IIFA 3GTOB 5C4HA 2DNEA 4DV1Q 3ICEA 1QNUA 1A15A 4CKEA 1UE7A 1HTLD 1Y1WB 2K14A 4M8AA 3AYHB 4G7ZC 5C5MA 2NVQB 2KEEA 3GTPB 4QUFA 2NZHA 3T56B 1MIUA 3J7A5 1QNKA 1B50A 3K5NA 4PMWA 1VS0A 1BO0A 3Q24A 1GXDC 1RHPA 3CW2C 3U9SA 2XIWA 2WKCA 1EYDA 3PQIA 1I6VC 1I3QH 5CV7A 3QB3A 2YTVA 2GA4B 1JC7A 3FPUB 1XNQQ 1YHAA 1I5FA 2F4VQ 4JYAQ 5EJWA 1C8CA 2NVYB 5E7NA 4GKKQ 3J81E 1LTID 1SYFA 3Q0AA 1O7LA 1SE3A 3CCRA 2DJGC 3DEOA 4K2KA 3J80E 1XXGA 1I4RA 2CWPA 3QR8A 3M85A 1T9HA 4JI7L 1TKWB 1K9MC 4G57A 1I6HH 3L3OC 4JV5L 1BUVT 5M3FH 3TSSA 2O5IC 3PO3B 5E1FA 4MN3A 1E2VA 3MAQA 3MXNB 1SNCA 2PCFB 1TS3A 4AIMA 1HFNA 4IFDH 3ULJA 2NTTA 1VQFA 5KYLA 4POFA 3GTKB 1PFMA 1AZPA 5EQ0A 2WB1B 2A19A 2R3ZA 1L2FA 5J39A 3GTMB 4GS3A 2B2YA 3QJYA 3H15A 4LW1A 2N78A 5BN3A 1WCMH 3T1YL 1JOQA 1IBKQ 2B2WA 4RCNA 3DM3A 4DR5L 3PIPA 4LAAA 4RHSA 2NYZD 2HQLA 2N55A 3S9WA 1TIID 3SR1A 4F7XA 1E24A 2A69D 3V2TA 5IYBH 4CHTB 4JI1L 4A3DG 1DZ1A 1CKOA 4C3JG 1OXVA 4NDXA 3G4SA 5IWAL 3UDFA 1F9SA 1PH4A 3G7LA 2F3IA 1DONA 1EQTA 5I9PA 2F3WA 1IW7D 1M8AA 4DV1L 2JA7H 1QVGA 4KN4C 4A3EG 3IRBA 1WOCA 4ZQ3A 3OTOL 4FF3A 1AP0A 4F87A 4HMIA 4ZYSA 2UUCQ 2R7DA 1VQPA 4YCUA 1EU3A 2FINB 2L5TA 1EQRA 1PFSA 4DUZL 1KRSA 3X3NA 2KQ3A 2C35B 1XTDA 1SNOA 3A7LA 3F1ZA 3FRPB 5LMUL 5K36H 1XNQL 4QIWE 4YHHL 2NN6H 2OQ0A 4ME5A 2Z4IA 2F4VL 4JYAL 4GKKL 2YTYA 4M1UB 1NCVA 3KLWA 1D5MC 3OOCA 3CCMA 1N36L 1BOSA 2B2VA 2Z4HA 3QIAA 2E2DC 4QGUA 1NJIC 3MVVA 2Y0SE 3R8BA 3CC2A 4GLVB 1XTCD 5LMNQ 2RCFA 2NZ1D 2X6GA 2F0LA 3RZOH 4X3KA 2QEXA 4I7AA 5GQOA 3NENA 1STYA 1BBWA 4FO2A 1LTTD 1TWGH 5FLMG 1S4ZA 3MXPA 3KF8A 1PH3A 1JB3A 1FGBD 1R4QB 4LFBQ 2NBFA 1VQIA 1Q81C 1GM5A 4JI6Q 2EXDA 2XGTA 1FGUA 4RGMA 1HCZA 4RKBA 1STHA 3S1MH 5IP9G 1SN8A 1PFNA 3QO2A 1QOHA 2DNCA 2IHFA 5C5LA 5C4JH 2CH4A 2A6HD 2NTSA 3W2DA 4CGYB 1CKNA 1II3A 1GD7A 4BBRG 1WTHA 4DAVA 1T5EA 3KLSX 1BR9A
chains in the Genus database with same CATH topology
5DM63 2JA8B 1YNJC 3EVQA 1KLUD 2LMCB 1E2WA 5KNDA 1GOZA 1ZKOA 2WV6D 1WD1A 2LFNA 3N52A 1VF7A 1LABA 1K8OA 4XYOA 5CC4A 4F8MA 1RKNA 4QMGA 1WTXA 1B2TA 5AFWA 4KD3A 4F88A 5COYA 4KI0A 2K04A 1SYBA 4I7ZC 4R8NA 4CBVA 2RBMA 4K5WA 5FO9B 3I70A 3NXWA 3DWAA 2PZUA 4OO1G 3IFTA 2EE1A 3GD7A 4HAEA 3F2UA 1SYGA 1SDFA 1WTVA 1BBXC 2VUMB 3I8ZA 3MFGA 1O7ZA 4IQZA 2JE6I 1J9OA 2RKSA 4MIUA 3K5MA 5D14A 4KJNA 3Q22A 3M4YA 1EZ8A 3M4OB 3RZOB 5T1GA 2VB3X 2F4IA 4ABNA 1ML0D 1TWGB 1SMYD 4A3FB 2WACA 2EY1A 4G4KA 1SNPA 2O5JC 1TWCB 5LL6X 1V1OA 2B2YC 1XX8A 5I9OA 1EY7A 4R8IA 1I4PA 3BDCA 2K28A 5C4JB 1VCIA 2DN8A 1D1KA 2PMZB 2PW5A 2QDBA 1B3AA 3CHBD 2VXWA 2EDGA 4K14A 5ELFA 2EYOA 1QG7A 4FP5D 1PZJD 5C0XJ 4C1NI 4EQNA 4E6IA 2L4NA 1UEAB 2DY7A 4IFDG 4HR7B 3KLRA 1X32A 1WTPA 4DK0A 3TZUA 3OMGA 4UDUC 3J7AV 2BA1A 4HSPA 3IAYA 3NQTA 4ZKBB 4Q5VA 2JA5B 2JYOA 1A2TA 4IFDJ 4CKCA 5I2XA 3M3YB 1MBYA 2EYMA 1IW7C 1F2ZA 1S5ED 3DM1A 2R92B 3BDOA 1I50B 1ENCA 2EYHA 4RGTA 4FXGC 2E74C 3TN2A 3RD4A 1CK1A 3I90A 3S1QB 1OXTA 4BS9A 1H9RA 2B2TA 4DA2A 3S16B 2NWGA 4BA2I 5KEEA 3D4WA 3GQBA 3NSWA 1KDAA 2QEJC 1ENFA 3H0GB 4X3TA 2A74C 3J7AF 1PRTD 5D3DA 3NPPA 1QWYA 5IGFA 2CW0C 2NB0A 1DOKA 1WTOA 2KA7A 4LMQD 1E0BA 5K36G 1RD9D 3QOJA 4J1MA 2NN6G 2Y0SB 4K2LA 5M5WB 1V8QA 5I6YA 2PQEA 2O2LD 4G7HC 2K32A 1AFPA 2XRQD 4DK1A 2BE5D 1PRTF 2A6HC 1OXSC 1BCPB 1WTRA 4RCOA 3FDTA 2M2LA 3PO2B 4DNRB 1ZEQX 2JP1A 3GTLB 4KY7A 4A93B 1QCBD 3MHBA 2ID0A 3T51B 1SYDA 1KTKA 1STAA 2PO4A 4JBWA 1NR2A 3SXHA 4H13C 1ET9A 1SJED 4IURA 4KTAA 3SVMA 2HQEA 1HQMC 1E2ZA 1W6JA 1FNUA 4I65A 3I4NB 3R3OA 1A3TA 4IUQA 2FHTA 2L55A 1ESRA 3TDQA 2BDOA 2WIIB 2C9OA 2SNMA 4DU9A 5M3MB 1JQYD 1JICA 2E75C 3HP3A 3ERQA 5K5PA 4YIJA 3SK8A 2H1EA 4O42A 1TR5A 5IGCA 1V1PA 2LY7A 4ZAIA 2C5CA 1S5BD 1I4QA 3S1RB 3VA7A 1EFID 3QOLA 1XWEA 5NUCA 1HA5A 5JAVA 4XT3B 4A3MB 3R93A 4CJ2C 1HRJA 3GV6A 2F0QA 4B08A 1JOKA 2K1BA 5A35A 4GZYC 1ESFA 4KKTA 1PTOD 4DAPA 1Y8NB 3C46A 2ZXRA 3U9OA 5C3XA 5ELBA 5C6AA 3GO5A 1Q8IA 1HQRD 4KD4A 4H44C 3JAML 1O80A 4XQNA 5E4WC 1QJOA 4QUCA 4AYBB 1ZXTA 2F0EA 3D6WA 3MTSA 1GUGA 2EYJA 1ICWA 4ZRZA 2AWOA 2E2JB 5JOBA 3VYRA 1SBBB 3S2DB 4DFAA 2EOTA 3K7AB 4K8IA 4FF2A 3MXNA 1OXXK 1L0XB 2RQXA 4PQXA 2PPBC 3K6OA 1C4QA 1LTRD 3ND8A 3P1HA 2B2TC 2EJMA 3NQIA 4IUVA 4R9WA 1PTOB 1H9JA 2QKIC 1CQVA 5JPNC 3P75A 3GV3A 1FR3A 1LT6D 2G9DA 5C0XH 4IZ8A 1U4PA 2VB2X 3KK7A 4C2MB 4RGNA 2I46A 3V05A 4BBRB 3GTJB 4J8QA 1AEXA 1SE4A 2KCNA 3IL8A 1EY6A 1A3UA 2YU9B 1EYCA 5I6WA 3NK9A 2B8GA 2L11A 3KBGA 2F0KA 3I3CA 2F0MA 1B1ZA 1LTGD 5IT9E 1FNWA 1PRTC 3HOUB 1RCVD 1IKMA 3PUVA 3SE0A 1A3VA 1D6EC 3RMHA 3HOZB 2FFKB 3OSOA 2JEBI 1SSOA 2Q8IB 2IX3A 4BWGB 3UI2A 5FKAC 3AU7A 3KBXA 2AUKA 5KNCA 3FMCA 3K57A 1CTMA 3TZDA 2A6ED 2FMCA 3V96A 1PMRA 4A3IB 5J22A 1YNND 2BDNA 3T13A 1F77A 1F9RA 2EY5A 4RKLA 1CFMA 1SNDA 2L0CA 5CMDA 3LNNA 3P20A 1G2SA 3VR3A 2NUCA 5CV5A 2F0TA 1H9KA 5D65A 4OIKA 2YYZA 4ZK9B 3JAME 1A2UA 2MJ8A 1LACA 3TP6A 4A3BB 3HOVB 5IGEA 2QF7A 3BZDB 3MZ5A 4WORA 1I3QB 2AUJD 4OO1I 2H4OA 2OEOA 1MSHA 4ZLTF 4RH6A 4TKOB 5EGTA 3ND9A 4J6HA 1A6XA 3Q6SA 3A7AB 4FXKC 2M00A 4IN3A 3OWEB 1EY0A 1PZID 1I6HB 1Z6HA 1EIHA 1R9TB 3R2TA 5M3FB 2MPMA 1G91A 3FEWX 2EYFA 1B4OA 1BXTA 2K33A 2HDLA 4KKUA 1TS5A 2G9HD 3VYTA 1TWFB 2ICEC 1GHKA 3S1NB 2XNAC 1G8ZD 4JK1C 1GJXA 3BVZA 4HMJA 1LV9A 5FLXL 1BF4A 1WCMB 2KJXA 4QCLA 1ZYRD 1JE4A 1RJTA 2EJGC 1Y69U 1JWSD 1PZKD 5C0XI 2TSSA 5C3WA 4XIGS 1EU4A 1Z47A 2F0JA 5DAUA 1IKLA 2JA7B 3URYA 1LT4D 2CQAA 4IFDI 5G3LD 2PYKA 3HKZB 4WFN3 2E76C 1SJHD 5FO7B 3D3RA 2IX1A 1SAPA 1CA5A 1D1IA 1EWCA 2Z1CA 5EKKA 5A2QL 2HCCA 5T1IA 1EEID 1HUMA 3DHQA 5FK9C 1BDOA 2F0OA 3FVQA 3K5OA 4HTHA 3BYTB 1Q1BA 3W3AA 5G3LF 2KECA 1GUOA 3PUYA 1SNMA 2JSOA 1EIGA 4QB4A 5ELEA 2F0SA 2KHSA 1LTAD 1IYUA 3T16A 4CJ0B 1GUTA 1L0YB 2N88A 3S1MB 5EKLA 1VMCA 2B2WC 5CBEE 5C0XG 2TMPA 4Z9CB 2A68D 1Q1EA 5DEHA 1X3QA 2NN6I 2F3VA 3ITPA 4K6LA 1ET6A 4K5VA 2A5HA 3K59A 5EBCA 2F0FA 1TU2B 2A69C 3BDLA 4OHJA 3HOYB 3DMUA 3TBIB 1K83B 1RDPD 2KVMA 1EZ6A 1CM9A 1TT2A 2MHVA 1C48A 2E2HB 4HN7A 4FXDA 2FJ2A 4DF7A 3D6CA 5CR3A 3TP8A 1NSNS 3OIPA 4XTCS 3FKIB 3DXJC 1LTSD 3LWUA 5FLXE 2B2VC 2Q8RE 2NVXB 1ENAA 5M5YB 3I4LA 4C3HG 1GHJA 1JOOA 1BCPD 2XWBB 1KDBA 4FF1A 3NHHA 1HUNA 1UAPA 1EY4A 3A55A 3S2HB 1U4MA 1RTOA 2K05A 5TSSA 1D5ZC 3A56A 2XRSD 2HUGA 2L1BA 1EWHA 4V0BA 2B2UA 4QIWB 3L9AX 3LX0A 3MXGA 4PMCA 5BN5A 4Y7NB 3A8KE 3EA6A 3ZYYX 2MUYA 2Z8LA 3IFDA 1BCPF 5CV4A 3K0YA 1Z7TA 3T4AC 1EOTA 2D62A 4QF4A 1W6KA 2K03A 5A2QE 3S14B 2OF1A 3TP5A 1OO9B 2SDFA 2QILA 3D4RA 3VR4A 4A3GB 2IJ0A 4C3IB 1AN8A 4A3JB 4FF4A 4ULLA 3NBHA 2WP8J 3AMUA 1IHZA 2XSCA 1EY8A 4OL7A 5DM73 4H7BA 