5CR3A

Crystal structure of staphylococcal nuclease variant delta+phs v104e/l125e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIAAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLERKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V104E/L125E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cr3A00
2EY2A 1JOOA 2PZUA 2F0JA 2F0VA 2F0TA 4KJNA 4QF4A 5EKLA 5JOBA 4B9XA 2NUCA 4NMZA 3TP5A 5KYLA 4K5VA 1KDBA 3QOLA 3HZXA 3P75A 4IALA 2RKSA 5CV8A 3BDCA 5M9OA 4ZQ3A 4N9TA 4K14A 3BDLA 5IGDA 2F0OA 1NSNS 4KY6A 3TP8A 4K2LA 5J1ZA 1EY6A 1AEXA 1F2MA 1KDCA 4K2KA 4K8IA 5C4ZA 1KAAA 5KYIA 4KV6A 4LAAA 3NHHA 4S3SA 3T16A 4I65A 3D8GA 5KEEA 1A2UA 3NK9A 2EYLA 5C6AA 5CV5A 1SNMA 3MZ5A 2ENBA 3NQTA 4R8NA 4WRDA 3RUZA 1STYA 2F0PA 3T13A 3EVQA 2F0DA 1F2YA 5CV6A 5CV4A 1EY0A 3SK6A 1U9RA 1A3VA 5IIFA 2WACA 1EY4A 2PZWA 4KTAA 3ERQA 4N9PA 4KHVA 3QOJA 3MXPA 2EY1A 5E3FA 3C1FA 2EYMA 4H7BA 4QMGA 5DEHA 4HMJA 2EYPA 5I9PA 5IGGA 2RDFA 2EYFA 5F2DA 5IODA 5KGUA 1EYAA 2PQEA 3TMEA 2F0HA 4TRDA 5KIXA 5ISRA 2F0KA 4K5XA 4ZUJA 3SHLA 5I6YA 1EY5A 1RKNA 3C1EA 2F0SA 3OMGA 3EJIA 4DU9A 5IOCA 4ZUIA 2EYJA 3QB3A 4IZ8A 4KY5A 1II3A 3SR1A 3S9WA 2F0NA 1IHZA 4RKBA 3P1HA 3TP7A 3MEHA 4RKLA 3NXWA 2EYHA 3SK5A 1F2ZA 2LKVA 4PMCA 5J22A 2F0EA 1SYGA 1JOQA 2PZTA 1STGA 3SK4A 4K6DA 5EKKA 1STBA 1STHA 4HTHA 4ODGA 5DAUA 5HGTA 5KRUA 4EVOA 3SK8A 3LX0A 4DFAA 5C3XA 4EQNA 4K5WA 2F3WA 4K8JA 3NUCA 4KJOA 4KY7A 1SYDA 4ME5A 4QB4A 1EZ8A 4DF7A 1JOKA 4MIUA 4NP5A 2EXZA 1KABA 1EY9A 1STAA 1NUCA 1TQOA 3NP8A 1ENCA 2F0UA 2OXPA 1A3UA 5CGKA 1SNDA 2F0GA 2F0IA 5CR3A 5E1FA 3E5SA 5HURA 5IGEA 1JORA 5CC4A 1KDAA 5EGTA 5I9OA 5JAVA 4J6HA 2OF1A 4YIJA 4KD4A 4DGZA 4EQPA 5C4HA 5I6WA 2SNSA 4J1MA 2F0LA 2QDBA 2OEOA 3HEJA 3MVVA 4HMIA 2RBMA 5CV7A 5C5LA 2EY6A 5IGBA 4F7XA 1SNPA 4PNYA 3ITPA 2O4XA 3D4WA 1EYDA 4KD3A 4OL7A 5C5MA 3OSOA 2M00A 3U9OA 2HQEA 3PMFA 1SYBA 1EYCA 1EY8A 1SNQA 1A2TA 2EY5A 4ID6A 4EQOA 2KQ3A 2PYKA 5IGCA 3SXHA 3D6CA 5CV9A 1SNCA 1SYCA 1TT2A 2F0FA 3R3OA 4NDXA 4NKLA 2F0WA 2SNMA 2PW7A 3H6MA 2F0QA 3DHQA 3OWFA 3V2TA 5C3WA 3EROA 3VA5A 1SNOA 1TR5A 3DMUA 5J39A 3D4DA 2EYOA 1EQVA 2PW5A 2KHSA 2SOBA 4B9WA 4F8MA 4E6IA 2F3VA 4IUNA 1EY7A 1STNA 1SYFA 3TP6A 1A3TA 4WORA 4PMBA 1EZ6A 5K5PA 3OMCA 1SYEA 4G57A 1ENAA 2F0MA 5NUCA 5IGFA 3MHBA
chains in the Genus database with same CATH superfamily
1E2VA 4QF4A 1GUWA 4CJ2C 3AMUA 3PO3B 2CFMA 3KBGA 3ULJA 3HZXA 4MZ9A 3BDCA 2B39A 3C2PA 4B3ML 4NPSA 4XYQA 5BN4A 1HNWL 4GKKL 3CU7A 4YHHL 1D5MC 5GQOA 5CV5A 3MZ5A 2QGQA 4XTCS 1F2YA 3KLRA 1W6JA 1Q86C 2PQAB 4H7BA 3DXJC 1PRTF 2EYPA 1JB3A 2BE5D 1F9RA 1ZYRC 2R7DA 4LFCL 4TRDA 5KIXA 3J81L 4OO1G 3BJUA 4OGQC 2F0SA 3RLOA 4LUOA 4A3GG 3HOZH 2F0NA 2Y0SG 4J15A 2PNHA 1EUJA 2EIFA 3D0FA 4DV2Q 3FHWA 1QUQA 4EVOA 4LWCA 2I5HA 5A35A 4EQ5A 1I5FA 2A68C 2OCEA 3HOUH 3DEOA 3BVZA 4BS9A 4OHJA 1YNJC 1VQ9A 2F0GA 1LTSD 4BA2I 1N34Q 5EGTA 4LF7Q 1EFID 1I4PA 2F0LA 5CYUA 2JA5B 2O4XA 2K05A 2WB1E 3MA2B 4C1NK 2LXJA 5M5XH 3HOYH 5E4XA 1B53A 2JA6G 1B2TA 4H0LC 3IKJA 3U4VA 2XTIA 5AJ3Q 4O2DA 1X55A 3FEWX 2EE1A 4NDXA 4NKLA 5C0XJ 2SNMA 2NN6I 3DHQA 4HR7B 2ZJQA 1LUZA 5JJLA 1F2LA 4F8MA 4DPGA 1EY7A 1VMCA 4FDBA 2CQAA 3EQLC 4F87A 1NCVA 3W5OA 1U5KA 3TS2A 4G57A 3K7AH 5K5PA 2HUGA 2Z6KA 4C56C 3IFTA 1LV9A 3RNUA 1Q8IA 4R4IA 2LFNA 5G3LF 3HS0C 2Z6BA 2DNEA 3MXUA 2B2TC 4KLKA 4OX9Q 4BXXG 5IGDA 2JA6H 5G3LD 3TP8A 5FOBB 2R7ZG 5J1ZA 1Q81C 4YWLA 1F2MA 1HR0W 3GO5A 4K2KA 1MKHA 2B29A 2K5NA 1F9SA 3D8GA 1XNRL 2ALYB 4IOAA 1B4OA 1TWAB 4A3JG 1JJ2A 2LS01 1Z7TA 3BVGA 1U9RA 2B2TA 5FKAC 3FPPA 4KTAA 3MWYW 4YWKA 3OTOL 4BWGB 4OONA 2EYMA 1HH2P 4ZRZA 1EYAA 1VQEA 4A93H 1CSPA 1GOZA 3K7AB 3I4OA 4HSPA 1PYSB 4JK1C 2R92G 3ND9A 4KY5A 3HOZB 3A8JE 3HFZB 1BVSA 3PIO3 2F1MA 3NBHA 2VY3A 4YCUA 5IT9L 1WD1A 1HR0L 1D7QA 1HUNA 2EYHA 2ICEC 1ZEQX 3E6ZX 1XPRA 4KHPL 5C4XB 1S5DD 1TU2B 3CAMA 1HCZA 3PV0A 4ZAIA 2SDFA 3M4OH 1E0BA 4QB4A 1EZ8A 1KAWA 1YNJD 2VQFL 2EXZA 1HXYD 1STAA 1W6KA 3ONAB 2OXPA 3GV6A 4BXXH 3E5SA 4H44C 1WJJA 4RCNA 4JI2L 5I6WA 5IY0A 4DGZA 3BG3A 1NR2A 4JI4L 5C5LA 1JJCB 4QUCA 2B2VC 4F88A 3DUZA 5FJ8G 3F2BA 1PRTD 3DM3A 4DNRB 3L9AX 1A2TA 4U673 4ID6A 4ALPA 3S2HH 3C46A 3OYYA 1DCZA 1N36L 2D9UA 2VUMB 4IUNA 2RDHA 3KLWA 4YY3Q 2ZJPA 2D2CC 4B3SL 3EIVA 1FYCA 3GTJH 1I94L 4A3DH 4A3KH 3I4NH 3L2PA 4OWTB 4B9XA 4A3MG 1YHAA 1U4MA 3HKSA 1G8ZD 5CV8A 5JPNC 1EU4A 3NELA 4B3TL 3STBD 2AKWB 3GP7A 3LWEA 2ES2A 3ER0A 5LMNL 3CCRA 3F1ZA 1Y8OB 1X65A 3PCOB 1F9PA 2NVQH 3NENA 1CKNA 1EYGA 3PUVA 1QILA 2QW7A 4BBRH 5C4JB 1B3AA 4LFAL 1RJTA 3HOZG 3T13A 5DM63 3KK7A 2UXCQ 4G7ZC 4JI1L 3CMAA 1EY4A 2QF7A 2ZT9C 2JA8H 2A6EC 2RQXA 1WD0A 4XQNA 2MUYA 5GROA 1JWUD 4RGOS 1S4ZA 2RDFA 1Y1VB 4XQQA 2L5TA 1PV4A 1N34L 1Z6HA 4KN4C 4K5XA 1HQMC 5M3FG 2UUCL 4PMWA 1H9SA 3I7FA 2ZXRA 4DR7L 1CHPD 4X6AH 1HHVA 3A5ZB 5C3EH 4U68A 4RKLA 3AU7A 3VYRA 2QA4A 5GADC 2A69C 4JI2Q 1WVLA 1IBKQ 4TKOB 1HZAA 1P8LA 1WCMB 4K6DA 2E75C 5GAHC 5A2QE 3H09A 4UP7A 4I7ZC 2A68D 2WV6D 4K0KL 3S17B 1JOKA 1QCBD 1PH6A 1E1OA 3J81j 4A3MH 1D6EC 3RLFA 1V43A 4B3TQ 1SAPA 1PH2A 1EEFD 2NZ1D 4LF8Q 3CRLC 3FVQA 4WFN3 4LNQA 4OL7A 2RHSB 2IY5B 1CI3M 1GUGA 2IPKD 2MJ8A 2FMMA 4JI8L 4EQOA 2PMZB 1LTID 1ICWA 4GNXC 2UXBL 2IHEA 3PO3G 2KCNA 4RHRA 4CKBA 1ET9A 2ZTCA 2K01A 3ICEA 1CZWA 4Q0FA 2ZXOA 5DM73 1STNA 2A73B 2I5LX 5M5WB 4ZCKA 1Y1WB 4DV4Q 4MNOA 1FNVA 1WTWA 1R9TB 3M4QA 3L3OC 5COYA 2M2LA 4QJFA 1C0AA 4X3UA 1X3GA 1MGSA 4EX5A 3QOLA 2G5DA 5M9OA 2Z6KC 4DV1Q 1TWGH 2KUMA 2F0OA 2VXWA 3WWVA 2MO1A 2HDMA 5HGTA 1J8IA 1PA6A 2JN4A 3RUZA 4DV1L 1VQDA 1F77A 4M8AA 2O5IC 4JBKA 1A3VA 1V1PB 2AMCB 1SEBD 2WAQB 2OWOA 1G2SA 1TXYA 4JVZA 4HCSA 4KHZA 1C8CA 3X3NA 2QCPX 3S17H 3M7GA 4AYBE 1YITA 2MGSA 1TWHB 1TS3A 5I4DA 4X62Q 4JI6L 1DM0B 5C44H 5IYDH 1WYDA 3E9IA 5ELCA 3PUZA 2KEDA 1IYVA 1GXDC 2CQOA 2QEJC 5IT9c 1E2ZA 1Z47A 3GTLH 1BXTA 5E7NA 1A3UA 3NSWA 3AEVA 5CR3A 1OTCA 4HIDA 4CGYB 4IUTA 3ERSX 5CC4A 3CCVA 4M1UB 5M3FB 5C4HA 1VF5C 1MSGA 4B08A 1HFGA 1GVPA 2L12A 2B2WC 4QQBX 1E7ZA 3OSOA 4L63B 1A8VA 4DV7L 2H5XA 2PI2A 1VQJA 1H9RA 2PYKA 2CW0D 3R3OA 1ONLA 2VZAA 1IBML 3X3MA 1MIUA 3R8BA 3FKIH 5BR8Q 3VA7A 1E24A 4P73A 4HSVA 1SFOH 5JJZA 1BQQT 3UDFA 1BCPB 3AB9A 2K5QA 2J4XA 5FO8B 1EIFA 1BO0A 1HZBA 2NTSA 2E2IB 4UY8C 2NBFA 2RKSA 3JAML 4DA2A 2UXCL 3M85A 4K14A 2JEBI 4A4IA 4NXNQ 1DZ1A 1NSNS 3F2DA 4A3BG 1I3QH 2PO4A 2NVYH 4BBSB 3L0OA 3FP9A 1LABA 2IWHA 2N49A 4S3SA 1C7YA 4R1JA 1S5FD 1CTMA 1D2BA 4FF3A 5EKIA 1C4QA 2VUMG 2ENBA 4LFCQ 4L5SA 5J3BA 2L15A 3K7UC 2IHFA 2WACA 4ULLA 5I2YA 1TWFH 1K83H 2DJGC 2A6HC 2E2JB 1YBYA 4JI4Q 3TRZA 3K81C 3TMEA 1D8LA 1JE5A 1G291 4YY3L 3TZUA 2QKIC 5C0XH 3HP3A 4QY7A 1IBLL 3SR1A 1TWHH 2RVLA 5CORA 1EFWA 3NXWA 1HJPA 3G6JB 4A3IB 1BR9A 3MFYA 5J22A 4AH6A 3E0EA 1Y69U 1EOVA 4IPHA 3J80c 1STHA 3K80C 1TS2A 2ASBA 3A74A 1OXVA 1RHPA 1Y1VH 5EPKA 2Z1CA 3MAQA 3VR6A 4EQNA 1I4QA 2XN9C 4HCEA 2OQKA 3S1RH 1S3OA 1UUPA 1Y14B 2B63B 3EA6A 4BY1H 2A6HD 1NMGA 1VQ6A 2BDOA 2EDGA 3T4AC 4C3JB 3D4RA 4J6HA 3J81i 4ZK9B 2NB0A 4B3SQ 4R8IA 5IP9H 3H3VH 4DXFA 2R93H 1K8OA 3K59A 4DR3Q 3I91A 5GAGC 4R4OA 3VR3A 1TVXA 2HCCA 1EYCA 1N36Q 4C2MB 1PH1A 1HR0Q 1U4LA 1JWMD 4A3KG 1O7YA 1SRUA 1LACA 5C44B 1W2BA 4A3IH 5ELFA 1L2FA 1CA5A 3S14B 2K28A 3CC7A 1RF2D 5M5WH 1Y1WH 3HKZG 3VYTA 3OMCA 5NUCA 3C3LA 2R7ZH 1M90C 1J5EQ 4RGNA 3T51B 1SFOB 5EKLA 4DUYQ 2AQ2B 1LT4D 2K33A 3GTPB 2R92H 4DR1L 3WDNA 3Q23A 4BBSG 4IN3A 4R4CA 5M3MH 2RA4A 3J7ZC 4UP9A 1XPUA 2M9VA 1TY0A 4DR2L 3CCLA 2G9DA 4N9PA 1G51A 2K5HA 3QOJA 3JAME 2EY1A 1VQPA 2JA6B 2HHHL 1TWGB 2V4DA 4ZKCB 1XNQL 2NZHA 2ZM6Q 2YV5A 2A5HA 3N52A 4IFDG 1H95A 3TZDA 1CQFA 1RKNA 5L37A 1RL2A 3J80E 4IOCA 5KNBA 2EYJA 4X64Q 3PQIA 3OTOQ 1II3A 4R9WA 3S9WA 1KD1C 3R93A 1R4QB 2Q2IA 3CC2A 4DUZL 3SK5A 1IZ6A 3VR2A 4OO1I 2PZTA 2E2HH 1STGA 1FR3A 4A3FB 1AN8A 2NVTB 5LMUL 1SR3A 4PG3A 4GKKQ 4DV2L 4UPAA 4XT3B 4NP5A 4KMUC 1JB7A 4YCWA 2K52A 5D3IB 4OX9L 4LMQD 2DN8A 1PH3A 1HTLD 3I70A 3A7LA 3M4YA 1MJEA 2NVQB 3I72A 2GA4B 1HQRD 5C0XI 5IGBA 1I50B 2R3ZA 2I07B 4KD3A 4DK0A 4X65L 4IQZA 2UUCQ 2N55A 1BNZA 3BZDB 1EY8A 4ME3A 4IUQA 3ULLA 3Q6SA 2K1BA 4BBRG 3VA5A 3RZOB 3D4DA 2Q2HA 3I4NG 1Q1BA 3H0GH 2QILA 1GHJA 1A3TA 1Q1EA 1PZID 5IGFA 1N32Q 2IT1A 1TWCH 4JV5L 3JC66 4CKCA 5JOBA 3UE1A 4JI0Q 4NMZA 3BVMA 4Q5VA 5LHY1 2VQEL 1RIPA 5DLQE 3DLLA 2Z4IA 2C5CA 4KHPQ 1DJRD 2KBNA 2L1BA 1PTOF 3K0XA 1C48A 1HPCA 3G4SA 3RLNA 4A93B 1NBWA 1Y1VG 1Z9FA 3S2DH 1E1TA 4I65A 2Z4HA 3A7AB 2DGYA 3KF6B 1VS0A 3T1HQ 5JPMC 4YCVA 2F0DA 2IX3A 1X9NA 3S15H 4RG1A 1JC7A 1L0XB 5KNDA 1KC8C 4POFA 3ERQA 3E9HA 3MXPA 1CKMA 5AFWA 4IUVA 1QVGA 4RHSA 3I4MB 2JK8A 5IT9E 4DR4L 4WJ3M 3HOXG 3A8IE 1K0RA 4GLAC 4G4KA 2A8VA 1B50A 