5CR3A

Crystal structure of staphylococcal nuclease variant delta+phs v104e/l125e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIAAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLERKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V104E/L125E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cr3A00
3SK6A 5CV6A 3NQTA 4KTAA 2F0KA 4KD4A 3BDLA 5CR3A 5HURA 1A3TA 1NUCA 4ZUIA 3U9OA 3VA5A 5IGEA 1SNMA 5C3XA 4N9TA 4YIJA 2F0QA 1AEXA 3ERQA 4ID6A 5C4ZA 1EQVA 3EROA 3C1FA 5E1FA 2PW7A 1EY5A 2F0IA 1A2UA 3BDCA 3NUCA 4HMJA 4ZQ3A 5E3FA 3RUZA 3SHLA 4EVOA 1SYCA 2F0DA 4N9PA 1SNOA 5M9OA 5CV5A 5KEEA 3ITPA 1F2YA 5CV7A 5K5PA 2F0FA 4H7BA 3MVVA 4TRDA 1KABA 4EQOA 4R8NA 5EKLA 3V2TA 1SYDA 2OEOA 4RKLA 4EQPA 5I9PA 1ENAA 4RKBA 5IGGA 5EGTA 1KDCA 1TT2A 1TQOA 2SNMA 1SNDA 4HMIA 4KJOA 3MZ5A 5KRUA 1A3VA 1EYAA 2QDBA 2PYKA 4QB4A 4PNYA 5NUCA 2F0UA 2F0SA 2SOBA 3S9WA 2F0TA 4DFAA 2EY5A 3R3OA 2KQ3A 1F2MA 1STYA 2EY6A 3QOLA 2EYJA 4IALA 4IUNA 4ME5A 3DHQA 1EY9A 5F2DA 3SR1A 3H6MA 4KY6A 1STHA 3DMUA 4EQNA 5IGFA 3T16A 4E6IA 4WORA 5CV8A 2RKSA 4ZUJA 5HGTA 5IGCA 1JOQA 5JOBA 4KY7A 2F3WA 1A3UA 1JOKA 2EYHA 3D4DA 4IZ8A 1EY6A 4K2LA 2ENBA 3SXHA 2EYPA 4DF7A 5I9OA 5J22A 1A2TA 2KHSA 5C3WA 5C5LA 1II3A 4I65A 3P1HA 5ISRA 3T13A 1JOOA 4QF4A 4NKLA 4LAAA 5C6AA 1EYDA 5JAVA 2EYMA 1EY8A 3PMFA 4MIUA 4K14A 2PZUA 5KIXA 5KGUA 5EKKA 4G57A 4B9WA 1NSNS 5KYLA 3OSOA 5DEHA 4KD3A 4NP5A 1EYCA 3OMGA 1ENCA 3NXWA 1EY4A 4OL7A 2OXPA 4PMCA 5J1ZA 1STNA 2RDFA 1SNQA 5CGKA 1SNPA 2EY1A 1JORA 1SYBA 2O4XA 1IHZA 3EJIA 5C5MA 2EXZA 2F0OA 3SK5A 2EY2A 1SYFA 2NUCA 3HEJA 3LX0A 5I6WA 4QMGA 4B9XA 1KDAA 3D4WA 2F0MA 2F0LA 2F0HA 1SYGA 3E5SA 2PZTA 2F0GA 4KJNA 2EYOA 3NP8A 4S3SA 2M00A 2EYLA 3QOJA 4ODGA 1EZ8A 4K5VA 1EY7A 5IGBA 1KDBA 3NHHA 1TR5A 4DGZA 5IIFA 2F0JA 3D8GA 4NMZA 2PZWA 3TMEA 1EY0A 4WRDA 2F0EA 4F8MA 2PQEA 3EVQA 5J39A 5I6YA 4KV6A 4J6HA 5CC4A 2PW5A 3SK8A 3TP6A 1SNCA 4K8JA 1F2ZA 4HTHA 4DU9A 4K5XA 2F0PA 5C4HA 4K6DA 5IODA 1KAAA 3QB3A 1U9RA 3NK9A 4K2KA 5DAUA 2SNSA 1STAA 1SYEA 2LKVA 3MEHA 3MXPA 3HZXA 3D6CA 3P75A 1STBA 5CV4A 3TP5A 2WACA 3C1EA 3SK4A 4KY5A 4PMBA 1EZ6A 3MHBA 3TP8A 4J1MA 2RBMA 5CV9A 4KHVA 1STGA 5IGDA 2F3VA 4K5WA 5IOCA 1RKNA 5KYIA 2EYFA 4NDXA 3TP7A 2OF1A 2F0WA 3OMCA 3OWFA 2HQEA 4K8IA 4F7XA 2F0NA 2F0VA
chains in the Genus database with same CATH superfamily
1WVLA 3U4ZA 5DM63 3L9AX 3VA5A 3PGZA 1I6VC 1NTGA 4DV0Q 4DV3Q 1L1OC 5G3LF 4IPGA 5IYCG 1V1PB 3RLOA 1B3QA 2Q2HA 1Q81C 1A63A 4ABNA 3OW7A 3LWEA 1PH9A 1PFSA 1B3AA 4FF4A 2YTVA 2KEEA 1QZHA 2XWBB 3DWQA 1YZ6A 5KRUA 4A3MB 1ZXTA 4JI1Q 3BYYB 5D3DA 1WTVA 3KUPA 3I4OA 1YNXA 1HJPA 2UU9Q 4JI2L 1QUQA 4QUCA 1EYGA 2RKSA 4ZUJA 1N34Q 1OTCA 2QDLA 1X32A 1A3UA 1JOKA 1FGUA 5EBCA 4YHHL 2AKWB 4A3DG 4WJWA 2VL6A 2IHEA 1II3A 2EVBA 2NVXB 2C35B 3HRZC 1YI2A 4J15A 2CWAA 1EUJA 1M90C 5IWAQ 2J7ZA 3Q8DA 2QEXA 4IFDH 2NVTB 3PO2H 4BBSB 1UEAB 2B2YA 5DEHA 5C3EG 5FLXE 3NXWA 1EY4A 1QG7A 4PMCA 4DAMA 2EOTA 3M3YH 2O4XA 2XWJB 1XTCD 2F0OA 2FHTA 4CJ2C 1TS2A 1BOSA 4RMFA 2A74C 4WJ4A 4DR3L 1F9QA 3RD4A 4TSSA 4GNXA 3QOJA 3J81L 3W3AA 2KEDA 4H44C 4I7ZC 3PO3H 2ES2A 1X65A 2MQHA 2ZM6Q 4JV5L 2D0PA 3MA2B 1IKLA 3S1MB 1F2ZA 2B2TC 3J80i 4LF4L 1KQSA 2EIFA 3NBIA 4G4KA 3TP5A 3MXPA 3P75A 2E2HH 2WACA 5BN5A 5LMNL 3LNNA 1DGSA 1S4ZA 3SVMA 1BNZA 2TMPA 1KNEA 2JA7H 1A0IA 4JI3Q 4BBRG 4MTNA 1QE6A 5EPKA 1LTSD 1N36L 1KTKA 4X62Q 4BS9A 1VQNA 4DPGA 2ID0A 3CC4A 1KHIA 2E2JB 1A3TA 4A93H 3JC66 3UI2A 4U673 1MSHA 5C4XH 4ZQ3A 3CCMA 1SLJA 2G9DA 1GO3E 5C0XG 3GTLH 4DV5L 2C9OA 2CQOA 5M3FB 1X3EA 1IYVA 1KDCA 5IP7G 3CCVA 2F52A 3P20A 5NUCA 2DNEA 3PUYA 1U5KA 1XX8A 2K5WA 4GKJL 4A3FG 1K8MA 3DHQA 1F9RA 5IT9L 2E5LQ 1BCPF 4HEDA 3QR8A 3HOXG 5M5WB 2OT2A 4X65L 1AE3A 2RDGA 4DV7L 2R61A 2JA5G 1XWEA 4F88A 3SXHA 3K59A 4JI3L 2EYPA 2KHSA 3CP0A 3FKIB 3PIOA 1YJWA 2K32A 4L5SA 4C2MB 5I2YA 4R4TA 3C3LA 1EY8A 3JAMc 1TWCB 1XMQQ 1S72A 3FPPA 1JCKB 4OONA 4NXNL 3FKIG 2KBNA 4IO9A 3WWVA 1FGBD 1STNA 1TWHB 2EY1A 4CHTB 2WP8J 4DV5Q 1CFMA 1X9NA 3TS2A 1I4RA 5EPJA 3FRPB 3VR2A 3WDNA 4DR3Q 3HGBA 5IP9G 1B2TA 3N6RA 4I7AA 1SFOH 2PQEA 3J7A5 4A3IH 1SMYC 5J39A 1D2BA 3SK8A 3NTHA 4A3KG 2B2UA 3J80c 2F0PA 2DGYA 1BCPD 3NK9A 5AJ3Q 4A3GH 3OPOA 5GROA 3CCSA 3H94A 1D8LA 1ZYRC 3B6YA 2UUBL 1FYCA 1Q86C 3HKZB 5IYDH 3K5NA 1EZ6A 1LTBD 1IBMQ 2Y0SB 4KHVA 4OGQC 1JJCB 5KYIA 3I73A 3G6EA 2R7ZH 2F0WA 5T1IA 1Z9FA 4UHVA 3CW2C 4JI6L 3E9HA 1YJ9A 1N36Q 5FLMH 5K36G 2QGQA 1VQDA 4DKAC 4B3SQ 1Q1BA 5LL6S 1LTTD 4RFBA 4A4IA 5GQOA 3NUCA 3I4NB 1NR4A 3Q23A 1QVFA 4ME3A 2O2LD 1WJJA 3KLSA 5FO8B 4R8IA 3V2TA 4MHEA 1LT5D 1TKWB 3UE1A 3U50C 4DV7Q 1CQFA 3KBGA 4KJOA 5J3BA 3M4QA 2ZTDA 1GKHA 3I4MG 1GJXA 4GNXC 1K8OA 3I4MH 2F0UA 3R3OA 1BUVT 3HOYG 4IALA 1X3QA 1LACA 1WOCA 4R9WA 1RL2A 3CQZB 3A8JE 3T56B 5LL6X 2YU9H 1L0WA 5IP7H 4XT1B 4LUOA 1SE3A 2MJ8A 4HJAA 1CKOA 4L5QA 4JYAQ 3P1HA 1HNZL 4BBSG 1JOOA 2VB2X 1OXUA 3HOWB 2KCMA 2BE5C 4PQXA 2PZUA 5EKKA 5KYLA 1ONLA 2JA6H 1IZ6A 3FMCA 1LLRD 1XJVA 1HA6A 1WTPA 1KAWA 1B9MA 4P72A 3CHBD 3MXNB 1A6XA 4X62L 5C5MA 3CKIB 3D4WA 3E5SA 3A7AB 2PZTA 4FF2A 2K6AA 2EYLA 1I3QH 2B63G 5A2QE 1KL9A 3RZOB 3I72A 4BY7B 3K6OA 1JJGA 4FXKC 4B3RL 4LF4Q 5GAEC 1HTLD 1OXVA 4J6HA 1BBWA 4RCOA 2ZM6L 5IODA 4K2KA 1N9WA 3S2HH 1SDFA 1PFBA 3GTOH 3MHBA 2ICIA 4C56C 1L0XB 2RHQB 4Y7NH 1RKNA 3GTKH 4A3EH 1Y1WG 4MNOA 4A3LG 4F7XA 3HP3A 2PPBC 5CGKA 3S1RB 1I6HH 1XMOL 4FYDA 2KHIA 4LF8Q 1PTOB 5CR3A 3TS0A 1QVCA 2K1BA 2CHBD 2L4NA 2IPKD 2MPMA 4YCUA 1CSQA 4JI8Q 4C3HB 3ERSX 3N52A 1Y1VH 1TU2B 5JVG3 1AZPA 4LFCL 4L63B 5IWAL 1HNZQ 1ASZA 1LTLA 1WYDA 1ESRA 3MC0B 3ER0A 4H7BA 1Q82C 1I4PA 1VQMA 2YTXA 2UXDL 2B2VC 1DXMA 1SNDA 1EYAA 1PTOC 2K04A 1O80A 1ESFA 2N55A 1Q1EA 5F2DA 3SR1A 1SRUA 1EY9A 2FXQA 5FJ8G 2AUJD 4CKCA 4OHJA 1QCBD 3T1YL 4BXXH 2K5VA 1CKMA 5JJZA 5J22A 4RWSC 4U68A 3J80L 4DR1Q 2LXKA 2UXBQ 2SDFA 5C5LA 4DUZL 3GTGB 1M4VA 3PO2B 1I50H 3VYSA 4M8AA 4DK0A 2A8VA 2KENA 3EFXD 2A6ED 4K14A 2N49A 3HOWG 4B3SL 1CK1A 1EOTA 4JG2A 2NVXH 4NP5A 1G91A 1EEID 5J1ZA 3CC2A 1IYUA 1HZCA 1HQMC 2VZAA 2F0LA 4DV4L 1L0YB 1HR0W 1PYWD 4LF9L 5IGBA 1HNWQ 4KHPQ 2EXDA 1C0AA 2B2YC 3A5ZB 3VYTA 1R9TB 3DM1A 5CC4A 2LXJA 4A3GG 1V8QA 4HCEA 2SNSA 5IYDG 2B63H 2Z4HA 1UEBA 1HZAA 4JI5Q 1K83B 1KIXA 4KY5A 2A68D 5CBAE 1LO5D 2FFKB 2AHOB 2D0OA 2HQLA 2DY8A 2D5DA 2OF1A 3LWUA 3ULJA 1SEBD 3OHXC 3OWFA 4DNRB 3F2BA 1YNJC 3RZDH 2K5QA 3CPWA 1F2LA 1PDQA 3NTIA 3SEBA 1CKNA 4KD4A 3BDLA 1IL8A 5C3XA 2R92B 5DNFA 5C4ZA 4XIGS 3GTOB 1YITA 2NBFA 4JI4Q 3S2HB 4IOAA 4CDEC 4HMJA 3PO2G 2ZJQA 1RIPA 1D1IA 1B7YB 1DOKA 2V1CC 1VQPA 4BBRB 3E0JA 1OXTA 2LMCB 4CGYB 4EQOA 4HIDA 3VR6A 4ZLTF 1G6PA 4PZ6A 4QIWB 3G71A 4EQ5A 2E5LL 1O7ZA 4A76A 1LABA 1I3QB 3S9WA 2JEAI 2FINB 1STYA 3QOLA 2A73B 4IUPA 2NZOA 3PCOB 4AQYQ 2BH2A 2ICEC 3MFYA 4IOCA 4LUVA 5JOBA 5LMUQ 3FHWA 4V0BA 1VQ7A 4K2LA 2WIIB 1DYQA 1L1OA 4C3HG 4HJ7A 1E0BA 1YNJD 1P16A 1YVCA 4DR7Q 2B2WA 4LF8L 2HDLA 3DXJC 1B53A 5C3EB 3HOXH 4LFBL 1LTAD 1TS5A 4RGMA 3TN2A 4DK1A 2RHSB 2Z6KC 2CVRA 4CJ0B 3A8KE 1S3OA 1CHPD 2EY2A 3LX0A 1D7QA 4A3EB 1E2VA 3UDXA 1JWUD 1S5CD 2R93H 4KJNA 1YHBA 2H4OA 2M00A 5FLMG 4X3TA 2F0JA 4NMZA 1J9OA 1K9MC 5IYBH 4F8MA 1WI5A 2JA8B 3PUXA 1G2TA 5E7NA 3X3MA 4A3KB 5IP9H 4OIJA 4CJ1B 4B08A 3T1HL 4DAYA 2H1EA 3CCEA 1I4GA 1Q90A 1VQLA 5I2XA 4BY7H 3SK4A 1Q8KA 1U0LA 3FVQA 4YY3L 1EL0A 1UE1A 5IOCA 3TEHB 1AW7A 5EBDA 5BR8L 4LMQD 2AWOA 4X64Q 2RVLA 3U4VA 4HN7A 3Q22A 1B4OA 4YWKA 2Q8RE 5M3MB 1TIID 3GTPB 2K05A 4BY1B 1UE5A 4X66L 1CTMA 4HSPA 1PA6A 1E24A 1VQ4A 4P71A 2EPBA 4O0AA 1TWAH 1DM0B 3MVVA 1WFQA 3IFDA 4R8NA 4XXEA 4R4QA 1N34L 1PH6A 5LMUL 1TQOA 2BDOA 4HMIA 2KCCA 3FP9A 3CQZH 2K52A 1K3RA 2EDGA 4O1NA 4ULLA 1VQOA 2Y0SE 1CT1D 2F1MA 5EPLA 2MHVA 4ME5A 3M7GA 1W2BA 4LF9Q 4RG1A 1XNQL 5JPNC 4YCWA 2EYHA 1BF4A 2NTTA 2F03A 3M4OH 1QVGA 4LFCQ 3VA7A 1VQCA 1SXTA 3QG1A 3V05A 1RDPD 4QF4A 1LT4D 4LAAA 5C6AA 2N88A 2VNUD 3M85A 3I4NH 3DEPA 5FK9C 4DV3L 1XPOA 4KN7C 2NN6G 3S14H 3GTPH 4Q5VA 1FL0A 4OEMB 4KKTA 4RGOS 4DNTB 3ND8A 1SYBA 1H9SA 2J0TD 2EXZA 3BS1A 1IW7C 5IT9E 2C5CA 2F0MA 1G2SA 2EJGC 1ILQA 3G7LA 3VYUA 4R4IA 1BO0A 4BY1H 2IL8A 5C4XG 2F4IA 3S17B 3IRBA 3M4YA 1M8AA 2DY7A 2XRQD 2KVMA 3BG3A 4B3RQ 2DNCA 3TBIB 1KC8C 5COYA 1IXRA 3TP6A 1B8AA 2HT1A 2NZHA 3I3CA 1UNSA 3K0YA 5KNDA 1NJIC 2YYZA 4P73A 2JSOA 1FJGQ 4MTKA 3H3VH 1HRJA 1SYEA 1VQAA 2VXWA 1YBYA 5CV4A 4DA2A 2UUAL 4RH6A 4FVMA 5EQ0A 1QJOA 4J1MA 4G7HC 4A3KH 1BR9A 1FJGL 4JK1C 2UUCQ 1A62A 4AYBE 5C0XJ 3KLSX 2Q2IA 3WOFA 4JPBW 2HQEA 1DCZA 4GZYC 2SEBD 2F0VA 2F0KA 4P74A 4XYQA 4DNIA 2L11A 4Y52H 2JA7B 3KF6B 2GA4B 3R8BA 2Z8LA 3K7AH 2KECA 1VQIA 5ELBA 3EROA 4IURA 1JB7A 1VQ5A 2R93B 1TWCH 4RCNA 1EU4A 3HOXB 