3EJIA 2J0TD 1B9NA 1IL8A 1XYIA 3QWNA 2VNUD 4KN7C 2LKVA 4IUPA 1TWAB 5EPLA 3X3MA 5ISRA 5ELDA 3C1EA 4CKBA 3J80L 4HEDA 2JA6B 3OW7A 2KCCA 5CYUA 1M4VA 2X6LA 1U9RA 1FNVA 5C4XB 2XN9C 3VYSA 4FVMA 3EQLC 2EYPA 5CV9A 1H9SB 5KIXA 4HCSA 1U4RA 3VR6A 4DAYA 4PNYA 1EY5A 2BA0A 1ONLA 4RFBA 2MP1A 1NR4A 1DJRD 1K8MA 3PUXA 4BBSB 3OIQA 4WJWA 5HURA 2JXMB 1QE6A 1DOLA 3BVGA 5IOCA 4NMZA 2B63B 4FYDA 1R4PB 1SMYC 5KGUA 3E6ZX 1G291 4KY6A 2K01A 1O7YA 3TP7A 2RDFA 5IGGA 1YNJD 2F0HA 2A73B 1U4LA 1SE2A 3E5SA 2BCOA 2A68C 2CHBD 4IUTA 4ZUJA 1KABA 4DN4M 3KUPA 1CZGA 1PTOF 1KAAA 2QCPX 4C3IG 2IW3A 4ILWA 4PMBA 4A3KB 2RA4A 4ID6A 3T53B 3BS1A 1KLGD 3H3VC 3BVMA 2OXPA 2RDGA 5DNFA 3NWSA 4TQUS 4KHVA 3RZDB 4G7OC 5CV8A 5E4XA 3NTKA 3BG3A 1TVXA 1WTQA 1J8IA 2IX0A 1B9MA 1PLFA 2AQ3B 1JR0D 2PZTA 1SXTA 1VDZA 3RUZA 3MXUA 4H0LC 3TMEA 2B2UC 1BCPC 4RA8A 3OPOA 4U673 1LO5D 5LHY1 1STBA 2AQ1B 4N9TA 1Q12A 3CQZB 4KY5A 2PW7A 1FD7D 3VA5A 4L6TB 2EZVA 2J7ZA 4TSSA 2F0UA 2EPBA 1CT1D 4BA1I 1S5CD 3E0JA 3DWPA 3ONAB 4KJOA 4X3UA 3WOFA 3SK4A 2EVBA 1HA6A 5JPMC 5CV6A 5KYIA 2RSOA 2AQ2B 2F0GA 1EYAA 1TS2A 3MWYW 5EPKA 2ZXPA 1O78A 2RSNA 5IODA 2BE5C 4WRDA 2RVLA 2FMMA 2LS01 1D2BA 5BN4A 1SFOB 1STNA 2J4XA 2AWNA 5F2DA 4N9PA 1GUSA 2F03A 4BY1B 3CRLC 1WVLA 4XQJA 3DEPA 2XVSA 3PV0A 2Q8TA 4NKLA 3GTQB 3VYUA 1JCKB 3MC0B 2OT2A 1QILA 4KHZA 1DOMA 2O4XA 1NUCA 3QG1A 4LK1C 1MGSA 3SK5A 4IUNA 4NW2A 1F2YA 4RAUC 2CW0D 5C4ZA 2IT1A 1CHPD 5CBAE 4B9XA 4MHEA 3HZXA 1OXUA 5JVG3 1TY2A 5JVH3 3H91A 1F2LA 4L63B 1SYCA 4DGZA 4V190 2L12A 1EQVA 4OGQC 1LT3D 3M7GA 1Q3LA 1RODA 3A54A 3K58A 1PTOC 3I72A 2HCIA 1SYEA 3OMCA 1CZWA 1KNEA 4K8JA 1CHQD 4UAIA 4C3HB 2B8FA 3DUZA 2F0NA 4HCEA 4XXEA 3FPPA 3IKJA 3H94A 3C2PA 1AZQA 2V4DA 5CORA 3I4MB 3O13A 1HHVA 2F0PA 3G6JB 4RGOS 4B9WA 2IWHA 2R6GA 1ILQA 4K6DA 1SEBD 1GUWA 4XDXA 2SOBA 5JEAH 1KNAA 3NBIA 5EPJA 2X69A 3S15B 2ICIA 3HEJA 1QB5D 2R7ZB 2F0IA 3PMFA 3CU7A 5IGBA 2NVTB 4RWSC 3OHXC 5I2YA 1I4XA 2EJFC 5IGDA 3BYYB 1X3PA 3SDZA 4U68A 3PUWA 2B39A 2MGSA 2EYLA 3CRKC 1STEA 1WD0A 2D2CC 4XT1B 3Q23A 4Q0FA 1EL0A 5C44B 1LTBD 1BQQT 5LL6S 1HTPA 2IPKD 1S5DD 1GUNA 2F0DA 1JORA 3SK6A 1UUPA 1STGA 3CKIB 3D4DA 1MI2A 3VR2A 2R61A 5M9OA 3C1FA 5FOBB 1LLRD 2XWJB 2SNSA 3NP8A 4IALA 2K5QA 3S17B 5JJZA 4TRDA 1EY9A 4KKSA 1EEFD 2F0VA 2D5DA 3HG9A 2EY6A 2PZWA 3D31A 3I91A 3NTHA 1F9QA 2ZXOA 3PUZA 5FO8B 5CGKA 2KOLA 5M5XB 3N6RA 4LJZC 1F9PA 2A6EC 4XYQA 1TQOA 3L7ZC 2K6AA 2EXZA 1YNNC 4KV6A 4DXGA 4HSVA 3C3LA 5E3FA 2KEDA 3HOWB 2K7VA 2SEBD 3A8IE 1I4GA 1PYWD 1TWHB 1IYVA 3H6MA 1HFGA 1MSGA 4OIJA 2R93B 1VMPA 2EY2A 1Y1VB 2K5DA 2KUMA 3WDNA 2WKDA 2HDMA 1MD2D 5EKIA 3GTGB 3A8JE 3KLSA 1D5XC 5EBDA 4XQQA 1G6ZA 2F1MA 3AB9A 4BY7B 1B44D 1TY0A 4RHRA 4L8JA 4PV1C 4DNTB 2D9UA 1HXYD 2ENBA 3DWQA 2F0WA 4K5XA 2PNRC 5J1ZA 4KMUC 4ZUIA 1G2TA 1FYCA 5C3EB 3NWTA 3SEBA 1F2MA 3PIO3 4X3SA 3VR5A 1AW7A 4EQOA 1CQFA 3EFXD 4IUUA 4P2CB 1DYQA 3NE5B 1H9SA 2L9HA 3HS0C 3HOXB 3M7NA 1ZYRC 2WINB 1DXMA 1KDCA 2I07B 3J81L 1PDQA 4ODGA 3NUCA 1Y8PB 3EROA 1LT5D 1RTNA 4S3SA 2IL8A 4EVOA 3H09A 1Q90A 3MEHA 2WAQB 2ZT9C 5KRUA 1DCZA 1PRTB 3SHLA 2JEAI 3HGBA 5D3IB 4FNFA 1PTOH 3NTIA 5IT9L 1ILPA 1TS4A 1RF2D 4NP5A 4ZKCB 3WOEA 4CJ1B 1NAPA 1S5FD 3J7YW 4DXFA 3R2IA 4EGVA 3P7JA 1JWMD 1UNSA 3MA2B 3D8GA 3OWFA 3K5LA 2E2IB 1B53A 3GP7A 2RDHA 3PIP3 3RLFA 5ELCA 4KK7A 3HRZC 2K5WA 4A3DB 4O1NA 4EQPA 5JEAG 4C3JB 3LWEA 5KNBA 1BNZA 1DM0B 3I73A 1WTWA 1T5XD 5JEAJ 4A3EB 4C1NK 3MFYA 1I4HA 5I4DA 1V1PB 4OO1H 1H9MA 2CVRA 2M9VA 1JWUD 5HGTA 1CI3M 1DD2A 1PFBA 1PXUA 1SNQA 2DY8A 1HPCA 1Y8OB 1CA6A 4C56C 2BOSA 1VF5C 1V43A 5IIFA 3GTOB 5C4HA 2DNEA 1QNUA 1A15A 4CKEA 1HTLD 1Y1WB 4M8AA 4G7ZC 5C5MA 2NVQB 2KEEA 3GTPB 4QUFA 3T56B 1QNKA 1B50A 3K5NA 4PMWA 1BO0A 3Q24A 1GXDC 1RHPA 3U9SA 2XIWA 2WKCA 1EYDA 1I6VC 5CV7A 3QB3A 2GA4B 1JC7A 3FPUB 5EJWA 1C8CA 2NVYB 3J81E 1LTID 1SYFA 3Q0AA 1O7LA 1SE3A 3DEOA 4K2KA 3J80E 1XXGA 1I4RA 3M85A 1TKWB 4G57A 3L3OC 1BUVT 3TSSA 2O5IC 3PO3B 5E1FA 4MN3A 1E2VA 3MAQA 1SNCA 2PCFB 1TS3A 1HFNA 4IFDH 2NTTA 5KYLA 3GTKB 1PFMA 1AZPA 5EQ0A 2WB1B 2R3ZA 5J39A 3GTMB 2B2YA 3QJYA 5BN3A 1JOQA 2B2WA 4RCNA 4LAAA 4RHSA 2NYZD 2N55A 3S9WA 1TIID 3SR1A 4F7XA 2A69D 3V2TA 4CHTB 1DZ1A 4C3JG 1OXVA 4NDXA 1F9SA 3G7LA 1DONA 1EQTA 5I9PA 2F3WA 1IW7D 1M8AA 4KN4C 4ZQ3A 4FF3A 1AP0A 4F87A 4HMIA 4ZYSA 1EU3A 2FINB 2L5TA 3X3NA 2KQ3A 1SNOA 3A7LA 3FRPB 5K36H 2NN6H 4ME5A 2Z4IA 4M1UB 1NCVA 3OOCA 1D5MC 1BOSA 2B2VA 2Z4HA 3QIAA 2E2DC 3MVVA 3R8BA 1XTCD 2NZ1D 2X6GA 2F0LA 4X3KA 1STYA 4FO2A 1LTTD 1S4ZA 3MXPA 3KF8A 1JB3A 1FGBD 1R4QB 2NBFA 4RGMA 1HCZA 4RKBA 1STHA 1PFNA 3QO2A 1QOHA 2DNCA 5C5LA 2A6HD 2NTSA 3W2DA 4CGYB 1II3A 4DAVA 1T5EA 3KLSX 1BR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQE A;  4PNY A;  4S3S A;  1EY5 A;  2F0K A;  2F0M A;  2EXZ A;  2PW5 A;  3EVQ A;  1SNQ A;  2QDB A;  4K6D A;  4KV6 A;  4NDX A;  1SNM A;  2PZT A;  4EVO A;  3MEH A;  2EYF A;  2EYO A;  4K14 A;  4QB4 A;  3RUZ A;  3LX0 A;  3TME A;  2O4X A;  3U9O A;  4PMC A;  5KRU A;  2F0S A;  2KHS A;  5C3X A;  2SOB A;  5E3F A;  2F3W A;  5C4H A;  5I9P A;  5IIF A;  3SHL A;  3T16 A;  4EQN A;  1NUC A;  5C6A A;  5CC4 A;  1A3V A;  4E6I A;  4KD4 A;  4F8M A;  5IOD A;  3SK5 A;  4IUN A;  5HUR A;  1RKN A;  4QMG A;  5EKL A;  1STB A;  4N9T A;  5CV4 A;  4ZQ3 A;  4KD3 A;  3OSO A;  4HMI A;  4KY7 A;  4HMJ A;  4KY5 A;  5IOC A;  2PW7 A;  3H6M A;  3HEJ A;  3OMG A;  4NMZ A;  2F0I A;  1F2Y A;  3PMF A;  5C5M A;  5IGB A;  5C4Z A;  3MHB A;  4QF4 A;  1SYB A;  3VA5 A;  3NQT A;  1SYD A;  2OF1 A;  4R8N A;  3TP5 A;  2F0E A;  4B9X A;  5DEH A;  2KQ3 A;  2EY2 A;  1A2T A;  1STA A;  2RBM A;  1SNO A;  5KGU A;  4K5W A;  2EYJ A;  4NP5 A;  1EYD A;  3SXH A;  3ITP A;  2F0U A;  2F3V A;  3HZX A;  5CV7 A;  4K5V A;  3QB3 A;  1IHZ A;  2EYL A;  3NXW A;  2PZU A;  4KY6 A;  4KTA A;  5JOB A;  2EYM A;  3TP7 A;  4ME5 A;  2HQE A;  1F2Z A;  4DFA A;  2RDF A;  4KJO A;  4I65 A;  5IGG A;  1SYF A;  1ENC A;  2F0H A;  5J22 A;  3R3O A;  2F0F A;  1SYG A;  5C3W A;  1EY8 A;  1A3T A;  1SYC A;  3T13 A;  4K8I A;  2EYH A;  3SK4 A;  4DGZ A;  2EY5 A;  4RKL A;  3MVV A;  3D8G A;  4K2K A;  3OWF A;  4OL7 A;  4H7B A;  2F0D A;  3EJI A;  1JOR A;  1SND A;  3E5S A;  3SK6 A;  1EQV A;  2ENB A;  2F0L A;  2F0J A;  3BDL A;  4G57 A;  5CV6 A;  5DAU A;  2SNM A;  2F0W A;  5KYI A;  1STG A;  4K5X A;  3NK9 A;  3D4D A;  1STY A;  2F0G A;  3DMU A;  1EYA A;  4DU9 A;  5J1Z A;  2NUC A;  5CV5 A;  2F0T A;  1SYE A;  5M9O A;  3MXP A;  2RKS A;  1EZ6 A;  3C1F A;  5E1F A;  3P1H A;  4MIU A;  4ZUJ A;  1KAB A;  4KJN A;  4ZUI