1XX8A 1B9MA 1SN8A 1FGUA 1DONA 1ICFB 3F2UA 1R9TH 2JA7G 1B7YB 3QB3A 3GTQB 2CKZB 1PFMA 4HJ9A 1HZCA 3SGIA 1RDPD 3OW7A 3UDGA 2MQHA 5A2QL 2LKVA 1B1ZA 2ID0A 2FXQA 4RGMA 2XNAC 3S2HB 1FVIA 5K36G 1L1OA 2F3WA 4KJOA 1UEAB 1PDQA 2HD3A 1V1OA 3G6EA 2AHOB 3ND8A 2NTTA 3HG9A 3S16B 4JC0A 1NNXA 2KCTA 3IL8A 2F4IA 2MNAA 1PRTB 4P2CB 2XSCA 4G7OC 1KDAA 1OO9B 1YJWA 2N8NA 3NWSA 2UUBQ 1JT8A 1VQ4A 4A3CG 3J7YW 3FKIG 2I0QA 4BY1G 4EGVA 3A56A 1EWHA 3HOVB 2UXDL 2E5LQ 3SEBA 4FF4A 1HNZQ 4PMCA 2BOSA 2WB1G 2F4VQ 1D1IA 3OWFA 1D5ZC 4OO1H 3OW2A 3GTPH 1SNOA 5J39A 2KA7A 2EJMA 2SOBA 1VQOA 4Y52H 4AYBB 1Q8KA 2WFWA 3TP6A 2KHIA 4WORA 4PMBA 5C4XG 5KYIA 2WINB 3PIP3 1UAPA 5HY6A 2K03A 3IFDA 2K75A 4K5VA 1KDBA 1LTAD 1VQFA 4ZQ3A 1T5XD 1Y8NB 4K2LA 4KI0A 1EY6A 4TVAB 3A54A 3BS1A 2NN6H 4KV6A 4LUZA 4DK1A 1I4GA 5EPJA 4OWXB 5KEEA 1N32L 4PZ7A 1VQGA 1KQSA 4IJLA 2E74C 4A3LG 1SE8A 1STYA 5C44G 3S1QB 1LM0A 4DAYB 1AFPA 1FNWA 1SBBB 1CUKA 4KN7C 4RMFA 2YU9B 2J0TD 3SE0A 5IIFA 4XXEA 4X66Q 3S1NH 4PZ8A 1QNKA 4CDEC 4C3JH 4A3JB 2NWGA 2F4VL 2K5VA 1S40A 2WP8J 4JOIC 3BYTB 2LSSA 3KDFA 3NQIA 2Q8RE 5HGQA 2R7ZB 1WTVA 3R2IA 1EWCA 1RTNA 3E0JA 4ZUIA 1SXTA 3HRZC 1V1PA 2LY7A 3MFGA 4BA1I 5FK9C 1SYGA 4L5QA 4CHTB 1KHIA 1EL0A 3KLSX 3PUYA 4V190 1FJGL 5IWAL 1KLGD 5FLXc 4DR6Q 1QWYA 1TY2A 3CP0A 4A3IG 4WJ4A 4QGUA 1ENCA 4IJHA 1MSHA 5CGKA 5T1GA 5HURA 1OXUA 2A6ED 4RWSC 2NYZD 1L1OB 3T1YL 4RCOA 1TWFB 5IWAQ 4DR6L 4KD4A 3A5UA 2QDBA 1CM9A 4HMIA 2O5JC 1VQKA 2Z0SA 3RD4A 1CKNB 3KOJA 1SYBA 4O1NA 2GVAA 1UNSA 3GDEA 1NAPA 3HOYG 3PO3H 1YHQA 4NXMQ 2F0WA 1QE6A 5C4XH 4P72A 1FGBD 3I2ZA 3RZDB 1N8RC 4JBJA 1EQVA 2KHSA 1B70B 5ELDA 1SMYC 4BY7H 1WCMH 4OIJA 1UE7A 2Q8TA 4LF6L 4HAEA 2F0MA 1FL0A 2B8FA 4A3BB 1VCIA 4AQYL 1D1KA 2F03A 4JI7Q 1AP0A 3BZKA 3P75A 1N33Q 3BDLA 4KY6A 4HIKA 4R4QA 4KKSA 4LF9Q 3PO2H 1PTOB 3NHHA 2HT1A 1SNMA 1L1OC 2R61A 3CPWA 1MD2D 2E5LL 1H9SB 4R4TA 3GTOH 1XTCD 1WFQA 1KRTA 5M3FH 4RFBA 5I2XA 4LW1A 2IL8A 1LLRD 2F52A 5EJWA 4HMJA 3PO2B 4JI5L 1HZ9A 3AFQA 1IKMA 3QG1A 3RMHA 3TEHB 4DV3Q 2L4NA 1G91A 1U4PA 3NTIA 4HJ7A 5FLXL 4A3GH 3OOCA 1VQMA 1JQYD 1O7LA 2Q8IB 4JI5Q 3FKIB 2K32A 2K04A 2ICIA 3PGZA 2LXKA 3J80L 3CW2C 1ML0D 3O13A 1DOLA 1B8AA 4JCVE 1VQBA 1SYDA 4ME5A 1X54A 1GD7A 2XRQD 1KABA 1EY9A 4DAVA 3L7ZC 2B2YA 4RGTA 1SNDA 2B2WA 5E1FA 2NZOA 2AUKA 3F8TA 5BN5A 4LK1C 2OF1A 5CMDA 3NBHB 2EQSA 2JA9A 3STBC 5M3MB 1PTOH 2R93B 3Q8DA 5CV7A 4IPCA 4I7AA 1HFNA 1K9MC 3MC0B 4C3IB 1X6OA 2ZTDA 1SNQA 1PFSA 1EQTA 2EVBA 2UXBQ 3KLSA 4JI8Q 5IGCA 2KJXA 3D6CA 4TSSA 1SYCA 3Q24A 2PPBC 1PYWD 1J6QA 1CHQD 5C3WA 1E22A 1TR5A 4LF5Q 3I56A 1KIXA 1A15A 4C3IG 3BZCA 1G6ZA 3CCJA 2TSSA 1KXLA 1ENAA 1ESRA 1TWCB 3CCEA 2NVXB 3H91A 1PLFA 2F0VA 5IYDG 5GAEC 4IPGA 1QG7A 4DV5L 2B2VA 2IJ0A 4YWMA 1AEXA 1A0IA 2XWJB 1GUSA 1BCPF 1PYBA 2UUAL 4L6TB 3T16A 2WB1B 4HJ5A 1Y1WG 3NK9A 5D14A 2IX1A 3HOVG 2VW9A 1I50H 4GKJL 1A63A 4DR5Q 1J9OA 5EPLA 3Q22A 1SSOA 1S5BD 3K8AA 2EJGC 3H15A 1BBWA 4QMGA 2MP1A 5DEHA 3V05A 1B3QA 1LTLA 4A3CH 5IODA 1SDFA 1X3EA 4A3EH 3AQQA 1PMRA 4FF1A 4JYAQ 4DV7Q 3FMCA 4CDDC 2BA0A 3G48A 4QIWB 3PUWA 1QUQB 4GS3A 4ZYSA 4RKBA 3RR5A 1H9KA 1LTTD 3MEHA 1ET6A 3TBIB 3OIQA 4LFBQ 2AQ3B 4LF4L 5EKKA 5DAUA 1X56A 5LMUQ 1RODA 4RAUC 2VQFQ 5FLXE 1ZKOA 1QNUA 2AUJD 4ILWA 1YHBA 2DUDA 3GTMB 3DWQA 1UEBA 1GM5A 2X69A 5C0XG 4EQPA 2XGTA 2RBMA 2R93G 1YJ9A 1SNPA 1CT1D 3ITPA 4XYOA 3S1MH 3PMFA 5EBDA 2OTJA 1B44D 3HOWB 2KQ3A 4DR5L 1IYUA 1JMCA 1SNCA 2F0FA 1DGSA 2F0QA 4FXDA 3EROA 2Q2UA 4ZKBB 4L5RC 2UUAQ 2HDLA 3NWTA 1O7ZA 4A3BH 2N88A 2NVXH 1WTXA 1LO5D 1M1KC 2PZUA 2F0JA 1VQ5A 4JI7L 5KYLA 4B3RL 1VQLA 3T53B 1V8QA 1DYQA 5JEAH 3FDTA 4LFBL 1JICA 3DWPA 1SE2A 1KDCA 2KCCA 1S72A 4A3EB 3CQZB 4LAAA 1JCKB 1LT3D 3GTGH 2VL6A 1YIJA 4IURA 2XIWA 5IYBG 4AIMA 1N33L 5LMNW 1PXUA 3A0JA 1ASYA 2MHVA 1EEID 4WJWA 2JA8G 1AE3A 2RCFA 4JI3L 4C3HG 4J8QA 1L0YB 4K6LA 2R92B 4JI3Q 3ZJYC 1KNAA 4ABNA 1PH5A 1MHWC 2H4OA 4L8JA 3HOXH 4MTKA 4GNXB 1EQQA 2EJFC 3IRBA 4UP8A 1RTOA 2F0KA 5ISRA 5IE8A 4A3KB 3K5LA 1OXSC 1EQRA 3UI2A 1AZQA 3P1HA 2KVMA 3TP7A 5DNFA 4DR4Q 2IW3A 1PZJD 4HTHA 4JPBW 1VQAA 3D3RA 5BN3A 3PO2G 5ELNA 4K5WA 4K8JA 1VMPA 1PH9A 4HN7A 4DF7A 3D6WA 3KF8B 1TQOA 3VYSA 4C3JG 1CA6A 3NP8A 3HOWH 1PZKD 1IW7C 1UE6A 2EOTA 1GUNA 1K3RA 1M4VA 2LMCB 3S1QH 3W2DA 3U9SA 4JI6Q 4LF4Q 3M3YH 3QR8A 4J1MA 4DV0Q 1LT6D 2MPMA 2L55A 1CK1A 2VB3X 1SMXA 1XXGA 2JXMB 4CDCC 4NXML 2QDLA 2I46A 2O2LD 4DV6L 3J81c 2DY8A 5CBAE 3R2TA 5CV9A 2MO0A 1MJCA 3G71A 3VDYA 1PHJA 1X32A 1NE3A 2MFIA 5M3MG 5JEAJ 3WOFA 3T1HL 3T1YQ 2GN5A 3MHBA 4PNYA 3OIPA 1HUMA 1XMOQ 1H9JA 1QOHA 3VYUA 3WOEA 4CBVA 3H3VI 3UE0A 1XMOL 4O42A 2DJFC 4LUVA 4CJ1B 2VUMH 4OEMB 3TSSA 3U50C 3TS0A 2E8GA 1XMQQ 2A74C 2BE5C 1XTDA 1GUTA 5BR8L 2K7VA 3PIOA 1C9OA 1AW7A 4P75A 5M5XB 1TWAH 1O78A 1PRTC 4A3EG 1I94Q 1SE3A 4R8NA 4JYAL 3NE5B 5IP7G 2L0CA 4DV6Q 1EOTA 4KKUA 1AZPA 1M8AA 1ILQA 4N8X1 5JVH3 3PUXA 3M3YB 1PFBA 5IP7H 1IBKL 2JA7B 2X6LA 4XIGS 3GD7A 5F2DA 5KGUA 1I6HB 3S16H 1EIHA 2PQEA 1RCVD 5EQ0A 4GKJQ 2F0HA 2DY7A 4DN4M 3SHLA 2RSOA 4LF8L 1OXXK 3M4OB 1EU3A 2YTYA 4DNIA 3EJIA 3KJPA 4UAIA 2RF4A 3H94A 3GTQH 1CQVA 1XNQQ 1BCPC 4JG2A 4DAYA 4IFDH 1DOMA 4FO2A 1MBYA 2F0EA 4LJZC 2JE6I 1JE4A 5FO7B 1Q46A 1QVFA 2E2DC 1PH7A 4AYBG 1DD2A 3LNNA 1LT5D 2PMZE 4KY7A 2VNUD 3S1MB 2VS1A 2CW0C 4MIUA 2HIVA 2WAQE 5C3EG 2F0UA 2F0IA 2Y0SB 4UHVA 2K14A 3I4MH 1XYIA 4APVA 1PVOA 3MXGA 3H3VC 1YEZA 4Y7NB 1YI2A 4X64L 2OEOA 1L0WA 5KNCA 3A8KE 4F7XA 2N3SA 1YNND 1QB5D 2B2UA 2M00A 5EBCA 1T5EA 2EY5A 2OTLA 4XDXA 4X3SA 1OXTA 4CDFC 3SDZA 1HTPA 1FNUA 1JR0D 1D5XC 1TIID 1TKWB 2RHQB 4P71A 4E6IA 4TQUS 1SYFA 4KKTA 5TSSA 4DV0L 1BBUA 2UUBL 2N78A 3F2CA 1Q7YC 3TREA 3KF6A 3J7AF 1WTHA 2EY2A 2JJQA 1AE2A 1PTOD 2WAQG 4OELB 2VQEQ 1I6VC 4N9TA 2TMPA 3I90A 3CMEA 1GO3E 1HA5A 3I8ZA 2JEAI 4A3DG 2KEEA 3QO2A 2JA5G 3UDXA 4C1NI 4Y7NH 3QWNA 1NR4A 1ASZA 2YTVA 5D65A 4AQYQ 3NQTA 3HOWG 3BDOA 2A1AA 1K83B 3I55A 1S5ED 2KCMA 3GTOB 3EVQA 2XVSA 4B3RQ 1CSQA 1K3BC 4GZYC 3TN2A 4IO9A 1YNXA 1A6XA 4DXGA 4POGA 5FJ8H 5LL6S 1K8MA 1WI5A 5I9PA 2EYFA 4L5TA 4QL5A 1YZ6A 4MN3A 4HEDA 3HOUB 1BOSA 5I6YA 1EY5A 1LTRD 2HCIA 1E3PA 3JAMc 1K73C 2Q2TA 3JAMi 4P74A 3QIAA 4JI1Q 1AH9A 4IZ8A 1IHZA 4A3GB 2E2HB 2D0PA 2KENA 3KJOA 1W3SA 4KK7A 2K6AA 3HKZE 5ELBA 1JOQA 3SK4A 4ODGA 3J80i 3M4PA 5KRUA 4N8FA 1SJED 2BH8A 3SK8A 1K28A 3HOXB 2J7ZA 1LYLA 2I5MX 1EWIA 4BY7G 1ILPA 3CF5A 1QJOA 1VQIA 3NBIA 3D31A 4LF6Q 4FP5D 4GN3B 2K4KA 1BUVT 3S1NB 2R6GA 3E3XA 4JI0L 2B3GA 4C2MH 1PTOC 3NTHA 5IGEA 2EZVA 1IL2A 2K50A 1GKHA 4X3KA 3SVMA 3CCMA 1SMYD 3MXNA 5I9OA 5JAVA 1HNZL 2JA5H 3GTGB 2BCOA 4A93G 5M5YH 3W1GA 1I3QB 4BBSH 1PH8A 1EYDA 1S5CD 4PZ6A 1X3PA 4QCLA 4DR2Q 5FLMH 2AWOA 1K8GA 3EN2A 1TT2A 4JBMA 4IFDI 2NVTH 3H6MA 3HOUG 2EXDA 3CKIB 2GVBA 5H1SE 2FINB 2K5DA 3S24A 1IL8A 3ULPA 3S14H 3I4NB 1X3FA 4C3HH 1XNRQ 2F0TA 1HRJA 2DNCA 2NUCA 1WTOA 1VDZA 4DK3C 1KL9A 3I4LA 3RZOH 3KBXA 1XMQL 2HIXA 3A55A 1Q90A 2E76C 1VQHA 1I4XA 4IPDA 1Q12A 4QUFA 1IXRA 1ZXTA 2PCFB 5LMNQ 4C3IH 5JEAG 1CZGA 5C6AA 1WTQA 1GJXA 2F0PA 2WIIB 3GTMH 2OQ0A 3M7NA 3S15B 2YU9H 3S1RB 2SEBD 4NB3A 5E3FA 2F3IA 4A3MB 1VQNA 4MHEA 4DV3L 4A3LH 1O80A 4RH6A 1BF4A 4H02A 4NW2A 3K57A 4FXKC 2IX0A 2CWPA 3GV3A 1ESFA 4XT1B 3CXCA 1JWSD 1DOKA 1GHKA 1IKLA 1VQ8A 2XRSD 4HIMA 4FVMA 2JQOA 1XWEA 1SROA 4A3FH 4LFAQ 4LF7L 1LTBD 4IUUA 1T9HA 3TDQA 3RZDH 1WTRA 1WCMG 1NJIC 2PQAA 4JBWA 3HKZB 3EFXD 3TQYA 1QZGA 1YNNC 3CD6A 3H0GG 2BDNA 5C3XA 2FJ2A 4JV5Q 2JP1A 1SE4A 4Z9CB 3J81E 3CCQA 1CFMA 3BYYB 1YVCA 4DUYL 4DV5Q 2D5DA 2A19A 2CHBD 1CKOA 4FXGC 2CWAA 3KDFB 4B3MQ 3DWAA 1JORA 3NTKA 2D0OA 1XJVA 3HEJA 2B8GA 1SJHD 2EY6A 4BBRB 1F9QA 5C4JH 3D4WA 5C5MA 2HQEA 2ZTEA 2ATWA 4OIKA 1PFNA 3SXHA 2E2IH 5JJKA 1VF7A 1E2WA 3CHBD 2Z8LA 3W1BA 4ZLTF 2K5WA 2PW7A 2ZJRA 5IYBH 2CVRA 4V0BA 2PW5A 3P20A 4MTNA 4B9WA 5IP9G 5D3DA 1RD9D 2D62A 1IYJB 2PNRC 3MXNB 3K6OA 1SYEA 2RCNA 1R4PB 1JOOA 3GTJB 3K0YA 4KJNA 5C3EB 3CCSA 1N9WA 1I6HH 4RA8A 3HOVH 3OWEB 3CRKC 3B6YA 2E2JH 2JA7H 3N6RA 1BCPD 2KOLA 4DKAC 5CBEE 3U4ZA 5IYCH 4K8IA 1KAAA 3EBEA 4A76A 4LF9L 5EAYA 3HOYB 1YJNA 4CJ0B 3W3AA 3GTKH 3G7LA 5E4WC 2PI2E 4WRDA 2WKCA 3U58A 2JA8B 5CV6A 3SK6A 3BU2A 5AJ3L 2A69D 2UU9Q 2B63G 3PF4A 1QZHA 3C1FA 2YTXA 1Y8PB 4LF5L 4OWWB 1P16A 3S2DB 1KNEA 2WKDA 3J7AV 1NY4A 2CCZA 5FO9B 1UWVA 1G2TA 5LL6X 5IYCG 4OXPA 4X65Q 3OMGA 2FFKB 5IOCA 3QJYA 5T1IA 4DR1Q 3DM1A 4G7HC 1F2ZA 4YHHQ 4IFDJ 1PH4A 3PSIA 1STBA 1K0SA 3AYHB 4DFAA 3NEMA 3H0GB 2B2YC 1BBXC 1TS4A 1O7IA 3GQBA 2V1CC 3I3CA 3K5MA 1NUCA 1VQCA 4QIWE 1EIYB 2KHJA 2RDGA 2FMCA 3FPUB 2L11A 1UE1A 2KECA 2P5ZX 3K5OA 1DXMA 3K5NA 4A3JH 1U4RA 1GUOA 2EPBA 2L9HA 1X3QA 3CCUA 3U9OA 4DNTB 4DR3L 4A75A 4X66L 4X62L 3CQZH 2FHTA 4HJ8A 4GOPB 3IAYA 2NVYB 2OT2A 3RN5A 1IBLQ 3CPFA 2ZM6L 2BA1A 4IUPA 4DAMA 2VB2X 5ELEA 1HNWQ 2X6GA 3URYA 4GOPA 3T56B 1LTGD 1WOCA 1VQ7A 4C3HB 1HA6A 3OHXC 2JSOA 4O0AA 3I4MG 3TP5A 1SLJA 4IALA 3VR4A 4H13C 4GNXA 3AFPA 3LGJA 1UE5A 4DV4L 1FJGQ 5C4ZA 1QVCA 4GLXA 3KFUA 1K8AC 1XPOA 1STEA 1A2UA 4GLVB 3LWUA 2EYLA 1MI2A 4K0KQ 1I4RA 4BY1B 5CV4A 1EY0A 3NPPA 2PZWA 4DK6C 4KHVA 3PIPA 3HGBA 3OPOA 3RN2A 4DUZQ 5ELOA 5IGGA 3KYHC 3P7JA 3VR5A 4GOPC 3Q0AA 3MTSA 4FYDA 1ENFA 4HIOA 2B2UC 1B9NA 2NN6G 4FF2A 4HJAA 4X3TA 4ZUJA 3C1EA 1V1QA 2ZXPA 3KUPA 4DU9A 1BDOA 2H1EA 4GN4B 2UXDQ 2CH4W 3K58A 1BKBA 2HHHQ 1KRSA 4NXNL 1KTKA 2R7FA 3FRPB 4DAPA 2HQLA 5K36H 4BY7B 1TS5A 3KF8A 3LX0A 1G6PA 1I4HA 3NUCA 1Q3LA 2CH4A 2RSNA 5JVG3 4UDUC 2C9OA 5M5YB 2Z9HA 2C35B 2AQ1B 1H9MA 4FNFA 1HNXQ 3DEPA 3CC4A 2QEXA 1IBMQ 3GTKB 4XQJA 1Q82C 4YIJA 4JOIA 2SNSA 1ZYRD 1NTGA 1EIGA 3MVVA 1U0LA 3V96A 2Y0SE 1J5EL 1NMFA 2AWNA 3MEFA 2YYZA 1A62A 1WTPA 4A3FG 2XWBB 3ZYYX 3GTLB 3PF5A 2B63H 4DR7Q 3V2TA 5FLMG 1JJGA 1V9PA 3DMUA 1IW7D 4GN5A 4PV1C 2BH2A 2EYOA 2G9HD 2F3VA 3UDIA 2UU9L 3I73A 3J7A5 4CKEA 1EZ6A 5JJIA 1KLUD 4JW0A 4PQXA 2JYOA 3M9BA 1FD7D 1HNXL 4A3DB