2JE6I 1I94L 5KNBA 4OWWB 2VQFL 2D2CC 4NXML 3OOCA 3R93A 1DZ1A 3FKIH 3CF5A 2JA6G 2IX1A 1T5EA 1QNUA 2I07B 3FEWX 4RKLA 4EQPA 1I94Q 4RKBA 5IGGA 5EGTA 1ASYA 3UE0A 1Q12A 3MZ5A 3GTJB 4C3IG 5M5WH 1BBUA 4GOPB 1GD7A 4FP5D 4IUNA 4KN4C 3KBXA 5IGFA 3TZUA 1GOZA 3VR5A 4WORA 5CV8A 5FKAC 2UXBL 3OWEB 2B2TA 2L5TA 2UUCL 1VS0A 1XNQQ 2B29A 1BVSA 3K80C 5HY6A 5TSSA 4NKLA 5JPMC 3K81C 2E2IH 2K01A 2VUMG 2B2WC 5KGUA 2EJFC 3Q24A 1ICWA 5IE8A 4DV6Q 4A93B 1XNRL 4JYAL 4BBRH 4MN3A 2ZXOA 1SNQA 1XMOQ 2I46A 5I6WA 3RZDB 2XRSD 2B8FA 2O5JC 1FNWA 1H9RA 5JJKA 1WTXA 4X66Q 3H15A 4S3SA 3K5LA 4A3JH 4G7OC 1X3PA 2XIWA 4B3TQ 5G3LD 2Z4IA 2R92G 2E2HB 1Y1VG 1D5XC 3TMEA 4WRDA 2M2LA 1X54A 4LF6L 1I4XA 1N32L 1S5FD 5I6YA 4POGA 4R4CA 3S1MH 4HTHA 2GN5A 3A56A 4UDUC 3HOVG 1IBKQ 1YHAA 1SMXA 3C1EA 4C1NI 1SBBB 3NEMA 3ULLA 1GHKA 4C3JB 4H13C 3CCJA 1V1PA 2D62A 2UUAQ 4KK7A 1ILPA 3U9SA 3CD6A 2E76C 1EQRA 1TVXA 4NXNQ 3KF6A 5CV6A 1DOLA 3M7NA 3MXUA 4QQBX 3BZKA 1A8VA 1LTID 3TREA 4A3DB 4ID6A 4BBSH 4FF1A 3C1FA 1VQGA 5BN3A 4DR7L 3A8IE 3BDCA 1A2UA 1YIJA 2WV6D 1PRTD 3EN2A 1XPUA 5E4WC 3I4NG 3GTGH 1GUWA 3ITPA 1F2YA 4EGVA 4CDDC 4DR2L 1C48A 3PIPA 1LV9A 1JQYD 1B9NA 3I91A 1PH2A 4GKJQ 1GUNA 2WB1G 3GV6A 3QIAA 4PNYA 2ZJPA 2F0TA 1PRTC 4GN4B 5I4DA 1VCIA 3DMUA 4DV2L 2F3WA 3K57A 3G6JB 1CQVA 1SAPA 5I9OA 1SE8A 3ULPA 1HZ9A 3L0OA 3PV0A 4C1NK 4UP8A 4I65A 3VR3A 1Q7YC 3MAQA 2DJGC 3S16B 4CDCC 2A69D 1JE4A 2X69A 2EYMA 1IBLL 1G6ZA 1QILA 3GTJH 1EQQA 5KIXA 2F4VL 4JVZA 4G57A 1NSNS 1NMFA 2JXMB 4UAIA 1TS3A 1DONA 4RGTA 4P75A 1HR0Q 1ICFB 2HCCA 1Y1WB 2JQOA 3AQQA 2WKCA 3GTQH 2F0HA 3PUZA 2QCPX 2F0GA 2HHHL 2HCIA 2X6LA 4JI5L 3A5UA 1HZBA 1QWYA 3I8ZA 2EE1A 2KJXA 5CBEE 2LS01 1HQRD 3PUWA 3S1RH 2K28A 1R4PB 1PRTB 1QB5D 3AYHB 4Y7NB 2XTIA 1WTHA 2FMMA 2IWHA 3PF4A 2BDNA 1F77A 3DEOA 4XTCS 1STBA 2E2IB 1VMPA 4LWCA 1B44D 3RLNA 1JE5A 4GLAC 1HUMA 1RF2D 3TQYA 2BE5D 1LT3D 3HOZG 5AFWA 3STBC 1HNXL 2B8GA 3HOUG 5K5PA 2RQXA 1VMCA 3LGJA 5IGEA 4NB3A 1C9OA 1NCVA 1T9HA 1XMQL 3RMHA 2HHHQ 2XVSA 3RUZA 5T1GA 4LNQA 3HOWH 1SNOA 5KEEA 4JOIC 1MI2A 1Y8NB 5HGQA 4JI7L 4R4OA 4JV5Q 1I4QA 2CH4W 4JI4L 5A2QL 2PYKA 4YCVA 5DLQE 5CYUA 2BA0A 3SE0A 2MGSA 2IW3A 2ZJRA 1HUNA 3TSSA 3D31A 1C8CA 1E3PA 3U58A 1F9SA 3K7AB 3I4MB 2KUMA 4AIMA 4UPAA 3S1NH 4LFBQ 3MWYW 5HGTA 4DR6Q 1EY6A 2IY5B 4CKEA 1H9KA 1MSGA 4P2CB 5M3FG 1AFPA 3NWTA 1CI3M 4DV2Q 2Q8IB 1TS4A 1PFMA 2KA7A 2ATWA 5C0XI 3CPFA 1Z6HA 1MJCA 3EIVA 2D9UA 2ASBA 5M5XB 4OX9L 2JN4A 1LTRD 4LFAL 4A3EG 1UUPA 2RDFA 1JORA 3EJIA 2L12A 1SYFA 4HAEA 3S17H 1K3BC 1IL2A 2JA7G 1EZ8A 4K5VA 1PH3A 3H91A 4JI2Q 3TDQA 1HPCA 4A3LH 1Z47A 3AEVA 2F0EA 2VQEQ 2J4XA 4JC0A 1CUKA 3HOVH 5IY0A 2JEBI 5C4HA 1L1OB 2IT1A 3VR4A 1U9RA 4QUFA 4HJ9A 5M5XH 2MO0A 1SFOB 1KRTA 4A3IG 2HUGA 1PV4A 5IYBG 1PRTF 3HKZG 3TP8A 2IHFA 3H09A 3DUZA 3J80E 3M4OB 2K5NA 1PVOA 4A3IB 4GN5A 1JMCA 3H0GG 4V190 3CCRA 4A3MG 4ZUIA 3U9OA 2GVAA 2F0QA 3T51B 5JEAG 1BDOA 1EQVA 1K28A 4DK6C 1EY5A 2F0IA 1QUQB 1EOVA 4DAVA 5JVH3 3I7FA 4KMUC 1EU3A 1SMYD 5CV5A 1WD0A 5CV7A 1WTOA 3CCLA 2K7VA 4IPHA 2EJMA 1TWAB 3P7JA 1SJED 3A7LA 1XXGA 3X3NA 3W2DA 2HIXA 3RLFA 5C3EH 2QA4A 1UE7A 2EY5A 1AE2A 2EY6A 1XYIA 2UU9L 3I4LA 2Z9HA 2YV5A 4LW1A 3H6MA 4KY6A 1X6OA 4JBJA 5C4JH 4KKUA 1HCZA 2WB1E 2A6HD 1U4MA 5M3FH 4CDFC 4DR6L 3AMUA 4A75A 3KDFB 3DWPA 5JJLA 2OQKA 1W6JA 3HG9A 2LSSA 5C44B 4X3KA 5ISRA 4CBVA 3CU7A 1PMRA 3W1BA 2JA9A 4DR4Q 1BXTA 3BVZA 2AUKA 2IX3A 3BYTB 1HFNA 4J8QA 4DV0L 2E74C 3Q0AA 4JI6Q 4DR4L 3S15H 4ZKCB 1X3GA 2K33A 2E2JH 1O78A 3NENA 1SE2A 4YWMA 1PH4A 4B9XA 2VQFQ 1NAPA 4XDXA 4JBKA 4O42A 4RA8A 2PQAB 4QL5A 1N33L 3NP8A 1Z7TA 1S5BD 1EWCA 3NHHA 1G51A 1YJNA 3I56A 4ALPA 2L0CA 2RF4A 1XPRA 1Y1WH 2R7FA 1J5EL 4A93G 1HTPA 1N8RC 5K36H 1VQ6A 1KLGD 3BZCA 1J5EQ 1UWVA 1TY2A 2H5XA 1PZJD 3HOUB 4POFA 1NE3A 1LT6D 2UUBQ 2RBMA 4MZ9A 3PO3G 5IGDA 5AJ3L 1Y14B 4FXGC 2JA8G 1RTOA 3I70A 3IKJA 3OMCA 4KI0A 1ML0D 3EVQA 3F2CA 4XQJA 4OX9Q 3GP7A 2CW0C 1ENFA 3KJPA 3I90A 1AEXA 3AFQA 3G4SA 3UDGA 5C44G 4GN3B 5E1FA 2NVTH 1OXSC 3GDEA 4KHZA 1PH5A 1KD1C 4N9PA 3O13A 4JW0A 2ZTCA 3KFUA 2F0FA 2Y0SG 3ONAB 1HR0L 3DWAA 3OTOQ 2RCNA 1ZEQX 4TRDA 1XTDA 5I9PA 2VQEL 3A74A 1LTGD 2JK8A 5M5YB 4RAUC 4DR5L 2G5DA 3H3VC 5JJIA 5JEAJ 2QKIC 1GUTA 4A3DH 2O5IC 3MTSA 3D6WA 3QWNA 4AYBB 2RSOA 2JA5B 3CRKC 1GXDC 5C0XH 4IZ8A 2MFIA 2A5HA 3IL8A 3KYHC 3PUVA 5KNCA 2NB0A 4X65Q 5C3WA 2WKDA 3C2PA 4UP7A 2BA1A 2QF7A 1IBML 2PO4A 1AH9A 1JR0D 4Z9CB 3CRLC 1K83H 5H1SE 4K0KQ 4A3MH 4A3FH 1KLUD 1HFGA 1LM0A 2A68C 2EQSA 3CXCA 4DV1Q 4LJZC 3OMGA 1HNXQ 1VF7A 2RSNA 4ZK9B 1BCPC 2HD3A 3ZJYC 4DR2Q 1O7YA 2NUCA 2NVYH 1PXUA 4WFN3 1G291 4GS3A 1SYGA 1GHJA 3A54A 4B3ML 4A3JB 1EY7A 1FVIA 3GD7A 5GAHC 4HJ8A 5A35A 2K4KA 5JEAH 3BDOA 4KKSA 1GUOA 4JI7Q 5FOBB 5LHY1 4O2DA 4FF3A 3URYA 4HIKA 5LMNQ 1L2FA 3HKZE 2AQ3B 3KF8B 3J81i 1TWGB 2CW0D 3VDYA 1I50B 4BA2I 2F3VA 2EYFA 3TP7A 5BN4A 3GTMB 4PG3A 3T53B 2Q8TA 3NBHB 2KOLA 1JT8A 4OIKA 1G8ZD 2DJFC 4L8JA 2BH8A 4N8X1 4G7ZC 1ZKOA 4IPDA 4HSVA 2PMZB 3NWSA 2WAQB 5L37A 1WCMG 1SYCA 1PFNA 2F0DA 3M9BA 2N78A 2IX0A 1K0RA 1SYDA 1SSOA 3GV3A 1CA6A 1ENAA 3AFPA 1D6EC 2R3ZA 1TT2A 1CM9A 1U4LA 3NTKA 1OO9B 4QB4A 2K5HA 4GNXB 3E0EA 4IQZA 1IW7D 2NN6H 4K6DA 2KQ3A 1F2MA 4DFAA 4X6AH 3L7ZC 3T16A 4X3SA 4E6IA 1K0SA 4YHHQ 1H9JA 1PTOH 3SGIA 2YU9B 1MBYA 2I0QA 4HJ5A 3F8TA 2VB3X 5CORA 2A6EC 1RODA 4DK3C 3HOYB 3K7UC 5JAVA 3HKSA 3A0JA 3HOYH 4K6LA 2VUMB 4A3BH 1IBLQ 1VF5C 1ENCA 3F2UA 4RHSA 4IFDJ 3BJUA 1W3SA 1C7YA 1IHZA 2L15A 3SK5A 2CFMA 2I5HA 2PNHA 4X3UA 3ND9A 3RZOH 1PTOD 2EYOA 2WFWA 2Z6BA 3J7AV 5FLXc 4ODGA 2OTLA 2PI2A 2CQAA 1EY0A 1DOMA 2I5MX 1PYBA 4AH6A 3K0XA 4UY8C 3CMAA 2R7ZB 1NY4A 2HDMA 4DU9A 4K5XA 1KAAA 5DAUA 4EX5A 3NBHA 3S14B 2FJ2A 3RR5A 3UDFA 1FD7D 5FO9B 2WAQE 4PMBA 4HIMA 3S1QH 1CSPA 5GADC 2XN9C 4DXGA 3F1ZA 2N8NA 1MJEA 3KF8A 1IBKL 2F3IA 5FLXL 1T5XD 4ZAIA 4DV6L 4K8IA 2CH4A 3SDZA 4LF5Q 2OTJA 3GTMH 1JOQA 5ELDA 3NQTA 4KTAA 5ELFA 3NSWA 3GO5A 4JI0L 1EIGA 4LK1C 2VW9A 2OCEA 3KK7A 3Q6SA 2RCFA 4JI1L 4B3TL 4EVOA 4C3IB 4FXDA 4H02A 2BCOA 1O7IA 2QEJC 1TWHH 3J7AF 4IUTA 1LUZA 4OO1H 4NXMQ 2OEOA 4TQUS 3S2DB 4KLKA 2R6GA 1A3VA 2F0SA 2NWGA 4A3CG 2EYJA 4APVA 4YWLA 4ZYSA 5IGCA 4DF7A 2ENBA 3WOEA 2PI2E 3I55A 3E9IA 1WTRA 1Q3LA 1NNXA 2RDHA 3MEFA 4FDBA 3OYYA 2B2VA 1PLFA 2AQ1B 4A3FB 3PMFA 4JI0Q 2XSCA 3KLRA 2E2DC 5IT9c 3K8AA 5CMDA 3R2TA 3L3OC 3E6ZX 2NZ1D 2LFNA 2OXPA 1Q8IA 3HOZH 2P5ZX 4JCVE 2JA8H 1KRSA 2BOSA 1K73C 3JAME 1MD2D 5IYCH 1EFWA 1HA5A 4DAPA 1B70B 1RHPA 4BY7G 3K5OA 3D0FA 2ZXRA 3H3VI 2NVQH 4Q0FA 5D65A 3IFTA 1PH8A 1TWGH 2M9VA 5IIFA 2AQ2B 5M5YH 2Z1CA 1B1ZA 2PZWA 3RNUA 1RJTA 2KCNA 3J7ZC 3DLLA 5M3MG 3K5MA 2IJ0A 4DUYQ 1NBWA 4LF6Q 1N32Q 1CKNB 3KOJA 3RN5A 2OWOA 4LF7Q 2R93G 3NQIA 3TRZA 1JWMD 1MHWC 3BVMA 4BA1I 1JICA 4RHRA 3T1HQ 2ZXPA 4LF7L 4ZRZA 4BY1G 2A69C 4NDXA 2MUYA 1E7ZA 1TWFH 1PH1A 2F0NA 2X6GA 4LFAQ 1WCMB 4A3BG 5HURA 1H95A 4LF5L 2ALYB 1NUCA 3ZYYX 4L5RC 1ET6A 1SNMA 4YIJA 4C3JH 1EWIA 1BBXC 3M4PA 2PW7A 1Y8PB 2MNAA 1J6QA 5E3FA 4GOPA 1CHQD 4AYBG 3EBEA 1NMGA 3HS0C 1GUGA 2NYZD 2PCFB 4M1UB 1HHVA 3GTLB 2PQAA 1YNNC 3F2DA 1EIHA 1YNND 3BZDB 1BCPB 4PZ7A 2AMCB 2JA5H 1RCVD 4HIOA 2TSSA 2L55A 5C4XB 1EWHA 4BXXG 1Q46A 4IUVA 1VQEA 3MFGA 2SOBA 3AU7A 1X3FA 5D14A 1PTOF 1V1QA 4R1JA 3HFZB 1I5FA 1E2ZA 3J81c 1WTWA 4X64L 1H9MA 1A2TA 5BR8Q 3S15B 5EJWA 4AQYL 2VS1A 3PF5A 2UXCQ 4QY7A 4OO1I 1FNUA 1SR3A 1JC7A 1STEA 1EYDA 2B2UC 3CAMA 2FMCA 4OXPA 1HH2P 4B9WA 2B63B 3NPPA 3OSOA 4GOPC 5C44H 1S40A 4ZKBB 1EQTA 4C3JG 4OL7A 3C46A 2ZTEA 2MP1A 1D5ZC 1WCMH 3D3RA 3NELA 5EKIA 1V1OA 1R9TH 1IKMA 1H9SB 1VQHA 4GKKQ 1DJRD 2Q2TA 3PO3B 3V96A 3QJYA 4GLVB 4DGZA 1PH7A 1UE6A 1SJHD 3HOUH 3ICEA 1SN8A 1CZWA 1TWFB 2VY3A 4KV6A 3M3YB 4K8JA 4PMWA 2G9HD 2E8GA 4JOIA 3QB3A 3OW2A 4ZCKA 1K8AC 2I5LX 2R7ZG 3MEHA 2LKVA 1TY0A 3HZXA 3D6CA 1IYJB 4YY3Q 4NPSA 5CV9A 1STGA 4IUUA 1ET9A 2NVQB 3E3XA 4XQQA 1RD9D 2WAQG 1U4RA 1VQKA 2A1AA 2CWPA 4TVAB 1A15A 2K03A 2KCTA 4L6TB 1MGSA 1VQJA 3SK6A 2Z0SA 3HOZB 4K0KL 3IAYA 4IFDG 1O7LA 3BU2A 1R4QB 2QW7A 1HNWL 2F4VQ 3R2IA 1F9PA 1GM5A 2R7DA 2Q2UA 2PNRC 2HIVA 4QJFA 3QO2A 3HOVB 1UAPA 5ELCA 5EKLA 1BKBA 2ZT9C 3W5OA 3I2ZA 4A3CH 2QDBA 5C4JB 3TZDA 3PIO3 1Y1VB 3D4RA 1JJ2A 3EA6A 3T13A 4C3HH 1JWSD 3BVGA 2CCZA 4DR1L 1I6HB 4KY7A 3S2DH 2CKZB 4QIWE 4DN4M 4XYOA 1S5DD 4DXFA 3T4AC 4JBMA 2NTSA 3GTKB 4DV1L 3STBD 1QNKA 4C3IH 5EAYA 1KXLA 4XT3B 4MIUA 2EZVA 2K50A 3J81E 2V4DA 4TKOB 3PSIA 4RGNA 1OXXK 3KLWA 1FNVA 1W6KA 1ZYRD 3OIQA 1D5MC 3FDTA 2LY7A 3G48A 3OIPA 3HEJA 3H0GH 4OELB 4QMGA 3K58A 4KHPL 3J81j 1KDAA 3S1NB 1MKHA 4OO1G 4QCLA 1VQ8A 4L5TA 1E1OA 1AN8A 3S24A 2B3GA 3S1QB 5ELNA 4GKKL 1WD1A 1KDBA 1EIYB 1VDZA 4DR5Q 4IPCA 1KNAA 4HR7B 1DD2A 4DUYL 4OWXB 2E75C 2PW5A 2AWNA 1I4HA 2DUDA 4F87A 2JA6B 3DM3A 1LYLA 4OWTB 4QGUA 3KDFA 1WTQA 2KHJA 1PZKD 2WINB 5M3MH 3VYRA 2NN6I 4A3JG 1JB3A 2K5DA 1TXYA 2RA4A 1X56A 2L1BA 4K5WA 1CA5A 1XNRQ 1S5ED 1SE4A 5FO7B 3GQBA 1J8IA 4HCSA 2JYOA 4N9TA 3ERQA 1HXYD 5D3IB 4A3BB 1BQQT 4B3MQ 3KJOA 3H0GB 3SHLA 3RN2A 2UXDQ 1M1KC 5M9OA 3CCUA 4FNFA 1VQFA 1Y69U 4DV4Q 1E22A 3PQIA 2GVBA 1E2WA 1KABA 4PV1C 1MIUA 5FJ8H 4JBWA 3CCQA 2VUMH 4IFDI 2SNMA 2XNAC 3UDIA 4IJLA 2K75A 4WJ3M 1PHJA 4PZ8A 4EQNA 1P8LA 1STHA 4IUQA 2Z6KA 4GLXA 1N33Q 1EFID 2DN8A 2XGTA 1EIFA 2K14A 2WB1B 3D4DA 2UXCL 3L2PA 1VQBA 5LMNW 3CMEA 2OQ0A 2YTYA 5ELOA 3T1YQ 4XQNA 2PMZE 5DM73 1V43A 3S16H 2JJQA 4N8FA 1C4QA 2MO1A 4A3GB 3MXNA 4KD3A 2A6HC 1PZID 1EYCA 4CKBA 4IJHA 1YHQA 4DUZQ 1Y8OB 3FPUB 1RTNA 1SNPA 1X55A 3OTOL 3W1GA 1AZQA 3CC7A 1GUSA 4FO2A 1EEFD 4DAYB 1E1TA 3EQLC 4LUZA 5GAGC 3J7YW 1NR2A 4ILWA 1SROA 1YEZA 1TR5A 3JAML 1D1KA 1U4PA 2L9HA 3D8GA 2QILA 5ELEA 4JI8L 1K8GA 4H0LC 1VQ9A 4BWGB 1AP0A 3A55A 1SNCA 4UP9A 3NE5B 2JP1A 3AB9A 1STAA 1V9PA 1PYSB 2N3SA 2B39A 1QZGA 3MXGA 4IN3A 4C2MH 3JAMi 2R92H 5E4XA 1FR3A 2A19A 1B50A 3GTQB 1GVPA 3PIP3 2NVYB 4NW2A 1CZGA 1QOHA