A;  5KEE A;  1SNC A;  3ERQ A;  1TT2 A;  2PYK A;  2LKV A;  3D4W A;  3OMC A;  2SNS A;  1A2U A;  4WRD A;  4YIJ A;  3SK8 A;  1KAA A;  3NP8 A;  4EQP A;  1KDA A;  4K8J A;  4IAL A;  3P75 A;  1EZ8 A;  4PMB A;  5KYL A;  4TRD A;  1TR5 A;  5ISR A;  1EY9 A;  3TP6 A;  5IGC A;  4DF7 A;  2F0V A;  3C1E A;  1F2M A;  4IZ8 A;  3D6C A;  5CR3 A;  2F0N A;  4RKB A;  1STH A;  5EKK A;  2EY6 A;  3TP8 A;  1NSN S;  1STN A;  4B9W A;  5IGE A;  3MZ5 A;  4WOR A;  5J39 A;  4EQO A;  5F2D A;  2WAC A;  4N9P A;  2EY1 A;  3QOL A;  5C5L A;  1ENA A;  2PZW A;  4ID6 A;  5IGF A;  1U9R A;  1SNP A;  5NUC A;  2OEO A;  2OXP A;  1JOO A;  3DHQ A;  5JAV A;  1KDB A;  3NHH A;  5I9O A;  1JOQ A;  1EY4 A;  1AEX A;  1KDC A;  4KHV A;  3QOJ A;  5EGT A;  5CGK A;  4J6H A;  5CV8 A;  2F0O A;  4HTH A;  1EY7 A;  1II3 A;  4J1M A;  4LAA A;  5IGD A;  2EYP A;  5CV9 A;  1EY6 A;  4K2L A;  5KIX A;  3S9W A;  1A3U A;  2M00 A;  1EYC A;  3BDC A;  3SR1 A;  5K5P A;  4NKL A;  2F0P A;  4ODG A;  3NUC A;  4F7X A;  2F0Q A;  3V2T A;  5I6Y A;  5HGT A;  1TQO A;  5I6W A;  3ERO A;  1EY0 A;  1JOK A; 
#chains in the Genus database with same CATH topology
 1AE3 A;  5DM6 3;  3KF8 B;  2JA8 B;  1YNJ C;  4PZ6 A;  3EVQ A;  1KLU D;  2LMC B;  3PF4 A;  1PH1 A;  1E2W A;  4B3M L;  5KND A;  1GOZ A;  1ZKO A;  2WV6 D;  1Q8K A;  1WD1 A;  2LFN A;  3N52 A;  1VF7 A;  2WB1 G;  1LAB A;  3OW2 A;  5AJ3 L;  1K8O A;  4XYO A;  5ELN A;  1QVF A;  4X65 Q;  5CC4 A;  4F8M A;  4JBK A;  2VQF Q;  3CXC A;  1RKN A;  4QMG A;  1WTX A;  1B2T A;  5GAD C;  5AFW A;  3Q8D A;  4KD3 A;  3CCJ A;  4UP7 A;  4F88 A;  4MTK A;  5COY A;  4KI0 A;  4B3S L;  2K04 A;  1PA6 A;  2AMC B;  1SYB A;  1I50 H;  4I7Z C;  4R8N A;  1NMF A;  2GN5 A;  4CBV A;  1ASY A;  2RBM A;  4K5W A;  5FO9 B;  3I70 A;  2NVX H;  3NXW A;  3DWA A;  2PZU A;  2WFW A;  3IFT A;  4X62 L;  2I5M X;  4OO1 G;  4DV4 Q;  2EE1 A;  3S2H H;  3GD7 A;  4HAE A;  3F2U A;  1SYG A;  1SDF A;  1WTV A;  1BBX C;  2VUM B;  5LMN L;  2Z6K A;  4A3I G;  4LF7 Q;  3I8Z A;  3MFG A;  1O7Z A;  2HIV A;  1VQH A;  3KJO A;  4IQZ A;  1WYD A;  2JE6 I;  1J9O A;  2RKS A;  4MIU A;  3K5M A;  5D14 A;  4KJN A;  4LFB L;  3Q22 A;  4JI6 L;  3CMA A;  3M4Y A;  4IPH A;  1EZ8 A;  3H3V H;  3M4O B;  3RZO B;  1X6O A;  4OX9 Q;  2VY3 A;  5T1G A;  2VB3 X;  2F4I A;  4ABN A;  1ML0 D;  1YVC A;  1TWG B;  1SMY D;  1DGS A;  4A3F B;  2WAC A;  2EY1 A;  4G4K A;  1SNP A;  2O5J C;  1TWC B;  2CKZ B;  5LL6 X;  2ZJR A;  1V1O A;  2B2Y C;  5EAY A;  1XX8 A;  4P74 A;  3S14 H;  5I9O A;  5GAG C;  4AYB E;  4A3G H;  1EY7 A;  2ES2 A;  4LNQ A;  1N32 Q;  4A3J H;  4R8I A;  1I4P A;  3BDC A;  4DV3 Q;  2PI2 E;  2K28 A;  4MTN A;  5C4J B;  1VCI A;  2DN8 A;  4L5Q A;  1D1K A;  3BZC A;  2DUD A;  2PMZ B;  1LTL A;  2PW5 A;  2QDB A;  1PHJ A;  3PO2 H;  1B3A A;  3CCE A;  3CHB D;  2N49 A;  2EDG A;  2VXW A;  4K14 A;  5ELF A;  2EYO A;  3GTL H;  4B3R Q;  4JOI C;  1QG7 A;  1VQO A;  4FP5 D;  2ZTD A;  3OYY A;  1PZJ D;  5C0X J;  4C1N I;  4EQN A;  4E6I A;  1C9O A;  2L4N A;  1UEA B;  1YZ6 A;  2DY7 A;  2LSS A;  4HR7 B;  4IFD G;  2FXQ A;  3KLR A;  1X32 A;  1H95 A;  1WTP A;  1XPO A;  4DK0 A;  1TWA H;  3UE1 A;  3AFQ A;  2MO1 A;  3TZU A;  3OMG A;  4UDU C;  3J7A V;  2BA1 A;  4YCV A;  3I4N H;  4HSP A;  3IAY A;  3NQT A;  4ZKB B;  4Q5V A;  5HY6 A;  2JA5 B;  2JYO A;  1A2T A;  4IFD J;  4CKC A;  2JA6 H;  5I2X A;  3M3Y B;  1MBY A;  2JA8 G;  4CDD C;  1WCM G;  2EYM A;  1IW7 C;  1F2Z A;  1S5E D;  3DM1 A;  2R92 B;  5C4X H;  3BDO A;  4JI2 L;  5M3M H;  1I50 B;  3CPW A;  1ENC A;  1CSP A;  5IYB G;  2EYH A;  4RGT A;  4FXG C;  2E74 C;  3TN2 A;  3RD4 A;  1CK1 A;  3I90 A;  3S1Q B;  1OXT A;  2JA9 A;  4BS9 A;  1VQB A;  1H9R A;  2B2T A;  4DA2 A;  3S16 B;  2NWG A;  3TS2 A;  4B3T Q;  3S1R H;  1UE6 A;  4LUV A;  4BA2 I;  5KEE A;  2PQA B;  3D4W A;  5BR8 L;  2JA7 G;  4A3C G;  3GQB A;  3NSW A;  1KDA A;  1K3B C;  4A3M H;  2QEJ C;  3RLN A;  1ENF A;  3H0G B;  4X3T A;  3CCL A;  1YIT A;  2A74 C;  3J7A F;  1PRT D;  5D3D A;  3NPP A;  1QWY A;  5IGF A;  2UUA Q;  2CW0 C;  2CFM A;  1A63 A;  4JI4 Q;  2NB0 A;  1DOK A;  1WTO A;  2KA7 A;  4LMQ D;  1VQ7 A;  1E0B A;  4A4I A;  4Y52 H;  5K36 G;  1RD9 D;  3UDX A;  3QOJ A;  4DNI A;  1YHQ A;  1N32 L;  4J1M A;  4L5R C;  2NN6 G;  2Y0S B;  4K2L A;  5M5W B;  1N33 Q;  1V8Q A;  5I6Y A;  1JE5 A;  5J3B A;  2PQE A;  3TEH B;  2O2L D;  4G7H C;  2ZTE A;  4AQY Q;  4B3R L;  2K32 A;  1VQ6 A;  1AFP A;  2XRQ D;  1EQQ A;  4DK1 A;  4P73 A;  2BE5 D;  3AQQ A;  1PRT F;  2A6H C;  3F2D A;  4A3F G;  1OXS C;  1BCP B;  1WTR A;  4RCO A;  3FDT A;  2M2L A;  3PO2 B;  4DNR B;  1ZEQ X;  1VQJ A;  2JP1 A;  1VQ9 A;  3GTL B;  4KY7 A;  4A93 B;  3EBE A;  1QCB D;  3MHB A;  1YHB A;  2ID0 A;  3T51 B;  4LF8 Q;  4DV5 Q;  3A0J A;  1SYD A;  1KTK A;  3K7A H;  1J5E L;  1STA A;  2PO4 A;  4JBW A;  4GNX C;  1P8L A;  4ME3 A;  1NR2 A;  3SXH A;  1CKM A;  4O2D A;  4H13 C;  1ET9 A;  1SJE D;  4IUR A;  4KTA A;  3SVM A;  2HQE A;  2D0O A;  2Q2H A;  3H3V I;  1HQM C;  1E2Z A;  1W6J A;  2VQE Q;  1FNU A;  4I65 A;  3I4N B;  1QZG A;  1V9P A;  4LFA L;  3R3O A;  3D0F A;  1A3T A;  3NBH B;  4IUQ A;  4HID A;  2FHT A;  5IYD H;  2L55 A;  1ESR A;  3TDQ A;  3JAM c;  2BDO A;  1VQ4 A;  4TVA B;  2JK8 A;  1XPU A;  2WII B;  5L37 A;  2C9O A;  2SNM A;  2E5L Q;  2Z6K C;  4DU9 A;  1LYL A;  5M3M B;  4C2M H;  1JQY D;  1JIC A;  2AHO B;  2E75 C;  3HP3 A;  3ERQ A;  2JA5 G;  3PF5 A;  5K5P A;  4YIJ A;  3SK8 A;  4KHP Q;  4DK3 C;  2H1E A;  4GN3 B;  4O42 A;  1TR5 A;  1PH7 A;  5IGC A;  1V1P A;  2LY7 A;  3I7F A;  4ZAI A;  2C5C A;  1S5B D;  2YU9 H;  1I4Q A;  3S1R B;  3VA7 A;  1EFI D;  3QOL A;  2UXD L;  2UUA L;  3CQZ H;  1XWE A;  3NEL A;  1HA5 A;  5NUC A;  5JAV A;  5LMN W;  4JV5 Q;  4XT3 B;  4A3M B;  3R93 A;  3VDY A;  3HOU H;  4CJ2 C;  1HRJ A;  1EUJ A;  1N33 L;  3GV6 A;  2F0Q A;  2K4K A;  4B08 A;  1JOK A;  2K1B A;  5A35 A;  4WJ3 M;  2ZJQ A;  4GZY C;  1E7Z A;  5FJ8 H;  2K75 A;  3HOZ H;  1ESF A;  3I2Z A;  4KKT A;  1PTO D;  4DAP A;  1A62 A;  1Y8N B;  3C46 A;  2ZXR A;  4JI8 Q;  3U9O A;  4YWL A;  5C3X A;  5ELB A;  1X3F A;  1WI5 A;  4WJ4 A;  5C6A A;  3GO5 A;  3T1Y Q;  1Q8I A;  1HQR D;  4KD4 A;  4H44 C;  3JAM L;  4LF6 L;  1O80 A;  1J6Q A;  4DR5 Q;  4GLX A;  1UEB A;  2D0P A;  4XQN A;  3CCU A;  5E4W C;  1N9W A;  3HFZ B;  3HKZ E;  1QJO A;  4QJF A;  4QUC A;  2Y0S G;  4LF8 L;  4DV5 L;  4AYB B;  4NXN Q;  1PV4 A;  1ZXT A;  2F0E A;  3D6W A;  3MTS A;  1SFO H;  1GUG A;  2EYJ A;  1ICW A;  4ZRZ A;  