chains in the Genus database with same CATH topology
1E2VA 4QF4A 1GUWA 4CJ2C 3AMUA 3PO3B 3KBGA 3HZXA 3BDCA 2B39A 3C2PA 4XYQA 5BN4A 3CU7A 1D5MC 5CV5A 3MZ5A 4XTCS 1F2YA 3KLRA 1W6JA 4H7BA 3DXJC 1PRTF 2EYPA 1JB3A 2BE5D 1F9RA 1ZYRC 3J81L 4TRDA 5KIXA 4OO1G 4OGQC 2F0SA 2F0NA 4EVOA 5A35A 2A68C 3DEOA 3BVZA 4BS9A 4OHJA 1YNJC 2F0GA 1LTSD 4BA2I 5EGTA 1EFID 1I4PA 2F0LA 5CYUA 2JA5B 2O4XA 2K05A 3MA2B 4C1NK 5E4XA 1B53A 1B2TA 4H0LC 3IKJA 3FEWX 2EE1A 4NDXA 4NKLA 5C0XJ 2SNMA 2NN6I 3DHQA 4HR7B 1F2LA 4F8MA 1EY7A 1VMCA 2CQAA 3EQLC 4F87A 1NCVA 4G57A 5K5PA 2HUGA 4C56C 3IFTA 1LV9A 1Q8IA 2LFNA 5G3LF 3HS0C 2DNEA 3MXUA 2B2TC 5IGDA 5G3LD 3TP8A 5FOBB 5J1ZA 1F2MA 3GO5A 4K2KA 1F9SA 3D8GA 1B4OA 1TWAB 2LS01 1Z7TA 3BVGA 1U9RA 2B2TA 5FKAC 3FPPA 4KTAA 3MWYW 4BWGB 2EYMA 4ZRZA 1EYAA 1GOZA 3K7AB 4HSPA 4JK1C 3ND9A 4KY5A 3HOZB 3A8JE 3PIO3 2F1MA 5IT9L 3NBHA 1WD1A 1HUNA 2EYHA 2ICEC 1ZEQX 3E6ZX 5C4XB 1S5DD 1TU2B 1HCZA 3PV0A 4ZAIA 2SDFA 1E0BA 4QB4A 1EZ8A 1YNJD 2EXZA 1HXYD 1STAA 1W6KA 3ONAB 2OXPA 3GV6A 3E5SA 4H44C 4RCNA 5I6WA 4DGZA 3BG3A 1NR2A 5C5LA 4QUCA 2B2VC 4F88A 3DUZA 1PRTD 4DNRB 3L9AX 1A2TA 4U673 4ID6A 3C46A 1DCZA 2D9UA 2VUMB 4IUNA 2RDHA 2D2CC 1FYCA 4B9XA 1U4MA 1G8ZD 5CV8A 5JPNC 1EU4A 3GP7A 3LWEA 1Y8OB 1F9PA 3PUVA 1QILA 5C4JB 1B3AA 1RJTA 3T13A 5DM63 3KK7A 4G7ZC 1EY4A 2QF7A 2ZT9C 2A6EC 2RQXA 1WD0A 4XQNA 2MUYA 1JWUD 4RGOS 1S4ZA 2RDFA 1Y1VB 4XQQA 2L5TA 1Z6HA 4KN4C 4K5XA 1HQMC 4PMWA 1H9SA 2ZXRA 1CHPD 1HHVA 4U68A 4RKLA 3AU7A 3VYRA 2A69C 1WVLA 4TKOB 4K6DA 1WCMB 2E75C 5A2QE 3H09A 4I7ZC 2A68D 2WV6D 3S17B 1JOKA 1QCBD 1D6EC 3RLFA 1V43A 1SAPA 1EEFD 2NZ1D 3CRLC 3FVQA 4WFN3 4OL7A 1CI3M 1GUGA 2IPKD 2MJ8A 2FMMA 4EQOA 2PMZB 1LTID 1ICWA 2KCNA 4RHRA 4CKBA 1ET9A 2K01A 1CZWA 4Q0FA 2ZXOA 5DM73 1STNA 2A73B 5M5WB 1Y1WB 1WTWA 1FNVA 1R9TB 3L3OC 5COYA 2M2LA 4X3UA 1MGSA 3QOLA 5M9OA 2KUMA 2F0OA 2VXWA 2HDMA 5HGTA 1J8IA 3RUZA 1F77A 2O5IC 4M8AA 1A3VA 1V1PB 1SEBD 2WAQB 1G2SA 4HCSA 4KHZA 1C8CA 3X3NA 2QCPX 3M7GA 2MGSA 1TWHB 1TS3A 5I4DA 1DM0B 5ELCA 3PUZA 2KEDA 1IYVA 1GXDC 2QEJC 1E2ZA 1Z47A 1BXTA 1A3UA 3NSWA 5CR3A 4CGYB 4IUTA 5CC4A 4M1UB 5M3FB 5C4HA 1VF5C 1MSGA 4B08A 1HFGA 2L12A 2B2WC 3OSOA 4L63B 1H9RA 2PYKA 2CW0D 3R3OA 1ONLA 3X3MA 3R8BA 3VA7A 4HSVA 5JJZA 1BQQT 1BCPB 3AB9A 2K5QA 2J4XA 5FO8B 1BO0A 2NTSA 2E2IB 2NBFA 2RKSA 3JAML 4DA2A 3M85A 4K14A 2JEBI 1DZ1A 1NSNS 4BBSB 2PO4A 1LABA 2IWHA 4S3SA 1D2BA 1S5FD 1CTMA 4FF3A 5EKIA 1C4QA 2ENBA 2WACA 4ULLA 5I2YA 2A6HC 2E2JB 3TMEA 1G291 3TZUA 2QKIC 5C0XH 3HP3A 3SR1A 2RVLA 5CORA 3NXWA 3G6JB 4A3IB 1BR9A 3MFYA 5J22A 1Y69U 1STHA 1TS2A 1OXVA 1RHPA 3MAQA 5EPKA 2Z1CA 3VR6A 4EQNA 1I4QA 2XN9C 4HCEA 1UUPA 2B63B 3EA6A 2A6HD 2BDOA 2EDGA 3T4AC 4C3JB 3D4RA 4J6HA 4ZK9B 2NB0A 4R8IA 4DXFA 1K8OA 3K59A 3I91A 3VR3A 1TVXA 2HCCA 1EYCA 4C2MB 1U4LA 1JWMD 1O7YA 1LACA 5C44B 5ELFA 3S14B 1CA5A 2K28A 1RF2D 3VYTA 3OMCA 5NUCA 3C3LA 4RGNA 3T51B 1SFOB 5EKLA 2AQ2B 1LT4D 2K33A 3GTPB 3WDNA 3Q23A 4IN3A 2RA4A 2M9VA 1TY0A 2G9DA 4N9PA 3QOJA 3JAME 2EY1A 2JA6B 1TWGB 2V4DA 4ZKCB 3N52A 2A5HA 4IFDG 3TZDA 1CQFA 1RKNA 3J80E 5KNBA 2EYJA 1II3A 4R9WA 3S9WA 3R93A 1R4QB 3SK5A 3VR2A 4OO1I 2PZTA 2NVTB 1STGA 4A3FB 1FR3A 1AN8A 4XT3B 4NP5A 4KMUC 5D3IB 2DN8A 4LMQD 1HTLD 3I70A 3A7LA 3M4YA 2NVQB 3I72A 2GA4B 1HQRD 5C0XI 5IGBA 1I50B 2R3ZA 2I07B 4KD3A 4DK0A 4IQZA 2N55A 1BNZA 3BZDB 1EY8A 4IUQA 3Q6SA 2K1BA 3VA5A 3RZOB 3D4DA 1Q1BA 2QILA 1GHJA 1A3TA 1Q1EA 1PZID 5IGFA 2IT1A 4CKCA 5JOBA 4NMZA 3BVMA 4Q5VA 5LHY1 2Z4IA 2C5CA 1DJRD 2L1BA 1PTOF 1C48A 1HPCA 4A93B 4I65A 2Z4HA 3A7AB 5JPMC 2F0DA 2IX3A 1JC7A 1L0XB 5KNDA 3ERQA 3MXPA 5AFWA 4IUVA 4RHSA 3I4MB 5IT9E 3A8IE 4G4KA 1B50A 1XX8A 1B9MA 1DONA 3F2UA 3QB3A 3GTQB 1PFMA 1RDPD 3OW7A 5A2QL 2LKVA 1B1ZA 2ID0A 4RGMA 2XNAC 3S2HB 5K36G 2F3WA 4KJOA 1UEAB 1PDQA 1V1OA 3ND8A 2NTTA 3HG9A 3S16B 3IL8A 2F4IA 1PRTB 4P2CB 2XSCA 4G7OC 1KDAA 1OO9B 3NWSA 3J7YW 4EGVA 3A56A 1EWHA 3HOVB 3SEBA 4FF4A 4PMCA 2BOSA 1D1IA 3OWFA 1D5ZC 4OO1H 1SNOA 5J39A 2KA7A 2EJMA 2SOBA 4AYBB 3TP6A 4WORA 4PMBA 5KYIA 2WINB 3PIP3 1UAPA 2K03A 3IFDA 4K5VA 1KDBA 1LTAD 4ZQ3A 1T5XD 1Y8NB 4K2LA 4KI0A 1EY6A 3A54A 3BS1A 2NN6H 4KV6A 4DK1A 1I4GA 5EPJA 5KEEA 2E74C 1STYA 3S1QB 1AFPA 2YU9B 1FNWA 1SBBB 4KN7C 2J0TD 5IIFA 3SE0A 4XXEA 1QNKA 4A3JB 2NWGA 2WP8J 3BYTB 3NQIA 2Q8RE 2R7ZB 1WTVA 3R2IA 1EWCA 1RTNA 3E0JA 4ZUIA 1SXTA 3HRZC 1V1PA 2LY7A 3MFGA 4BA1I 5FK9C 1SYGA 4CHTB 1EL0A 3KLSX 3PUYA 4V190 1KLGD 1QWYA 1TY2A 1ENCA 1MSHA 5CGKA 5T1GA 5HURA 1OXUA 2A6ED 4RWSC 2NYZD 4RCOA 1TWFB 4KD4A 2QDBA 1CM9A 4HMIA 2O5JC 3RD4A 1SYBA 4O1NA 1UNSA 1NAPA 2F0WA 1QE6A 1FGBD 3RZDB 1EQVA 2KHSA 5ELDA 1SMYC 4OIJA 2Q8TA 4HAEA 2F0MA 2B8FA 4A3BB 1VCIA 1D1KA 2F03A 1AP0A 3P75A 3BDLA 4KY6A 4KKSA 1PTOB 3NHHA 1SNMA 2R61A 1MD2D 1H9SB 1XTCD 4RFBA 5I2XA 2IL8A 1LLRD 5EJWA 4HMJA 3PO2B 1IKMA 3QG1A 3RMHA 1G91A 2L4NA 1U4PA 3NTIA 5FLXL 3OOCA 1JQYD 1O7LA 2Q8IB 3FKIB 2K32A 2K04A 2ICIA 3J80L 1ML0D 3O13A 1DOLA 1SYDA 4ME5A 2XRQD 1KABA 1EY9A 4DAVA 3L7ZC 2B2YA 4RGTA 1SNDA 2B2WA 5E1FA 2AUKA 5BN5A 4LK1C 2OF1A 5CMDA 2R93B 5M3MB 1PTOH 5CV7A 1HFNA 3MC0B 4C3IB 1SNQA 2EVBA 1EQTA 3KLSA 5IGCA 2KJXA 3D6CA 4TSSA 1SYCA 3Q24A 2PPBC 1PYWD 1CHQD 5C3WA 1TR5A 1A15A 4C3IG 1G6ZA 2TSSA 1ENAA 1ESRA 1TWCB 2NVXB 3H91A 1PLFA 2F0VA 1QG7A 2B2VA 2IJ0A 1AEXA 2XWJB 1GUSA 1BCPF 4L6TB 3T16A 2WB1B 3NK9A 5D14A 2IX1A 1J9OA 5EPLA 3Q22A 1SSOA 1S5BD 2EJGC 4QMGA 2MP1A 5DEHA 3V05A 5IODA 1SDFA 1PMRA 4FF1A 3FMCA 2BA0A 4QIWB 3PUWA 4ZYSA 4RKBA 1H9KA 1LTTD 3MEHA 1ET6A 3TBIB 3OIQA 2AQ3B 5EKKA 5DAUA 1RODA 4RAUC 5FLXE 1ZKOA 1QNUA 2AUJD 4ILWA 3GTMB 3DWQA 2X69A 5C0XG 4EQPA 2RBMA 1SNPA 1CT1D 3ITPA 4XYOA 3PMFA 5EBDA 1B44D 3HOWB 2KQ3A 1IYUA 1SNCA 2F0FA 2F0QA 4FXDA 3EROA 4ZKBB 2HDLA 3NWTA 1O7ZA 2N88A 1WTXA 1LO5D 2PZUA 2F0JA 5KYLA 3T53B 1V8QA 1DYQA 5JEAH 3FDTA 1JICA 3DWPA 1SE2A 1KDCA 2KCCA 4A3EB 3CQZB 4LAAA 1JCKB 1LT3D 4IURA 2XIWA 1PXUA 2MHVA 1EEID 4WJWA 4C3HG 4J8QA 1L0YB 4K6LA 2R92B 1KNAA 4ABNA 2H4OA 4L8JA 2EJFC 5ISRA 1RTOA 2F0KA 4A3KB 3K5LA 1OXSC 3UI2A 1AZQA 3P1HA 2KVMA 3TP7A 5DNFA 2IW3A 1PZJD 4HTHA 3D3RA 5BN3A 4K5WA 4K8JA 1VMPA 4HN7A 4DF7A 3D6WA 3VYSA 1TQOA 4C3JG 1CA6A 3NP8A 1PZKD 1IW7C 2EOTA 1GUNA 1M4VA 2LMCB 3W2DA 3U9SA 4J1MA 1LT6D 2MPMA 2L55A 1CK1A 2VB3X 1XXGA 2JXMB 2I46A 2O2LD 2DY8A 5CBAE 3R2TA 5CV9A 1X32A 5JEAJ 3WOFA 3MHBA 4PNYA 3OIPA 1HUMA 1H9JA 1QOHA 3VYUA 3WOEA 4CBVA 4O42A 4CJ1B 3TSSA 2A74C 2BE5C 1GUTA 2K7VA 1AW7A 5M5XB 1O78A 1PRTC 1SE3A 4R8NA 3NE5B 2L0CA 1EOTA 4KKUA 1AZPA 1M8AA 1ILQA 5JVH3 3PUXA 3M3YB 1PFBA 2JA7B 2X6LA 4XIGS 3GD7A 5F2DA 5KGUA 1I6HB 1EIHA 2PQEA 1RCVD 5EQ0A 2F0HA 2DY7A 4DN4M 3SHLA 2RSOA 3M4OB 1OXXK 1EU3A 3EJIA 4UAIA 3H94A 1CQVA 1BCPC 4DAYA 4IFDH 1DOMA 4FO2A 1MBYA 2F0EA 4LJZC 2JE6I 1JE4A 5FO7B 2E2DC 1DD2A 3LNNA 1LT5D 4KY7A 2VNUD 3S1MB 2CW0C 4MIUA 2F0UA 2F0IA 2Y0SB 1XYIA 3MXGA 3H3VC 4Y7NB 2OEOA 5KNCA 3A8KE 4F7XA 1YNND 1QB5D 2B2UA 2M00A 5EBCA 1T5EA 2EY5A 4XDXA 4X3SA 1OXTA 3SDZA 1HTPA 1FNUA 1JR0D 1D5XC 1TIID 1TKWB 4E6IA 4TQUS 1SYFA 4KKTA 5TSSA 3J7AF 2EY2A 1PTOD 1I6VC 4N9TA 2TMPA 3I90A 1HA5A 3I8ZA 2JEAI 2KEEA 3QO2A 4C1NI 3QWNA 1NR4A 5D65A 3NQTA 3BDOA 1K83B 1S5ED 3GTOB 3EVQA 2XVSA 4GZYC 3TN2A 1A6XA 4DXGA 5LL6S 1K8MA 5I9PA 2EYFA 4MN3A 4HEDA 3HOUB 1BOSA 5I6YA 1EY5A 1LTRD 2HCIA 3QIAA 4IZ8A 1IHZA 4A3GB 2E2HB 4KK7A 2K6AA 5ELBA 1JOQA 3SK4A 4ODGA 5KRUA 1SJED 3SK8A 3HOXB 2J7ZA 1ILPA 1QJOA 3NBIA 3D31A 4FP5D 1BUVT 3S1NB 2R6GA 5IGEA 1PTOC 