chains in the Genus database with same CATH topology
1WVLA 5DM63 3L9AX 3VA5A 1I6VC 5G3LF 1V1PB 4ABNA 3OW7A 3LWEA 1B3AA 4FF4A 2KEEA 2XWBB 3DWQA 5KRUA 4A3MB 1ZXTA 3BYYB 5D3DA 1WTVA 3KUPA 4QUCA 2RKSA 4ZUJA 1X32A 1A3UA 1JOKA 5EBCA 4WJWA 1II3A 2EVBA 2NVXB 3HRZC 2J7ZA 4IFDH 2NVTB 4BBSB 1UEAB 2B2YA 5DEHA 5FLXE 3NXWA 1EY4A 1QG7A 4PMCA 2EOTA 2O4XA 2XWJB 1XTCD 2F0OA 2FHTA 4CJ2C 1TS2A 1BOSA 2A74C 1F9QA 3RD4A 4TSSA 3QOJA 3J81L 3W3AA 2KEDA 4H44C 4I7ZC 3MA2B 1IKLA 3S1MB 1F2ZA 2B2TC 3NBIA 4G4KA 3TP5A 3MXPA 3P75A 2WACA 5BN5A 3LNNA 1S4ZA 3SVMA 1BNZA 2TMPA 1KNEA 1QE6A 5EPKA 1LTSD 1KTKA 4BS9A 2ID0A 2E2JB 1A3TA 3UI2A 4U673 1MSHA 4ZQ3A 2G9DA 5C0XG 2C9OA 5M3FB 1IYVA 1KDCA 3P20A 5NUCA 2DNEA 3PUYA 1XX8A 2K5WA 1K8MA 3DHQA 1F9RA 5IT9L 1BCPF 4HEDA 5M5WB 2OT2A 2RDGA 2R61A 1XWEA 4F88A 3SXHA 3K59A 2EYPA 2KHSA 3FKIB 2K32A 4C2MB 5I2YA 3C3LA 1EY8A 1TWCB 3FPPA 1JCKB 1FGBD 1STNA 1TWHB 2EY1A 4CHTB 2WP8J 1CFMA 1I4RA 5EPJA 3FRPB 3VR2A 3WDNA 3HGBA 1B2TA 3N6RA 2PQEA 1D2BA 1SMYC 5J39A 3SK8A 3NTHA 2B2UA 2F0PA 1BCPD 3NK9A 3OPOA 3H94A 1ZYRC 1FYCA 3HKZB 3K5NA 1EZ6A 1LTBD 2Y0SB 4KHVA 4OGQC 5KYIA 3I73A 2F0WA 5T1IA 5K36G 1Q1BA 5LL6S 1LTTD 4RFBA 3NUCA 3I4NB 1NR4A 3Q23A 2O2LD 3KLSA 5FO8B 4R8IA 3V2TA 4MHEA 1LT5D 1TKWB 1CQFA 3KBGA 4KJOA 1GJXA 1K8OA 2F0UA 3R3OA 1BUVT 4IALA 1X3QA 1LACA 4R9WA 3CQZB 3A8JE 3T56B 5LL6X 4XT1B 1SE3A 2MJ8A 3P1HA 1JOOA 2VB2X 1OXUA 3HOWB 2BE5C 4PQXA 2PZUA 5EKKA 5KYLA 1ONLA 3FMCA 1LLRD 1HA6A 1WTPA 1B9MA 3CHBD 1A6XA 5C5MA 3CKIB 3D4WA 3E5SA 3A7AB 2PZTA 4FF2A 2K6AA 2EYLA 5A2QE 3RZOB 3I72A 4BY7B 3K6OA 4FXKC 1HTLD 1OXVA 4J6HA 4RCOA 5IODA 4K2KA 1SDFA 1PFBA 3MHBA 2ICIA 4C56C 1L0XB 1RKNA 4F7XA 3HP3A 2PPBC 5CGKA 3S1RB 4FYDA 1PTOB 5CR3A 2K1BA 2CHBD 2L4NA 2IPKD 2MPMA 4C3HB 3N52A 1AZPA 5JVG3 1TU2B 4L63B 1ESRA 3MC0B 4H7BA 1I4PA 2B2VC 1DXMA 1SNDA 1EYAA 1PTOC 2K04A 1O80A 1ESFA 2N55A 1Q1EA 5F2DA 3SR1A 1EY9A 2AUJD 4CKCA 4OHJA 1QCBD 5JJZA 5J22A 4RWSC 4U68A 3J80L 2SDFA 5C5LA 3GTGB 1M4VA 3PO2B 3VYSA 4M8AA 4DK0A 3EFXD 2A6ED 4K14A 1CK1A 1EOTA 4NP5A 1G91A 1EEID 5J1ZA 1IYUA 1HQMC 2F0LA 1L0YB 1PYWD 5IGBA 2B2YC 3VYTA 1R9TB 3DM1A 5CC4A 1V8QA 4HCEA 2SNSA 2Z4HA 1K83B 4KY5A 2A68D 5CBAE 1LO5D 2FFKB 2DY8A 2D5DA 2OF1A 3LWUA 4DNRB 1SEBD 3OHXC 3OWFA 1YNJC 2K5QA 1F2LA 1PDQA 3NTIA 3SEBA 4KD4A 3BDLA 1IL8A 5C3XA 2R92B 5DNFA 5C4ZA 4XIGS 3GTOB 2NBFA 3S2HB 4HMJA 1D1IA 1DOKA 4BBRB 3E0JA 1OXTA 2LMCB 4CGYB 4EQOA 3VR6A 4ZLTF 4QIWB 1O7ZA 1LABA 1I3QB 3S9WA 2JEAI 2FINB 1STYA 3QOLA 2A73B 4IUPA 2ICEC 3MFYA 5JOBA 4V0BA 4K2LA 2WIIB 1DYQA 4C3HG 1E0BA 1YNJD 2B2WA 2HDLA 3DXJC 1B53A 5C3EB 1LTAD 1TS5A 4RGMA 3TN2A 4DK1A 2CVRA 4CJ0B 3A8KE 1CHPD 2EY2A 3LX0A 4A3EB 1E2VA 1JWUD 1S5CD 4KJNA 2H4OA 2M00A 4X3TA 2F0JA 4NMZA 1J9OA 4F8MA 2JA8B 3PUXA 1G2TA 3X3MA 4A3KB 4OIJA 4CJ1B 4B08A 4DAYA 2H1EA 1I4GA 1Q90A 5I2XA 3SK4A 3FVQA 1EL0A 5IOCA 1AW7A 5EBDA 4LMQD 2AWOA 2RVLA 4HN7A 3Q22A 1B4OA 5M3MB 2Q8RE 1TIID 3GTPB 2K05A 4BY1B 1CTMA 4HSPA 2EPBA 1DM0B 3MVVA 3IFDA 4R8NA 4XXEA 1TQOA 2BDOA 4HMIA 2KCCA 2EDGA 4O1NA 4ULLA 1CT1D 2F1MA 5EPLA 2MHVA 4ME5A 3M7GA 5JPNC 2EYHA 1BF4A 2NTTA 2F03A 3VA7A 1SXTA 3QG1A 3V05A 1RDPD 4QF4A 1LT4D 4LAAA 5C6AA 2N88A 2VNUD 3M85A 3DEPA 5FK9C 4KN7C 2NN6G 4Q5VA 4KKTA 4RGOS 4DNTB 3ND8A 1SYBA 1H9SA 2J0TD 2EXZA 3BS1A 1IW7C 5IT9E 2C5CA 2F0MA 1G2SA 2EJGC 1ILQA 3G7LA 3VYUA 1BO0A 2IL8A 2F4IA 3S17B 3M4YA 1M8AA 2DY7A 2XRQD 2KVMA 3BG3A 2DNCA 3TBIB 5COYA 3TP6A 3I3CA 1UNSA 3K0YA 5KNDA 2YYZA 2JSOA 1HRJA 1SYEA 2VXWA 5CV4A 4DA2A 4RH6A 4FVMA 5EQ0A 1QJOA 4J1MA 4G7HC 1BR9A 4JK1C 5C0XJ 3KLSX 3WOFA 2HQEA 1DCZA 4GZYC 2SEBD 2F0VA 2F0KA 4XYQA 2L11A 2JA7B 2GA4B 3R8BA 2Z8LA 2KECA 5ELBA 3EROA 4IURA 2R93B 4RCNA 1EU4A 3HOXB 2JE6I 5KNBA 2D2CC 3OOCA 3R93A 1DZ1A 2IX1A 1T5EA 1QNUA 2I07B 3FEWX 4RKLA 4EQPA 4RKBA 5IGGA 5EGTA 1Q12A 3MZ5A 3GTJB 4C3IG 4FP5D 4IUNA 4KN4C 3KBXA 5IGFA 3TZUA 1GOZA 3VR5A 4WORA 5CV8A 5FKAC 3OWEB 2B2TA 2L5TA 5TSSA 4NKLA 5JPMC 2K01A 2B2WC 5KGUA 2EJFC 3Q24A 1ICWA 4A93B 4MN3A 2ZXOA 1SNQA 2I46A 5I6WA 3RZDB 2XRSD 2B8FA 2O5JC 1FNWA 1H9RA 1WTXA 3K5LA 4S3SA 4G7OC 1X3PA 2XIWA 5G3LD 2Z4IA 2E2HB 1D5XC 3TMEA 4WRDA 2M2LA 1I4XA 1S5FD 5I6YA 4HTHA 3A56A 4UDUC 3C1EA 4C1NI 1SBBB 1GHKA 4C3JB 4H13C 1V1PA 2D62A 4KK7A 1ILPA 3U9SA 2E76C 1TVXA 5CV6A 1DOLA 3M7NA 3MXUA 1LTID 4A3DB 4ID6A 4FF1A 3C1FA 5BN3A 3A8IE 3BDCA 1A2UA 2WV6D 1PRTD 5E4WC 1GUWA 3ITPA 1F2YA 4EGVA 1C48A 1LV9A 1JQYD 1B9NA 3I91A 1GUNA 3GV6A 3QIAA 4PNYA 2F0TA 1PRTC 5I4DA 1VCIA 3DMUA 2F3WA 3K57A 3G6JB 1CQVA 1SAPA 5I9OA 3PV0A 4C1NK 4I65A 3VR3A 3MAQA 3S16B 2A69D 1JE4A 2X69A 2EYMA 1G6ZA 1QILA 5KIXA 4G57A 1NSNS 2JXMB 4UAIA 1TS3A 1DONA 4RGTA 2HCCA 1Y1WB 2WKCA 2F0HA 3PUZA 2QCPX 2F0GA 2HCIA 2X6LA 1QWYA 2EE1A 2KJXA 3I8ZA 5CBEE 2LS01 1HQRD 3PUWA 2K28A 1R4PB 1PRTB 1QB5D 4Y7NB 2FMMA 2IWHA 2BDNA 1F77A 3DEOA 4XTCS 1STBA 2E2IB 1VMPA 1B44D 1HUMA 1RF2D 2BE5D 1LT3D 5AFWA 2B8GA 5K5PA 2RQXA 1VMCA 5IGEA 1NCVA 3RMHA 2XVSA 3RUZA 5T1GA 1SNOA 5KEEA 1MI2A 1Y8NB 1I4QA 5A2QL 2PYKA 5CYUA 2BA0A 3SE0A 2MGSA 2IW3A 1HUNA 3TSSA 3D31A 1C8CA 1F9SA 3K7AB 3I4MB 2KUMA 3MWYW 5HGTA 1EY6A 4CKEA 1H9KA 1MSGA 4P2CB 1AFPA 3NWTA 1CI3M 2Q8IB 1TS4A 1PFMA 2KA7A 5C0XI 1Z6HA 2D9UA 5M5XB 1LTRD 1UUPA 2RDFA 1JORA 3EJIA 2L12A 1SYFA 4HAEA 1EZ8A 4K5VA 3H91A 3TDQA 1HPCA 1Z47A 2F0EA 2J4XA 2JEBI 5C4HA 2IT1A 3VR4A 1U9RA 4QUFA 1SFOB 2HUGA 1PRTF 3TP8A 3H09A 3DUZA 3J80E 3M4OB 4A3IB 4V190 4ZUIA 3U9OA 2F0QA 3T51B 5JEAG 1BDOA 1EQVA 1EY5A 2F0IA 4DAVA 5JVH3 4KMUC 1EU3A 1SMYD 5CV5A 1WD0A 5CV7A 1WTOA 2K7VA 2EJMA 1TWAB 3P7JA 1SJED 3A7LA 1XXGA 3X3NA 3W2DA 3RLFA 2EY5A 2EY6A 1XYIA 3I4LA 3H6MA 4KY6A 4KKUA 1HCZA 2A6HD 1U4MA 3AMUA 3DWPA 1W6JA 3HG9A 5C44B 4X3KA 5ISRA 4CBVA 3CU7A 1PMRA 1BXTA 3BVZA 2AUKA 2IX3A 3BYTB 1HFNA 4J8QA 2E74C 3Q0AA 4ZKCB 2K33A 1O78A 1SE2A 4B9XA 1NAPA 4XDXA 4O42A 4RA8A 3NP8A 1Z7TA 1S5BD 1EWCA 3NHHA 2L0CA 1HTPA 5K36H 1KLGD 1TY2A 1PZJD 3HOUB 1LT6D 2RBMA 5IGDA 4FXGC 1RTOA 3I70A 3IKJA 3OMCA 4KI0A 1ML0D 3EVQA 4XQJA 3GP7A 2CW0C 1ENFA 3I90A 1AEXA 5E1FA 1OXSC 4KHZA 4N9PA 3O13A 2F0FA 3ONAB 3DWAA 1ZEQX 4TRDA 5I9PA 1LTGD 5M5YB 4RAUC 3H3VC 5JEAJ 2QKIC 1GUTA 2O5IC 3MTSA 3D6WA 3QWNA 4AYBB 2RSOA 2JA5B 3CRKC 1GXDC 5C0XH 4IZ8A 2A5HA 3IL8A 3PUVA 5KNCA 2NB0A 5C3WA 2WKDA 3C2PA 2BA1A 2QF7A 2PO4A 1JR0D 4Z9CB 3CRLC 1KLUD 1HFGA 2A68C 4LJZC 3OMGA 1VF7A 2RSNA 4ZK9B 1BCPC 1O7YA 2NUCA 4WFN3 1PXUA 1G291 1SYGA 1GHJA 3A54A 4A3JB 1EY7A 3GD7A 5A35A 5JEAH 3BDOA 4KKSA 1GUOA 5FOBB 5LHY1 4FF3A 3URYA 2AQ3B 1TWGB 2CW0D 1I50B 4BA2I 2F3VA 2EYFA 3TP7A 5BN4A 3GTMB 3T53B 2Q8TA 2KOLA 1G8ZD 4OIKA 4L8JA 4G7ZC 1ZKOA 4HSVA 2PMZB 3NWSA 2WAQB 1SYCA 1PFNA 2F0DA 2IX0A 1SYDA 1SSOA 3GV3A 1CA6A 1ENAA 1D6EC 2R3ZA 1TT2A 1CM9A 1U4LA 3NTKA 1OO9B 4QB4A 4IQZA 1IW7D 2NN6H 4K6DA 2KQ3A 1F2MA 4DFAA 3L7ZC 3T16A 4X3SA 4E6IA 1H9JA 1PTOH 2YU9B 1MBYA 2VB3X 5CORA 2A6EC 1RODA 3HOYB 5JAVA 4K6LA 2VUMB 1VF5C 1ENCA 3F2UA 4RHSA 4IFDJ 1IHZA 3SK5A 4X3UA 3ND9A 1PTOD 2EYOA 3J7AV 4ODGA 2CQAA 1EY0A 1DOMA 2R7ZB 2HDMA 4DU9A 4K5XA 1KAAA 5DAUA 3NBHA 3S14B 2FJ2A 1FD7D 5FO9B 4PMBA 2XN9C 4DXGA 3KF8A 5FLXL 1T5XD 4ZAIA 4K8IA 3SDZA 1JOQA 5ELDA 3NQTA 4KTAA 5ELFA 3NSWA 3GO5A 1EIGA 4LK1C 3KK7A 3Q6SA 4EVOA 4C3IB 4FXDA 2BCOA 2QEJC 3J7AF 4IUTA 4OO1H 2OEOA 4TQUS 3S2DB 2R6GA 1A3VA 2F0SA 2NWGA 2EYJA 4ZYSA 5IGCA 4DF7A 2ENBA 3WOEA 1WTRA 1Q3LA 2RDHA 2B2VA 1PLFA 2AQ1B 4A3FB 3PMFA 2XSCA 3KLRA 2E2DC 5CMDA 3R2TA 3L3OC 3E6ZX 2NZ1D 2LFNA 2OXPA 