4P71 A;  2AWO A;  2E2J B;  1AH9 A;  5JOB A;  3VYR A;  4LF4 L;  1SBB B;  3S2D B;  2VQE L;  4DFA A;  1XMQ L;  3E0E A;  4A3J G;  3TRZ A;  1E22 A;  2EOT A;  1X65 A;  5GAH C;  3K7A B;  3OTO Q;  4K8I A;  3CD6 A;  4FF2 A;  3MXN A;  1OXX K;  1L0X B;  4OEL B;  2RQX A;  4PQX A;  2PPB C;  3K6O A;  3PO2 G;  4A3B H;  1C4Q A;  2E5L L;  4DUZ Q;  3HOV H;  4P75 A;  4A93 G;  1LTR D;  3BJU A;  3ND8 A;  1WFQ A;  5LMU Q;  1EWI A;  1QVC A;  3P1H A;  2B2T C;  2EJM A;  3NQI A;  4IUV A;  3M4Q A;  1PTO B;  4R9W A;  1H9J A;  4YHH Q;  4KHP L;  2QKI C;  1CQV A;  5JPN C;  3P75 A;  3GV3 A;  3U4V A;  1FR3 A;  1LT6 D;  2G9D A;  5C0X H;  2EQS A;  1N36 Q;  4IZ8 A;  1KC8 C;  1U4P A;  2VB2 X;  3KK7 A;  4C2M B;  2UUB Q;  4RGN A;  3I4N G;  1B8A A;  1XNR Q;  1X54 A;  2I46 A;  1K3R A;  1KD1 C;  1R9T H;  3K0X A;  3V05 A;  4BBR B;  3GTJ B;  4J8Q A;  2JA6 G;  1AEX A;  1CSQ A;  1D7Q A;  3RN5 A;  1SE4 A;  2KCN A;  2ALY B;  3IL8 A;  1L1O B;  1LM0 A;  1EY6 A;  1A3U A;  2B3G A;  1EYC A;  2YU9 B;  3W1G A;  5C4X G;  3EN2 A;  5M3M G;  5I6W A;  3NK9 A;  1TWF H;  2B8G A;  2L11 A;  1MKH A;  3KBG A;  1YJ9 A;  2F0K A;  3I3C A;  2F0M A;  3W5O A;  4DR1 L;  3S1N H;  3K80 C;  1B1Z A;  1LTG D;  5IT9 E;  1UE1 A;  1FNW A;  1PRT C;  3HOU B;  4JI8 L;  1RCV D;  1L0W A;  1YNX A;  1IKM A;  3PUV A;  3SE0 A;  1A3V A;  1D6E C;  4A76 A;  4YY3 L;  3RMH A;  1G51 A;  1PH6 A;  3HOZ B;  2RHS B;  2FFK B;  4AH6 A;  3OSO A;  2JEB I;  4A3M G;  1SSO A;  4MNO A;  2Q8I B;  2IX3 A;  4BWG B;  3UI2 A;  2JQO A;  5FKA C;  4NXN L;  1HH2 P;  3AU7 A;  4C3H H;  3KBX A;  4B3M Q;  1XPR A;  1X55 A;  4KLK A;  2AUK A;  5KNC A;  3FMC A;  1SLJ A;  3BU2 A;  5IP7 H;  5AJ3 Q;  3K57 A;  1CTM A;  2IY5 B;  3TZD A;  2A6E D;  2FMC A;  3V96 A;  4GOP A;  1PMR A;  4A3I B;  5J22 A;  1M1K C;  4JVZ A;  1YNN D;  1KAW A;  2BDN A;  3T13 A;  1F77 A;  3I4M H;  1F9R A;  2EY5 A;  4RKL A;  1CFM A;  4B3S Q;  4DR2 L;  1SND A;  2KEN A;  2L0C A;  1EFW A;  5CMD A;  5GAE C;  3LNN A;  3P20 A;  1G2S A;  3VR3 A;  2NUC A;  5CV5 A;  2F0T A;  1H9K A;  5D65 A;  1VQE A;  4OIK A;  2YYZ A;  4R4T A;  4AYB G;  5FLX c;  4X62 Q;  4ZK9 B;  3JAM E;  1A2U A;  2MJ8 A;  1LAC A;  4OON A;  3TP6 A;  4X66 L;  4A3B B;  3CCS A;  3HOV B;  5IGE A;  2QF7 A;  3BZD B;  3MZ5 A;  4WOR A;  1I3Q B;  2UUB L;  2AUJ D;  1XNR L;  4GOP B;  4OO1 I;  2H4O A;  2OEO A;  2R7Z H;  1MSH A;  1B7Y B;  4ZLT F;  4RH6 A;  1GKH A;  3B6Y A;  4TKO B;  5EGT A;  3ND9 A;  4J6H A;  4LFC Q;  1A6X A;  3Q6S A;  3A7A B;  4FXK C;  2M00 A;  4IN3 A;  4DR3 Q;  3OWE B;  3T1H Q;  1EY0 A;  3A74 A;  1PZI D;  1I6H B;  1Z6H A;  1EIH A;  1R9T B;  3R2T A;  5IYD G;  5C44 H;  5M3F B;  2MPM A;  1G91 A;  3FEW X;  2EYF A;  4IPG A;  1B4O A;  1BXT A;  2K33 A;  2HDL A;  4KKU A;  1TS5 A;  3K81 C;  2G9H D;  3VYT A;  1TWF B;  2ICE C;  1GHK A;  3S1N B;  2XNA C;  1JT8 A;  1G8Z D;  4JK1 C;  1GJX A;  3RN2 A;  3BVZ A;  4HMJ A;  1LV9 A;  1LUZ A;  1HZ9 A;  5IYC H;  4OWT B;  3S17 H;  5FLX L;  1IXR A;  1VQG A;  1BF4 A;  1WCM B;  4PZ8 A;  4N8F A;  2KJX A;  4QCL A;  1ZYR D;  1JE4 A;  1RJT A;  2EJG C;  1Y69 U;  1JWS D;  3WWV A;  4BXX H;  2WAQ E;  1PZK D;  4HIK A;  1M90 C;  3HOY H;  5C0X I;  3HOU G;  2BH8 A;  1K83 H;  5H1S E;  2Q2T A;  2TSS A;  1IBL Q;  5C3W A;  3RLO A;  5M5X H;  4XIG S;  4GN4 B;  1EU4 A;  1C0A A;  2E2H H;  5FJ8 G;  3HOZ G;  1Z47 A;  2F0J A;  1HZA A;  2KHI A;  1IKL A;  5DAU A;  1YIJ A;  1MJC A;  1K0S A;  2JA7 B;  3URY A;  4IJL A;  1LT4 D;  2CQA A;  4R1J A;  3FKI H;  4IFD I;  4DUY Q;  1SMX A;  5G3L D;  5M5Y H;  2PYK A;  3HKZ B;  4WFN 3;  2E76 C;  2YV5 A;  1SJH D;  5FO7 B;  3D3R A;  4JI2 Q;  3KOJ A;  1HNX L;  2IX1 A;  1SAP A;  1CA5 A;  2XTI A;  1D1I A;  1EWC A;  2Z1C A;  5EKK A;  3TRE A;  5A2Q L;  1TWH H;  2HCC A;  1I94 Q;  5T1I A;  1EEI D;  2A1A A;  1S72 A;  4GLA C;  1HUM A;  3DHQ A;  2R93 H;  3K7U C;  5FK9 C;  4LFC L;  1Y1V H;  1QZH A;  1BDO A;  2F0O A;  3FVQ A;  3K5O A;  4HTH A;  1X3E A;  3E3X A;  3BYT B;  1BKB A;  1Q1B A;  3W3A A;  3UE0 A;  5BR8 Q;  4DR3 L;  3T1H L;  4Y7N H;  1BBU A;  4JI0 L;  5G3L F;  1E1T A;  2KEC A;  1GUO A;  3PUY A;  1SNM A;  2JSO A;  1EIG A;  1ICF B;  4QB4 A;  5ELE A;  4A3B G;  2F0S A;  2KHS A;  4GNX B;  1LTA D;  1IYU A;  2RF4 A;  3HOV G;  3T16 A;  4CJ0 B;  1GUT A;  1L0Y B;  2N88 A;  4C3I H;  3RNU A;  3I56 A;  3S1M B;  5EKL A;  1VMC A;  3K8A A;  2B2W C;  5CBE E;  4HIM A;  5C0X G;  4JI3 Q;  2TMP A;  4NPS A;  4Z9C B;  2ASB A;  2A68 D;  4R4C A;  2OWO A;  1N8R C;  1Q1E A;  5DEH A;  1K73 C;  1X3Q A;  2NN6 I;  2F3V A;  3ITP A;  4K6L A;  1ET6 A;  4K5V A;  1VQ5 A;  1S40 A;  5M3F G;  2A5H A;  3HOX H;  2HIX A;  3K59 A;  2JJQ A;  2BH2 A;  1IBL L;  5EBC A;  2F0F A;  3STB D;  1TU2 B;  2A69 C;  2LXJ A;  4FDB A;  2PQA A;  3BDL A;  4OHJ A;  4IJH A;  4IOC A;  3HOY B;  3DMU A;  1VQN A;  3TBI B;  1J5E Q;  1K83 B;  1RDP D;  2KVM A;  1EZ6 A;  4DUY L;  4NB3 A;  1P16 A;  1CM9 A;  2ATW A;  1TT2 A;  1D8L A;  2MHV A;  1C48 A;  2E2H B;  4HN7 A;  3G48 A;  4R4O A;  3U50 C;  2CWA A;  4FXD A;  2FJ2 A;  4DF7 A;  4LFA Q;  1VQM A;  3D6C A;  5CR3 A;  2HHH L;  1HZC A;  3TP8 A;  1X9N A;  1NSN S;  3EIV A;  3OIP A;  3FKI B;  1PYS B;  3DXJ C;  1LTS D;  3LWU A;  4XTC S;  4YWM A;  5FLX E;  1I94 L;  2B2V C;  2Q8R E;  2NVX B;  1ENA A;  5M5Y B;  3I4L A;  2N8N A;  4C3H G;  1GHJ A;  1JOO A;  1BCP D;  2XWB B;  1KDB A;  4FF1 A;  3NHH A;  1HUN A;  1UAP A;  1EY4 A;  3A55 A;  1KRT A;  5IP7 G;  3S2H B;  1U4M A;  1RTO A;  3PCO B;  2K05 A;  1FJG L;  4JBM A;  5TSS A;  4P72 A;  2VS1 A;  4BBS H;  1D5Z C;  3A56 A;  2XRS D;  3HKZ G;  2HUG A;  4NXM L;  3I4M G;  2L1B A;  2I5H A;  1EWH A;  4V0B A;  2B2U A;  4QIW B;  2UXD Q;  3L9A X;  3LX0 A;  2E2I H;  3MXG A;  4PMC A;  5BN5 A;  1E3P A;  1KQS A;  2B63 H;  1MHW C;  4Y7N B;  1IL2 A;  1EIF A;  3A8K E;  3EA6 A;  3ZYY X;  2MUY A;  1KIX A;  2Z8L A;  3IFD A;  4LUZ A;  1BCP F;  5CV4 A;  1BVS A;  3K0Y A;  1Z7T A;  4JI3 L;  3T4A C;  1EOT A;  2D62 A;  4QF4 A;  1W6K A;  5IY0 A;  2K03 A;  5A2Q E;  3S14 B;  2OF1 A;  3TP5 A;  3S24 A;  1OO9 B;  2SDF A;  2QIL A;  3D4R A;  3VR4 A;  4A3G B;  2IJ0 A;  4C3I B;  1NNX A;  1AN8 A;  4A3J B;  4FF4 A;  2R7Z G;  4ULL A;  3NBH A;  2WP8 J;  3AMU A;  1IHZ A;  4LF9 Q;  1S3O A;  1YEZ A;  4LF6 Q;  2XSC A;  4X64 L;  1EY8 A;  1A0I A;  1SR3 A;  3J80 i;  4OL7 A;  4UP9 A;  5DM7 3;  4H7B A;  3EJI A;  2J0T D;  3KF6 B;  5C44 G;  1B9N A;  4A3K H;  1IL8 A;  1XYI A;  3QWN A;  2VNU D;  1JJG A;  