3NTHA 2EZVA 4X3KA 3SVMA 1SMYD 3MXNA 5I9OA 5JAVA 3GTGB 2BCOA 1I3QB 1EYDA 1S5CD 1X3PA 4QCLA 2AWOA 1TT2A 4IFDI 3H6MA 3CKIB 2FINB 2K5DA 1IL8A 3I4NB 2F0TA 1HRJA 2DNCA 2NUCA 1WTOA 1VDZA 3I4LA 3KBXA 3A55A 1Q90A 2E76C 1I4XA 1Q12A 4QUFA 1ZXTA 2PCFB 5JEAG 1CZGA 5C6AA 1WTQA 1GJXA 2F0PA 2WIIB 3M7NA 3S15B 3S1RB 2SEBD 5E3FA 4A3MB 4MHEA 1O80A 4RH6A 1BF4A 3K57A 4NW2A 4FXKC 2IX0A 3GV3A 1ESFA 4XT1B 1JWSD 1DOKA 1GHKA 1IKLA 2XRSD 4FVMA 1XWEA 1LTBD 4IUUA 3TDQA 1WTRA 4JBWA 3HKZB 3EFXD 1YNNC 2BDNA 5C3XA 2FJ2A 2JP1A 1SE4A 4Z9CB 3J81E 1CFMA 3BYYB 2D5DA 2CHBD 4FXGC 1JORA 3DWAA 3NTKA 3HEJA 2B8GA 1SJHD 2EY6A 4BBRB 1F9QA 3D4WA 5C5MA 2HQEA 4OIKA 1PFNA 3SXHA 1VF7A 1E2WA 3CHBD 2Z8LA 4ZLTF 2K5WA 2PW7A 2CVRA 4V0BA 2PW5A 3P20A 4B9WA 5D3DA 1RD9D 2D62A 2PNRC 3K6OA 1SYEA 1R4PB 1JOOA 3GTJB 3K0YA 4KJNA 5C3EB 4RA8A 3OWEB 3CRKC 3N6RA 1BCPD 2KOLA 5CBEE 4K8IA 1KAAA 3HOYB 4CJ0B 3W3AA 3G7LA 5E4WC 4WRDA 2WKCA 2JA8B 5CV6A 3SK6A 2A69D 3C1FA 1Y8PB 3S2DB 1KNEA 2WKDA 3J7AV 5FO9B 1G2TA 5LL6X 3OMGA 2FFKB 5IOCA 3QJYA 5T1IA 4G7HC 3DM1A 1F2ZA 4IFDJ 1STBA 4DFAA 3H0GB 2B2YC 1BBXC 1TS4A 3GQBA 3I3CA 3K5MA 1NUCA 2RDGA 2FMCA 2L11A 3FPUB 2KECA 3K5OA 1DXMA 3K5NA 1U4RA 1GUOA 2EPBA 2L9HA 1X3QA 3U9OA 4DNTB 2FHTA 3IAYA 2NVYB 2OT2A 2BA1A 4IUPA 2VB2X 5ELEA 2X6GA 3URYA 3T56B 1LTGD 4C3HB 1HA6A 3OHXC 2JSOA 3TP5A 4IALA 3VR4A 4H13C 5C4ZA 1STEA 1A2UA 3LWUA 2EYLA 1MI2A 1I4RA 4BY1B 5CV4A 1EY0A 3NPPA 2PZWA 4KHVA 3HGBA 3OPOA 5IGGA 3P7JA 3VR5A 3Q0AA 3MTSA 4FYDA 1ENFA 2B2UC 4FF2A 1B9NA 2NN6G 4X3TA 4ZUJA 3C1EA 2ZXPA 3KUPA 4DU9A 1BDOA 2H1EA 3K58A 1KTKA 3FRPB 4DAPA 5K36H 4BY7B 1TS5A 3KF8A 3LX0A 1I4HA 3NUCA 1Q3LA 2RSNA 5JVG3 4UDUC 2C9OA 5M5YB 2AQ1B 1H9MA 4FNFA 3DEPA 3GTKB 4XQJA 4YIJA 2SNSA 1ZYRD 1EIGA 3MVVA 3V96A 2AWNA 2YYZA 1WTPA 2XWBB 3ZYYX 3GTLB 3V2TA 3DMUA 1IW7D 4PV1C 2EYOA 2G9HD 2F3VA 3I73A 4CKEA 1EZ6A 1KLUD 4PQXA 2JYOA 1FD7D 4A3DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY2 A;  1JOO A;  2PZU A;  2F0J A;  2F0V A;  2F0T A;  4KJN A;  4QF4 A;  5EKL A;  5JOB A;  4B9X A;  2NUC A;  4NMZ A;  3TP5 A;  5KYL A;  4K5V A;  1KDB A;  3QOL A;  3HZX A;  3P75 A;  4IAL A;  2RKS A;  5CV8 A;  3BDC A;  5M9O A;  4ZQ3 A;  4N9T A;  4K14 A;  3BDL A;  5IGD A;  2F0O A;  1NSN S;  4KY6 A;  3TP8 A;  4K2L A;  5J1Z A;  1EY6 A;  1AEX A;  1F2M A;  1KDC A;  4K2K A;  4K8I A;  5C4Z A;  1KAA A;  5KYI A;  4KV6 A;  4LAA A;  3NHH A;  4S3S A;  3T16 A;  4I65 A;  3D8G A;  5KEE A;  1A2U A;  3NK9 A;  2EYL A;  5C6A A;  5CV5 A;  1SNM A;  3MZ5 A;  2ENB A;  3NQT A;  4R8N A;  4WRD A;  3RUZ A;  1STY A;  2F0P A;  3T13 A;  3EVQ A;  2F0D A;  1F2Y A;  5CV6 A;  5CV4 A;  1EY0 A;  3SK6 A;  1U9R A;  1A3V A;  5IIF A;  2WAC A;  1EY4 A;  2PZW A;  4KTA A;  3ERQ A;  4N9P A;  4KHV A;  3QOJ A;  3MXP A;  2EY1 A;  5E3F A;  3C1F A;  2EYM A;  4H7B A;  4QMG A;  5DEH A;  4HMJ A;  2EYP A;  5I9P A;  5IGG A;  2RDF A;  2EYF A;  5F2D A;  5IOD A;  5KGU A;  1EYA A;  2PQE A;  3TME A;  2F0H A;  4TRD A;  5KIX A;  5ISR A;  2F0K A;  4K5X A;  4ZUJ A;  3SHL A;  5I6Y A;  1EY5 A;  1RKN A;  3C1E A;  2F0S A;  3OMG A;  3EJI A;  4DU9 A;  5IOC A;  4ZUI A;  2EYJ A;  3QB3 A;  4IZ8 A;  4KY5 A;  1II3 A;  3SR1 A;  3S9W A;  2F0N A;  1IHZ A;  4RKB A;  3P1H A;  3TP7 A;  3MEH A;  4RKL A;  3NXW A;  2EYH A;  3SK5 A;  1F2Z A;  2LKV A;  4PMC A;  5J22 A;  2F0E A;  1SYG A;  1JOQ A;  2PZT A;  1STG A;  3SK4 A;  4K6D A;  5EKK A;  1STB A;  1STH A;  4HTH A;  4ODG A;  5DAU A;  5HGT A;  5KRU A;  4EVO A;  3SK8 A;  3LX0 A;  4DFA A;  5C3X A;  4EQN A;  4K5W A;  2F3W A;  4K8J A;  3NUC A;  4KJO A;  4KY7 A;  1SYD A;  4ME5 A;  4QB4 A;  1EZ8 A;  4DF7 A;  1JOK A;  4MIU A;  4NP5 A;  2EXZ A;  1KAB A;  1EY9 A;  1STA A;  1NUC A;  1TQO A;  3NP8 A;  1ENC A;  2F0U A;  2OXP A;  1A3U A;  5CGK A;  1SND A;  2F0G A;  2F0I A;  5CR3 A;  5E1F A;  3E5S A;  5HUR A;  5IGE A;  1JOR A;  5CC4 A;  1KDA A;  5EGT A;  5I9O A;  5JAV A;  4J6H A;  2OF1 A;  4YIJ A;  4KD4 A;  4DGZ A;  4EQP A;  5C4H A;  5I6W A;  2SNS A;  4J1M A;  2F0L A;  2QDB A;  2OEO A;  3HEJ A;  3MVV A;  4HMI A;  2RBM A;  5CV7 A;  5C5L A;  2EY6 A;  5IGB A;  4F7X A;  1SNP A;  4PNY A;  3ITP A;  2O4X A;  3D4W A;  1EYD A;  4KD3 A;  4OL7 A;  5C5M A;  3OSO A;  2M00 A;  3U9O A;  2HQE A;  3PMF A;  1SYB A;  1EYC A;  1EY8 A;  1SNQ A;  1A2T A;  2EY5 A;  4ID6 A;  4EQO A;  2KQ3 A;  2PYK A;  5IGC A;  3SXH A;  3D6C A;  5CV9 A;  1SNC A;  1SYC A;  1TT2 A;  2F0F A;  3R3O A;  4NDX A;  4NKL A;  2F0W A;  2SNM A;  2PW7 A;  3H6M A;  2F0Q A;  3DHQ A;  3OWF A;  3V2T A;  5C3W A;  3ERO A;  3VA5 A;  1SNO A;  1TR5 A;  3DMU A;  5J39 A;  3D4D A;  2EYO A;  1EQV A;  2PW5 A;  2KHS A;  2SOB A;  4B9W A;  4F8M A;  4E6I A;  2F3V A;  4IUN A;  1EY7 A;  1STN A;  1SYF A;  3TP6 A;  1A3T A;  4WOR A;  4PMB A;  1EZ6 A;  5K5P A;  3OMC A;  1SYE A;  4G57 A;  1ENA A;  2F0M A;  5NUC A;  5IGF A;  3MHB A; 
#chains in the Genus database with same CATH topology
 1E2V A;  4QF4 A;  1GUW A;  4CJ2 C;  3AMU A;  3PO3 B;  2CFM A;  3KBG A;  3ULJ A;  3HZX A;  4MZ9 A;  3BDC A;  2B39 A;  3C2P A;  4B3M L;  4NPS A;  4XYQ A;  5BN4 A;  1HNW L;  4GKK L;  3CU7 A;  4YHH L;  1D5M C;  5GQO A;  5CV5 A;  3MZ5 A;  2QGQ A;  4XTC S;  1F2Y A;  3KLR A;  1W6J A;  1Q86 C;  2PQA B;  4H7B A;  3DXJ C;  1PRT F;  2EYP A;  1JB3 A;  2BE5 D;  1F9R A;  1ZYR C;  2R7D A;  4LFC L;  4TRD A;  5KIX A;  3J81 L;  4OO1 G;  3BJU A;  4OGQ C;  2F0S A;  3RLO A;  4LUO A;  4A3G G;  3HOZ H;  2F0N A;  2Y0S G;  4J15 A;  2PNH A;  1EUJ A;  2EIF A;  3D0F A;  4DV2 Q;  3FHW A;  1QUQ A;  4EVO A;  4LWC A;  2I5H A;  5A35 A;  4EQ5 A;  1I5F A;  2A68 C;  2OCE A;  3HOU H;  3DEO A;  3BVZ A;  4BS9 A;  4OHJ A;  1YNJ C;  1VQ9 A;  2F0G A;  1LTS D;  4BA2 I;  1N34 Q;  5EGT A;  4LF7 Q;  1EFI D;  1I4P A;  2F0L A;  5CYU A;  2JA5 B;  2O4X A;  2K05 A;  2WB1 E;  3MA2 B;  4C1N K;  2LXJ A;  5M5X H;  3HOY H;  5E4X A;  1B53 A;  2JA6 G;  1B2T A;  4H0L C;  3IKJ A;  3U4V A;  2XTI A;  5AJ3 Q;  4O2D A;  1X55 A;  3FEW X;  2EE1 A;  4NDX A;  4NKL A;  5C0X J;  2SNM A;  2NN6 I;  3DHQ A;  4HR7 B;  2ZJQ A;  1LUZ A;  5JJL A;  1F2L A;  4F8M A;  4DPG A;  1EY7 A;  1VMC A;  4FDB A;  2CQA A;  3EQL C;  4F87 A;  1NCV A;  3W5O A;  1U5K A;  3TS2 A;  4G57 A;  3K7A H;  5K5P A;  2HUG A;  2Z6K A;  4C56 C;  3IFT A;  1LV9 A;  3RNU A;  1Q8I A;  4R4I A;  2LFN A;  5G3L F;  3HS0 C;  2Z6B A;  2DNE A;  3MXU A;  2B2T C;  4KLK A;  4OX9 Q;  4BXX G;  5IGD A;  2JA6 H;  5G3L D;  3TP8 A;  5FOB B;  2R7Z G;  5J1Z A;  1Q81 C;  4YWL A;  1F2M A;  1HR0 W;  3GO5 A;  4K2K A;  1MKH A;  2B29 A;  2K5N A;  1F9S A;  3D8G A;  1XNR L;  2ALY B;  4IOA A;  1B4O A;  1TWA B;  4A3J G;  1JJ2 A;  2LS0 1;  1Z7T A;  3BVG A;  1U9R A;  2B2T A;  5FKA C;  3FPP A;  4KTA A;  3MWY W;  4YWK A;  3OTO L;  4BWG B;  4OON A;  2EYM A;  1HH2 P;  4ZRZ A;  1EYA A;  1VQE A;  4A93 H;  1CSP A;  1GOZ A;  3K7A B;  3I4O A;  4HSP A;  1PYS B;  4JK1 C;  2R92 G;  3ND9 A;  4KY5 A;  3HOZ B;  3A8J E;  3HFZ B;  1BVS A;  3PIO 3;  2F1M A;  3NBH A;  2VY3 A;  4YCU A;  5IT9 L;  1WD1 A;  1HR0 L;  1D7Q A;  1HUN A;  2EYH A;  2ICE C;  1ZEQ X;  3E6Z X;  1XPR A;  4KHP L;  5C4X B;  1S5D D;  1TU2 B;  3CAM A;  1HCZ A;  3PV0 A;  4ZAI A;  2SDF A;  3M4O H;  1E0B A;  4QB4 A;  1EZ8 A;  1KAW A;  1YNJ D;  2VQF L;  2EXZ A;  1HXY D;  1STA A;  1W6K A;  3ONA B;  2OXP A;  3GV6 A;  4BXX H;  3E5S A;  4H44 C;  1WJJ A;  4RCN A;  4JI2 L;  5I6W A;  5IY0 A;  4DGZ A;  3BG3 A;  1NR2 A;  4JI4 L;  5C5L A;  1JJC B;  4QUC A;  2B2V C;  4F88 A;  3DUZ A;  5FJ8 G;  3F2B A;  1PRT D;  3DM3 A;  4DNR B;  3L9A X;  1A2T A;  4U67 3;  4ID6 A;  4ALP A;  3S2H H;  3C46 A;  3OYY A;  1DCZ A;  1N36 L;  2D9U A;  2VUM B;  4IUN A;  2RDH A;  3KLW A;  4YY3 Q;  2ZJP A;  2D2C C;  4B3S L;  3EIV A;  1FYC A;  3GTJ H;  1I94 L;  4A3D H;  4A3K H;  3I4N H;  3L2P A;  4OWT B;  4B9X A;  4A3M G;  1YHA A;  1U4M A;  3HKS A;  1G8Z D;  5CV8 A;  5JPN C;  1EU4 A;  3NEL A;  4B3T L;  3STB D;  2AKW B;  3GP7 A;  3LWE A;  2ES2 A;  3ER0 A;  5LMN L;  3CCR A;  3F1Z A;  1Y8O B;  1X65 A;  3PCO B;  1F9P A;  2NVQ H;  3NEN A;  1CKN A;  1EYG A;  3PUV A;  1QIL A;  2QW7 A;  4BBR H;  5C4J B;  1B3A A;  4LFA L;  1RJT A;  3HOZ G;  3T13 A;  5DM6 3;  3KK7 A;  2UXC Q;  4G7Z C;  4JI1 L;  3CMA A;  1EY4 A;  2QF7 A;  2ZT9 C;  2JA8 H;  2A6E C;  2RQX A;  1WD0 A;  4XQN A;  2MUY A;  5GRO A;  1JWU D;  4RGO S;  1S4Z A;  2RDF A;  1Y1V B;  4XQQ A;  2L5T A;  1PV4 A;  1N34 L;  1Z6H A;  4KN4 C;  4K5X A;  1HQM C;  5M3F G;  2UUC L;  4PMW A;  1H9S A;  3I7F A;  2ZXR A;  4DR7 L;  1CHP D;  4X6A H;  1HHV A;  