1Q8IA 2BOSA 3JAME 1MD2D 1HA5A 4DAPA 1RHPA 3K5OA 2ZXRA 4Q0FA 5D65A 3IFTA 2M9VA 5IIFA 2AQ2B 2Z1CA 1B1ZA 2PZWA 1RJTA 2KCNA 3K5MA 2IJ0A 3NQIA 1JWMD 3BVMA 4BA1I 1JICA 4RHRA 2ZXPA 4ZRZA 2A69C 4NDXA 2MUYA 2F0NA 2X6GA 1WCMB 5HURA 1NUCA 3ZYYX 1ET6A 1SNMA 4YIJA 1BBXC 2PW7A 1Y8PB 5E3FA 1CHQD 3HS0C 1GUGA 2NYZD 2PCFB 4M1UB 1HHVA 3GTLB 1YNNC 1EIHA 1YNND 3BZDB 1BCPB 1RCVD 2TSSA 2L55A 5C4XB 1EWHA 4IUVA 3MFGA 2SOBA 3AU7A 5D14A 1PTOF 1E2ZA 1WTWA 1H9MA 1A2TA 3S15B 5EJWA 4OO1I 1FNUA 1JC7A 1STEA 1EYDA 2B2UC 2FMCA 4B9WA 2B63B 3NPPA 3OSOA 4ZKBB 1EQTA 4C3JG 4OL7A 3C46A 2MP1A 1D5ZC 3D3RA 5EKIA 1V1OA 1IKMA 1H9SB 1DJRD 3PO3B 3V96A 3QJYA 4DGZA 1SJHD 1CZWA 1TWFB 4KV6A 3M3YB 4K8JA 4PMWA 2G9HD 3QB3A 3MEHA 2LKVA 1TY0A 3HZXA 3D6CA 5CV9A 1STGA 4IUUA 1ET9A 2NVQB 4XQQA 1RD9D 1U4RA 1A15A 2K03A 4L6TB 1MGSA 3SK6A 3HOZB 3IAYA 4IFDG 1O7LA 1R4QB 3R2IA 1F9PA 2PNRC 3QO2A 3HOVB 1UAPA 5ELCA 5EKLA 2ZT9C 2QDBA 5C4JB 3TZDA 3PIO3 1Y1VB 3D4RA 3EA6A 3T13A 1JWSD 3BVGA 1I6HB 4KY7A 4DN4M 4XYOA 1S5DD 4DXFA 3T4AC 2NTSA 3GTKB 1QNKA 4XT3B 4MIUA 2EZVA 3J81E 2V4DA 4TKOB 4RGNA 1OXXK 1FNVA 1W6KA 1ZYRD 3OIQA 1D5MC 3FDTA 2LY7A 3OIPA 3HEJA 4QMGA 3K58A 4QCLA 1KDAA 3S1NB 4OO1G 1AN8A 3S1QB 1WD1A 1KDBA 1VDZA 1KNAA 4HR7B 1DD2A 2E75C 2PW5A 2AWNA 1I4HA 4F87A 2JA6B 1WTQA 1PZKD 2WINB 3VYRA 2NN6I 1JB3A 2K5DA 2RA4A 2L1BA 4K5WA 1CA5A 1S5ED 1SE4A 5FO7B 3GQBA 1J8IA 4HCSA 2JYOA 4N9TA 3ERQA 1HXYD 5D3IB 4A3BB 1BQQT 3H0GB 3SHLA 5M9OA 4FNFA 1Y69U 1E2WA 1KABA 4PV1C 4JBWA 4IFDI 2SNMA 2XNAC 4EQNA 1STHA 4IUQA 1EFID 2DN8A 2WB1B 3D4DA 4XQNA 5DM73 1V43A 1C4QA 4A3GB 3MXNA 4KD3A 2A6HC 1PZID 1EYCA 4CKBA 1Y8OB 3FPUB 1RTNA 1SNPA 1AZQA 1GUSA 4FO2A 1EEFD 3EQLC 3J7YW 1NR2A 4ILWA 1TR5A 3JAML 1D1KA 1U4PA 2L9HA 3D8GA 2QILA 5ELEA 4H0LC 4BWGB 1AP0A 3A55A 1SNCA 3NE5B 2JP1A 3AB9A 1STAA 2B39A 3MXGA 4IN3A 5E4XA 1FR3A 1B50A 3GTQB 3PIP3 2NVYB 4NW2A 1CZGA 1QOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SK6 A;  5CV6 A;  3NQT A;  4KTA A;  2F0K A;  4KD4 A;  3BDL A;  5CR3 A;  5HUR A;  1A3T A;  1NUC A;  4ZUI A;  3U9O A;  3VA5 A;  5IGE A;  1SNM A;  5C3X A;  4N9T A;  4YIJ A;  2F0Q A;  1AEX A;  3ERQ A;  4ID6 A;  5C4Z A;  1EQV A;  3ERO A;  3C1F A;  5E1F A;  2PW7 A;  1EY5 A;  2F0I A;  1A2U A;  3BDC A;  3NUC A;  4HMJ A;  4ZQ3 A;  5E3F A;  3RUZ A;  3SHL A;  4EVO A;  1SYC A;  2F0D A;  4N9P A;  1SNO A;  5M9O A;  5CV5 A;  5KEE A;  3ITP A;  1F2Y A;  5CV7 A;  5K5P A;  2F0F A;  4H7B A;  3MVV A;  4TRD A;  1KAB A;  4EQO A;  4R8N A;  5EKL A;  3V2T A;  1SYD A;  2OEO A;  4RKL A;  4EQP A;  5I9P A;  1ENA A;  4RKB A;  5IGG A;  5EGT A;  1KDC A;  1TT2 A;  1TQO A;  2SNM A;  1SND A;  4HMI A;  4KJO A;  3MZ5 A;  5KRU A;  1A3V A;  1EYA A;  2QDB A;  2PYK A;  4QB4 A;  4PNY A;  5NUC A;  2F0U A;  2F0S A;  2SOB A;  3S9W A;  2F0T A;  4DFA A;  2EY5 A;  3R3O A;  2KQ3 A;  1F2M A;  1STY A;  2EY6 A;  3QOL A;  2EYJ A;  4IAL A;  4IUN A;  4ME5 A;  3DHQ A;  1EY9 A;  5F2D A;  3SR1 A;  3H6M A;  4KY6 A;  1STH A;  3DMU A;  4EQN A;  5IGF A;  3T16 A;  4E6I A;  4WOR A;  5CV8 A;  2RKS A;  4ZUJ A;  5HGT A;  5IGC A;  1JOQ A;  5JOB A;  4KY7 A;  2F3W A;  1A3U A;  1JOK A;  2EYH A;  3D4D A;  4IZ8 A;  1EY6 A;  4K2L A;  2ENB A;  3SXH A;  2EYP A;  4DF7 A;  5I9O A;  5J22 A;  1A2T A;  2KHS A;  5C3W A;  5C5L A;  1II3 A;  4I65 A;  3P1H A;  5ISR A;  3T13 A;  1JOO A;  4QF4 A;  4NKL A;  4LAA A;  5C6A A;  1EYD A;  5JAV A;  2EYM A;  1EY8 A;  3PMF A;  4MIU A;  4K14 A;  2PZU A;  5KIX A;  5KGU A;  5EKK A;  4G57 A;  4B9W A;  1NSN S;  5KYL A;  3OSO A;  5DEH A;  4KD3 A;  4NP5 A;  1EYC A;  3OMG A;  1ENC A;  3NXW A;  1EY4 A;  4OL7 A;  2OXP A;  4PMC A;  5J1Z A;  1STN A;  2RDF A;  1SNQ A;  5CGK A;  1SNP A;  2EY1 A;  1JOR A;  1SYB A;  2O4X A;  1IHZ A;  3EJI A;  5C5M A;  2EXZ A;  2F0O A;  3SK5 A;  2EY2 A;  1SYF A;  2NUC A;  3HEJ A;  3LX0 A;  5I6W A;  4QMG A;  4B9X A;  1KDA A;  3D4W A;  2F0M A;  2F0L A;  2F0H A;  1SYG A;  3E5S A;  2PZT A;  2F0G A;  4KJN A;  2EYO A;  3NP8 A;  4S3S A;  2M00 A;  2EYL A;  3QOJ A;  4ODG A;  1EZ8 A;  4K5V A;  1EY7 A;  5IGB A;  1KDB A;  3NHH A;  1TR5 A;  4DGZ A;  5IIF A;  2F0J A;  3D8G A;  4NMZ A;  2PZW A;  3TME A;  1EY0 A;  4WRD A;  2F0E A;  4F8M A;  2PQE A;  3EVQ A;  5J39 A;  5I6Y A;  4KV6 A;  4J6H A;  5CC4 A;  2PW5 A;  3SK8 A;  3TP6 A;  1SNC A;  4K8J A;  1F2Z A;  4HTH A;  4DU9 A;  4K5X A;  2F0P A;  5C4H A;  4K6D A;  5IOD A;  1KAA A;  3QB3 A;  1U9R A;  3NK9 A;  4K2K A;  5DAU A;  2SNS A;  1STA A;  1SYE A;  2LKV A;  3MEH A;  3MXP A;  3HZX A;  3D6C A;  3P75 A;  1STB A;  5CV4 A;  3TP5 A;  2WAC A;  3C1E A;  3SK4 A;  4KY5 A;  4PMB A;  1EZ6 A;  3MHB A;  3TP8 A;  4J1M A;  2RBM A;  5CV9 A;  4KHV A;  1STG A;  5IGD A;  2F3V A;  4K5W A;  5IOC A;  1RKN A;  5KYI A;  2EYF A;  4NDX A;  3TP7 A;  2OF1 A;  2F0W A;  3OMC A;  3OWF A;  2HQE A;  4K8I A;  4F7X A;  2F0N A;  2F0V A; 
#chains in the Genus database with same CATH topology
 1WVL A;  3U4Z A;  5DM6 3;  3L9A X;  3VA5 A;  3PGZ A;  1I6V C;  1NTG A;  4DV0 Q;  4DV3 Q;  1L1O C;  5G3L F;  4IPG A;  5IYC G;  1V1P B;  3RLO A;  1B3Q A;  2Q2H A;  1Q81 C;  1A63 A;  4ABN A;  3OW7 A;  3LWE A;  1PH9 A;  1PFS A;  1B3A A;  4FF4 A;  2YTV A;  2KEE A;  1QZH A;  2XWB B;  3DWQ A;  1YZ6 A;  5KRU A;  4A3M B;  1ZXT A;  4JI1 Q;  3BYY B;  5D3D A;  1WTV A;  3KUP A;  3I4O A;  1YNX A;  1HJP A;  2UU9 Q;  4JI2 L;  1QUQ A;  4QUC A;  1EYG A;  2RKS A;  4ZUJ A;  1N34 Q;  1OTC A;  2QDL A;  1X32 A;  1A3U A;  1JOK A;  1FGU A;  5EBC A;  4YHH L;  2AKW B;  4A3D G;  4WJW A;  2VL6 A;  2IHE A;  1II3 A;  2EVB A;  2NVX B;  2C35 B;  3HRZ C;  1YI2 A;  4J15 A;  2CWA A;  1EUJ A;  1M90 C;  5IWA Q;  2J7Z A;  3Q8D A;  2QEX A;  4IFD H;  2NVT B;  3PO2 H;  4BBS B;  1UEA B;  2B2Y A;  5DEH A;  5C3E G;  5FLX E;  3NXW A;  1EY4 A;  1QG7 A;  4PMC A;  4DAM A;  2EOT A;  3M3Y H;  2O4X A;  2XWJ B;  1XTC D;  2F0O A;  2FHT A;  4CJ2 C;  1TS2 A;  1BOS A;  4RMF A;  2A74 C;  4WJ4 A;  4DR3 L;  1F9Q A;  3RD4 A;  4TSS A;  4GNX A;  3QOJ A;  3J81 L;  3W3A A;  2KED A;  4H44 C;  4I7Z C;  3PO3 H;  2ES2 A;  1X65 A;  2MQH A;  2ZM6 Q;  4JV5 L;  2D0P A;  3MA2 B;  1IKL A;  3S1M B;  1F2Z A;  2B2T C;  3J80 i;  4LF4 L;  1KQS A;  2EIF A;  3NBI A;  4G4K A;  3TP5 A;  3MXP A;  3P75 A;  2E2H H;  2WAC A;  5BN5 A;  5LMN L;  3LNN A;  1DGS A;  1S4Z A;  3SVM A;  1BNZ A;  2TMP A;  1KNE A;  2JA7 H;  1A0I A;  4JI3 Q;  4BBR G;  4MTN A;  1QE6 A;  5EPK A;  1LTS D;  1N36 L;  1KTK A;  4X62 Q;  4BS9 A;  1VQN A;  4DPG A;  2ID0 A;  3CC4 A;  1KHI A;  2E2J B;  1A3T A;  4A93 H;  3JC6 6;  3UI2 A;  4U67 3;  1MSH A;  5C4X H;  4ZQ3 A;  3CCM A;  1SLJ A;  2G9D A;  1GO3 E;  5C0X G;  3GTL H;  4DV5 L;  2C9O A;  2CQO A;  5M3F B;  1X3E A;  1IYV A;  1KDC A;  5IP7 G;  3CCV A;  2F52 A;  3P20 A;  5NUC A;  2DNE A;  3PUY A;  1U5K A;  1XX8 A;  2K5W A;  4GKJ L;  4A3F G;  1K8M A;  3DHQ A;  1F9R A;  5IT9 L;  2E5L Q;  1BCP F;  4HED A;  3QR8 A;  3HOX G;  5M5W B;  2OT2 A;  4X65 L;  1AE3 A;  2RDG A;  4DV7 L;  2R61 A;  2JA5 G;  1XWE A;  4F88 A;  3SXH A;  3K59 A;  4JI3 L;  2EYP A;  2KHS A;  3CP0 A;  3FKI B;  3PIO A;  1YJW A;  2K32 A;  4L5S A;  4C2M B;  5I2Y A;  4R4T A;  3C3L A;  1EY8 A;  3JAM c;  1TWC B;  1XMQ Q;  1S72 A;  3FPP A;  1JCK B;  4OON A;  4NXN L;  3FKI G;  2KBN A;  4IO9 A;  3WWV A;  1FGB D;  1STN A;  1TWH B;  2EY1 A;  4CHT B;  2WP8 J;  4DV5 Q;  1CFM A;  1X9N A;  3TS2 A;  1I4R A;  5EPJ A;  3FRP B;  3VR2 A;  3WDN A;  4DR3 Q;  3HGB A;  5IP9 G;  1B2T A;  3N6R A;  4I7A A;  1SFO H;  2PQE A;  3J7A 5;  4A3I H;  1SMY C;  5J39 A;  1D2B A;  3SK8 A;  3NTH A;  4A3K G;  2B2U A;  3J80 c;  2F0P A;  2DGY A;  1BCP D;  3NK9 A;  5AJ3 Q;  4A3G H;  3OPO A;  5GRO A;  3CCS A;  3H94 A;  1D8L A;  1ZYR C;  3B6Y A;  2UUB L;  1FYC A;  1Q86 C;  3HKZ B;  5IYD H;  3K5N A;  1EZ6 A;  1LTB D;  1IBM Q;  2Y0S B;  4KHV A;  4OGQ C;  1JJC B;  5KYI A;  3I73 A;  3G6E A;  2R7Z H;  2F0W A;  5T1I A;  1Z9F A;  4UHV A;  3CW2 C;  4JI6 L;  3E9H A;  1YJ9 A;  1N36 Q;  5FLM H;  5K36 G;  2QGQ A;  1VQD A;  4DKA C;  4B3S Q;  1Q1B A;  5LL6 S;  1LTT D;  4RFB A;  4A4I A;  5GQO A;  3NUC A;  3I4N B;  1NR4 A;  3Q23 A;  1QVF A;  4ME3 A;  2O2L D;  1WJJ A;  3KLS A;  5FO8 B;  4R8I A;  3V2T A;  4MHE A;  1LT5 D;  1TKW B;  3UE1 A;  3U50 C;  4DV7 Q;  1CQF A;  3KBG A;  4KJO A;  5J3B A;  3M4Q A;  2ZTD A;  1GKH A;  3I4M G;  1GJX A;  4GNX C;  1K8O A;  3I4M H;  2F0U A;  3R3O A;  1BUV T;  3HOY G;  4IAL A;  1X3Q A;  1LAC A;  1WOC A;  4R9W A;  1RL2 A;  3CQZ B;  3A8J E;  3T56 B;  5LL6 X;  2YU9 H;  1L0W A;  5IP7 H;  4XT1 B;  