4KN7 C;  1PH2 A;  4DV2 L;  1XMO L;  3MEF A;  2LKV A;  4IUP A;  1TWA B;  4LF4 Q;  5EPL A;  1XMQ Q;  1YJN A;  3GTO H;  1E1O A;  3X3M A;  1IBM L;  3RZD H;  5ISR A;  5ELD A;  4JG2 A;  3C1E A;  4CKB A;  3J80 L;  4HED A;  2JA6 B;  3OW7 A;  1Y1W H;  2KCC A;  5IYC G;  4J15 A;  1M4V A;  2X6L A;  5CYU A;  4JI5 L;  1FL0 A;  4EX5 A;  3TQY A;  1U9R A;  1G6P A;  3GTP H;  1FNV A;  2MNA A;  2QA4 A;  5C4X B;  2XN9 C;  3VYS A;  4FVM A;  3EQL C;  4BXX G;  2EYP A;  5CV9 A;  1H9S B;  5KIX A;  4HCS A;  3UDI A;  3ULP A;  1U4R A;  4YWK A;  3HOY G;  3VR6 A;  1ASZ A;  4DAY A;  4PNY A;  1EY5 A;  2BA0 A;  1ONL A;  4RFB A;  1KL9 A;  2MP1 A;  1NR4 A;  4DKA C;  1DJR D;  1K8M A;  4UP8 A;  1NTG A;  3PUX A;  4UY8 C;  3FKI G;  1EYG A;  4BBS B;  3OIQ A;  1HR0 Q;  1VQ8 A;  4WJW A;  4HJ9 A;  3PO3 H;  1NMG A;  5HUR A;  2JXM B;  1QE6 A;  1DOL A;  3BVG A;  5IOC A;  3TS0 A;  4K0K L;  2PI2 A;  4NMZ A;  2B63 B;  4FYD A;  3GTK H;  4DR1 Q;  4CDF C;  1R4P B;  1SMY C;  5KGU A;  3E6Z X;  3KDF B;  4DAY B;  1G29 1;  2B29 A;  2R93 G;  4LF9 L;  3I55 A;  4KY6 A;  2K01 A;  1O7Y A;  3TP7 A;  4IO9 A;  1Q82 C;  1Y1V G;  2RDF A;  4YY3 Q;  5IGG A;  1YNJ D;  2F0H A;  2HD3 A;  2A73 B;  4RMF A;  1U4L A;  5DLQ E;  1SE2 A;  3E5S A;  2BCO A;  2A68 C;  1GVP A;  2CHB D;  4IUT A;  2ZTC A;  2H5X A;  4ZUJ A;  4OWW B;  1KAB A;  4DN4 M;  4A3L H;  3KUP A;  4BY1 H;  1CZG A;  1PTO F;  1KAA A;  4A3G G;  2QCP X;  4C3I G;  2R7F A;  2OTJ A;  2IW3 A;  4ILW A;  4PMB A;  2K5V A;  4A3K B;  2VL6 A;  2CCZ A;  3STB C;  2RA4 A;  2OTL A;  3GTQ H;  1L1O A;  4DR2 Q;  4ID6 A;  3T53 B;  3BS1 A;  1KLG D;  3H3V C;  3BVM A;  2DJF C;  2OXP A;  2RDG A;  5DNF A;  3NWS A;  4TQU S;  2QGQ A;  4KHV A;  3RZD B;  4O0A A;  4G7O C;  5CV8 A;  5E4X A;  3NTK A;  3BG3 A;  4H02 A;  4DV6 L;  3CC7 A;  3HOX G;  1TVX A;  1WTQ A;  1J8I A;  4QQB X;  2IX0 A;  1B9M A;  1PLF A;  2AQ3 B;  1JR0 D;  4IPC A;  4X66 Q;  3U4Z A;  3ZJY C;  2PZT A;  1JJC B;  1SXT A;  1VDZ A;  3RUZ A;  3MXU A;  4H0L C;  3TME A;  3LGJ A;  2B2U C;  1BCP C;  1C7Y A;  1HNW Q;  2GVB A;  4RA8 A;  1HR0 L;  2WAQ G;  1VQC A;  3OPO A;  4U67 3;  4DPG A;  1LO5 D;  5LHY 1;  1STB A;  2AQ1 B;  4N9T A;  1Q12 A;  4DR4 L;  3F8T A;  4DR7 L;  3CQZ B;  4KY5 A;  1UWV A;  1SE8 A;  2PW7 A;  1FVI A;  1FD7 D;  3A5Z B;  1KXL A;  2K50 A;  3VA5 A;  1PH9 A;  4L6T B;  2EZV A;  2J7Z A;  3FP9 A;  2CH4 W;  3J81 j;  2PMZ E;  4TSS A;  2F0U A;  2EPB A;  1CT1 D;  4BA1 I;  1S5C D;  3E0J A;  3DWP A;  3ONA B;  4KJO A;  4X3U A;  3A5U A;  2OCE A;  3WOF A;  3SK4 A;  2EVB A;  4BBS G;  3E9H A;  1HA6 A;  5JPM C;  4DR6 Q;  1U0L A;  1IZ6 A;  5CV6 A;  5KYI A;  2JA8 H;  5ELO A;  2RSO A;  2AQ2 B;  2F0G A;  1NE3 A;  1EYA A;  1TS2 A;  3MWY W;  5EPK A;  2ZXP A;  1O78 A;  4GKJ L;  2B63 G;  2RSN A;  2KCM A;  5IOD A;  2BE5 C;  4WRD A;  2RVL A;  2FMM A;  2LS0 1;  1D2B A;  2EIF A;  2GVA A;  5BN4 A;  4JOI A;  1SFO B;  1STN A;  2J4X A;  2AWN A;  5F2D A;  4N9P A;  1GUS A;  4N8X 1;  2F03 A;  4BY1 B;  3CRL C;  1WVL A;  4XQJ A;  3DEP A;  2F52 A;  2XVS A;  3PV0 A;  1HNZ Q;  4A3C H;  2Q8T A;  4NKL A;  3GTQ B;  3VYU A;  1JCK B;  3MC0 B;  1HNX Q;  1U5K A;  2OT2 A;  2G5D A;  2V1C C;  1QIL A;  4KHZ A;  2VUM H;  1DOM A;  3S15 H;  2O4X A;  4A3K G;  3G6E A;  2NVT H;  3PGZ A;  1HNW L;  1NUC A;  5JJK A;  3QG1 A;  4LK1 C;  1MGS A;  3SK5 A;  4IUN A;  4NW2 A;  1K8A C;  4CDC C;  2QW7 A;  1VQA A;  2VZA A;  4OEM B;  4JI0 Q;  1F2Y A;  4RAU C;  2CW0 D;  5C4Z A;  2IT1 A;  1CHP D;  1SRU A;  5CBA E;  3M4O H;  1Y1W G;  4B9X A;  1EOV A;  2I0Q A;  4MHE A;  3CCV A;  1CUK A;  3HZX A;  4A3F H;  1OXU A;  4RG1 A;  5JVG 3;  1TY2 A;  5JVH 3;  2RCN A;  1TWC H;  3H91 A;  2UU9 Q;  1F2L A;  4L63 B;  2DGY A;  1SYC A;  4DGZ A;  4V19 0;  2L12 A;  4JW0 A;  4DR6 L;  3U58 A;  3AEV A;  1EQV A;  3L0O A;  4OGQ C;  1LT3 D;  3M7G A;  1Q3L A;  1K28 A;  3J7Z C;  1ROD A;  3A54 A;  3K58 A;  1PTO C;  3I72 A;  2HCI A;  2K5N A;  1IBK L;  1SYE A;  4HJ5 A;  3KJP A;  3OMC A;  1CZW A;  1IYJ B;  1KNE A;  2KBN A;  1X3G A;  4K8J A;  1CHQ D;  3PO3 G;  4UAI A;  4EQ5 A;  4C3H B;  1Z9F A;  2B8F A;  3DUZ A;  2F0N A;  4HCE A;  1UE5 A;  5JJL A;  4XXE A;  3FPP A;  3IKJ A;  3H94 A;  4GN5 A;  3C2P A;  1K0R A;  2NZO A;  1AZQ A;  2Q2I A;  2V4D A;  1B70 B;  1L1O C;  4POG A;  1HNZ L;  2JA5 H;  5COR A;  2K52 A;  3M3Y H;  3I4M B;  3O13 A;  1HHV A;  1YJW A;  2UUC L;  2F0P A;  2MQH A;  3G6J B;  4RGO S;  4B9W A;  2IWH A;  3HOW H;  4A75 A;  1N34 Q;  2R6G A;  1ILQ A;  4GNX A;  2R92 H;  4HJ7 A;  1CKN B;  2HHH Q;  4K6D A;  4LWC A;  1SEB D;  1GUW A;  4CDE C;  4XDX A;  3S1Q H;  2SOB A;  3NEM A;  4DV0 Q;  5JEA H;  1XJV A;  1PYB A;  1KNA A;  3NBI A;  5EPJ A;  4BY1 G;  3S16 H;  4A3L G;  3GTG H;  1X56 A;  1FJG Q;  2X69 A;  3S15 B;  2E8G A;  2ICI A;  3HEJ A;  1QB5 D;  3UDG A;  2F0I A;  3PMF A;  3CU7 A;  2R7Z B;  5IGB A;  3CF5 A;  2NVT B;  4RWS C;  3OHX C;  5I2Y A;  1I4X A;  4NXM Q;  3H0G H;  2EJF C;  5IGD A;  4X6A H;  4BY7 H;  3BYY B;  1X3P A;  3SDZ A;  4U68 A;  3PUW A;  1YI2 A;  2B39 A;  3KYH C;  4R4I A;  2MGS A;  2EYL A;  3CRK C;  1STE A;  3ER0 A;  2D2C C;  2Z0S A;  4XT1 B;  1WD0 A;  3Q23 A;  3CAM A;  3G71 A;  2UU9 L;  4Q0F A;  4UHV A;  1EL0 A;  5C44 B;  1LTB D;  1BQQ T;  2YTX A;  3FHW A;  5LL6 S;  1HR0 W;  1HTP A;  4IOA A;  2A8V A;  5M5W H;  2IPK D;  1Y14 B;  1S5D D;  1GUN A;  2F0D A;  1JOR A;  3SK6 A;  2HT1 A;  5C3E H;  1UUP A;  1STG A;  5GRO A;  3CKI B;  2LXK A;  3D4D A;  1MI2 A;  3VR2 A;  2R61 A;  2P5Z X;  5M9O A;  4L5T A;  3C1F A;  2UXC Q;  5FOB B;  1LLR D;  2XWJ B;  2SNS A;  3NP8 A;  3M9B A;  4IAL A;  2K5Q A;  3S17 B;  5JJZ A;  4TRD A;  1Q46 A;  1EY9 A;  4KKS A;  1EEF D;  5HGQ A;  2F0V A;  4X64 Q;  2D5D A;  3HG9 A;  2EY6 A;  1HZB A;  4GOP C;  1KHI A;  2PZW A;  4A93 H;  3D31 A;  3I91 A;  3NTH A;  1F9Q A;  2ZXO A;  3RR5 A;  1PH5 A;  3PUZ A;  2I5L X;  4X65 L;  5FO8 B;  2UXB Q;  5CGK A;  2VQF L;  4ALP A;  4HJA A;  2KOL A;  4DV2 Q;  5M5X B;  3N6R A;  1XMO Q;  4LJZ C;  1F9P A;  1A8V A;  2A6E C;  4XYQ A;  1TQO A;  3L7Z C;  3ERS X;  1GO3 E;  1IBM Q;  1N34 L;  2K6A A;  4LF5 Q;  2RHQ B;  2EXZ A;  4QY7 A;  1YNN C;  4KV6 A;  4HJ8 A;  4DXG A;  4HSV A;  1JB7 A;  1EIY B;  4JI5 Q;  3C3L A;  4JCV E;  5E3F A;  4DV0 L;  3GDE A;  3F2C A;  4ZCK A;  3JC6 6;  2KED A;  4DV4 L;  4DAM A;  2KHJ A;  3HOW B;  2K5H A;  2K7V A;  1W2B A;  2SEB D;  3A8I E;  1I4G A;  1PYW D;  1TWH B;  1IYV A;  3H6M A;  1HFG A;  1MSG A;  1SRO A;  