3A5Z B;  5C3E H;  4U68 A;  4RKL A;  3AU7 A;  3VYR A;  2QA4 A;  5GAD C;  2A69 C;  4JI2 Q;  1WVL A;  1IBK Q;  4TKO B;  1HZA A;  1P8L A;  1WCM B;  4K6D A;  2E75 C;  5GAH C;  5A2Q E;  3H09 A;  4UP7 A;  4I7Z C;  2A68 D;  2WV6 D;  4K0K L;  3S17 B;  1JOK A;  1QCB D;  1PH6 A;  1E1O A;  3J81 j;  4A3M H;  1D6E C;  3RLF A;  1V43 A;  4B3T Q;  1SAP A;  1PH2 A;  1EEF D;  2NZ1 D;  4LF8 Q;  3CRL C;  3FVQ A;  4WFN 3;  4LNQ A;  4OL7 A;  2RHS B;  2IY5 B;  1CI3 M;  1GUG A;  2IPK D;  2MJ8 A;  2FMM A;  4JI8 L;  4EQO A;  2PMZ B;  1LTI D;  1ICW A;  4GNX C;  2UXB L;  2IHE A;  3PO3 G;  2KCN A;  4RHR A;  4CKB A;  1ET9 A;  2ZTC A;  2K01 A;  3ICE A;  1CZW A;  4Q0F A;  2ZXO A;  5DM7 3;  1STN A;  2A73 B;  2I5L X;  5M5W B;  4ZCK A;  1Y1W B;  4DV4 Q;  4MNO A;  1FNV A;  1WTW A;  1R9T B;  3M4Q A;  3L3O C;  5COY A;  2M2L A;  4QJF A;  1C0A A;  4X3U A;  1X3G A;  1MGS A;  4EX5 A;  3QOL A;  2G5D A;  5M9O A;  2Z6K C;  4DV1 Q;  1TWG H;  2KUM A;  2F0O A;  2VXW A;  3WWV A;  2MO1 A;  2HDM A;  5HGT A;  1J8I A;  1PA6 A;  2JN4 A;  3RUZ A;  4DV1 L;  1VQD A;  1F77 A;  4M8A A;  2O5I C;  4JBK A;  1A3V A;  1V1P B;  2AMC B;  1SEB D;  2WAQ B;  2OWO A;  1G2S A;  1TXY A;  4JVZ A;  4HCS A;  4KHZ A;  1C8C A;  3X3N A;  2QCP X;  3S17 H;  3M7G A;  4AYB E;  1YIT A;  2MGS A;  1TWH B;  1TS3 A;  5I4D A;  4X62 Q;  4JI6 L;  1DM0 B;  5C44 H;  5IYD H;  1WYD A;  3E9I A;  5ELC A;  3PUZ A;  2KED A;  1IYV A;  1GXD C;  2CQO A;  2QEJ C;  5IT9 c;  1E2Z A;  1Z47 A;  3GTL H;  1BXT A;  5E7N A;  1A3U A;  3NSW A;  3AEV A;  5CR3 A;  1OTC A;  4HID A;  4CGY B;  4IUT A;  3ERS X;  5CC4 A;  3CCV A;  4M1U B;  5M3F B;  5C4H A;  1VF5 C;  1MSG A;  4B08 A;  1HFG A;  1GVP A;  2L12 A;  2B2W C;  4QQB X;  1E7Z A;  3OSO A;  4L63 B;  1A8V A;  4DV7 L;  2H5X A;  2PI2 A;  1VQJ A;  1H9R A;  2PYK A;  2CW0 D;  3R3O A;  1ONL A;  2VZA A;  1IBM L;  3X3M A;  1MIU A;  3R8B A;  3FKI H;  5BR8 Q;  3VA7 A;  1E24 A;  4P73 A;  4HSV A;  1SFO H;  5JJZ A;  1BQQ T;  3UDF A;  1BCP B;  3AB9 A;  2K5Q A;  2J4X A;  5FO8 B;  1EIF A;  1BO0 A;  1HZB A;  2NTS A;  2E2I B;  4UY8 C;  2NBF A;  2RKS A;  3JAM L;  4DA2 A;  2UXC L;  3M85 A;  4K14 A;  2JEB I;  4A4I A;  4NXN Q;  1DZ1 A;  1NSN S;  3F2D A;  4A3B G;  1I3Q H;  2PO4 A;  2NVY H;  4BBS B;  3L0O A;  3FP9 A;  1LAB A;  2IWH A;  2N49 A;  4S3S A;  1C7Y A;  4R1J A;  1S5F D;  1CTM A;  1D2B A;  4FF3 A;  5EKI A;  1C4Q A;  2VUM G;  2ENB A;  4LFC Q;  4L5S A;  5J3B A;  2L15 A;  3K7U C;  2IHF A;  2WAC A;  4ULL A;  5I2Y A;  1TWF H;  1K83 H;  2DJG C;  2A6H C;  2E2J B;  1YBY A;  4JI4 Q;  3TRZ A;  3K81 C;  3TME A;  1D8L A;  1JE5 A;  1G29 1;  4YY3 L;  3TZU A;  2QKI C;  5C0X H;  3HP3 A;  4QY7 A;  1IBL L;  3SR1 A;  1TWH H;  2RVL A;  5COR A;  1EFW A;  3NXW A;  1HJP A;  3G6J B;  4A3I B;  1BR9 A;  3MFY A;  5J22 A;  4AH6 A;  3E0E A;  1Y69 U;  1EOV A;  4IPH A;  3J80 c;  1STH A;  3K80 C;  1TS2 A;  2ASB A;  3A74 A;  1OXV A;  1RHP A;  1Y1V H;  5EPK A;  2Z1C A;  3MAQ A;  3VR6 A;  4EQN A;  1I4Q A;  2XN9 C;  4HCE A;  2OQK A;  3S1R H;  1S3O A;  1UUP A;  1Y14 B;  2B63 B;  3EA6 A;  4BY1 H;  2A6H D;  1NMG A;  1VQ6 A;  2BDO A;  2EDG A;  3T4A C;  4C3J B;  3D4R A;  4J6H A;  3J81 i;  4ZK9 B;  2NB0 A;  4B3S Q;  4R8I A;  5IP9 H;  3H3V H;  4DXF A;  2R93 H;  1K8O A;  3K59 A;  4DR3 Q;  3I91 A;  5GAG C;  4R4O A;  3VR3 A;  1TVX A;  2HCC A;  1EYC A;  1N36 Q;  4C2M B;  1PH1 A;  1HR0 Q;  1U4L A;  1JWM D;  4A3K G;  1O7Y A;  1SRU A;  1LAC A;  5C44 B;  1W2B A;  4A3I H;  5ELF A;  1L2F A;  1CA5 A;  3S14 B;  2K28 A;  3CC7 A;  1RF2 D;  5M5W H;  1Y1W H;  3HKZ G;  3VYT A;  3OMC A;  5NUC A;  3C3L A;  2R7Z H;  1M90 C;  1J5E Q;  4RGN A;  3T51 B;  1SFO B;  5EKL A;  4DUY Q;  2AQ2 B;  1LT4 D;  2K33 A;  3GTP B;  2R92 H;  4DR1 L;  3WDN A;  3Q23 A;  4BBS G;  4IN3 A;  4R4C A;  5M3M H;  2RA4 A;  3J7Z C;  4UP9 A;  1XPU A;  2M9V A;  1TY0 A;  4DR2 L;  3CCL A;  2G9D A;  4N9P A;  1G51 A;  2K5H A;  3QOJ A;  3JAM E;  2EY1 A;  1VQP A;  2JA6 B;  2HHH L;  1TWG B;  2V4D A;  4ZKC B;  1XNQ L;  2NZH A;  2ZM6 Q;  2YV5 A;  2A5H A;  3N52 A;  4IFD G;  1H95 A;  3TZD A;  1CQF A;  1RKN A;  5L37 A;  1RL2 A;  3J80 E;  4IOC A;  5KNB A;  2EYJ A;  4X64 Q;  3PQI A;  3OTO Q;  1II3 A;  4R9W A;  3S9W A;  1KD1 C;  3R93 A;  1R4Q B;  2Q2I A;  3CC2 A;  4DUZ L;  3SK5 A;  1IZ6 A;  3VR2 A;  4OO1 I;  2PZT A;  2E2H H;  1STG A;  1FR3 A;  4A3F B;  1AN8 A;  2NVT B;  5LMU L;  1SR3 A;  4PG3 A;  4GKK Q;  4DV2 L;  4UPA A;  4XT3 B;  4NP5 A;  4KMU C;  1JB7 A;  4YCW A;  2K52 A;  5D3I B;  4OX9 L;  4LMQ D;  2DN8 A;  1PH3 A;  1HTL D;  3I70 A;  3A7L A;  3M4Y A;  1MJE A;  2NVQ B;  3I72 A;  2GA4 B;  1HQR D;  5C0X I;  5IGB A;  1I50 B;  2R3Z A;  2I07 B;  4KD3 A;  4DK0 A;  4X65 L;  4IQZ A;  2UUC Q;  2N55 A;  1BNZ A;  3BZD B;  1EY8 A;  4ME3 A;  4IUQ A;  3ULL A;  3Q6S A;  2K1B A;  4BBR G;  3VA5 A;  3RZO B;  3D4D A;  2Q2H A;  3I4N G;  1Q1B A;  3H0G H;  2QIL A;  1GHJ A;  1A3T A;  1Q1E A;  1PZI D;  5IGF A;  1N32 Q;  2IT1 A;  1TWC H;  4JV5 L;  3JC6 6;  4CKC A;  5JOB A;  3UE1 A;  4JI0 Q;  4NMZ A;  3BVM A;  4Q5V A;  5LHY 1;  2VQE L;  1RIP A;  5DLQ E;  3DLL A;  2Z4I A;  2C5C A;  4KHP Q;  1DJR D;  2KBN A;  2L1B A;  1PTO F;  3K0X A;  1C48 A;  1HPC A;  3G4S A;  3RLN A;  4A93 B;  1NBW A;  1Y1V G;  1Z9F A;  3S2D H;  1E1T A;  4I65 A;  2Z4H A;  3A7A B;  2DGY A;  3KF6 B;  1VS0 A;  3T1H Q;  5JPM C;  4YCV A;  2F0D A;  2IX3 A;  1X9N A;  3S15 H;  4RG1 A;  1JC7 A;  1L0X B;  5KND A;  1KC8 C;  4POF A;  3ERQ A;  3E9H A;  3MXP A;  1CKM A;  5AFW A;  4IUV A;  1QVG A;  4RHS A;  3I4M B;  2JK8 A;  5IT9 E;  4DR4 L;  4WJ3 M;  3HOX G;  3A8I E;  1K0R A;  4GLA C;  4G4K A;  2A8V A;  1B50 A;  1XX8 A;  1B9M A;  1SN8 A;  1FGU A;  1DON A;  1ICF B;  3F2U A;  1R9T H;  2JA7 G;  1B7Y B;  3QB3 A;  3GTQ B;  2CKZ B;  1PFM A;  4HJ9 A;  1HZC A;  3SGI A;  1RDP D;  3OW7 A;  3UDG A;  2MQH A;  5A2Q L;  2LKV A;  1B1Z A;  2ID0 A;  2FXQ A;  4RGM A;  2XNA C;  3S2H B;  1FVI A;  5K36 G;  1L1O A;  2F3W A;  4KJO A;  1UEA B;  1PDQ A;  2HD3 A;  1V1O A;  3G6E A;  2AHO B;  3ND8 A;  2NTT A;  3HG9 A;  3S16 B;  4JC0 A;  1NNX A;  2KCT A;  3IL8 A;  2F4I A;  2MNA A;  1PRT B;  4P2C B;  2XSC A;  4G7O C;  1KDA A;  1OO9 B;  1YJW A;  2N8N A;  3NWS A;  2UUB Q;  1JT8 A;  1VQ4 A;  4A3C G;  3J7Y W;  3FKI G;  2I0Q A;  4BY1 G;  4EGV A;  3A56 A;  1EWH A;  3HOV B;  2UXD L;  2E5L Q;  3SEB A;  4FF4 A;  1HNZ Q;  4PMC A;  2BOS A;  2WB1 G;  2F4V Q;  1D1I A;  3OWF A;  1D5Z C;  4OO1 H;  3OW2 A;  3GTP H;  1SNO A;  5J39 A;  2KA7 A;  2EJM A;  2SOB A;  1VQO A;  4Y52 H;  4AYB B;  1Q8K A;  2WFW A;  3TP6 A;  2KHI A;  4WOR A;  4PMB A;  5C4X G;  5KYI A;  2WIN B;  3PIP 3;  1UAP A;  5HY6 A;  2K03 A;  3IFD A;  2K75 A;  4K5V A;  1KDB A;  1LTA D;  1VQF A;  4ZQ3 A;  1T5X D;  1Y8N B;  4K2L A;  4KI0 A;  1EY6 A;  4TVA B;  3A54 A;  3BS1 A;  2NN6 H;  4KV6 A;  4LUZ A;  4DK1 A;  1I4G A;  5EPJ A;  4OWX B;  5KEE A;  1N32 L;  4PZ7 A;  1VQG A;  1KQS A;  4IJL A;  2E74 C;  4A3L G;  1SE8 A;  1STY A;  5C44 G;  3S1Q B;  1LM0 A;  4DAY B;  1AFP A;  1FNW A;  1SBB B;  1CUK A;  4KN7 C;  4RMF A;  2YU9 B;  2J0T D;  3SE0 A;  5IIF A;  4XXE A;  4X66 Q;  3S1N H;  4PZ8 A;  1QNK A;  4CDE C;  4C3J H;  4A3J B;  2NWG A;  2F4V L;  2K5V A;  1S40 A;  2WP8 J;  4JOI C;  3BYT B;  2LSS A;  3KDF A;  3NQI A;  2Q8R E;  5HGQ A;  2R7Z B;  1WTV A;  3R2I A;  1EWC A;  1RTN A;  3E0J A;  4ZUI A;  1SXT A;  3HRZ C;  1V1P A;  2LY7 A;  3MFG A;  4BA1 I;  5FK9 C;  1SYG A;  4L5Q A;  4CHT B;  1KHI A;  1EL0 A;  3KLS X;  3PUY A;  4V19 0;  1FJG L;  5IWA L;  1KLG D;  5FLX c;  4DR6 Q;  1QWY A;  1TY2 A;  3CP0 A;  4A3I G;  4WJ4 A;  4QGU A;  1ENC A;  4IJH A;  1MSH A;  5CGK A;  5T1G A;  5HUR A;  1OXU A;  2A6E D;  4RWS C;  2NYZ D;  1L1O B;  3T1Y L;  4RCO A;  1TWF B;  5IWA Q;  4DR6 L;  4KD4 A;  3A5U A;  2QDB A;  1CM9 A;  4HMI A;  2O5J C;  1VQK A;  2Z0S A;  3RD4 A;  1CKN B;  3KOJ A;  1SYB A;  4O1N A;  2GVA A;  1UNS A;  3GDE A;  1NAP A;  3HOY G;  3PO3 H;  1YHQ A;  4NXM Q;  2F0W A;  1QE6 A;  5C4X H;  4P72 A;  1FGB D;  3I2Z A;  3RZD B;  1N8R C;  4JBJ A;  1EQV A;  2KHS A;  1B70 B;  5ELD A;  1SMY C;  4BY7 H;  1WCM H;  4OIJ A;  1UE7 A;  2Q8T A;  4LF6 L;  4HAE A;  2F0M A;  1FL0 A;  2B8F A;  4A3B B;  1VCI A;  4AQY L;  1D1K A;  2F03 A;  4JI7 Q;  1AP0 A;  3BZK A;  3P75 A;  1N33 Q;  3BDL A;  4KY6 A;  4HIK A;  4R4Q A;  4KKS A;  4LF9 Q;  3PO2 H;  1PTO B;  3NHH A;  2HT1 A;  1SNM A;  1L1O C;  2R61 A;  3CPW A;  1MD2 D;  2E5L L;  1H9S B;  4R4T A;  3GTO H;  1XTC D;  1WFQ A;  1KRT A;  5M3F H;  