4LUO A;  1SE3 A;  2MJ8 A;  4HJA A;  1CKO A;  4L5Q A;  4JYA Q;  3P1H A;  1HNZ L;  4BBS G;  1JOO A;  2VB2 X;  1OXU A;  3HOW B;  2KCM A;  2BE5 C;  4PQX A;  2PZU A;  5EKK A;  5KYL A;  1ONL A;  2JA6 H;  1IZ6 A;  3FMC A;  1LLR D;  1XJV A;  1HA6 A;  1WTP A;  1KAW A;  1B9M A;  4P72 A;  3CHB D;  3MXN B;  1A6X A;  4X62 L;  5C5M A;  3CKI B;  3D4W A;  3E5S A;  3A7A B;  2PZT A;  4FF2 A;  2K6A A;  2EYL A;  1I3Q H;  2B63 G;  5A2Q E;  1KL9 A;  3RZO B;  3I72 A;  4BY7 B;  3K6O A;  1JJG A;  4FXK C;  4B3R L;  4LF4 Q;  5GAE C;  1HTL D;  1OXV A;  4J6H A;  1BBW A;  4RCO A;  2ZM6 L;  5IOD A;  4K2K A;  1N9W A;  3S2H H;  1SDF A;  1PFB A;  3GTO H;  3MHB A;  2ICI A;  4C56 C;  1L0X B;  2RHQ B;  4Y7N H;  1RKN A;  3GTK H;  4A3E H;  1Y1W G;  4MNO A;  4A3L G;  4F7X A;  3HP3 A;  2PPB C;  5CGK A;  3S1R B;  1I6H H;  1XMO L;  4FYD A;  2KHI A;  4LF8 Q;  1PTO B;  5CR3 A;  3TS0 A;  1QVC A;  2K1B A;  2CHB D;  2L4N A;  2IPK D;  2MPM A;  4YCU A;  1CSQ A;  4JI8 Q;  4C3H B;  3ERS X;  3N52 A;  1Y1V H;  1TU2 B;  5JVG 3;  1AZP A;  4LFC L;  4L63 B;  5IWA L;  1HNZ Q;  1ASZ A;  1LTL A;  1WYD A;  1ESR A;  3MC0 B;  3ER0 A;  4H7B A;  1Q82 C;  1I4P A;  1VQM A;  2YTX A;  2UXD L;  2B2V C;  1DXM A;  1SND A;  1EYA A;  1PTO C;  2K04 A;  1O80 A;  1ESF A;  2N55 A;  1Q1E A;  5F2D A;  3SR1 A;  1SRU A;  1EY9 A;  2FXQ A;  5FJ8 G;  2AUJ D;  4CKC A;  4OHJ A;  1QCB D;  3T1Y L;  4BXX H;  2K5V A;  1CKM A;  5JJZ A;  5J22 A;  4RWS C;  4U68 A;  3J80 L;  4DR1 Q;  2LXK A;  2UXB Q;  2SDF A;  5C5L A;  4DUZ L;  3GTG B;  1M4V A;  3PO2 B;  1I50 H;  3VYS A;  4M8A A;  4DK0 A;  2A8V A;  2KEN A;  3EFX D;  2A6E D;  4K14 A;  2N49 A;  3HOW G;  4B3S L;  1CK1 A;  1EOT A;  4JG2 A;  2NVX H;  4NP5 A;  1G91 A;  1EEI D;  5J1Z A;  3CC2 A;  1IYU A;  1HZC A;  1HQM C;  2VZA A;  2F0L A;  4DV4 L;  1L0Y B;  1HR0 W;  1PYW D;  4LF9 L;  5IGB A;  1HNW Q;  4KHP Q;  2EXD A;  1C0A A;  2B2Y C;  3A5Z B;  3VYT A;  1R9T B;  3DM1 A;  5CC4 A;  2LXJ A;  4A3G G;  1V8Q A;  4HCE A;  2SNS A;  5IYD G;  2B63 H;  2Z4H A;  1UEB A;  1HZA A;  4JI5 Q;  1K83 B;  1KIX A;  4KY5 A;  2A68 D;  5CBA E;  1LO5 D;  2FFK B;  2AHO B;  2D0O A;  2HQL A;  2DY8 A;  2D5D A;  2OF1 A;  3LWU A;  3ULJ A;  1SEB D;  3OHX C;  3OWF A;  4DNR B;  3F2B A;  1YNJ C;  3RZD H;  2K5Q A;  3CPW A;  1F2L A;  1PDQ A;  3NTI A;  3SEB A;  1CKN A;  4KD4 A;  3BDL A;  1IL8 A;  5C3X A;  2R92 B;  5DNF A;  5C4Z A;  4XIG S;  3GTO B;  1YIT A;  2NBF A;  4JI4 Q;  3S2H B;  4IOA A;  4CDE C;  4HMJ A;  3PO2 G;  2ZJQ A;  1RIP A;  1D1I A;  1B7Y B;  1DOK A;  2V1C C;  1VQP A;  4BBR B;  3E0J A;  1OXT A;  2LMC B;  4CGY B;  4EQO A;  4HID A;  3VR6 A;  4ZLT F;  1G6P A;  4PZ6 A;  4QIW B;  3G71 A;  4EQ5 A;  2E5L L;  1O7Z A;  4A76 A;  1LAB A;  1I3Q B;  3S9W A;  2JEA I;  2FIN B;  1STY A;  3QOL A;  2A73 B;  4IUP A;  2NZO A;  3PCO B;  4AQY Q;  2BH2 A;  2ICE C;  3MFY A;  4IOC A;  4LUV A;  5JOB A;  5LMU Q;  3FHW A;  4V0B A;  1VQ7 A;  4K2L A;  2WII B;  1DYQ A;  1L1O A;  4C3H G;  4HJ7 A;  1E0B A;  1YNJ D;  1P16 A;  1YVC A;  4DR7 Q;  2B2W A;  4LF8 L;  2HDL A;  3DXJ C;  1B53 A;  5C3E B;  3HOX H;  4LFB L;  1LTA D;  1TS5 A;  4RGM A;  3TN2 A;  4DK1 A;  2RHS B;  2Z6K C;  2CVR A;  4CJ0 B;  3A8K E;  1S3O A;  1CHP D;  2EY2 A;  3LX0 A;  1D7Q A;  4A3E B;  1E2V A;  3UDX A;  1JWU D;  1S5C D;  2R93 H;  4KJN A;  1YHB A;  2H4O A;  2M00 A;  5FLM G;  4X3T A;  2F0J A;  4NMZ A;  1J9O A;  1K9M C;  5IYB H;  4F8M A;  1WI5 A;  2JA8 B;  3PUX A;  1G2T A;  5E7N A;  3X3M A;  4A3K B;  5IP9 H;  4OIJ A;  4CJ1 B;  4B08 A;  3T1H L;  4DAY A;  2H1E A;  3CCE A;  1I4G A;  1Q90 A;  1VQL A;  5I2X A;  4BY7 H;  3SK4 A;  1Q8K A;  1U0L A;  3FVQ A;  4YY3 L;  1EL0 A;  1UE1 A;  5IOC A;  3TEH B;  1AW7 A;  5EBD A;  5BR8 L;  4LMQ D;  2AWO A;  4X64 Q;  2RVL A;  3U4V A;  4HN7 A;  3Q22 A;  1B4O A;  4YWK A;  2Q8R E;  5M3M B;  1TII D;  3GTP B;  2K05 A;  4BY1 B;  1UE5 A;  4X66 L;  1CTM A;  4HSP A;  1PA6 A;  1E24 A;  1VQ4 A;  4P71 A;  2EPB A;  4O0A A;  1TWA H;  1DM0 B;  3MVV A;  1WFQ A;  3IFD A;  4R8N A;  4XXE A;  4R4Q A;  1N34 L;  1PH6 A;  5LMU L;  1TQO A;  2BDO A;  4HMI A;  2KCC A;  3FP9 A;  3CQZ H;  2K52 A;  1K3R A;  2EDG A;  4O1N A;  4ULL A;  1VQO A;  2Y0S E;  1CT1 D;  2F1M A;  5EPL A;  2MHV A;  4ME5 A;  3M7G A;  1W2B A;  4LF9 Q;  4RG1 A;  1XNQ L;  5JPN C;  4YCW A;  2EYH A;  1BF4 A;  2NTT A;  2F03 A;  3M4O H;  1QVG A;  4LFC Q;  3VA7 A;  1VQC A;  1SXT A;  3QG1 A;  3V05 A;  1RDP D;  4QF4 A;  1LT4 D;  4LAA A;  5C6A A;  2N88 A;  2VNU D;  3M85 A;  3I4N H;  3DEP A;  5FK9 C;  4DV3 L;  1XPO A;  4KN7 C;  2NN6 G;  3S14 H;  3GTP H;  4Q5V A;  1FL0 A;  4OEM B;  4KKT A;  4RGO S;  4DNT B;  3ND8 A;  1SYB A;  1H9S A;  2J0T D;  2EXZ A;  3BS1 A;  1IW7 C;  5IT9 E;  2C5C A;  2F0M A;  1G2S A;  2EJG C;  1ILQ A;  3G7L A;  3VYU A;  4R4I A;  1BO0 A;  4BY1 H;  2IL8 A;  5C4X G;  2F4I A;  3S17 B;  3IRB A;  3M4Y A;  1M8A A;  2DY7 A;  2XRQ D;  2KVM A;  3BG3 A;  4B3R Q;  2DNC A;  3TBI B;  1KC8 C;  5COY A;  1IXR A;  3TP6 A;  1B8A A;  2HT1 A;  2NZH A;  3I3C A;  1UNS A;  3K0Y A;  5KND A;  1NJI C;  2YYZ A;  4P73 A;  2JSO A;  1FJG Q;  4MTK A;  3H3V H;  1HRJ A;  1SYE A;  1VQA A;  2VXW A;  1YBY A;  5CV4 A;  4DA2 A;  2UUA L;  4RH6 A;  4FVM A;  5EQ0 A;  1QJO A;  4J1M A;  4G7H C;  4A3K H;  1BR9 A;  1FJG L;  4JK1 C;  2UUC Q;  1A62 A;  4AYB E;  5C0X J;  3KLS X;  2Q2I A;  3WOF A;  4JPB W;  2HQE A;  1DCZ A;  4GZY C;  2SEB D;  2F0V A;  2F0K A;  4P74 A;  4XYQ A;  4DNI A;  2L11 A;  4Y52 H;  2JA7 B;  3KF6 B;  2GA4 B;  3R8B A;  2Z8L A;  3K7A H;  2KEC A;  1VQI A;  5ELB A;  3ERO A;  4IUR A;  1JB7 A;  1VQ5 A;  2R93 B;  1TWC H;  4RCN A;  1EU4 A;  3HOX B;  2JE6 I;  1I94 L;  5KNB A;  4OWW B;  2VQF L;  2D2C C;  4NXM L;  3OOC A;  3R93 A;  1DZ1 A;  3FKI H;  3CF5 A;  2JA6 G;  2IX1 A;  1T5E A;  1QNU A;  2I07 B;  3FEW X;  4RKL A;  4EQP A;  1I94 Q;  4RKB A;  5IGG A;  5EGT A;  1ASY A;  3UE0 A;  1Q12 A;  3MZ5 A;  3GTJ B;  4C3I G;  5M5W H;  1BBU A;  4GOP B;  1GD7 A;  4FP5 D;  4IUN A;  4KN4 C;  3KBX A;  5IGF A;  3TZU A;  1GOZ A;  3VR5 A;  4WOR A;  5CV8 A;  5FKA C;  2UXB L;  3OWE B;  2B2T A;  2L5T A;  2UUC L;  1VS0 A;  1XNQ Q;  2B29 A;  1BVS A;  3K80 C;  5HY6 A;  5TSS A;  4NKL A;  5JPM C;  3K81 C;  2E2I H;  2K01 A;  2VUM G;  2B2W C;  5KGU A;  2EJF C;  3Q24 A;  1ICW A;  5IE8 A;  4DV6 Q;  4A93 B;  1XNR L;  4JYA L;  4BBR H;  4MN3 A;  2ZXO A;  1SNQ A;  1XMO Q;  2I46 A;  5I6W A;  3RZD B;  2XRS D;  2B8F A;  2O5J C;  1FNW A;  1H9R A;  5JJK A;  1WTX A;  4X66 Q;  3H15 A;  4S3S A;  3K5L A;  4A3J H;  4G7O C;  1X3P A;  2XIW A;  4B3T Q;  5G3L D;  2Z4I A;  2R92 G;  2E2H B;  1Y1V G;  1D5X C;  3TME A;  4WRD A;  2M2L A;  1X54 A;  4LF6 L;  1I4X A;  1N32 L;  1S5F D;  5I6Y A;  4POG A;  4R4C A;  3S1M H;  4HTH A;  2GN5 A;  3A56 A;  4UDU C;  3HOV G;  1IBK Q;  1YHA A;  1SMX A;  3C1E A;  4C1N I;  1SBB B;  3NEM A;  3ULL A;  1GHK A;  4C3J B;  4H13 C;  3CCJ A;  1V1P A;  2D62 A;  2UUA Q;  4KK7 A;  1ILP A;  3U9S A;  3CD6 A;  2E76 C;  1EQR A;  1TVX A;  4NXN Q;  3KF6 A;  5CV6 A;  1DOL A;  3M7N A;  3MXU A;  4QQB X;  3BZK A;  1A8V A;  1LTI D;  3TRE A;  4A3D B;  4ID6 A;  4BBS H;  4FF1 A;  3C1F A;  1VQG A;  5BN3 A;  4DR7 L;  3A8I E;  3BDC A;  1A2U A;  1YIJ A;  2WV6 D;  1PRT D;  3EN2 A;  1XPU A;  5E4W C;  3I4N G;  3GTG H;  1GUW A;  3ITP A;  1F2Y A;  4EGV A;  4CDD C;  4DR2 L;  1C48 A;  3PIP A;  1LV9 A;  1JQY D;  1B9N A;  3I91 A;  1PH2 A;  4GKJ Q;  1GUN A;  2WB1 G;  3GV6 A;  3QIA A;  4PNY A;  2ZJP A;  2F0T A;  1PRT C;  4GN4 B;  5I4D A;  1VCI A;  3DMU A;  4DV2 L;  2F3W A;  3K57 A;  3G6J B;  1CQV A;  1SAP A;  5I9O A;  1SE8 A;  3ULP A;  1HZ9 A;  3L0O A;  3PV0 A;  4C1N K;  4UP8 A;  4I65 A;  3VR3 A;  1Q7Y C;  3MAQ A;  2DJG C;  3S16 B;  4CDC C;  2A69 D;  1JE4 A;  2X69 A;  2EYM A;  1IBL L;  1G6Z A;  1QIL A;  3GTJ H;  1EQQ A;  5KIX A;  2F4V L;  4JVZ A;  4G57 A;  1NSN S;  1NMF A;  2JXM B;  4UAI A;  1TS3 A;  1DON A;  4RGT A;  4P75 A;  1HR0 Q;  1ICF B;  2HCC A;  1Y1W B;  2JQO A;  3AQQ A;  2WKC A;  3GTQ H;  2F0H A;  3PUZ A;  2QCP X;  2F0G A;  2HHH L;  2HCI A;  2X6L A;  4JI5 L;  3A5U A;  1HZB A;  1QWY A;  3I8Z A;  2EE1 A;  2KJX A;  5CBE E;  2LS0 1;  1HQR D;  3PUW A;  3S1R H;  2K28 A;  1R4P B;  1PRT B;  1QB5 D;  3AYH B;  4Y7N B;  2XTI A;  1WTH A;  2FMM A;  2IWH A;  3PF4 A;  2BDN A;  1F77 A;  3DEO A;  4XTC S;  1STB A;  2E2I B;  1VMP A;  4LWC A;  1B44 D;  3RLN A;  1JE5 A;  4GLA C;  1HUM A;  1RF2 D;  3TQY A;  2BE5 D;  1LT3 D;  3HOZ G;  5AFW A;  3STB C;  1HNX L;  2B8G A;  