4LF7 L;  4OIJ A;  2R93 B;  3J81 c;  1VMP A;  4JPB W;  3CC4 A;  2EY2 A;  1WJJ A;  1Y1V B;  2K5D A;  2KUM A;  3WDN A;  2WB1 E;  2WKD A;  2HDM A;  1MD2 D;  5EKI A;  3GTG B;  3A8J E;  3J80 c;  3KLS A;  1D5X C;  1OTC A;  5EBD A;  4XQQ A;  1V1Q A;  3KF6 A;  1G6Z A;  2N3S A;  4OX9 L;  2F1M A;  3AB9 A;  4BY7 B;  1QUQ A;  2ZM6 Q;  1B44 D;  4A3D H;  1VQD A;  1TY0 A;  3HKS A;  4RHR A;  4C3J H;  4L8J A;  4PV1 C;  4K0K Q;  4DNT B;  2D9U A;  1HXY D;  4APV A;  3AFP A;  2ENB A;  3DWQ A;  3KFU A;  2F0W A;  3CCQ A;  4K5X A;  2Z9H A;  3CP0 A;  2VUM G;  2PNR C;  5J1Z A;  2UXC L;  3BZK A;  4DK6 C;  3CME A;  4A3E H;  4KMU C;  4ZUI A;  5IT9 c;  4DV3 L;  1G2T A;  3J81 i;  4PG3 A;  4HIO A;  1FYC A;  4OWX B;  4JC0 A;  5C3E B;  3NWT A;  3SEB A;  1RIP A;  1F2M A;  4OXP A;  1PVO A;  2CQO A;  3PIO 3;  4X3S A;  3VR5 A;  1AW7 A;  4EQO A;  1CQF A;  3EFX D;  4DV7 Q;  4IUU A;  4P2C B;  1DYQ A;  1YBY A;  3NE5 B;  1H9S A;  1O7I A;  2L9H A;  3HS0 C;  3HOX B;  1QUQ B;  3M7N A;  1ZYR C;  2WIN B;  2UXB L;  1DXM A;  1KDC A;  2I07 B;  2L15 A;  3J81 L;  1PDQ A;  2E2J H;  4ODG A;  3NUC A;  1Y8P B;  4JBJ A;  3S2D H;  3ERO A;  4LF5 L;  4R4Q A;  1LT5 D;  1RTN A;  4S3S A;  2IL8 A;  4EVO A;  3H09 A;  1Q90 A;  3MEH A;  2OQK A;  2WAQ B;  2ZT9 C;  3DLL A;  1MJE A;  5FLM H;  2NVQ H;  5KRU A;  1DCZ A;  1TXY A;  3ULL A;  1PRT B;  3SHL A;  2JEA I;  1NY4 A;  3HGB A;  2PNH A;  3SGI A;  2AKW B;  5D3I B;  4FNF A;  4DV6 Q;  2JN4 A;  1JJ2 A;  1PTO H;  3NTI A;  5JJI A;  2Q2U A;  3KDF A;  5IP9 H;  4LUO A;  4QL5 A;  2NVY H;  3W1B A;  5IT9 L;  1ILP A;  2MFI A;  1TS4 A;  4B3T L;  1RF2 D;  4NP5 A;  3PSI A;  4ZKC B;  3WOE A;  4CJ1 B;  1NAP A;  2VW9 A;  1S5F D;  4BBR H;  3GTJ H;  3J7Y W;  4DXF A;  3R2I A;  4EGV A;  3P7J A;  2ZM6 L;  1RL2 A;  1JWM D;  4DR4 Q;  1UNS A;  3MA2 B;  3F2B A;  4DR7 Q;  3D8G A;  3HOW G;  3OWF A;  3K5L A;  2E2I B;  5IE8 A;  2R92 G;  1W3S A;  1K8G A;  1B53 A;  3GP7 A;  1HJP A;  4JI4 L;  4JI7 Q;  2RDH A;  3I4O A;  3PIP 3;  3RLF A;  2MO0 A;  5ELC A;  4KK7 A;  3GTM H;  3HRZ C;  2K5W A;  4YCW A;  4A3D B;  3JAM i;  4O1N A;  4EQP A;  5JEA G;  4C3J B;  3LWE A;  5KNB A;  1BNZ A;  1B3Q A;  2ZJP A;  4L5S A;  2Z6B A;  1DM0 B;  4MZ9 A;  3I73 A;  1VQL A;  4AQY L;  1WTW A;  3L2P A;  4DV7 L;  1T5X D;  5JEA J;  4A3E B;  3E9I A;  4C1N K;  1JMC A;  3H0G G;  4BY7 G;  3MFY A;  1I4H A;  1NBW A;  5I4D A;  1V1P B;  4OO1 H;  1H9M A;  2KCT A;  2IHE A;  4GKJ Q;  2CVR A;  1Q86 C;  2M9V A;  1AE2 A;  1JWU D;  5HGT A;  1CI3 M;  1DD2 A;  3M4P A;  4JI1 Q;  4A3I H;  1PFB A;  1PXU A;  4UPA A;  4PZ7 A;  1SNQ A;  2DY8 A;  2QDL A;  3CPF A;  1HPC A;  1Y8O B;  5IWA Q;  1VQK A;  1Q7Y C;  5C3E G;  4IPD A;  1CA6 A;  4C56 C;  3PIO A;  1PH8 A;  2BOS A;  1VF5 C;  1V43 A;  5IIF A;  3GTO B;  5C4H A;  2DNE A;  4DV1 Q;  3ICE A;  1QNU A;  1A15 A;  4CKE A;  1UE7 A;  1HTL D;  1Y1W B;  2K14 A;  4M8A A;  3AYH B;  4G7Z C;  5C5M A;  2NVQ B;  2KEE A;  3GTP B;  4QUF A;  2NZH A;  3T56 B;  1MIU A;  3J7A 5;  1QNK A;  1B50 A;  3K5N A;  4PMW A;  1VS0 A;  1BO0 A;  3Q24 A;  1GXD C;  1RHP A;  3CW2 C;  3U9S A;  2XIW A;  2WKC A;  1EYD A;  3PQI A;  1I6V C;  1I3Q H;  5CV7 A;  3QB3 A;  2YTV A;  2GA4 B;  1JC7 A;  3FPU B;  1XNQ Q;  1YHA A;  1I5F A;  2F4V Q;  4JYA Q;  5EJW A;  1C8C A;  2NVY B;  5E7N A;  4GKK Q;  3J81 E;  1LTI D;  1SYF A;  3Q0A A;  1O7L A;  1SE3 A;  3CCR A;  2DJG C;  3DEO A;  4K2K A;  3J80 E;  1XXG A;  1I4R A;  2CWP A;  3QR8 A;  3M85 A;  1T9H A;  4JI7 L;  1TKW B;  1K9M C;  4G57 A;  1I6H H;  3L3O C;  4JV5 L;  1BUV T;  5M3F H;  3TSS A;  2O5I C;  3PO3 B;  5E1F A;  4MN3 A;  1E2V A;  3MAQ A;  3MXN B;  1SNC A;  2PCF B;  1TS3 A;  4AIM A;  1HFN A;  4IFD H;  3ULJ A;  2NTT A;  1VQF A;  5KYL A;  4POF A;  3GTK B;  1PFM A;  1AZP A;  5EQ0 A;  2WB1 B;  2A19 A;  2R3Z A;  1L2F A;  5J39 A;  3GTM B;  4GS3 A;  2B2Y A;  3QJY A;  3H15 A;  4LW1 A;  2N78 A;  5BN3 A;  1WCM H;  3T1Y L;  1JOQ A;  1IBK Q;  2B2W A;  4RCN A;  3DM3 A;  4DR5 L;  3PIP A;  4LAA A;  4RHS A;  2NYZ D;  2HQL A;  2N55 A;  3S9W A;  1TII D;  3SR1 A;  4F7X A;  1E24 A;  2A69 D;  3V2T A;  5IYB H;  4CHT B;  4JI1 L;  4A3D G;  1DZ1 A;  1CKO A;  4C3J G;  1OXV A;  4NDX A;  3G4S A;  5IWA L;  3UDF A;  1F9S A;  1PH4 A;  3G7L A;  2F3I A;  1DON A;  1EQT A;  5I9P A;  2F3W A;  1IW7 D;  1M8A A;  4DV1 L;  2JA7 H;  1QVG A;  4KN4 C;  4A3E G;  3IRB A;  1WOC A;  4ZQ3 A;  3OTO L;  4FF3 A;  1AP0 A;  4F87 A;  4HMI A;  4ZYS A;  2UUC Q;  2R7D A;  1VQP A;  4YCU A;  1EU3 A;  2FIN B;  2L5T A;  1EQR A;  1PFS A;  4DUZ L;  1KRS A;  3X3N A;  2KQ3 A;  2C35 B;  1XTD A;  1SNO A;  3A7L A;  3F1Z A;  3FRP B;  5LMU L;  5K36 H;  1XNQ L;  4QIW E;  4YHH L;  2NN6 H;  2OQ0 A;  4ME5 A;  2Z4I A;  2F4V L;  4JYA L;  4GKK L;  2YTY A;  4M1U B;  1NCV A;  3KLW A;  1D5M C;  3OOC A;  3CCM A;  1N36 L;  1BOS A;  2B2V A;  2Z4H A;  3QIA A;  2E2D C;  4QGU A;  1NJI C;  3MVV A;  2Y0S E;  3R8B A;  3CC2 A;  4GLV B;  1XTC D;  5LMN Q;  2RCF A;  2NZ1 D;  2X6G A;  2F0L A;  3RZO H;  4X3K A;  2QEX A;  4I7A A;  5GQO A;  3NEN A;  1STY A;  1BBW A;  4FO2 A;  1LTT D;  1TWG H;  5FLM G;  1S4Z A;  3MXP A;  3KF8 A;  1PH3 A;  1JB3 A;  1FGB D;  1R4Q B;  4LFB Q;  2NBF A;  1VQI A;  1Q81 C;  1GM5 A;  4JI6 Q;  2EXD A;  2XGT A;  1FGU A;  4RGM A;  1HCZ A;  4RKB A;  1STH A;  3S1M H;  5IP9 G;  1SN8 A;  1PFN A;  3QO2 A;  1QOH A;  2DNC A;  2IHF A;  5C5L A;  5C4J H;  2CH4 A;  2A6H D;  2NTS A;  3W2D A;  4CGY B;  1CKN A;  1II3 A;  1GD7 A;  4BBR G;  1WTH A;  4DAV A;  1T5E A;  3KLS X;  1BR9 A; 
#chains in the Genus database with same CATH homology