4RFB A;  5I2X A;  4LW1 A;  2IL8 A;  1LLR D;  2F52 A;  5EJW A;  4HMJ A;  3PO2 B;  4JI5 L;  1HZ9 A;  3AFQ A;  1IKM A;  3QG1 A;  3RMH A;  3TEH B;  4DV3 Q;  2L4N A;  1G91 A;  1U4P A;  3NTI A;  4HJ7 A;  5FLX L;  4A3G H;  3OOC A;  1VQM A;  1JQY D;  1O7L A;  2Q8I B;  4JI5 Q;  3FKI B;  2K32 A;  2K04 A;  2ICI A;  3PGZ A;  2LXK A;  3J80 L;  3CW2 C;  1ML0 D;  3O13 A;  1DOL A;  1B8A A;  4JCV E;  1VQB A;  1SYD A;  4ME5 A;  1X54 A;  1GD7 A;  2XRQ D;  1KAB A;  1EY9 A;  4DAV A;  3L7Z C;  2B2Y A;  4RGT A;  1SND A;  2B2W A;  5E1F A;  2NZO A;  2AUK A;  3F8T A;  5BN5 A;  4LK1 C;  2OF1 A;  5CMD A;  3NBH B;  2EQS A;  2JA9 A;  3STB C;  5M3M B;  1PTO H;  2R93 B;  3Q8D A;  5CV7 A;  4IPC A;  4I7A A;  1HFN A;  1K9M C;  3MC0 B;  4C3I B;  1X6O A;  2ZTD A;  1SNQ A;  1PFS A;  1EQT A;  2EVB A;  2UXB Q;  3KLS A;  4JI8 Q;  5IGC A;  2KJX A;  3D6C A;  4TSS A;  1SYC A;  3Q24 A;  2PPB C;  1PYW D;  1J6Q A;  1CHQ D;  5C3W A;  1E22 A;  1TR5 A;  4LF5 Q;  3I56 A;  1KIX A;  1A15 A;  4C3I G;  3BZC A;  1G6Z A;  3CCJ A;  2TSS A;  1KXL A;  1ENA A;  1ESR A;  1TWC B;  3CCE A;  2NVX B;  3H91 A;  1PLF A;  2F0V A;  5IYD G;  5GAE C;  4IPG A;  1QG7 A;  4DV5 L;  2B2V A;  2IJ0 A;  4YWM A;  1AEX A;  1A0I A;  2XWJ B;  1GUS A;  1BCP F;  1PYB A;  2UUA L;  4L6T B;  3T16 A;  2WB1 B;  4HJ5 A;  1Y1W G;  3NK9 A;  5D14 A;  2IX1 A;  3HOV G;  2VW9 A;  1I50 H;  4GKJ L;  1A63 A;  4DR5 Q;  1J9O A;  5EPL A;  3Q22 A;  1SSO A;  1S5B D;  3K8A A;  2EJG C;  3H15 A;  1BBW A;  4QMG A;  2MP1 A;  5DEH A;  3V05 A;  1B3Q A;  1LTL A;  4A3C H;  5IOD A;  1SDF A;  1X3E A;  4A3E H;  3AQQ A;  1PMR A;  4FF1 A;  4JYA Q;  4DV7 Q;  3FMC A;  4CDD C;  2BA0 A;  3G48 A;  4QIW B;  3PUW A;  1QUQ B;  4GS3 A;  4ZYS A;  4RKB A;  3RR5 A;  1H9K A;  1LTT D;  3MEH A;  1ET6 A;  3TBI B;  3OIQ A;  4LFB Q;  2AQ3 B;  4LF4 L;  5EKK A;  5DAU A;  1X56 A;  5LMU Q;  1ROD A;  4RAU C;  2VQF Q;  5FLX E;  1ZKO A;  1QNU A;  2AUJ D;  4ILW A;  1YHB A;  2DUD A;  3GTM B;  3DWQ A;  1UEB A;  1GM5 A;  2X69 A;  5C0X G;  4EQP A;  2XGT A;  2RBM A;  2R93 G;  1YJ9 A;  1SNP A;  1CT1 D;  3ITP A;  4XYO A;  3S1M H;  3PMF A;  5EBD A;  2OTJ A;  1B44 D;  3HOW B;  2KQ3 A;  4DR5 L;  1IYU A;  1JMC A;  1SNC A;  2F0F A;  1DGS A;  2F0Q A;  4FXD A;  3ERO A;  2Q2U A;  4ZKB B;  4L5R C;  2UUA Q;  2HDL A;  3NWT A;  1O7Z A;  4A3B H;  2N88 A;  2NVX H;  1WTX A;  1LO5 D;  1M1K C;  2PZU A;  2F0J A;  1VQ5 A;  4JI7 L;  5KYL A;  4B3R L;  1VQL A;  3T53 B;  1V8Q A;  1DYQ A;  5JEA H;  3FDT A;  4LFB L;  1JIC A;  3DWP A;  1SE2 A;  1KDC A;  2KCC A;  1S72 A;  4A3E B;  3CQZ B;  4LAA A;  1JCK B;  1LT3 D;  3GTG H;  2VL6 A;  1YIJ A;  4IUR A;  2XIW A;  5IYB G;  4AIM A;  1N33 L;  5LMN W;  1PXU A;  3A0J A;  1ASY A;  2MHV A;  1EEI D;  4WJW A;  2JA8 G;  1AE3 A;  2RCF A;  4JI3 L;  4C3H G;  4J8Q A;  1L0Y B;  4K6L A;  2R92 B;  4JI3 Q;  3ZJY C;  1KNA A;  4ABN A;  1PH5 A;  1MHW C;  2H4O A;  4L8J A;  3HOX H;  4MTK A;  4GNX B;  1EQQ A;  2EJF C;  3IRB A;  4UP8 A;  1RTO A;  2F0K A;  5ISR A;  5IE8 A;  4A3K B;  3K5L A;  1OXS C;  1EQR A;  3UI2 A;  1AZQ A;  3P1H A;  2KVM A;  3TP7 A;  5DNF A;  4DR4 Q;  2IW3 A;  1PZJ D;  4HTH A;  4JPB W;  1VQA A;  3D3R A;  5BN3 A;  3PO2 G;  5ELN A;  4K5W A;  4K8J A;  1VMP A;  1PH9 A;  4HN7 A;  4DF7 A;  3D6W A;  3KF8 B;  1TQO A;  3VYS A;  4C3J G;  1CA6 A;  3NP8 A;  3HOW H;  1PZK D;  1IW7 C;  1UE6 A;  2EOT A;  1GUN A;  1K3R A;  1M4V A;  2LMC B;  3S1Q H;  3W2D A;  3U9S A;  4JI6 Q;  4LF4 Q;  3M3Y H;  3QR8 A;  4J1M A;  4DV0 Q;  1LT6 D;  2MPM A;  2L55 A;  1CK1 A;  2VB3 X;  1SMX A;  1XXG A;  2JXM B;  4CDC C;  4NXM L;  2QDL A;  2I46 A;  2O2L D;  4DV6 L;  3J81 c;  2DY8 A;  5CBA E;  3R2T A;  5CV9 A;  2MO0 A;  1MJC A;  3G71 A;  3VDY A;  1PHJ A;  1X32 A;  1NE3 A;  2MFI A;  5M3M G;  5JEA J;  3WOF A;  3T1H L;  3T1Y Q;  2GN5 A;  3MHB A;  4PNY A;  3OIP A;  1HUM A;  1XMO Q;  1H9J A;  1QOH A;  3VYU A;  3WOE A;  4CBV A;  3H3V I;  3UE0 A;  1XMO L;  4O42 A;  2DJF C;  4LUV A;  4CJ1 B;  2VUM H;  4OEM B;  3TSS A;  3U50 C;  3TS0 A;  2E8G A;  1XMQ Q;  2A74 C;  2BE5 C;  1XTD A;  1GUT A;  5BR8 L;  2K7V A;  3PIO A;  1C9O A;  1AW7 A;  4P75 A;  5M5X B;  1TWA H;  1O78 A;  1PRT C;  4A3E G;  1I94 Q;  1SE3 A;  4R8N A;  4JYA L;  3NE5 B;  5IP7 G;  2L0C A;  4DV6 Q;  1EOT A;  4KKU A;  1AZP A;  1M8A A;  1ILQ A;  4N8X 1;  5JVH 3;  3PUX A;  3M3Y B;  1PFB A;  5IP7 H;  1IBK L;  2JA7 B;  2X6L A;  4XIG S;  3GD7 A;  5F2D A;  5KGU A;  1I6H B;  3S16 H;  1EIH A;  2PQE A;  1RCV D;  5EQ0 A;  4GKJ Q;  2F0H A;  2DY7 A;  4DN4 M;  3SHL A;  2RSO A;  4LF8 L;  1OXX K;  3M4O B;  1EU3 A;  2YTY A;  4DNI A;  3EJI A;  3KJP A;  4UAI A;  2RF4 A;  3H94 A;  3GTQ H;  1CQV A;  1XNQ Q;  1BCP C;  4JG2 A;  4DAY A;  4IFD H;  1DOM A;  4FO2 A;  1MBY A;  2F0E A;  4LJZ C;  2JE6 I;  1JE4 A;  5FO7 B;  1Q46 A;  1QVF A;  2E2D C;  1PH7 A;  4AYB G;  1DD2 A;  3LNN A;  1LT5 D;  2PMZ E;  4KY7 A;  2VNU D;  3S1M B;  2VS1 A;  2CW0 C;  4MIU A;  2HIV A;  2WAQ E;  5C3E G;  2F0U A;  2F0I A;  2Y0S B;  4UHV A;  2K14 A;  3I4M H;  1XYI A;  4APV A;  1PVO A;  3MXG A;  3H3V C;  1YEZ A;  4Y7N B;  1YI2 A;  4X64 L;  2OEO A;  1L0W A;  5KNC A;  3A8K E;  4F7X A;  2N3S A;  1YNN D;  1QB5 D;  2B2U A;  2M00 A;  5EBC A;  1T5E A;  2EY5 A;  2OTL A;  4XDX A;  4X3S A;  1OXT A;  4CDF C;  3SDZ A;  1HTP A;  1FNU A;  1JR0 D;  1D5X C;  1TII D;  1TKW B;  2RHQ B;  4P71 A;  4E6I A;  4TQU S;  1SYF A;  4KKT A;  5TSS A;  4DV0 L;  1BBU A;  2UUB L;  2N78 A;  3F2C A;  1Q7Y C;  3TRE A;  3KF6 A;  3J7A F;  1WTH A;  2EY2 A;  2JJQ A;  1AE2 A;  1PTO D;  2WAQ G;  4OEL B;  2VQE Q;  1I6V C;  4N9T A;  2TMP A;  3I90 A;  3CME A;  1GO3 E;  1HA5 A;  3I8Z A;  2JEA I;  4A3D G;  2KEE A;  3QO2 A;  2JA5 G;  3UDX A;  4C1N I;  4Y7N H;  3QWN A;  1NR4 A;  1ASZ A;  2YTV A;  5D65 A;  4AQY Q;  3NQT A;  3HOW G;  3BDO A;  2A1A A;  1K83 B;  3I55 A;  1S5E D;  2KCM A;  3GTO B;  3EVQ A;  2XVS A;  4B3R Q;  1CSQ A;  1K3B C;  4GZY C;  3TN2 A;  4IO9 A;  1YNX A;  1A6X A;  4DXG A;  4POG A;  5FJ8 H;  5LL6 S;  1K8M A;  1WI5 A;  5I9P A;  2EYF A;  4L5T A;  4QL5 A;  1YZ6 A;  4MN3 A;  4HED A;  3HOU B;  1BOS A;  5I6Y A;  1EY5 A;  1LTR D;  2HCI A;  1E3P A;  3JAM c;  1K73 C;  2Q2T A;  3JAM i;  4P74 A;  3QIA A;  4JI1 Q;  1AH9 A;  4IZ8 A;  1IHZ A;  4A3G B;  2E2H B;  2D0P A;  2KEN A;  3KJO A;  1W3S A;  4KK7 A;  2K6A A;  3HKZ E;  5ELB A;  1JOQ A;  3SK4 A;  4ODG A;  3J80 i;  3M4P A;  5KRU A;  4N8F A;  1SJE D;  2BH8 A;  3SK8 A;  1K28 A;  3HOX B;  2J7Z A;  1LYL A;  2I5M X;  1EWI A;  4BY7 G;  1ILP A;  3CF5 A;  1QJO A;  1VQI A;  3NBI A;  3D31 A;  4LF6 Q;  4FP5 D;  4GN3 B;  2K4K A;  1BUV T;  3S1N B;  2R6G A;  3E3X A;  4JI0 L;  2B3G A;  4C2M H;  1PTO C;  3NTH A;  5IGE A;  2EZV A;  1IL2 A;  2K50 A;  1GKH A;  4X3K A;  3SVM A;  3CCM A;  1SMY D;  3MXN A;  5I9O A;  5JAV A;  1HNZ L;  2JA5 H;  3GTG B;  2BCO A;  4A93 G;  5M5Y H;  3W1G A;  1I3Q B;  4BBS H;  1PH8 A;  1EYD A;  1S5C D;  4PZ6 A;  1X3P A;  4QCL A;  4DR2 Q;  5FLM H;  2AWO A;  1K8G A;  3EN2 A;  1TT2 A;  4JBM A;  4IFD I;  2NVT H;  3H6M A;  3HOU G;  2EXD A;  3CKI B;  2GVB A;  5H1S E;  2FIN B;  2K5D A;  3S24 A;  1IL8 A;  3ULP A;  3S14 H;  3I4N B;  1X3F A;  4C3H H;  1XNR Q;  2F0T A;  1HRJ A;  2DNC A;  2NUC A;  1WTO A;  1VDZ A;  4DK3 C;  1KL9 A;  3I4L A;  3RZO H;  3KBX A;  1XMQ L;  2HIX A;  3A55 A;  1Q90 A;  2E76 C;  1VQH A;  1I4X A;  4IPD A;  1Q12 A;  4QUF A;  1IXR A;  1ZXT A;  2PCF B;  5LMN Q;  4C3I H;  5JEA G;  1CZG A;  5C6A A;  1WTQ A;  1GJX A;  2F0P A;  2WII B;  3GTM H;  2OQ0 A;  3M7N A;  3S15 B;  2YU9 H;  3S1R B;  2SEB D;  4NB3 A;  5E3F A;  2F3I A;  4A3M B;  1VQN A;  4MHE A;  4DV3 L;  4A3L H;  1O80 A;  4RH6 A;  1BF4 A;  4H02 A;  4NW2 A;  3K57 A;  4FXK C;  2IX0 A;  2CWP A;  3GV3 A;  1ESF A;  4XT1 B;  3CXC A;  1JWS D;  1DOK A;  1GHK A;  1IKL A;  1VQ8 A;  2XRS D;  4HIM A;  4FVM A;  2JQO A;  1XWE A;  1SRO A;  4A3F H;  4LFA Q;  4LF7 L;  1LTB D;  4IUU A;  1T9H A;  3TDQ A;  3RZD H;  1WTR A;  1WCM G;  1NJI C;  2PQA A;  4JBW A;  3HKZ B;  3EFX D;  3TQY A;  1QZG A;  1YNN C;  3CD6 A;  3H0G G;  2BDN A;  5C3X A;  2FJ2 A;  4JV5 Q;  2JP1 A;  1SE4 A;  4Z9C B;  3J81 E;  3CCQ A;  1CFM A;  3BYY B;  1YVC A;  4DUY L;  4DV5 Q;  2D5D A;  2A19 A;  2CHB D;  1CKO A;  4FXG C;  2CWA A;  3KDF B;  4B3M Q;  3DWA A;  1JOR A;  3NTK A;  2D0O A;  1XJV A;  3HEJ A;  2B8G A;  1SJH D;  2EY6 A;  4BBR B;  1F9Q A;  5C4J H;  3D4W A;  5C5M A;  2HQE A;  2ZTE A;  2ATW A;  4OIK A;  1PFN A;  3SXH A;  2E2I H;  5JJK A;  1VF7 A;  1E2W A;  