5CS1A

The structure of the nk1 fragment of hgf/sf
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 38
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 5cs1A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 5cs1A01
4UAOA 2Q8AA 3U73A 2F83A 2K4RA 1NL2A 3NXPA 2K51A 1JFNA 4R1BA 4Z09A 3SRIA 5CS5A 2SPTA 1PKRA 2DOIA 3BT1A 4BV7A 1HKYA 3HN4A 5CS1A 3E6PL 5COEA 2YILA 3HMTA 1KI0A 1W81A 1YXEA 1W8KA 3K65A 2PF1A 2HPPP 3SP8A 3BT2A 1BHTA 4NZQA 3MKPA 4KIVA 1NK1A 2PK4A 4BVVA 5EOKA 4IUAA 2DOHX 2FEBA 2QJ2A 4BVCA 2J8LA 1B2IA 5CT3A 2LL4M 4BVWA 5CSQA 1HPJA 2Z8WA 1TPKA 1KDUA 1A0HA 1GMNA 5CT2A 1Z40A 1PMLA 4Z0DA 4Z0EA 2X2ZA 4APLA 2KNFA 2L0SA 4O03A 1I8NA 3HMRA 4BVDA 2QJ4A 5CS9A 4BV5A 2HGFA 4Z0FA 3ZLEA 4DURA 2KJ4A 2HPQP 5I25A 1HPKA 2Q8BA 5CP9A 1KRNA 1GMOA 1I5KA 4R19A 2Z8VA 4HZHA 1NL1A 2FD6A 2K13X 3LAQA 2Y8RA 3ZWZA 1GP9A 4R1AA 1CEAA 2I9BA 4D3CA 1KIVA 2PF2A 4APMA 2YIPA 3SRJA 2I9AA 5HPGA 2J8JA 1CEBA 4UV6A 1I71A 4R1CA 5EODA 2LL3A 2YIOA 4A5TS 1URKA 3KIVA 5CS3A 1PK2A 1PMKA 1PK4A 3HMSA 4CIKA 5CT1A
chains in the Genus database with same CATH superfamily
4UAOA 2Q8AA 3U73A 2F83A 2K4RA 1NL2A 3NXPA 2K51A 1JFNA 4R1BA 4Z09A 3SRIA 5CS5A 4YIZA 2SPTA 1PKRA 2DOIA 3BT1A 4BV7A 1HKYA 3HN4A 5CS1A 3E6PL 5COEA 2YILA 3HMTA 1KI0A 1W81A 1YXEA 2KL5A 1W8KA 3K65A 2PF1A 2HPPP 3SP8A 3BT2A 1BHTA 4NZQA 3MKPA 4KIVA 1NK1A 2PK4A 4BVVA 5EOKA 4IUAA 2DOHX 2FEBA 2QJ2A 4BVCA 2J8LA 1B2IA 5CT3A 2LL4M 4BVWA 5CSQA 1HPJA 2Z8WA 1TPKA 1KDUA 1A0HA 1GMNA 5CT2A 1Z40A 1PMLA 4Z0DA 4Z0EA 2X2ZA 4APLA 2KNFA 2L0SA 4O03A 1I8NA 3HMRA 4BVDA 2QJ4A 5CS9A 4BV5A 2HGFA 4Z0FA 3ZLEA 4DURA 2KJ4A 2HPQP 5I25A 1HPKA 2Q8BA 5CP9A 1KRNA 4YIVA 1GMOA 1I5KA 4R19A 2Z8VA 4HZHA 1NL1A 2FD6A 2K13X 3LAQA 2Y8RA 3ZWZA 1GP9A 4R1AA 1CEAA 2I9BA 4D3CA 1KIVA 2PF2A 4APMA 2YIPA 3SRJA 2I9AA 5HPGA 2J8JA 1CEBA 4UV6A 1I71A 4R1CA 5EODA 2LL3A 2YIOA 4A5TS 1URKA 3KIVA 5CS3A 1PK2A 1PMKA 1PK4A 3HMSA 4CIKA 5CT1A