 5DM6 3;  2JA8 B;  1YNJ C;  3EVQ A;  1KLU D;  2LMC B;  1E2W A;  5KND A;  1GOZ A;  1ZKO A;  2WV6 D;  1WD1 A;  2LFN A;  3N52 A;  1VF7 A;  1LAB A;  1K8O A;  4XYO A;  5CC4 A;  4F8M A;  1RKN A;  4QMG A;  1WTX A;  1B2T A;  5AFW A;  4KD3 A;  4F88 A;  5COY A;  4KI0 A;  2K04 A;  1SYB A;  4I7Z C;  4R8N A;  4CBV A;  2RBM A;  4K5W A;  5FO9 B;  3I70 A;  3NXW A;  3DWA A;  2PZU A;  4OO1 G;  3IFT A;  2EE1 A;  3GD7 A;  4HAE A;  3F2U A;  1SYG A;  1SDF A;  1WTV A;  1BBX C;  2VUM B;  3I8Z A;  3MFG A;  1O7Z A;  4IQZ A;  2JE6 I;  1J9O A;  2RKS A;  4MIU A;  3K5M A;  5D14 A;  4KJN A;  3Q22 A;  3M4Y A;  1EZ8 A;  3M4O B;  3RZO B;  5T1G A;  2VB3 X;  2F4I A;  4ABN A;  1ML0 D;  1TWG B;  1SMY D;  4A3F B;  2WAC A;  2EY1 A;  4G4K A;  1SNP A;  2O5J C;  1TWC B;  5LL6 X;  1V1O A;  2B2Y C;  1XX8 A;  5I9O A;  1EY7 A;  4R8I A;  1I4P A;  3BDC A;  2K28 A;  5C4J B;  1VCI A;  2DN8 A;  1D1K A;  2PMZ B;  2PW5 A;  2QDB A;  1B3A A;  3CHB D;  2VXW A;  2EDG A;  4K14 A;  5ELF A;  2EYO A;  1QG7 A;  4FP5 D;  1PZJ D;  5C0X J;  4C1N I;  4EQN A;  4E6I A;  2L4N A;  1UEA B;  2DY7 A;  4IFD G;  4HR7 B;  3KLR A;  1X32 A;  1WTP A;  4DK0 A;  3TZU A;  3OMG A;  4UDU C;  3J7A V;  2BA1 A;  4HSP A;  3IAY A;  3NQT A;  4ZKB B;  4Q5V A;  2JA5 B;  2JYO A;  1A2T A;  4IFD J;  4CKC A;  5I2X A;  3M3Y B;  1MBY A;  2EYM A;  1IW7 C;  1F2Z A;  1S5E D;  3DM1 A;  2R92 B;  3BDO A;  1I50 B;  1ENC A;  2EYH A;  4RGT A;  4FXG C;  2E74 C;  3TN2 A;  3RD4 A;  1CK1 A;  3I90 A;  3S1Q B;  1OXT A;  4BS9 A;  1H9R A;  2B2T A;  4DA2 A;  3S16 B;  2NWG A;  4BA2 I;  5KEE A;  3D4W A;  3GQB A;  3NSW A;  1KDA A;  2QEJ C;  1ENF A;  3H0G B;  4X3T A;  2A74 C;  3J7A F;  1PRT D;  5D3D A;  3NPP A;  1QWY A;  5IGF A;  2CW0 C;  2NB0 A;  1DOK A;  1WTO A;  2KA7 A;  4LMQ D;  1E0B A;  5K36 G;  1RD9 D;  3QOJ A;  4J1M A;  2NN6 G;  2Y0S B;  4K2L A;  5M5W B;  1V8Q A;  5I6Y A;  2PQE A;  2O2L D;  4G7H C;  2K32 A;  1AFP A;  2XRQ D;  4DK1 A;  2BE5 D;  1PRT F;  2A6H C;  1OXS C;  1BCP B;  1WTR A;  4RCO A;  3FDT A;  2M2L A;  3PO2 B;  4DNR B;  1ZEQ X;  2JP1 A;  3GTL B;  4KY7 A;  4A93 B;  1QCB D;  3MHB A;  2ID0 A;  3T51 B;  1SYD A;  1KTK A;  1STA A;  2PO4 A;  4JBW A;  1NR2 A;  3SXH A;  4H13 C;  1ET9 A;  1SJE D;  4IUR A;  4KTA A;  3SVM A;  2HQE A;  1HQM C;  1E2Z A;  1W6J A;  1FNU A;  4I65 A;  3I4N B;  3R3O A;  1A3T A;  4IUQ A;  2FHT A;  2L55 A;  1ESR A;  3TDQ A;  2BDO A;  2WII B;  2C9O A;  2SNM A;  4DU9 A;  5M3M B;  1JQY D;  1JIC A;  2E75 C;  3HP3 A;  3ERQ A;  5K5P A;  4YIJ A;  3SK8 A;  2H1E A;  4O42 A;  1TR5 A;  5IGC A;  1V1P A;  2LY7 A;  4ZAI A;  2C5C A;  1S5B D;  1I4Q A;  3S1R B;  3VA7 A;  1EFI D;  3QOL A;  1XWE A;  5NUC A;  1HA5 A;  5JAV A;  4XT3 B;  4A3M B;  3R93 A;  4CJ2 C;  1HRJ A;  3GV6 A;  2F0Q A;  4B08 A;  1JOK A;  2K1B A;  5A35 A;  4GZY C;  1ESF A;  4KKT A;  1PTO D;  4DAP A;  1Y8N B;  3C46 A;  2ZXR A;  3U9O A;  5C3X A;  5ELB A;  5C6A A;  3GO5 A;  1Q8I A;  1HQR D;  4KD4 A;  4H44 C;  3JAM L;  1O80 A;  4XQN A;  5E4W C;  1QJO A;  4QUC A;  4AYB B;  1ZXT A;  2F0E A;  3D6W A;  3MTS A;  1GUG A;  2EYJ A;  1ICW A;  4ZRZ A;  2AWO A;  2E2J B;  5JOB A;  3VYR A;  1SBB B;  3S2D B;  4DFA A;  2EOT A;  3K7A B;  4K8I A;  4FF2 A;  3MXN A;  1OXX K;  1L0X B;  2RQX A;  4PQX A;  2PPB C;  3K6O A;  1C4Q A;  1LTR D;  3ND8 A;  3P1H A;  2B2T C;  2EJM A;  3NQI A;  4IUV A;  4R9W A;  1PTO B;  1H9J A;  2QKI C;  1CQV A;  5JPN C;  3P75 A;  3GV3 A;  1FR3 A;  1LT6 D;  2G9D A;  5C0X H;  4IZ8 A;  1U4P A;  2VB2 X;  3KK7 A;  4C2M B;  4RGN A;  2I46 A;  3V05 A;  4BBR B;  3GTJ B;  4J8Q A;  1AEX A;  1SE4 A;  2KCN A;  3IL8 A;  1EY6 A;  1A3U A;  2YU9 B;  1EYC A;  5I6W A;  3NK9 A;  2B8G A;  2L11 A;  3KBG A;  2F0K A;  3I3C A;  2F0M A;  1B1Z A;  1LTG D;  5IT9 E;  1FNW A;  1PRT C;  3HOU B;  1RCV D;  1IKM A;  3PUV A;  3SE0 A;  1A3V A;  1D6E C;  3RMH A;  3HOZ B;  2FFK B;  3OSO A;  2JEB I;  1SSO A;  2Q8I B;  2IX3 A;  4BWG B;  3UI2 A;  5FKA C;  3AU7 A;  3KBX A;  2AUK A;  5KNC A;  3FMC A;  3K57 A;  1CTM A;  3TZD A;  2A6E D;  2FMC A;  3V96 A;  1PMR A;  4A3I B;  5J22 A;  1YNN D;  2BDN A;  3T13 A;  1F77 A;  1F9R A;  2EY5 A;  4RKL A;  1CFM A;  1SND A;  2L0C A;  5CMD A;  3LNN A;  3P20 A;  1G2S A;  3VR3 A;  2NUC A;  5CV5 A;  2F0T A;  1H9K A;  5D65 A;  4OIK A;  2YYZ A;  4ZK9 B;  3JAM E;  1A2U A;  2MJ8 A;  1LAC A;  3TP6 A;  4A3B B;  3HOV B;  5IGE A;  2QF7 A;  3BZD B;  3MZ5 A;  4WOR A;  1I3Q B;  2AUJ D;  4OO1 I;  2H4O A;  2OEO A;  1MSH A;  4ZLT F;  4RH6 A;  4TKO B;  5EGT A;  3ND9 A;  4J6H A;  1A6X A;  3Q6S A;  3A7A B;  4FXK C;  2M00 A;  4IN3 A;  3OWE B;  1EY0 A;  1PZI D;  1I6H B;  1Z6H A;  1EIH A;  1R9T B;  3R2T A;  5M3F B;  2MPM A;  1G91 A;  3FEW X;  2EYF A;  1B4O A;  1BXT A;  2K33 A;  2HDL A;  4KKU A;  1TS5 A;  2G9H D;  3VYT A;  1TWF B;  2ICE C;  1GHK A;  3S1N B;  2XNA C;  1G8Z D;  4JK1 C;  1GJX A;  3BVZ A;  4HMJ A;  1LV9 A;  5FLX L;  1BF4 A;  1WCM B;  2KJX A;  4QCL A;  1ZYR D;  1JE4 A;  1RJT A;  2EJG C;  1Y69 U;  1JWS D;  1PZK D;  5C0X I;  2TSS A;  5C3W A;  4XIG S;  1EU4 A;  1Z47 A;  2F0J A;  5DAU A;  1IKL A;  2JA7 B;  3URY A;  1LT4 D;  2CQA A;  4IFD I;  5G3L D;  2PYK A;  3HKZ B;  4WFN 3;  2E76 C;  1SJH D;  5FO7 B;  3D3R A;  2IX1 A;  1SAP A;  1CA5 A;  1D1I A;  1EWC A;  2Z1C A;  5EKK A;  5A2Q L;  2HCC A;  5T1I A;  1EEI D;  1HUM A;  3DHQ A;  5FK9 C;  1BDO A;  2F0O A;  3FVQ A;  3K5O A;  4HTH A;  3BYT B;  1Q1B A;  3W3A A;  5G3L F;  2KEC A;  1GUO A;  3PUY A;  1SNM A;  2JSO A;  1EIG A;  4QB4 A;  5ELE A;  2F0S A;  2KHS A;  1LTA D;  1IYU A;  3T16 A;  4CJ0 B;  1GUT A;  1L0Y B;  2N88 A;  3S1M B;  5EKL A;  1VMC A;  2B2W C;  5CBE E;  5C0X G;  2TMP A;  4Z9C B;  2A68 D;  1Q1E A;  5DEH A;  1X3Q A;  2NN6 I;  2F3V A;  3ITP A;  4K6L A;  1ET6 A;  4K5V A;  2A5H A;  3K59 A;  5EBC A;  2F0F A;  1TU2 B;  2A69 C;  3BDL A;  4OHJ A;  3HOY B;  3DMU A;  3TBI B;  1K83 B;  1RDP D;  2KVM A;  1EZ6 A;  1CM9 A;  1TT2 A;  2MHV A;  1C48 A;  2E2H B;  4HN7 A;  4FXD A;  2FJ2 A;  4DF7 A;  3D6C A;  5CR3 A;  3TP8 A;  1NSN S;  3OIP A;  4XTC S;  3FKI B;  3DXJ C;  1LTS D;  3LWU A;  5FLX E;  2B2V C;  2Q8R E;  2NVX B;  1ENA A;  5M5Y B;  3I4L A;  4C3H G;  1GHJ A;  1JOO A;  1BCP D;  2XWB B;  1KDB A;  4FF1 A;  3NHH A;  1HUN A;  1UAP A;  1EY4 A;  3A55 A;  3S2H B;  1U4M A;  1RTO A;  2K05 A;  5TSS A;  1D5Z C;  3A56 A;  2XRS D;  2HUG A;  2L1B A;  1EWH A;  4V0B A;  2B2U A;  4QIW B;  3L9A X;  3LX0 A;  3MXG A;  4PMC A;  5BN5 A;  4Y7N B;  3A8K E;  3EA6 A;  3ZYY X;  2MUY A;  2Z8L A;  3IFD A;  1BCP F;  5CV4 A;  3K0Y A;  1Z7T A;  3T4A C;  1EOT A;  2D62 A;  4QF4 A;  1W6K A;  2K03 A;  5A2Q E;  3S14 B;  2OF1 A;  3TP5 A;  1OO9 B;  2SDF A;  2QIL A;  3D4R A;  3VR4 A;  4A3G B;  2IJ0 A;  4C3I B;  1AN8 A;  4A3J B;  4FF4 A;  4ULL A;  3NBH A;  2WP8 J;  3AMU A;  1IHZ A;  2XSC A;  1EY8 A;  4OL7 A;  5DM7 3;  4H7B A;  3EJI A;  2J0T D;  1B9N A;  1IL8 A;  1XYI A;  3QWN A;  2VNU D;  4KN7 C;  2LKV A;  4IUP A;  1TWA B;  5EPL A;  3X3M A;  5ISR A;  5ELD A;  3C1E A;  4CKB A;  3J80 L;  4HED A;  2JA6 B;  3OW7 A;  2KCC A;  5CYU A;  1M4V A;  2X6L A;  1U9R A;  1FNV A;  5C4X B;  2XN9 C;  3VYS A;  4FVM A;  3EQL C;  2EYP A;  5CV9 A;  1H9S B;  5KIX A;  4HCS A;  1U4R A;  3VR6 A;  4DAY A;  4PNY A;  1EY5 A;  2BA0 A;  1ONL A;  4RFB A;  2MP1 A;  1NR4 A;  1DJR D;  1K8M A;  3PUX A;  4BBS