3CHB D;  2Z8L A;  3W1B A;  4ZLT F;  2K5W A;  2PW7 A;  2ZJR A;  5IYB H;  2CVR A;  4V0B A;  2PW5 A;  3P20 A;  4MTN A;  4B9W A;  5IP9 G;  5D3D A;  1RD9 D;  2D62 A;  1IYJ B;  2PNR C;  3MXN B;  3K6O A;  1SYE A;  2RCN A;  1R4P B;  1JOO A;  3GTJ B;  3K0Y A;  4KJN A;  5C3E B;  3CCS A;  1N9W A;  1I6H H;  4RA8 A;  3HOV H;  3OWE B;  3CRK C;  3B6Y A;  2E2J H;  2JA7 H;  3N6R A;  1BCP D;  2KOL A;  4DKA C;  5CBE E;  3U4Z A;  5IYC H;  4K8I A;  1KAA A;  3EBE A;  4A76 A;  4LF9 L;  5EAY A;  3HOY B;  1YJN A;  4CJ0 B;  3W3A A;  3GTK H;  3G7L A;  5E4W C;  2PI2 E;  4WRD A;  2WKC A;  3U58 A;  2JA8 B;  5CV6 A;  3SK6 A;  3BU2 A;  5AJ3 L;  2A69 D;  2UU9 Q;  2B63 G;  3PF4 A;  1QZH A;  3C1F A;  2YTX A;  1Y8P B;  4LF5 L;  4OWW B;  1P16 A;  3S2D B;  1KNE A;  2WKD A;  3J7A V;  1NY4 A;  2CCZ A;  5FO9 B;  1UWV A;  1G2T A;  5LL6 X;  5IYC G;  4OXP A;  4X65 Q;  3OMG A;  2FFK B;  5IOC A;  3QJY A;  5T1I A;  4DR1 Q;  3DM1 A;  4G7H C;  1F2Z A;  4YHH Q;  4IFD J;  1PH4 A;  3PSI A;  1STB A;  1K0S A;  3AYH B;  4DFA A;  3NEM A;  3H0G B;  2B2Y C;  1BBX C;  1TS4 A;  1O7I A;  3GQB A;  2V1C C;  3I3C A;  3K5M A;  1NUC A;  1VQC A;  4QIW E;  1EIY B;  2KHJ A;  2RDG A;  2FMC A;  3FPU B;  2L11 A;  1UE1 A;  2KEC A;  2P5Z X;  3K5O A;  1DXM A;  3K5N A;  4A3J H;  1U4R A;  1GUO A;  2EPB A;  2L9H A;  1X3Q A;  3CCU A;  3U9O A;  4DNT B;  4DR3 L;  4A75 A;  4X66 L;  4X62 L;  3CQZ H;  2FHT A;  4HJ8 A;  4GOP B;  3IAY A;  2NVY B;  2OT2 A;  3RN5 A;  1IBL Q;  3CPF A;  2ZM6 L;  2BA1 A;  4IUP A;  4DAM A;  2VB2 X;  5ELE A;  1HNW Q;  2X6G A;  3URY A;  4GOP A;  3T56 B;  1LTG D;  1WOC A;  1VQ7 A;  4C3H B;  1HA6 A;  3OHX C;  2JSO A;  4O0A A;  3I4M G;  3TP5 A;  1SLJ A;  4IAL A;  3VR4 A;  4H13 C;  4GNX A;  3AFP A;  3LGJ A;  1UE5 A;  4DV4 L;  1FJG Q;  5C4Z A;  1QVC A;  4GLX A;  3KFU A;  1K8A C;  1XPO A;  1STE A;  1A2U A;  4GLV B;  3LWU A;  2EYL A;  1MI2 A;  4K0K Q;  1I4R A;  4BY1 B;  5CV4 A;  1EY0 A;  3NPP A;  2PZW A;  4DK6 C;  4KHV A;  3PIP A;  3HGB A;  3OPO A;  3RN2 A;  4DUZ Q;  5ELO A;  5IGG A;  3KYH C;  3P7J A;  3VR5 A;  4GOP C;  3Q0A A;  3MTS A;  4FYD A;  1ENF A;  4HIO A;  2B2U C;  1B9N A;  2NN6 G;  4FF2 A;  4HJA A;  4X3T A;  4ZUJ A;  3C1E A;  1V1Q A;  2ZXP A;  3KUP A;  4DU9 A;  1BDO A;  2H1E A;  4GN4 B;  2UXD Q;  2CH4 W;  3K58 A;  1BKB A;  2HHH Q;  1KRS A;  4NXN L;  1KTK A;  2R7F A;  3FRP B;  4DAP A;  2HQL A;  5K36 H;  4BY7 B;  1TS5 A;  3KF8 A;  3LX0 A;  1G6P A;  1I4H A;  3NUC A;  1Q3L A;  2CH4 A;  2RSN A;  5JVG 3;  4UDU C;  2C9O A;  5M5Y B;  2Z9H A;  2C35 B;  2AQ1 B;  1H9M A;  4FNF A;  1HNX Q;  3DEP A;  3CC4 A;  2QEX A;  1IBM Q;  3GTK B;  4XQJ A;  1Q82 C;  4YIJ A;  4JOI A;  2SNS A;  1ZYR D;  1NTG A;  1EIG A;  3MVV A;  1U0L A;  3V96 A;  2Y0S E;  1J5E L;  1NMF A;  2AWN A;  3MEF A;  2YYZ A;  1A62 A;  1WTP A;  4A3F G;  2XWB B;  3ZYY X;  3GTL B;  3PF5 A;  2B63 H;  4DR7 Q;  3V2T A;  5FLM G;  1JJG A;  1V9P A;  3DMU A;  1IW7 D;  4GN5 A;  4PV1 C;  2BH2 A;  2EYO A;  2G9H D;  2F3V A;  3UDI A;  2UU9 L;  3I73 A;  3J7A 5;  4CKE A;  1EZ6 A;  5JJI A;  1KLU D;  4JW0 A;  4PQX A;  2JYO A;  3M9B A;  1FD7 D;  1HNX L;  4A3D B; 
#chains in the Genus database with same CATH homology
 1E2V A;  4QF4 A;  1GUW A;  4CJ2 C;  3AMU A;  3PO3 B;  3KBG A;  3HZX A;  3BDC A;  2B39 A;  3C2P A;  4XYQ A;  5BN4 A;  3CU7 A;  1D5M C;  5CV5 A;  3MZ5 A;  4XTC S;  1F2Y A;  3KLR A;  1W6J A;  4H7B A;  3DXJ C;  1PRT F;  2EYP A;  1JB3 A;  2BE5 D;  1F9R A;  1ZYR C;  3J81 L;  4TRD A;  5KIX A;  4OO1 G;  4OGQ C;  2F0S A;  2F0N A;  4EVO A;  5A35 A;  2A68 C;  3DEO A;  3BVZ A;  4BS9 A;  4OHJ A;  1YNJ C;  2F0G A;  1LTS D;  4BA2 I;  5EGT A;  1EFI D;  1I4P A;  2F0L A;  5CYU A;  2JA5 B;  2O4X A;  2K05 A;  3MA2 B;  4C1N K;  5E4X A;  1B53 A;  1B2T A;  4H0L C;  3IKJ A;  3FEW X;  2EE1 A;  4NDX A;  4NKL A;  5C0X J;  2SNM A;  2NN6 I;  3DHQ A;  4HR7 B;  1F2L A;  4F8M A;  1EY7 A;  1VMC A;  2CQA A;  3EQL C;  4F87 A;  1NCV A;  4G57 A;  5K5P A;  2HUG A;  4C56 C;  3IFT A;  1LV9 A;  1Q8I A;  2LFN A;  5G3L F;  3HS0 C;  2DNE A;  3MXU A;  2B2T C;  5IGD A;  5G3L D;  3TP8 A;  5FOB B;  5J1Z A;  1F2M A;  3GO5 A;  4K2K A;  1F9S A;  3D8G A;  1B4O A;  1TWA B;  2LS0 1;  1Z7T A;  3BVG A;  1U9R A;  2B2T A;  5FKA C;  3FPP A;  4KTA A;  3MWY W;  4BWG B;  2EYM A;  4ZRZ A;  1EYA A;  1GOZ A;  3K7A B;  4HSP A;  4JK1 C;  3ND9 A;  4KY5 A;  3HOZ B;  3A8J E;  3PIO 3;  2F1M A;  5IT9 L;  3NBH A;  1WD1 A;  1HUN A;  2EYH A;  2ICE C;  1ZEQ X;  3E6Z X;  5C4X B;  1S5D D;  1TU2 B;  1HCZ A;  3PV0 A;  4ZAI A;  2SDF A;  1E0B A;  4QB4 A;  1EZ8 A;  1YNJ D;  2EXZ A;  1HXY D;  1STA A;  1W6K A;  3ONA B;  2OXP A;  3GV6 A;  3E5S A;  4H44 C;  4RCN A;  5I6W A;  4DGZ A;  3BG3 A;  1NR2 A;  5C5L A;  4QUC A;  2B2V C;  4F88 A;  3DUZ A;  1PRT D;  4DNR B;  3L9A X;  1A2T A;  4U67 3;  4ID6 A;  3C46 A;  1DCZ A;  2D9U A;  2VUM B;  4IUN A;  2RDH A;  2D2C C;  1FYC A;  4B9X A;  1U4M A;  1G8Z D;  5CV8 A;  5JPN C;  1EU4 A;  3GP7 A;  3LWE A;  1Y8O B;  1F9P A;  3PUV A;  1QIL A;  5C4J B;  1B3A A;  1RJT A;  3T13 A;  5DM6 3;  3KK7 A;  4G7Z C;  1EY4 A;  2QF7 A;  2ZT9 C;  2A6E C;  2RQX A;  1WD0 A;  4XQN A;  2MUY A;  1JWU D;  4RGO S;  1S4Z A;  2RDF A;  1Y1V B;  4XQQ A;  2L5T A;  1Z6H A;  4KN4 C;  4K5X A;  1HQM C;  4PMW A;  1H9S A;  2ZXR A;  1CHP D;  1HHV A;  4U68 A;  4RKL A;  3AU7 A;  3VYR A;  2A69 C;  1WVL A;  4TKO B;  4K6D A;  1WCM B;  2E75 C;  5A2Q E;  3H09 A;  4I7Z C;  2A68 D;  2WV6 D;  3S17 B;  1JOK A;  1QCB D;  1D6E C;  3RLF A;  1V43 A;  1SAP A;  1EEF D;  2NZ1 D;  3CRL C;  3FVQ A;  4WFN 3;  4OL7 A;  1CI3 M;  1GUG A;  2IPK D;  2MJ8 A;  2FMM A;  4EQO A;  2PMZ B;  1LTI D;  1ICW A;  2KCN A;  4RHR A;  4CKB A;  1ET9 A;  2K01 A;  1CZW A;  4Q0F A;  2ZXO A;  5DM7 3;  1STN A;  2A73 B;  5M5W B;  1Y1W B;  1WTW A;  1FNV A;  1R9T B;  3L3O C;  5COY A;  2M2L A;  4X3U A;  1MGS A;  3QOL A;  5M9O A;  2KUM A;  2F0O A;  2VXW A;  2HDM A;  5HGT A;  1J8I A;  3RUZ A;  1F77 A;  2O5I C;  4M8A A;  1A3V A;  1V1P B;  1SEB D;  2WAQ B;  1G2S A;  4HCS A;  4KHZ A;  1C8C A;  3X3N A;  2QCP X;  3M7G A;  2MGS A;  1TWH B;  1TS3 A;  5I4D A;  1DM0 B;  5ELC A;  3PUZ A;  2KED A;  1IYV A;  1GXD C;  2QEJ C;  1E2Z A;  1Z47 A;  1BXT A;  1A3U A;  3NSW A;  5CR3 A;  4CGY B;  4IUT A;  5CC4 A;  4M1U B;  5M3F B;  5C4H A;  1VF5 C;  1MSG A;  4B08 A;  1HFG A;  2L12 A;  2B2W C;  3OSO A;  4L63 B;  1H9R A;  2PYK A;  2CW0 D;  3R3O A;  1ONL A;  3X3M A;  3R8B A;  3VA7 A;  4HSV A;  5JJZ A;  1BQQ T;  1BCP B;  3AB9 A;  2K5Q A;  2J4X A;  5FO8 B;  1BO0 A;  2NTS A;  2E2I B;  2NBF A;  2RKS A;  3JAM L;  4DA2 A;  3M85 A;  4K14 A;  2JEB I;  1DZ1 A;  1NSN S;  4BBS B;  2PO4 A;  1LAB A;  2IWH A;  4S3S A;  1D2B A;  1S5F D;  1CTM A;  4FF3 A;  5EKI A;  1C4Q A;  2ENB A;  2WAC A;  4ULL A;  5I2Y A;  2A6H C;  2E2J B;  3TME A;  1G29 1;  3TZU A;  2QKI C;  5C0X H;  3HP3 A;  3SR1 A;  2RVL A;  5COR A;  3NXW A;  3G6J B;  4A3I B;  1BR9 A;  3MFY A;  5J22 A;  1Y69 U;  1STH A;  1TS2 A;  1OXV A;  1RHP A;  3MAQ A;  5EPK A;  2Z1C A;  3VR6 A;  4EQN A;  1I4Q A;  2XN9 C;  4HCE A;  1UUP A;  2B63 B;  3EA6 A;  2A6H D;  2BDO A;  2EDG A;  3T4A C;  4C3J B;  3D4R A;  4J6H A;  4ZK9 B;  2NB0 A;  4R8I A;  4DXF A;  1K8O A;  3K59 A;  3I91 A;  3VR3 A;  1TVX A;  2HCC A;  1EYC A;  4C2M B;  1U4L A;  1JWM D;  1O7Y A;  1LAC A;  5C44 B;  5ELF A;  3S14 B;  1CA5 A;  2K28 A;  1RF2 D;  3VYT A;  3OMC A;  5NUC A;  3C3L A;  4RGN A;  3T51 B;  1SFO B;  5EKL A;  2AQ2 B;  1LT4 D;  2K33 A;  3GTP B;  3WDN A;  3Q23 A;  4IN3 A;  2RA4 A;  2M9V A;  1TY0 A;  2G9D A;  4N9P A;  3QOJ A;  3JAM E;  2EY1 A;  2JA6 B;  1TWG B;  2V4D A;  4ZKC B;  3N52 A;  2A5H A;  4IFD G;  3TZD A;  1CQF A;  1RKN A;  3J80 E;  5KNB A;  2EYJ A;  1II3 A;  4R9W A;  3S9W A;  3R93 A;  1R4Q B;  3SK5 A;  3VR2 A;  4OO1 I;  2PZT A;  2NVT B;  1STG A;  4A3F B;  1FR3 A;  1AN8 A;  4XT3 B;  4NP5 A;  4KMU C;  5D3I B;  2DN8 A;  4LMQ D;  1HTL D;  3I70 A;  3A7L A;  3M4Y A;  2NVQ B;  3I72 A;  2GA4 B;  1HQR D;  5C0X I;  5IGB A;  1I50 B;  2R3Z A;  2I07 B;  4KD3 A;  4DK0 A;  4IQZ A;  2N55 A;  1BNZ A;  3BZD B;  1EY8 A;  4IUQ A;  3Q6S A;  2K1B A;  3VA5 A;  3RZO B;  3D4D A;  1Q1B A;  2QIL A;  1GHJ A;  1A3T A;  1Q1E A;  1PZI D;  5IGF A;  2IT1 A;  4CKC A;  5JOB A;  4NMZ A;  3BVM A;  4Q5V A;  5LHY 1;  2Z4I A;  2C5C A;  1DJR D;  2L1B A;  1PTO F;  1C48 A;  1HPC A;  4A93 B;  4I65 A;  2Z4H A;  3A7A B;  5JPM C;  2F0D A;  2IX3 A;  1JC7 A;  1L0X B;  5KND A;  3ERQ A;  3MXP A;  5AFW A;  4IUV A;  4RHS