3HOU G;  5K5P A;  2RQX A;  1VMC A;  3LGJ A;  5IGE A;  4NB3 A;  1C9O A;  1NCV A;  1T9H A;  1XMQ L;  3RMH A;  2HHH Q;  2XVS A;  3RUZ A;  5T1G A;  4LNQ A;  3HOW H;  1SNO A;  5KEE A;  4JOI C;  1MI2 A;  1Y8N B;  5HGQ A;  4JI7 L;  4R4O A;  4JV5 Q;  1I4Q A;  2CH4 W;  4JI4 L;  5A2Q L;  2PYK A;  4YCV A;  5DLQ E;  5CYU A;  2BA0 A;  3SE0 A;  2MGS A;  2IW3 A;  2ZJR A;  1HUN A;  3TSS A;  3D31 A;  1C8C A;  1E3P A;  3U58 A;  1F9S A;  3K7A B;  3I4M B;  2KUM A;  4AIM A;  4UPA A;  3S1N H;  4LFB Q;  3MWY W;  5HGT A;  4DR6 Q;  1EY6 A;  2IY5 B;  4CKE A;  1H9K A;  1MSG A;  4P2C B;  5M3F G;  1AFP A;  3NWT A;  1CI3 M;  4DV2 Q;  2Q8I B;  1TS4 A;  1PFM A;  2KA7 A;  2ATW A;  5C0X I;  3CPF A;  1Z6H A;  1MJC A;  3EIV A;  2D9U A;  2ASB A;  5M5X B;  4OX9 L;  2JN4 A;  1LTR D;  4LFA L;  4A3E G;  1UUP A;  2RDF A;  1JOR A;  3EJI A;  2L12 A;  1SYF A;  4HAE A;  3S17 H;  1K3B C;  1IL2 A;  2JA7 G;  1EZ8 A;  4K5V A;  1PH3 A;  3H91 A;  4JI2 Q;  3TDQ A;  1HPC A;  4A3L H;  1Z47 A;  3AEV A;  2F0E A;  2VQE Q;  2J4X A;  4JC0 A;  1CUK A;  3HOV H;  5IY0 A;  2JEB I;  5C4H A;  1L1O B;  2IT1 A;  3VR4 A;  1U9R A;  4QUF A;  4HJ9 A;  5M5X H;  2MO0 A;  1SFO B;  1KRT A;  4A3I G;  2HUG A;  1PV4 A;  5IYB G;  1PRT F;  3HKZ G;  3TP8 A;  2IHF A;  3H09 A;  3DUZ A;  3J80 E;  3M4O B;  2K5N A;  1PVO A;  4A3I B;  4GN5 A;  1JMC A;  3H0G G;  4V19 0;  3CCR A;  4A3M G;  4ZUI A;  3U9O A;  2GVA A;  2F0Q A;  3T51 B;  5JEA G;  1BDO A;  1EQV A;  1K28 A;  4DK6 C;  1EY5 A;  2F0I A;  1QUQ B;  1EOV A;  4DAV A;  5JVH 3;  3I7F A;  4KMU C;  1EU3 A;  1SMY D;  5CV5 A;  1WD0 A;  5CV7 A;  1WTO A;  3CCL A;  2K7V A;  4IPH A;  2EJM A;  1TWA B;  3P7J A;  1SJE D;  3A7L A;  1XXG A;  3X3N A;  3W2D A;  2HIX A;  3RLF A;  5C3E H;  2QA4 A;  1UE7 A;  2EY5 A;  1AE2 A;  2EY6 A;  1XYI A;  2UU9 L;  3I4L A;  2Z9H A;  2YV5 A;  4LW1 A;  3H6M A;  4KY6 A;  1X6O A;  4JBJ A;  5C4J H;  4KKU A;  1HCZ A;  2WB1 E;  2A6H D;  1U4M A;  5M3F H;  4CDF C;  4DR6 L;  3AMU A;  4A75 A;  3KDF B;  3DWP A;  5JJL A;  2OQK A;  1W6J A;  3HG9 A;  2LSS A;  5C44 B;  4X3K A;  5ISR A;  4CBV A;  3CU7 A;  1PMR A;  3W1B A;  2JA9 A;  4DR4 Q;  1BXT A;  3BVZ A;  2AUK A;  2IX3 A;  3BYT B;  1HFN A;  4J8Q A;  4DV0 L;  2E74 C;  3Q0A A;  4JI6 Q;  4DR4 L;  3S15 H;  4ZKC B;  1X3G A;  2K33 A;  2E2J H;  1O78 A;  3NEN A;  1SE2 A;  4YWM A;  1PH4 A;  4B9X A;  2VQF Q;  1NAP A;  4XDX A;  4JBK A;  4O42 A;  4RA8 A;  2PQA B;  4QL5 A;  1N33 L;  3NP8 A;  1Z7T A;  1S5B D;  1EWC A;  3NHH A;  1G51 A;  1YJN A;  3I56 A;  4ALP A;  2L0C A;  2RF4 A;  1XPR A;  1Y1W H;  2R7F A;  1J5E L;  4A93 G;  1HTP A;  1N8R C;  5K36 H;  1VQ6 A;  1KLG D;  3BZC A;  1J5E Q;  1UWV A;  1TY2 A;  2H5X A;  1PZJ D;  3HOU B;  4POF A;  1NE3 A;  1LT6 D;  2UUB Q;  2RBM A;  4MZ9 A;  3PO3 G;  5IGD A;  5AJ3 L;  1Y14 B;  4FXG C;  2JA8 G;  1RTO A;  3I70 A;  3IKJ A;  3OMC A;  4KI0 A;  1ML0 D;  3EVQ A;  3F2C A;  4XQJ A;  4OX9 Q;  3GP7 A;  2CW0 C;  1ENF A;  3KJP A;  3I90 A;  1AEX A;  3AFQ A;  3G4S A;  3UDG A;  5C44 G;  4GN3 B;  5E1F A;  2NVT H;  1OXS C;  3GDE A;  4KHZ A;  1PH5 A;  1KD1 C;  4N9P A;  3O13 A;  4JW0 A;  2ZTC A;  3KFU A;  2F0F A;  2Y0S G;  3ONA B;  1HR0 L;  3DWA A;  3OTO Q;  2RCN A;  1ZEQ X;  4TRD A;  1XTD A;  5I9P A;  2VQE L;  3A74 A;  1LTG D;  2JK8 A;  5M5Y B;  4RAU C;  4DR5 L;  2G5D A;  3H3V C;  5JJI A;  5JEA J;  2QKI C;  1GUT A;  4A3D H;  2O5I C;  3MTS A;  3D6W A;  3QWN A;  4AYB B;  2RSO A;  2JA5 B;  3CRK C;  1GXD C;  5C0X H;  4IZ8 A;  2MFI A;  2A5H A;  3IL8 A;  3KYH C;  3PUV A;  5KNC A;  2NB0 A;  4X65 Q;  5C3W A;  2WKD A;  3C2P A;  4UP7 A;  2BA1 A;  2QF7 A;  1IBM L;  2PO4 A;  1AH9 A;  1JR0 D;  4Z9C B;  3CRL C;  1K83 H;  5H1S E;  4K0K Q;  4A3M H;  4A3F H;  1KLU D;  1HFG A;  1LM0 A;  2A68 C;  2EQS A;  3CXC A;  4DV1 Q;  4LJZ C;  3OMG A;  1HNX Q;  1VF7 A;  2RSN A;  4ZK9 B;  1BCP C;  2HD3 A;  3ZJY C;  4DR2 Q;  1O7Y A;  2NUC A;  2NVY H;  1PXU A;  4WFN 3;  1G29 1;  4GS3 A;  1SYG A;  1GHJ A;  3A54 A;  4B3M L;  4A3J B;  1EY7 A;  1FVI A;  3GD7 A;  5GAH C;  4HJ8 A;  5A35 A;  2K4K A;  5JEA H;  3BDO A;  4KKS A;  1GUO A;  4JI7 Q;  5FOB B;  5LHY 1;  4O2D A;  4FF3 A;  3URY A;  4HIK A;  5LMN Q;  1L2F A;  3HKZ E;  2AQ3 B;  3KF8 B;  3J81 i;  1TWG B;  2CW0 D;  3VDY A;  1I50 B;  4BA2 I;  2F3V A;  2EYF A;  3TP7 A;  5BN4 A;  3GTM B;  4PG3 A;  3T53 B;  2Q8T A;  3NBH B;  2KOL A;  1JT8 A;  4OIK A;  1G8Z D;  2DJF C;  4L8J A;  2BH8 A;  4N8X 1;  4G7Z C;  1ZKO A;  4IPD A;  4HSV A;  2PMZ B;  3NWS A;  2WAQ B;  5L37 A;  1WCM G;  1SYC A;  1PFN A;  2F0D A;  3M9B A;  2N78 A;  2IX0 A;  1K0R A;  1SYD A;  1SSO A;  3GV3 A;  1CA6 A;  1ENA A;  3AFP A;  1D6E C;  2R3Z A;  1TT2 A;  1CM9 A;  1U4L A;  3NTK A;  1OO9 B;  4QB4 A;  2K5H A;  4GNX B;  3E0E A;  4IQZ A;  1IW7 D;  2NN6 H;  4K6D A;  2KQ3 A;  1F2M A;  4DFA A;  4X6A H;  3L7Z C;  3T16 A;  4X3S A;  4E6I A;  1K0S A;  4YHH Q;  1H9J A;  1PTO H;  3SGI A;  2YU9 B;  1MBY A;  2I0Q A;  4HJ5 A;  3F8T A;  2VB3 X;  5COR A;  2A6E C;  1ROD A;  4DK3 C;  3HOY B;  3K7U C;  5JAV A;  3HKS A;  3A0J A;  3HOY H;  4K6L A;  2VUM B;  4A3B H;  1IBL Q;  1VF5 C;  1ENC A;  3F2U A;  4RHS A;  4IFD J;  3BJU A;  1W3S A;  1C7Y A;  1IHZ A;  2L15 A;  3SK5 A;  2CFM A;  2I5H A;  2PNH A;  4X3U A;  3ND9 A;  3RZO H;  1PTO D;  2EYO A;  2WFW A;  2Z6B A;  3J7A V;  5FLX c;  4ODG A;  2OTL A;  2PI2 A;  2CQA A;  1EY0 A;  1DOM A;  2I5M X;  1PYB A;  4AH6 A;  3K0X A;  4UY8 C;  3CMA A;  2R7Z B;  1NY4 A;  2HDM A;  4DU9 A;  4K5X A;  1KAA A;  5DAU A;  4EX5 A;  3NBH A;  3S14 B;  2FJ2 A;  3RR5 A;  3UDF A;  1FD7 D;  5FO9 B;  2WAQ E;  4PMB A;  4HIM A;  3S1Q H;  1CSP A;  5GAD C;  2XN9 C;  4DXG A;  3F1Z A;  2N8N A;  1MJE A;  3KF8 A;  1IBK L;  2F3I A;  5FLX L;  1T5X D;  4ZAI A;  4DV6 L;  4K8I A;  2CH4 A;  3SDZ A;  4LF5 Q;  2OTJ A;  3GTM H;  1JOQ A;  5ELD A;  3NQT A;  4KTA A;  5ELF A;  3NSW A;  3GO5 A;  4JI0 L;  1EIG A;  4LK1 C;  2VW9 A;  2OCE A;  3KK7 A;  3Q6S A;  2RCF A;  4JI1 L;  4B3T L;  4EVO A;  4C3I B;  4FXD A;  4H02 A;  2BCO A;  1O7I A;  2QEJ C;  1TWH H;  3J7A F;  4IUT A;  1LUZ A;  4OO1 H;  4NXM Q;  2OEO A;  4TQU S;  3S2D B;  4KLK A;  2R6G A;  1A3V A;  2F0S A;  2NWG A;  4A3C G;  2EYJ A;  4APV A;  4YWL A;  4ZYS A;  5IGC A;  4DF7 A;  2ENB A;  3WOE A;  2PI2 E;  3I55 A;  3E9I A;  1WTR A;  1Q3L A;  1NNX A;  2RDH A;  3MEF A;  4FDB A;  3OYY A;  2B2V A;  1PLF A;  2AQ1 B;  4A3F B;  3PMF A;  4JI0 Q;  2XSC A;  3KLR A;  2E2D C;  5IT9 c;  3K8A A;  5CMD A;  3R2T A;  3L3O C;  3E6Z X;  2NZ1 D;  2LFN A;  2OXP A;  1Q8I A;  3HOZ H;  2P5Z X;  4JCV E;  2JA8 H;  1KRS A;  2BOS A;  1K73 C;  3JAM E;  1MD2 D;  5IYC H;  1EFW A;  1HA5 A;  4DAP A;  1B70 B;  1RHP A;  4BY7 G;  3K5O A;  3D0F A;  2ZXR A;  3H3V I;  2NVQ H;  4Q0F A;  5D65 A;  3IFT A;  1PH8 A;  1TWG H;  2M9V A;  5IIF A;  2AQ2 B;  5M5Y H;  2Z1C A;  1B1Z A;  2PZW A;  3RNU A;  1RJT A;  2KCN A;  3J7Z C;  3DLL A;  5M3M G;  3K5M A;  2IJ0 A;  4DUY Q;  1NBW A;  4LF6 Q;  1N32 Q;  1CKN B;  3KOJ A;  3RN5 A;  2OWO A;  4LF7 Q;  2R93 G;  3NQI A;  3TRZ A;  1JWM D;  1MHW C;  3BVM A;  4BA1 I;  1JIC A;  4RHR A;  3T1H Q;  2ZXP A;  4LF7 L;  4ZRZ A;  4BY1 G;  2A69 C;  4NDX A;  2MUY A;  1E7Z A;  1TWF H;  1PH1 A;  2F0N A;  2X6G A;  4LFA Q;  1WCM B;  4A3B G;  5HUR A;  1H95 A;  4LF5 L;  2ALY B;  1NUC A;  3ZYY X;  4L5R C;  1ET6 A;  1SNM A;  4YIJ A;  4C3J H;  1EWI A;  1BBX C;  3M4P A;  2PW7 A;  1Y8P B;  2MNA A;  1J6Q A;  5E3F A;  4GOP A;  1CHQ D;  4AYB G;  3EBE A;  1NMG A;  3HS0 C;  1GUG A;  2NYZ D;  2PCF B;  4M1U B;  1HHV A;  3GTL B;  2PQA A;  1YNN C;  3F2D A;  1EIH A;  1YNN D;  3BZD B;  1BCP B;  4PZ7 A;  2AMC B;  2JA5 H;  1RCV D;  4HIO A;  2TSS A;  2L55 A;  5C4X B;  1EWH A;  4BXX G;  1Q46 A;  4IUV A;  1VQE A;  3MFG A;  2SOB A;  3AU7 A;  1X3F A;  5D14 A;  1PTO F;  1V1Q A;  4R1J A;  3HFZ B;  1I5F A;  1E2Z A;  3J81 c;  1WTW A;  4X64 L;  1H9M A;  1A2T A;  5BR8 Q;  3S15 B;  5EJW A;  4AQY L;  2VS1 A;  3PF5 A;  2UXC Q;  4QY7 A;  4OO1 I;  1FNU A;  1SR3 A;  1JC7 A;  1STE A;  1EYD A;  2B2U C;  3CAM A;  2FMC A;  4OXP A;  1HH2 P;  4B9W A;  2B63 B;  3NPP A;  3OSO A;  4GOP C;  5C44 H;  1S40 A;  4ZKB B;  1EQT A;  4C3J G;  4OL7 A;  3C46 A;  2ZTE A;  2MP1 A;  1D5Z C;  1WCM H;  3D3R A;  3NEL A;  5EKI A;  1V1O A;  1R9T H;  1IKM A;  1H9S B;  1VQH A;  4GKK Q;  1DJR D;  2Q2T A;  3PO3 B;  3V96 A;  3QJY A;  4GLV B;  4DGZ A;  1PH7 A;  1UE6 A;  1SJH D;  3HOU H;  3ICE A;  1SN8 A;  1CZW A;  1TWF B;  2VY3 A;  4KV6 A;  3M3Y B;  4K8J A;  4PMW A;  2G9H D;  