B;  3OIQ A;  4WJW A;  5HUR A;  2JXM B;  1QE6 A;  1DOL A;  3BVG A;  5IOC A;  4NMZ A;  2B63 B;  4FYD A;  1R4P B;  1SMY C;  5KGU A;  3E6Z X;  1G29 1;  4KY6 A;  2K01 A;  1O7Y A;  3TP7 A;  2RDF A;  5IGG A;  1YNJ D;  2F0H A;  2A73 B;  1U4L A;  1SE2 A;  3E5S A;  2BCO A;  2A68 C;  2CHB D;  4IUT A;  4ZUJ A;  1KAB A;  4DN4 M;  3KUP A;  1CZG A;  1PTO F;  1KAA A;  2QCP X;  4C3I G;  2IW3 A;  4ILW A;  4PMB A;  4A3K B;  2RA4 A;  4ID6 A;  3T53 B;  3BS1 A;  1KLG D;  3H3V C;  3BVM A;  2OXP A;  2RDG A;  5DNF A;  3NWS A;  4TQU S;  4KHV A;  3RZD B;  4G7O C;  5CV8 A;  5E4X A;  3NTK A;  3BG3 A;  1TVX A;  1WTQ A;  1J8I A;  2IX0 A;  1B9M A;  1PLF A;  2AQ3 B;  1JR0 D;  2PZT A;  1SXT A;  1VDZ A;  3RUZ A;  3MXU A;  4H0L C;  3TME A;  2B2U C;  1BCP C;  4RA8 A;  3OPO A;  4U67 3;  1LO5 D;  5LHY 1;  1STB A;  2AQ1 B;  4N9T A;  1Q12 A;  3CQZ B;  4KY5 A;  2PW7 A;  1FD7 D;  3VA5 A;  4L6T B;  2EZV A;  2J7Z A;  4TSS A;  2F0U A;  2EPB A;  1CT1 D;  4BA1 I;  1S5C D;  3E0J A;  3DWP A;  3ONA B;  4KJO A;  4X3U A;  3WOF A;  3SK4 A;  2EVB A;  1HA6 A;  5JPM C;  5CV6 A;  5KYI A;  2RSO A;  2AQ2 B;  2F0G A;  1EYA A;  1TS2 A;  3MWY W;  5EPK A;  2ZXP A;  1O78 A;  2RSN A;  5IOD A;  2BE5 C;  4WRD A;  2RVL A;  2FMM A;  2LS0 1;  1D2B A;  5BN4 A;  1SFO B;  1STN A;  2J4X A;  2AWN A;  5F2D A;  4N9P A;  1GUS A;  2F03 A;  4BY1 B;  3CRL C;  1WVL A;  4XQJ A;  3DEP A;  2XVS A;  3PV0 A;  2Q8T A;  4NKL A;  3GTQ B;  3VYU A;  1JCK B;  3MC0 B;  2OT2 A;  1QIL A;  4KHZ A;  1DOM A;  2O4X A;  1NUC A;  3QG1 A;  4LK1 C;  1MGS A;  3SK5 A;  4IUN A;  4NW2 A;  1F2Y A;  4RAU C;  2CW0 D;  5C4Z A;  2IT1 A;  1CHP D;  5CBA E;  4B9X A;  4MHE A;  3HZX A;  1OXU A;  5JVG 3;  1TY2 A;  5JVH 3;  3H91 A;  1F2L A;  4L63 B;  1SYC A;  4DGZ A;  4V19 0;  2L12 A;  1EQV A;  4OGQ C;  1LT3 D;  3M7G A;  1Q3L A;  1ROD A;  3A54 A;  3K58 A;  1PTO C;  3I72 A;  2HCI A;  1SYE A;  3OMC A;  1CZW A;  1KNE A;  4K8J A;  1CHQ D;  4UAI A;  4C3H B;  2B8F A;  3DUZ A;  2F0N A;  4HCE A;  4XXE A;  3FPP A;  3IKJ A;  3H94 A;  3C2P A;  1AZQ A;  2V4D A;  5COR A;  3I4M B;  3O13 A;  1HHV A;  2F0P A;  3G6J B;  4RGO S;  4B9W A;  2IWH A;  2R6G A;  1ILQ A;  4K6D A;  1SEB D;  1GUW A;  4XDX A;  2SOB A;  5JEA H;  1KNA A;  3NBI A;  5EPJ A;  2X69 A;  3S15 B;  2ICI A;  3HEJ A;  1QB5 D;  2R7Z B;  2F0I A;  3PMF A;  3CU7 A;  5IGB A;  2NVT B;  4RWS C;  3OHX C;  5I2Y A;  1I4X A;  2EJF C;  5IGD A;  3BYY B;  1X3P A;  3SDZ A;  4U68 A;  3PUW A;  2B39 A;  2MGS A;  2EYL A;  3CRK C;  1STE A;  1WD0 A;  2D2C C;  4XT1 B;  3Q23 A;  4Q0F A;  1EL0 A;  5C44 B;  1LTB D;  1BQQ T;  5LL6 S;  1HTP A;  2IPK D;  1S5D D;  1GUN A;  2F0D A;  1JOR A;  3SK6 A;  1UUP A;  1STG A;  3CKI B;  3D4D A;  1MI2 A;  3VR2 A;  2R61 A;  5M9O A;  3C1F A;  5FOB B;  1LLR D;  2XWJ B;  2SNS A;  3NP8 A;  4IAL A;  2K5Q A;  3S17 B;  5JJZ A;  4TRD A;  1EY9 A;  4KKS A;  1EEF D;  2F0V A;  2D5D A;  3HG9 A;  2EY6 A;  2PZW A;  3D31 A;  3I91 A;  3NTH A;  1F9Q A;  2ZXO A;  3PUZ A;  5FO8 B;  5CGK A;  2KOL A;  5M5X B;  3N6R A;  4LJZ C;  1F9P A;  2A6E C;  4XYQ A;  1TQO A;  3L7Z C;  2K6A A;  2EXZ A;  1YNN C;  4KV6 A;  4DXG A;  4HSV A;  3C3L A;  5E3F A;  2KED A;  3HOW B;  2K7V A;  2SEB D;  3A8I E;  1I4G A;  1PYW D;  1TWH B;  1IYV A;  3H6M A;  1HFG A;  1MSG A;  4OIJ A;  2R93 B;  1VMP A;  2EY2 A;  1Y1V B;  2K5D A;  2KUM A;  3WDN A;  2WKD A;  2HDM A;  1MD2 D;  5EKI A;  3GTG B;  3A8J E;  3KLS A;  1D5X C;  5EBD A;  4XQQ A;  1G6Z A;  2F1M A;  3AB9 A;  4BY7 B;  1B44 D;  1TY0 A;  4RHR A;  4L8J A;  4PV1 C;  4DNT B;  2D9U A;  1HXY D;  2ENB A;  3DWQ A;  2F0W A;  4K5X A;  2PNR C;  5J1Z A;  4KMU C;  4ZUI A;  1G2T A;  1FYC A;  5C3E B;  3NWT A;  3SEB A;  1F2M A;  3PIO 3;  4X3S A;  3VR5 A;  1AW7 A;  4EQO A;  1CQF A;  3EFX D;  4IUU A;  4P2C B;  1DYQ A;  3NE5 B;  1H9S A;  2L9H A;  3HS0 C;  3HOX B;  3M7N A;  1ZYR C;  2WIN B;  1DXM A;  1KDC A;  2I07 B;  3J81 L;  1PDQ A;  4ODG A;  3NUC A;  1Y8P B;  3ERO A;  1LT5 D;  1RTN A;  4S3S A;  2IL8 A;  4EVO A;  3H09 A;  1Q90 A;  3MEH A;  2WAQ B;  2ZT9 C;  5KRU A;  1DCZ A;  1PRT B;  3SHL A;  2JEA I;  3HGB A;  5D3I B;  4FNF A;  1PTO H;  3NTI A;  5IT9 L;  1ILP A;  1TS4 A;  1RF2 D;  4NP5 A;  4ZKC B;  3WOE A;  4CJ1 B;  1NAP A;  1S5F D;  3J7Y W;  4DXF A;  3R2I A;  4EGV A;  3P7J A;  1JWM D;  1UNS A;  3MA2 B;  3D8G A;  3OWF A;  3K5L A;  2E2I B;  1B53 A;  3GP7 A;  2RDH A;  3PIP 3;  3RLF A;  5ELC A;  4KK7 A;  3HRZ C;  2K5W A;  4A3D B;  4O1N A;  4EQP A;  5JEA G;  4C3J B;  3LWE A;  5KNB A;  1BNZ A;  1DM0 B;  3I73 A;  1WTW A;  1T5X D;  5JEA J;  4A3E B;  4C1N K;  3MFY A;  1I4H A;  5I4D A;  1V1P B;  4OO1 H;  1H9M A;  2CVR A;  2M9V A;  1JWU D;  5HGT A;  1CI3 M;  1DD2 A;  1PFB A;  1PXU A;  1SNQ A;  2DY8 A;  1HPC A;  1Y8O B;  1CA6 A;  4C56 C;  2BOS A;  1VF5 C;  1V43 A;  5IIF A;  3GTO B;  5C4H A;  2DNE A;  1QNU A;  1A15 A;  4CKE A;  1HTL D;  1Y1W B;  4M8A A;  4G7Z C;  5C5M A;  2NVQ B;  2KEE A;  3GTP B;  4QUF A;  3T56 B;  1QNK A;  1B50 A;  3K5N A;  4PMW A;  1BO0 A;  3Q24 A;  1GXD C;  1RHP A;  3U9S A;  2XIW A;  2WKC A;  1EYD A;  1I6V C;  5CV7 A;  3QB3 A;  2GA4 B;  1JC7 A;  3FPU B;  5EJW A;  1C8C A;  2NVY B;  3J81 E;  1LTI D;  1SYF A;  3Q0A A;  1O7L A;  1SE3 A;  3DEO A;  4K2K A;  3J80 E;  1XXG A;  1I4R A;  3M85 A;  1TKW B;  4G57 A;  3L3O C;  1BUV T;  3TSS A;  2O5I C;  3PO3 B;  5E1F A;  4MN3 A;  1E2V A;  3MAQ A;  1SNC A;  2PCF B;  1TS3 A;  1HFN A;  4IFD H;  2NTT A;  5KYL A;  3GTK B;  1PFM A;  1AZP A;  5EQ0 A;  2WB1 B;  2R3Z A;  5J39 A;  3GTM B;  2B2Y A;  3QJY A;  5BN3 A;  1JOQ A;  2B2W A;  4RCN A;  4LAA A;  4RHS A;  2NYZ D;  2N55 A;  3S9W A;  1TII D;  3SR1 A;  4F7X A;  2A69 D;  3V2T A;  4CHT B;  1DZ1 A;  4C3J G;  1OXV A;  4NDX A;  1F9S A;  3G7L A;  1DON A;  1EQT A;  5I9P A;  2F3W A;  1IW7 D;  1M8A A;  4KN4 C;  4ZQ3 A;  4FF3 A;  1AP0 A;  4F87 A;  4HMI A;  4ZYS A;  1EU3 A;  2FIN B;  2L5T A;  3X3N A;  2KQ3 A;  1SNO A;  3A7L A;  3FRP B;  5K36 H;  2NN6 H;  4ME5 A;  2Z4I A;  4M1U B;  1NCV A;  3OOC A;  1D5M C;  1BOS A;  2B2V A;  2Z4H A;  3QIA A;  2E2D C;  3MVV A;  3R8B A;  1XTC D;  2NZ1 D;  2X6G A;  2F0L A;  4X3K A;  1STY A;  4FO2 A;  1LTT D;  1S4Z A;  3MXP A;  3KF8 A;  1JB3 A;  1FGB D;  1R4Q B;  2NBF A;  4RGM A;  1HCZ A;  4RKB A;  1STH A;  1PFN A;  3QO2 A;  1QOH A;  2DNC A;  5C5L A;  2A6H D;  2NTS A;  3W2D A;  4CGY B;  1II3 A;  4DAV A;  1T5E A;  3KLS X;  1BR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...