A;  3I4M B;  5IT9 E;  3A8I E;  4G4K A;  1B50 A;  1XX8 A;  1B9M A;  1DON A;  3F2U A;  3QB3 A;  3GTQ B;  1PFM A;  1RDP D;  3OW7 A;  5A2Q L;  2LKV A;  1B1Z A;  2ID0 A;  4RGM A;  2XNA C;  3S2H B;  5K36 G;  2F3W A;  4KJO A;  1UEA B;  1PDQ A;  1V1O A;  3ND8 A;  2NTT A;  3HG9 A;  3S16 B;  3IL8 A;  2F4I A;  1PRT B;  4P2C B;  2XSC A;  4G7O C;  1KDA A;  1OO9 B;  3NWS A;  3J7Y W;  4EGV A;  3A56 A;  1EWH A;  3HOV B;  3SEB A;  4FF4 A;  4PMC A;  2BOS A;  1D1I A;  3OWF A;  1D5Z C;  4OO1 H;  1SNO A;  5J39 A;  2KA7 A;  2EJM A;  2SOB A;  4AYB B;  3TP6 A;  4WOR A;  4PMB A;  5KYI A;  2WIN B;  3PIP 3;  1UAP A;  2K03 A;  3IFD A;  4K5V A;  1KDB A;  1LTA D;  4ZQ3 A;  1T5X D;  1Y8N B;  4K2L A;  4KI0 A;  1EY6 A;  3A54 A;  3BS1 A;  2NN6 H;  4KV6 A;  4DK1 A;  1I4G A;  5EPJ A;  5KEE A;  2E74 C;  1STY A;  3S1Q B;  1AFP A;  2YU9 B;  1FNW A;  1SBB B;  4KN7 C;  2J0T D;  5IIF A;  3SE0 A;  4XXE A;  1QNK A;  4A3J B;  2NWG A;  2WP8 J;  3BYT B;  3NQI A;  2Q8R E;  2R7Z B;  1WTV A;  3R2I A;  1EWC A;  1RTN A;  3E0J A;  4ZUI A;  1SXT A;  3HRZ C;  1V1P A;  2LY7 A;  3MFG A;  4BA1 I;  5FK9 C;  1SYG A;  4CHT B;  1EL0 A;  3KLS X;  3PUY A;  4V19 0;  1KLG D;  1QWY A;  1TY2 A;  1ENC A;  1MSH A;  5CGK A;  5T1G A;  5HUR A;  1OXU A;  2A6E D;  4RWS C;  2NYZ D;  4RCO A;  1TWF B;  4KD4 A;  2QDB A;  1CM9 A;  4HMI A;  2O5J C;  3RD4 A;  1SYB A;  4O1N A;  1UNS A;  1NAP A;  2F0W A;  1QE6 A;  1FGB D;  3RZD B;  1EQV A;  2KHS A;  5ELD A;  1SMY C;  4OIJ A;  2Q8T A;  4HAE A;  2F0M A;  2B8F A;  4A3B B;  1VCI A;  1D1K A;  2F03 A;  1AP0 A;  3P75 A;  3BDL A;  4KY6 A;  4KKS A;  1PTO B;  3NHH A;  1SNM A;  2R61 A;  1MD2 D;  1H9S B;  1XTC D;  4RFB A;  5I2X A;  2IL8 A;  1LLR D;  5EJW A;  4HMJ A;  3PO2 B;  1IKM A;  3QG1 A;  3RMH A;  1G91 A;  2L4N A;  1U4P A;  3NTI A;  5FLX L;  3OOC A;  1JQY D;  1O7L A;  2Q8I B;  3FKI B;  2K32 A;  2K04 A;  2ICI A;  3J80 L;  1ML0 D;  3O13 A;  1DOL A;  1SYD A;  4ME5 A;  2XRQ D;  1KAB A;  1EY9 A;  4DAV A;  3L7Z C;  2B2Y A;  4RGT A;  1SND A;  2B2W A;  5E1F A;  2AUK A;  5BN5 A;  4LK1 C;  2OF1 A;  5CMD A;  2R93 B;  5M3M B;  1PTO H;  5CV7 A;  1HFN A;  3MC0 B;  4C3I B;  1SNQ A;  2EVB A;  1EQT A;  3KLS A;  5IGC A;  2KJX A;  3D6C A;  4TSS A;  1SYC A;  3Q24 A;  2PPB C;  1PYW D;  1CHQ D;  5C3W A;  1TR5 A;  1A15 A;  4C3I G;  1G6Z A;  2TSS A;  1ENA A;  1ESR A;  1TWC B;  2NVX B;  3H91 A;  1PLF A;  2F0V A;  1QG7 A;  2B2V A;  2IJ0 A;  1AEX A;  2XWJ B;  1GUS A;  1BCP F;  4L6T B;  3T16 A;  2WB1 B;  3NK9 A;  5D14 A;  2IX1 A;  1J9O A;  5EPL A;  3Q22 A;  1SSO A;  1S5B D;  2EJG C;  4QMG A;  2MP1 A;  5DEH A;  3V05 A;  5IOD A;  1SDF A;  1PMR A;  4FF1 A;  3FMC A;  2BA0 A;  4QIW B;  3PUW A;  4ZYS A;  4RKB A;  1H9K A;  1LTT D;  3MEH A;  1ET6 A;  3TBI B;  3OIQ A;  2AQ3 B;  5EKK A;  5DAU A;  1ROD A;  4RAU C;  5FLX E;  1ZKO A;  1QNU A;  2AUJ D;  4ILW A;  3GTM B;  3DWQ A;  2X69 A;  5C0X G;  4EQP A;  2RBM A;  1SNP A;  1CT1 D;  3ITP A;  4XYO A;  3PMF A;  5EBD A;  1B44 D;  3HOW B;  2KQ3 A;  1IYU A;  1SNC A;  2F0F A;  2F0Q A;  4FXD A;  3ERO A;  4ZKB B;  2HDL A;  3NWT A;  1O7Z A;  2N88 A;  1WTX A;  1LO5 D;  2PZU A;  2F0J A;  5KYL A;  3T53 B;  1V8Q A;  1DYQ A;  5JEA H;  3FDT A;  1JIC A;  3DWP A;  1SE2 A;  1KDC A;  2KCC A;  4A3E B;  3CQZ B;  4LAA A;  1JCK B;  1LT3 D;  4IUR A;  2XIW A;  1PXU A;  2MHV A;  1EEI D;  4WJW A;  4C3H G;  4J8Q A;  1L0Y B;  4K6L A;  2R92 B;  1KNA A;  4ABN A;  2H4O A;  4L8J A;  2EJF C;  5ISR A;  1RTO A;  2F0K A;  4A3K B;  3K5L A;  1OXS C;  3UI2 A;  1AZQ A;  3P1H A;  2KVM A;  3TP7 A;  5DNF A;  2IW3 A;  1PZJ D;  4HTH A;  3D3R A;  5BN3 A;  4K5W A;  4K8J A;  1VMP A;  4HN7 A;  4DF7 A;  3D6W A;  3VYS A;  1TQO A;  4C3J G;  1CA6 A;  3NP8 A;  1PZK D;  1IW7 C;  2EOT A;  1GUN A;  1M4V A;  2LMC B;  3W2D A;  3U9S A;  4J1M A;  1LT6 D;  2MPM A;  2L55 A;  1CK1 A;  2VB3 X;  1XXG A;  2JXM B;  2I46 A;  2O2L D;  2DY8 A;  5CBA E;  3R2T A;  5CV9 A;  1X32 A;  5JEA J;  3WOF A;  3MHB A;  4PNY A;  3OIP A;  1HUM A;  1H9J A;  1QOH A;  3VYU A;  3WOE A;  4CBV A;  4O42 A;  4CJ1 B;  3TSS A;  2A74 C;  2BE5 C;  1GUT A;  2K7V A;  1AW7 A;  5M5X B;  1O78 A;  1PRT C;  1SE3 A;  4R8N A;  3NE5 B;  2L0C A;  1EOT A;  4KKU A;  1AZP A;  1M8A A;  1ILQ A;  5JVH 3;  3PUX A;  3M3Y B;  1PFB A;  2JA7 B;  2X6L A;  4XIG S;  3GD7 A;  5F2D A;  5KGU A;  1I6H B;  1EIH A;  2PQE A;  1RCV D;  5EQ0 A;  2F0H A;  2DY7 A;  4DN4 M;  3SHL A;  2RSO A;  3M4O B;  1OXX K;  1EU3 A;  3EJI A;  4UAI A;  3H94 A;  1CQV A;  1BCP C;  4DAY A;  4IFD H;  1DOM A;  4FO2 A;  1MBY A;  2F0E A;  4LJZ C;  2JE6 I;  1JE4 A;  5FO7 B;  2E2D C;  1DD2 A;  3LNN A;  1LT5 D;  4KY7 A;  2VNU D;  3S1M B;  2CW0 C;  4MIU A;  2F0U A;  2F0I A;  2Y0S B;  1XYI A;  3MXG A;  3H3V C;  4Y7N B;  2OEO A;  5KNC A;  3A8K E;  4F7X A;  1YNN D;  1QB5 D;  2B2U A;  2M00 A;  5EBC A;  1T5E A;  2EY5 A;  4XDX A;  4X3S A;  1OXT A;  3SDZ A;  1HTP A;  1FNU A;  1JR0 D;  1D5X C;  1TII D;  1TKW B;  4E6I A;  4TQU S;  1SYF A;  4KKT A;  5TSS A;  3J7A F;  2EY2 A;  1PTO D;  1I6V C;  4N9T A;  2TMP A;  3I90 A;  1HA5 A;  3I8Z A;  2JEA I;  2KEE A;  3QO2 A;  4C1N I;  3QWN A;  1NR4 A;  5D65 A;  3NQT A;  3BDO A;  1K83 B;  1S5E D;  3GTO B;  3EVQ A;  2XVS A;  4GZY C;  3TN2 A;  1A6X A;  4DXG A;  5LL6 S;  1K8M A;  5I9P A;  2EYF A;  4MN3 A;  4HED A;  3HOU B;  1BOS A;  5I6Y A;  1EY5 A;  1LTR D;  2HCI A;  3QIA A;  4IZ8 A;  1IHZ A;  4A3G B;  2E2H B;  4KK7 A;  2K6A A;  5ELB A;  1JOQ A;  3SK4 A;  4ODG A;  5KRU A;  1SJE D;  3SK8 A;  3HOX B;  2J7Z A;  1ILP A;  1QJO A;  3NBI A;  3D31 A;  4FP5 D;  1BUV T;  3S1N B;  2R6G A;  5IGE A;  1PTO C;  3NTH A;  2EZV A;  4X3K A;  3SVM A;  1SMY D;  3MXN A;  5I9O A;  5JAV A;  3GTG B;  2BCO A;  1I3Q B;  1EYD A;  1S5C D;  1X3P A;  4QCL A;  2AWO A;  1TT2 A;  4IFD I;  3H6M A;  3CKI B;  2FIN B;  2K5D A;  1IL8 A;  3I4N B;  2F0T A;  1HRJ A;  2DNC A;  2NUC A;  1WTO A;  1VDZ A;  3I4L A;  3KBX A;  3A55 A;  1Q90 A;  2E76 C;  1I4X A;  1Q12 A;  4QUF A;  1ZXT A;  2PCF B;  5JEA G;  1CZG A;  5C6A A;  1WTQ A;  1GJX A;  2F0P A;  2WII B;  3M7N A;  3S15 B;  3S1R B;  2SEB D;  5E3F A;  4A3M B;  4MHE A;  1O80 A;  4RH6 A;  1BF4 A;  3K57 A;  4NW2 A;  4FXK C;  2IX0 A;  3GV3 A;  1ESF A;  4XT1 B;  1JWS D;  1DOK A;  1GHK A;  1IKL A;  2XRS D;  4FVM A;  1XWE A;  1LTB D;  4IUU A;  3TDQ A;  1WTR A;  4JBW A;  3HKZ B;  3EFX D;  1YNN C;  2BDN A;  5C3X A;  2FJ2 A;  2JP1 A;  1SE4 A;  4Z9C B;  3J81 E;  1CFM A;  3BYY B;  2D5D A;  2CHB D;  4FXG C;  1JOR A;  3DWA A;  3NTK A;  3HEJ A;  2B8G A;  1SJH D;  2EY6 A;  4BBR B;  1F9Q A;  3D4W A;  5C5M A;  2HQE A;  4OIK A;  1PFN A;  3SXH A;  1VF7 A;  1E2W A;  3CHB D;  2Z8L A;  4ZLT F;  2K5W A;  2PW7 A;  2CVR A;  4V0B A;  2PW5 A;  3P20 A;  4B9W A;  5D3D A;  1RD9 D;  2D62 A;  2PNR C;  3K6O A;  1SYE A;  1R4P B;  1JOO A;  3GTJ B;  3K0Y A;  4KJN A;  5C3E B;  4RA8 A;  3OWE B;  3CRK C;  3N6R A;  1BCP D;  2KOL A;  5CBE E;  4K8I A;  1KAA A;  3HOY B;  4CJ0 B;  3W3A A;  3G7L A;  5E4W C;  4WRD A;  2WKC A;  2JA8 B;  5CV6 A;  3SK6 A;  2A69 D;  3C1F A;  1Y8P B;  3S2D B;  1KNE A;  2WKD A;  3J7A V;  5FO9 B;  1G2T A;  5LL6 X;  3OMG A;  2FFK B;  5IOC A;  3QJY A;  5T1I A;  4G7H C;  3DM1 A;  1F2Z A;  4IFD J;  1STB A;  4DFA A;  3H0G B;  2B2Y C;  1BBX C;  1TS4 A;  3GQB A;  3I3C A;  3K5M A;  1NUC A;  2RDG A;  2FMC A;  2L11 A;  3FPU B;  2KEC A;  3K5O A;  1DXM A;  3K5N A;  1U4R A;  1GUO A;  2EPB A;  2L9H A;  1X3Q A;  3U9O A;  4DNT B;  2FHT A;  3IAY A;  2NVY B;  2OT2 A;  2BA1 A;  4IUP A;  2VB2 X;  5ELE A;  2X6G A;  3URY A;  3T56 B;  1LTG D;  4C3H B;  1HA6 A;  3OHX C;  2JSO A;  3TP5 A;  4IAL A;  3VR4 A;  4H13 C;  5C4Z A;  1STE A;  1A2U A;  3LWU A;  2EYL A;  1MI2 A;  1I4R A;  4BY1 B;  5CV4 A;  1EY0 A;  3NPP A;  2PZW A;  4KHV A;  3HGB A;  3OPO A;  5IGG A;  3P7J A;  3VR5 A;  3Q0A A;  3MTS A;  4FYD A;  1ENF A;  2B2U C;  4FF2 A;  1B9N A;  2NN6 G;  4X3T A;  4ZUJ A;  3C1E A;  2ZXP A;  3KUP A;  4DU9 A;  1BDO A;  2H1E A;  3K58 A;  1KTK A;  3FRP B;  4DAP A;  5K36 H;  4BY7 B;  1TS5 A;  3KF8 A;  3LX0 A;  1I4H A;  3NUC A;  1Q3L A;  2RSN A;  5JVG 3;  4UDU C;  2C9O A;  5M5Y B;  2AQ1 B;  1H9M A;  4FNF A;  3DEP A;  3GTK B;  4XQJ A;  4YIJ A;  2SNS A;  1ZYR D;  1EIG A;  3MVV A;  3V96 A;  2AWN A;  2YYZ A;  1WTP A;  2XWB B;  3ZYY X;  3GTL B;  3V2T A;  3DMU A;  1IW7 D;  4PV1 C;  2EYO A;  2G9H D;  2F3V A;  3I73 A;  4CKE A;  1EZ6 A;  1KLU D;  4PQX A;  2JYO A;  1FD7 D;  4A3D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...