2E8G A;  4JOI A;  3QB3 A;  3OW2 A;  4ZCK A;  1K8A C;  2I5L X;  2R7Z G;  3MEH A;  2LKV A;  1TY0 A;  3HZX A;  3D6C A;  1IYJ B;  4YY3 Q;  4NPS A;  5CV9 A;  1STG A;  4IUU A;  1ET9 A;  2NVQ B;  3E3X A;  4XQQ A;  1RD9 D;  2WAQ G;  1U4R A;  1VQK A;  2A1A A;  2CWP A;  4TVA B;  1A15 A;  2K03 A;  2KCT A;  4L6T B;  1MGS A;  1VQJ A;  3SK6 A;  2Z0S A;  3HOZ B;  4K0K L;  3IAY A;  4IFD G;  1O7L A;  3BU2 A;  1R4Q B;  2QW7 A;  1HNW L;  2F4V Q;  3R2I A;  1F9P A;  1GM5 A;  2R7D A;  2Q2U A;  2PNR C;  2HIV A;  4QJF A;  3QO2 A;  3HOV B;  1UAP A;  5ELC A;  5EKL A;  1BKB A;  2ZT9 C;  3W5O A;  3I2Z A;  4A3C H;  2QDB A;  5C4J B;  3TZD A;  3PIO 3;  1Y1V B;  3D4R A;  1JJ2 A;  3EA6 A;  3T13 A;  4C3H H;  1JWS D;  3BVG A;  2CCZ A;  4DR1 L;  1I6H B;  4KY7 A;  3S2D H;  2CKZ B;  4QIW E;  4DN4 M;  4XYO A;  1S5D D;  4DXF A;  3T4A C;  4JBM A;  2NTS A;  3GTK B;  4DV1 L;  3STB D;  1QNK A;  4C3I H;  5EAY A;  1KXL A;  4XT3 B;  4MIU A;  2EZV A;  2K50 A;  3J81 E;  2V4D A;  4TKO B;  3PSI A;  4RGN A;  1OXX K;  3KLW A;  1FNV A;  1W6K A;  1ZYR D;  3OIQ A;  1D5M C;  3FDT A;  2LY7 A;  3G48 A;  3OIP A;  3HEJ A;  3H0G H;  4OEL B;  4QMG A;  3K58 A;  4KHP L;  3J81 j;  1KDA A;  3S1N B;  1MKH A;  4OO1 G;  4QCL A;  1VQ8 A;  4L5T A;  1E1O A;  1AN8 A;  3S24 A;  2B3G A;  3S1Q B;  5ELN A;  4GKK L;  1WD1 A;  1KDB A;  1EIY B;  1VDZ A;  4DR5 Q;  4IPC A;  1KNA A;  4HR7 B;  1DD2 A;  4DUY L;  4OWX B;  2E75 C;  2PW5 A;  2AWN A;  1I4H A;  2DUD A;  4F87 A;  2JA6 B;  3DM3 A;  1LYL A;  4OWT B;  4QGU A;  3KDF A;  1WTQ A;  2KHJ A;  1PZK D;  2WIN B;  5M3M H;  3VYR A;  2NN6 I;  4A3J G;  1JB3 A;  2K5D A;  1TXY A;  2RA4 A;  1X56 A;  2L1B A;  4K5W A;  1CA5 A;  1XNR Q;  1S5E D;  1SE4 A;  5FO7 B;  3GQB A;  1J8I A;  4HCS A;  2JYO A;  4N9T A;  3ERQ A;  1HXY D;  5D3I B;  4A3B B;  1BQQ T;  4B3M Q;  3KJO A;  3H0G B;  3SHL A;  3RN2 A;  2UXD Q;  1M1K C;  5M9O A;  3CCU A;  4FNF A;  1VQF A;  1Y69 U;  4DV4 Q;  1E22 A;  3PQI A;  2GVB A;  1E2W A;  1KAB A;  4PV1 C;  1MIU A;  5FJ8 H;  4JBW A;  3CCQ A;  2VUM H;  4IFD I;  2SNM A;  2XNA C;  3UDI A;  4IJL A;  2K75 A;  4WJ3 M;  1PHJ A;  4PZ8 A;  4EQN A;  1P8L A;  1STH A;  4IUQ A;  2Z6K A;  4GLX A;  1N33 Q;  1EFI D;  2DN8 A;  2XGT A;  1EIF A;  2K14 A;  2WB1 B;  3D4D A;  2UXC L;  3L2P A;  1VQB A;  5LMN W;  3CME A;  2OQ0 A;  2YTY A;  5ELO A;  3T1Y Q;  4XQN A;  2PMZ E;  5DM7 3;  1V43 A;  3S16 H;  2JJQ A;  4N8F A;  1C4Q A;  2MO1 A;  4A3G B;  3MXN A;  4KD3 A;  2A6H C;  1PZI D;  1EYC A;  4CKB A;  4IJH A;  1YHQ A;  4DUZ Q;  1Y8O B;  3FPU B;  1RTN A;  1SNP A;  1X55 A;  3OTO L;  3W1G A;  1AZQ A;  3CC7 A;  1GUS A;  4FO2 A;  1EEF D;  4DAY B;  1E1T A;  3EQL C;  4LUZ A;  5GAG C;  3J7Y W;  1NR2 A;  4ILW A;  1SRO A;  1YEZ A;  1TR5 A;  3JAM L;  1D1K A;  1U4P A;  2L9H A;  3D8G A;  2QIL A;  5ELE A;  4JI8 L;  1K8G A;  4H0L C;  1VQ9 A;  4BWG B;  1AP0 A;  3A55 A;  1SNC A;  4UP9 A;  3NE5 B;  2JP1 A;  3AB9 A;  1STA A;  1V9P A;  1PYS B;  2N3S A;  2B39 A;  1QZG A;  3MXG A;  4IN3 A;  4C2M H;  3JAM i;  2R92 H;  5E4X A;  1FR3 A;  2A19 A;  1B50 A;  3GTQ B;  1GVP A;  3PIP 3;  2NVY B;  4NW2 A;  1CZG A;  1QOH A; 
#chains in the Genus database with same CATH homology
 1WVL A;  5DM6 3;  3L9A X;  3VA5 A;  1I6V C;  5G3L F;  1V1P B;  4ABN A;  3OW7 A;  3LWE A;  1B3A A;  4FF4 A;  2KEE A;  2XWB B;  3DWQ A;  5KRU A;  4A3M B;  1ZXT A;  3BYY B;  5D3D A;  1WTV A;  3KUP A;  4QUC A;  2RKS A;  4ZUJ A;  1X32 A;  1A3U A;  1JOK A;  5EBC A;  4WJW A;  1II3 A;  2EVB A;  2NVX B;  3HRZ C;  2J7Z A;  4IFD H;  2NVT B;  4BBS B;  1UEA B;  2B2Y A;  5DEH A;  5FLX E;  3NXW A;  1EY4 A;  1QG7 A;  4PMC A;  2EOT A;  2O4X A;  2XWJ B;  1XTC D;  2F0O A;  2FHT A;  4CJ2 C;  1TS2 A;  1BOS A;  2A74 C;  1F9Q A;  3RD4 A;  4TSS A;  3QOJ A;  3J81 L;  3W3A A;  2KED A;  4H44 C;  4I7Z C;  3MA2 B;  1IKL A;  3S1M B;  1F2Z A;  2B2T C;  3NBI A;  4G4K A;  3TP5 A;  3MXP A;  3P75 A;  2WAC A;  5BN5 A;  3LNN A;  1S4Z A;  3SVM A;  1BNZ A;  2TMP A;  1KNE A;  1QE6 A;  5EPK A;  1LTS D;  1KTK A;  4BS9 A;  2ID0 A;  2E2J B;  1A3T A;  3UI2 A;  4U67 3;  1MSH A;  4ZQ3 A;  2G9D A;  5C0X G;  2C9O A;  5M3F B;  1IYV A;  1KDC A;  3P20 A;  5NUC A;  2DNE A;  3PUY A;  1XX8 A;  2K5W A;  1K8M A;  3DHQ A;  1F9R A;  5IT9 L;  1BCP F;  4HED A;  5M5W B;  2OT2 A;  2RDG A;  2R61 A;  1XWE A;  4F88 A;  3SXH A;  3K59 A;  2EYP A;  2KHS A;  3FKI B;  2K32 A;  4C2M B;  5I2Y A;  3C3L A;  1EY8 A;  1TWC B;  3FPP A;  1JCK B;  1FGB D;  1STN A;  1TWH B;  2EY1 A;  4CHT B;  2WP8 J;  1CFM A;  1I4R A;  5EPJ A;  3FRP B;  3VR2 A;  3WDN A;  3HGB A;  1B2T A;  3N6R A;  2PQE A;  1D2B A;  1SMY C;  5J39 A;  3SK8 A;  3NTH A;  2B2U A;  2F0P A;  1BCP D;  3NK9 A;  3OPO A;  3H94 A;  1ZYR C;  1FYC A;  3HKZ B;  3K5N A;  1EZ6 A;  1LTB D;  2Y0S B;  4KHV A;  4OGQ C;  5KYI A;  3I73 A;  2F0W A;  5T1I A;  5K36 G;  1Q1B A;  5LL6 S;  1LTT D;  4RFB A;  3NUC A;  3I4N B;  1NR4 A;  3Q23 A;  2O2L D;  3KLS A;  5FO8 B;  4R8I A;  3V2T A;  4MHE A;  1LT5 D;  1TKW B;  1CQF A;  3KBG A;  4KJO A;  1GJX A;  1K8O A;  2F0U A;  3R3O A;  1BUV T;  4IAL A;  1X3Q A;  1LAC A;  4R9W A;  3CQZ B;  3A8J E;  3T56 B;  5LL6 X;  4XT1 B;  1SE3 A;  2MJ8 A;  3P1H A;  1JOO A;  2VB2 X;  1OXU A;  3HOW B;  2BE5 C;  4PQX A;  2PZU A;  5EKK A;  5KYL A;  1ONL A;  3FMC A;  1LLR D;  1HA6 A;  1WTP A;  1B9M A;  3CHB D;  1A6X A;  5C5M A;  3CKI B;  3D4W A;  3E5S A;  3A7A B;  2PZT A;  4FF2 A;  2K6A A;  2EYL A;  5A2Q E;  3RZO B;  3I72 A;  4BY7 B;  3K6O A;  4FXK C;  1HTL D;  1OXV A;  4J6H A;  4RCO A;  5IOD A;  4K2K A;  1SDF A;  1PFB A;  3MHB A;  2ICI A;  4C56 C;  1L0X B;  1RKN A;  4F7X A;  3HP3 A;  2PPB C;  5CGK A;  3S1R B;  4FYD A;  1PTO B;  5CR3 A;  2K1B A;  2CHB D;  2L4N A;  2IPK D;  2MPM A;  4C3H B;  3N52 A;  1AZP A;  5JVG 3;  1TU2 B;  4L63 B;  1ESR A;  3MC0 B;  4H7B A;  1I4P A;  2B2V C;  1DXM A;  1SND A;  1EYA A;  1PTO C;  2K04 A;  1O80 A;  1ESF A;  2N55 A;  1Q1E A;  5F2D A;  3SR1 A;  1EY9 A;  2AUJ D;  4CKC A;  4OHJ A;  1QCB D;  5JJZ A;  5J22 A;  4RWS C;  4U68 A;  3J80 L;  2SDF A;  5C5L A;  3GTG B;  1M4V A;  3PO2 B;  3VYS A;  4M8A A;  4DK0 A;  3EFX D;  2A6E D;  4K14 A;  1CK1 A;  1EOT A;  4NP5 A;  1G91 A;  1EEI D;  5J1Z A;  1IYU A;  1HQM C;  2F0L A;  1L0Y B;  1PYW D;  5IGB A;  2B2Y C;  3VYT A;  1R9T B;  3DM1 A;  5CC4 A;  1V8Q A;  4HCE A;  2SNS A;  2Z4H A;  1K83 B;  4KY5 A;  2A68 D;  5CBA E;  1LO5 D;  2FFK B;  2DY8 A;  2D5D A;  2OF1 A;  3LWU A;  4DNR B;  1SEB D;  3OHX C;  3OWF A;  1YNJ C;  2K5Q A;  1F2L A;  1PDQ A;  3NTI A;  3SEB A;  4KD4 A;  3BDL A;  1IL8 A;  5C3X A;  2R92 B;  5DNF A;  5C4Z A;  4XIG S;  3GTO B;  2NBF A;  3S2H B;  4HMJ A;  1D1I A;  1DOK A;  4BBR B;  3E0J A;  1OXT A;  2LMC B;  4CGY B;  4EQO A;  3VR6 A;  4ZLT F;  4QIW B;  1O7Z A;  1LAB A;  1I3Q B;  3S9W A;  2JEA I;  2FIN B;  1STY A;  3QOL A;  2A73 B;  4IUP A;  2ICE C;  3MFY A;  5JOB A;  4V0B A;  4K2L A;  2WII B;  1DYQ A;  4C3H G;  1E0B A;  1YNJ D;  2B2W A;  2HDL A;  3DXJ C;  1B53 A;  5C3E B;  1LTA D;  1TS5 A;  4RGM A;  3TN2 A;  4DK1 A;  2CVR A;  4CJ0 B;  3A8K E;  1CHP D;  2EY2 A;  3LX0 A;  4A3E B;  1E2V A;  1JWU D;  1S5C D;  4KJN A;  2H4O A;  2M00 A;  4X3T A;  2F0J A;  4NMZ A;  1J9O A;  4F8M A;  2JA8 B;  3PUX A;  1G2T A;  3X3M A;  4A3K B;  4OIJ A;  4CJ1 B;  4B08 A;  4DAY A;  2H1E A;  1I4G A;  1Q90 A;  5I2X A;  3SK4 A;  3FVQ A;  1EL0 A;  5IOC A;  1AW7 A;  5EBD A;  4LMQ D;  2AWO A;  2RVL A;  4HN7 A;  3Q22 A;  1B4O A;  5M3M B;  2Q8R E;  1TII D;  3GTP B;  2K05 A;  4BY1 B;  1CTM A;  4HSP A;  2EPB A;  1DM0 B;  3MVV A;  3IFD A;  4R8N A;  4XXE A;  1TQO A;  2BDO A;  4HMI A;  2KCC A;  2EDG A;  4O1N A;  4ULL A;  1CT1 D;  2F1M A;  5EPL A;  2MHV A;  4ME5 A;  3M7G A;  5JPN C;  2EYH A;  1BF4 A;  2NTT A;  2F03 A;  3VA7 A;  1SXT A;  3QG1 A;  3V05 A;  1RDP D;  4QF4 A;  1LT4 D;  4LAA A;  5C6A A;  2N88 A;  2VNU D;  3M85 A;  3DEP A;  5FK9 C;  4KN7 C;  2NN6 G;  4Q5V A;  4KKT A;  4RGO S;  4DNT B;  3ND8 A;  1SYB A;  1H9S A;  2J0T D;  2EXZ A;  3BS1 A;  1IW7 C;  5IT9 E;  2C5C A;  2F0M A;  1G2S A;  2EJG C;  1ILQ A;  3G7L A;  3VYU A;  1BO0 A;  2IL8 A;  2F4I A;  3S17 B;  3M4Y A;  1M8A A;  2DY7 A;  2XRQ D;  2KVM A;  3BG3 A;  2DNC A;  3TBI B;  5COY A;  3TP6 A;  3I3C A;  1UNS A;  3K0Y A;  5KND A;  2YYZ A;  2JSO A;  1HRJ A;  1SYE A;  2VXW A;  5CV4 A;  4DA2 A;  4RH6 A;  4FVM A;  5EQ0 A;  1QJO A;  4J1M A;  4G7H C;  1BR9 A;  4JK1 C;  5C0X J;  3KLS X;  3WOF A;  2HQE A;  1DCZ A;  4GZY C;  2SEB D;  2F0V A;  2F0K A;  4XYQ A;  2L11 A;  2JA7 B;  2GA4 B;  3R8B A;  2Z8L A;  2KEC A;  5ELB A;  3ERO A;  4IUR A;  2R93 B;  4RCN A;  1EU4 A;  3HOX B;  2JE6 I;  5KNB A;  2D2C C;  3OOC A;  3R93 A;  1DZ1 A;  2IX1 A;  1T5E A;  1QNU A;  2I07 B;  3FEW X;  4RKL A;  4EQP A;  4RKB A;  5IGG A;  5EGT A;  1Q12 A;  3MZ5 A;  3GTJ B;  4C3I G;  4FP5 D;  4IUN A;  4KN4 C;  3KBX A;  5IGF A;  3TZU A;  1GOZ A;  3VR5 A;  4WOR A;  5CV8 A;  5FKA C;  3OWE B;  2B2T A;  2L5T A;  5TSS A;  4NKL A;  5JPM C;  2K01 A;  2B2W C;  5KGU A;  2EJF C;  3Q24 A;  1ICW A;  4A93 B;  4MN3 A;  2ZXO A;  1SNQ A;  2I46 A;  5I6W A;  3RZD B;  2XRS D;  2B8F A;  2O5J C;  1FNW A;  1H9R A;  1WTX A;  3K5L A;  4S3S A;  4G7O C;  1X3P A;  2XIW A;  5G3L D;  2Z4I A;  2E2H B;  1D5X C;  3TME A;  4WRD A;  2M2L A;  1I4X A;  1S5F D;  5I6Y A;  4HTH A;  3A56 A;  4UDU C;  3C1E A;  4C1N I;  1SBB B;  1GHK A;  4C3J B;  4H13 C;  1V1P A;  2D62 A;  4KK7 A;  1ILP A;  3U9S A;  2E76 C;  1TVX A;  5CV6 A;  1DOL A;  3M7N A;  3MXU A;  1LTI D;  4A3D B;  4ID6 A;  4FF1 A;  3C1F A;  5BN3 A;  3A8I E;  3BDC A;  1A2U A;  2WV6 D;  1PRT D;  5E4W C;  1GUW A;  3ITP A;  1F2Y A;  4EGV A;  1C48 A;  1LV9 A;  1JQY D;  1B9N A;  3I91 A;  1GUN A;  3GV6 A;  3QIA A;  4PNY A;  2F0T A;  1PRT C;  5I4D A;  1VCI A;  3DMU A;  2F3W A;  3K57 A;  3G6J B;  1CQV A;  1SAP A;  5I9O A;  3PV0 A;  4C1N K;  4I65 A;  3VR3 A;  3MAQ A;  3S16 B;  2A69 D;  1JE4 A;  2X69 A;  2EYM A;  1G6Z A;  1QIL A;  5KIX A;  4G57 A;  1NSN S;  2JXM B;  4UAI A;  1TS3 A;  1DON A;  4RGT A;  2HCC A;  1Y1W B;  2WKC A;  2F0H A;  3PUZ A;  2QCP X;  2F0G A;  2HCI A;  2X6L A;  1QWY A;  2EE1 A;  2KJX A;  3I8Z A;  5CBE E;  2LS0 1;  1HQR D;  3PUW A;  2K28 A;  1R4P B;  1PRT B;  1QB5 D;  4Y7N B;  2FMM A;  2IWH A;  2BDN A;  1F77 A;  3DEO A;  4XTC S;  1STB A;  2E2I B;  1VMP A;  1B44 D;  1HUM A;  1RF2 D;  2BE5 D;  1LT3 D;  5AFW A;  2B8G A;  5K5P A;  2RQX A;  1VMC A;  5IGE A;  1NCV A;  3RMH A;  2XVS A;  3RUZ A;  5T1G A;  1SNO A;  5KEE A;  1MI2 A;  1Y8N B;  1I4Q A;  5A2Q L;  2PYK A;  5CYU A;  2BA0 A;  3SE0 A;  2MGS A;  2IW3 A;  1HUN A;  3TSS A;  3D31 A;  1C8C A;  1F9S A;  3K7A B;  3I4M B;  2KUM A;  3MWY W;  5HGT A;  1EY6 A;  4CKE A;  1H9K A;  1MSG A;  4P2C B;  1AFP A;  3NWT A;  1CI3 M;  2Q8I B;  1TS4 A;  1PFM A;  2KA7 A;  5C0X I;  1Z6H A;  2D9U A;  5M5X B;  1LTR D;  1UUP A;  2RDF A;  1JOR A;  3EJI A;  2L12 A;  1SYF A;  4HAE A;  1EZ8 A;  4K5V A;  3H91 A;  3TDQ A;  1HPC A;  1Z47 A;  2F0E A;  2J4X A;  2JEB I;  5C4H A;  2IT1 A;  3VR4 A;  1U9R A;  4QUF A;  1SFO B;  2HUG A;  1PRT F;  3TP8 A;  3H09 A;  3DUZ A;  3J80 E;  3M4O B;  4A3I B;  4V19 0;  4ZUI A;  3U9O A;  2F0Q A;  3T51 B;  5JEA G;  1BDO A;  1EQV A;  1EY5 A;  2F0I A;  4DAV A;  5JVH 3;  4KMU C;  1EU3 A;  1SMY D;  5CV5 A;  1WD0 A;  5CV7 A;  1WTO A;  2K7V A;  2EJM A;  1TWA B;  3P7J A;  1SJE D;  3A7L A;  1XXG A;  3X3N A;  3W2D A;  3RLF A;  2EY5 A;  2EY6 A;  1XYI A;  3I4L A;  3H6M A;  4KY6 A;  4KKU A;  1HCZ A;  2A6H D;  1U4M A;  3AMU A;  3DWP A;  1W6J A;  3HG9 A;  5C44 B;  4X3K A;  5ISR A;  4CBV A;  3CU7 A;  1PMR A;  1BXT A;  3BVZ A;  2AUK A;  2IX3 A;  3BYT B;  1HFN A;  4J8Q A;  2E74 C;  3Q0A A;  4ZKC B;  2K33 A;  1O78 A;  1SE2 A;  4B9X A;  1NAP A;  4XDX A;  4O42 A;  4RA8 A;  3NP8 A;  1Z7T A;  1S5B D;  1EWC A;  3NHH A;  2L0C A;  1HTP A;  5K36 H;  1KLG D;  1TY2 A;  1PZJ D;  3HOU B;  1LT6 D;  2RBM A;  5IGD A;  4FXG C;  1RTO A;  3I70 A;  3IKJ A;  3OMC A;  4KI0 A;  1ML0 D;  3EVQ A;  4XQJ A;  3GP7 A;  2CW0 C;  1ENF A;  3I90 A;  1AEX A;  5E1F A;  1OXS C;  4KHZ A;  4N9P A;  3O13 A;  2F0F A;  3ONA B;  3DWA A;  1ZEQ X;  4TRD A;  5I9P A;  1LTG D;  5M5Y B;  4RAU C;  3H3V C;  5JEA J;  2QKI C;  1GUT A;  2O5I C;  3MTS A;  3D6W A;  3QWN A;  4AYB B;  2RSO A;  2JA5 B;  3CRK C;  1GXD C;  5C0X H;  4IZ8 A;  2A5H A;  3IL8 A;  3PUV A;  5KNC A;  2NB0 A;  5C3W A;  2WKD A;  3C2P A;  2BA1 A;  2QF7 A;  2PO4 A;  1JR0 D;  4Z9C B;  3CRL C;  1KLU D;  1HFG A;  2A68 C;  4LJZ C;  3OMG A;  1VF7 A;  2RSN A;  4ZK9 B;  1BCP C;  1O7Y A;  2NUC A;  4WFN 3;  1PXU A;  1G29 1;  1SYG A;  1GHJ A;  3A54 A;  4A3J B;  1EY7 A;  3GD7 A;  5A35 A;  5JEA H;  3BDO A;  4KKS A;  1GUO A;  5FOB B;  5LHY 1;  4FF3 A;  3URY A;  2AQ3 B;  1TWG B;  2CW0 D;  1I50 B;  4BA2 I;  2F3V A;  2EYF A;  3TP7 A;  5BN4 A;  3GTM B;  3T53 B;  2Q8T A;  2KOL A;  1G8Z D;  4OIK A;  4L8J A;  4G7Z C;  1ZKO A;  4HSV A;  2PMZ B;  3NWS A;  2WAQ B;  1SYC A;  1PFN A;  2F0D A;  2IX0 A;  1SYD A;  1SSO A;  3GV3 A;  1CA6 A;  1ENA A;  1D6E C;  2R3Z A;  1TT2 A;  1CM9 A;  1U4L A;  3NTK A;  1OO9 B;  4QB4 A;  4IQZ A;  1IW7 D;  2NN6 H;  4K6D A;  2KQ3 A;  1F2M A;  4DFA A;  3L7Z C;  3T16 A;  4X3S A;  4E6I A;  1H9J A;  1PTO H;  2YU9 B;  1MBY A;  2VB3 X;  5COR A;  2A6E C;  1ROD A;  3HOY B;  5JAV A;  4K6L A;  2VUM B;  1VF5 C;  1ENC A;  3F2U A;  4RHS A;  4IFD J;  1IHZ A;  3SK5 A;  4X3U A;  3ND9 A;  1PTO D;  2EYO A;  3J7A V;  4ODG A;  2CQA A;  1EY0 A;  1DOM A;  2R7Z B;  2HDM A;  4DU9 A;  4K5X A;  1KAA A;  5DAU A;  3NBH A;  3S14 B;  2FJ2 A;  1FD7 D;  5FO9 B;  4PMB A;  2XN9 C;  4DXG A;  3KF8 A;  5FLX L;  1T5X D;  4ZAI A;  4K8I A;  3SDZ A;  1JOQ A;  5ELD A;  3NQT A;  4KTA A;  5ELF A;  3NSW A;  3GO5 A;  1EIG A;  4LK1 C;  3KK7 A;  3Q6S A;  4EVO A;  4C3I B;  4FXD A;  2BCO A;  2QEJ C;  3J7A F;  4IUT A;  4OO1 H;  2OEO A;  4TQU S;  3S2D B;  2R6G A;  1A3V A;  2F0S A;  2NWG A;  2EYJ A;  4ZYS A;  5IGC A;  4DF7 A;  2ENB A;  3WOE A;  1WTR A;  1Q3L A;  2RDH A;  2B2V A;  1PLF A;  2AQ1 B;  4A3F B;  3PMF A;  2XSC A;  3KLR A;  2E2D C;  5CMD A;  3R2T A;  3L3O C;  3E6Z X;  2NZ1 D;  2LFN A;  2OXP A;  1Q8I A;  2BOS A;  3JAM E;  1MD2 D;  1HA5 A;  4DAP A;  1RHP A;  3K5O A;  2ZXR A;  4Q0F A;  5D65 A;  3IFT A;  2M9V A;  5IIF A;  2AQ2 B;  2Z1C A;  1B1Z A;  2PZW A;  1RJT A;  2KCN A;  3K5M A;  2IJ0 A;  3NQI A;  1JWM D;  3BVM A;  4BA1 I;  1JIC A;  4RHR A;  2ZXP A;  4ZRZ A;  2A69 C;  4NDX A;  2MUY A;  2F0N A;  2X6G A;  1WCM B;  5HUR A;  1NUC A;  3ZYY X;  1ET6 A;  1SNM A;  4YIJ A;  1BBX C;  2PW7 A;  1Y8P B;  5E3F A;  1CHQ D;  3HS0 C;  1GUG A;  2NYZ D;  2PCF B;  4M1U B;  1HHV A;  3GTL B;  1YNN C;  1EIH A;  1YNN D;  3BZD B;  1BCP B;  1RCV D;  2TSS A;  2L55 A;  5C4X B;  1EWH A;  4IUV A;  3MFG A;  2SOB A;  3AU7 A;  5D14 A;  1PTO F;  1E2Z A;  1WTW A;  1H9M A;  1A2T A;  3S15 B;  5EJW A;  4OO1 I;  1FNU A;  1JC7 A;  1STE A;  1EYD A;  2B2U C;  2FMC A;  4B9W A;  2B63 B;  3NPP A;  3OSO A;  4ZKB B;  1EQT A;  4C3J G;  4OL7 A;  3C46 A;  2MP1 A;  1D5Z C;  3D3R A;  5EKI A;  1V1O A;  1IKM A;  1H9S B;  1DJR D;  3PO3 B;  3V96 A;  3QJY A;  4DGZ A;  1SJH D;  1CZW A;  1TWF B;  4KV6 A;  3M3Y B;  4K8J A;  4PMW A;  2G9H D;  3QB3 A;  3MEH A;  2LKV A;  1TY0 A;  3HZX A;  3D6C A;  5CV9 A;  1STG A;  4IUU A;  1ET9 A;  2NVQ B;  4XQQ A;  1RD9 D;  1U4R A;  1A15 A;  2K03 A;  4L6T B;  1MGS A;  3SK6 A;  3HOZ B;  3IAY A;  4IFD G;  1O7L A;  1R4Q B;  3R2I A;  1F9P A;  2PNR C;  3QO2 A;  3HOV B;  1UAP A;  5ELC A;  5EKL A;  2ZT9 C;  2QDB A;  5C4J B;  3TZD A;  3PIO 3;  1Y1V B;  3D4R A;  3EA6 A;  3T13 A;  1JWS D;  3BVG A;  1I6H B;  4KY7 A;  4DN4 M;  4XYO A;  1S5D D;  4DXF A;  3T4A C;  2NTS A;  3GTK B;  1QNK A;  4XT3 B;  4MIU A;  2EZV A;  3J81 E;  2V4D A;  4TKO B;  4RGN A;  1OXX K;  1FNV A;  1W6K A;  1ZYR D;  3OIQ A;  1D5M C;  3FDT A;  2LY7 A;  3OIP A;  3HEJ A;  4QMG A;  3K58 A;  4QCL A;  1KDA A;  3S1N B;  4OO1 G;  1AN8 A;  3S1Q B;  1WD1 A;  1KDB A;  1VDZ A;  1KNA A;  4HR7 B;  1DD2 A;  2E75 C;  2PW5 A;  2AWN A;  1I4H A;  4F87 A;  2JA6 B;  1WTQ A;  1PZK D;  2WIN B;  3VYR A;  2NN6 I;  1JB3 A;  2K5D A;  2RA4 A;  2L1B A;  4K5W A;  1CA5 A;  1S5E D;  1SE4 A;  5FO7 B;  3GQB A;  1J8I A;  4HCS A;  2JYO A;  4N9T A;  3ERQ A;  1HXY D;  5D3I B;  4A3B B;  1BQQ T;  3H0G B;  3SHL A;  5M9O A;  4FNF A;  1Y69 U;  1E2W A;  1KAB A;  4PV1 C;  4JBW A;  4IFD I;  2SNM A;  2XNA C;  4EQN A;  1STH A;  4IUQ A;  1EFI D;  2DN8 A;  2WB1 B;  3D4D A;  4XQN A;  5DM7 3;  1V43 A;  1C4Q A;  4A3G B;  3MXN A;  4KD3 A;  2A6H C;  1PZI D;  1EYC A;  4CKB A;  1Y8O B;  3FPU B;  1RTN A;  1SNP A;  1AZQ A;  1GUS A;  4FO2 A;  1EEF D;  3EQL C;  3J7Y W;  1NR2 A;  4ILW A;  1TR5 A;  3JAM L;  1D1K A;  1U4P A;  2L9H A;  3D8G A;  2QIL A;  5ELE A;  4H0L C;  4BWG B;  1AP0 A;  3A55 A;  1SNC A;  3NE5 B;  2JP1 A;  3AB9 A;  1STA A;  2B39 A;  3MXG A;  4IN3 A;  5E4X A;  1FR3 A;  1B50 A;  3GTQ B;  3PIP 3;  2NVY B;  4NW2 A;  1CZG A;  1QOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...