chains in the Genus database with same CATH topology
4UAOA 2Q8AA 3U73A 2F83A 2K4RA 1NL2A 3NXPA 2K51A 1JFNA 4R1BA 4Z09A 3SRIA 5CS5A 4YIZA 2SPTA 1PKRA 2DOIA 3BT1A 4BV7A 1HKYA 3HN4A 5CS1A 3E6PL 5COEA 2YILA 3HMTA 1KI0A 1W81A 1YXEA 2KL5A 1W8KA 3K65A 2PF1A 2HPPP 3SP8A 3BT2A 1BHTA 4NZQA 3MKPA 4KIVA 1NK1A 2PK4A 4BVVA 5EOKA 4IUAA 2DOHX 2FEBA 2QJ2A 4BVCA 2J8LA 1B2IA 5CT3A 2LL4M 4BVWA 5CSQA 1HPJA 2Z8WA 1TPKA 1KDUA 1A0HA 1GMNA 5CT2A 1Z40A 1PMLA 4Z0DA 4Z0EA 2X2ZA 4APLA 2KNFA 2L0SA 4O03A 1I8NA 3HMRA 4BVDA 2QJ4A 5CS9A 4BV5A 2HGFA 4Z0FA 3ZLEA 4DURA 2KJ4A 2HPQP 5I25A 1HPKA 2Q8BA 5CP9A 1KRNA 4YIVA 1GMOA 1I5KA 4R19A 2Z8VA 4HZHA 1NL1A 2FD6A 2K13X 3LAQA 2Y8RA 3ZWZA 1GP9A 4R1AA 1CEAA 2I9BA 4D3CA 1KIVA 2PF2A 4APMA 2YIPA 3SRJA 2I9AA 5HPGA 2J8JA 1CEBA 4UV6A 1I71A 4R1CA 5EODA 2LL3A 2YIOA 4A5TS 1URKA 3KIVA 5CS3A 1PK2A 1PMKA 1PK4A 3HMSA 4CIKA 5CT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UAO A;  2Q8A A;  3U73 A;  2F83 A;  2K4R A;  1NL2 A;  3NXP A;  2K51 A;  1JFN A;  4R1B A;  4Z09 A;  3SRI A;  5CS5 A;  2SPT A;  1PKR A;  2DOI A;  3BT1 A;  4BV7 A;  1HKY A;  3HN4 A;  5CS1 A;  3E6P L;  5COE A;  2YIL A;  3HMT A;  1KI0 A;  1W81 A;  1YXE A;  1W8K A;  3K65 A;  2PF1 A;  2HPP P;  3SP8 A;  3BT2 A;  1BHT A;  4NZQ A;  3MKP A;  4KIV A;  1NK1 A;  2PK4 A;  4BVV A;  5EOK A;  4IUA A;  2DOH X;  2FEB A;  2QJ2 A;  4BVC A;  2J8L A;  1B2I A;  5CT3 A;  2LL4 M;  4BVW A;  5CSQ A;  1HPJ A;  2Z8W A;  1TPK A;  1KDU A;  1A0H A;  1GMN A;  5CT2 A;  1Z40 A;  1PML A;  4Z0D A;  4Z0E A;  2X2Z A;  4APL A;  2KNF A;  2L0S A;  4O03 A;  1I8N A;  3HMR A;  4BVD A;  2QJ4 A;  5CS9 A;  4BV5 A;  2HGF A;  4Z0F A;  3ZLE A;  4DUR A;  2KJ4 A;  2HPQ P;  5I25 A;  1HPK A;  2Q8B A;  5CP9 A;  1KRN A;  1GMO A;  1I5K A;  4R19 A;  2Z8V A;  4HZH A;  1NL1 A;  2FD6 A;  2K13 X;  3LAQ A;  2Y8R A;  3ZWZ A;  1GP9 A;  4R1A A;  1CEA A;  2I9B A;  4D3C A;  1KIV A;  2PF2 A;  4APM A;  2YIP A;  3SRJ A;  2I9A A;  5HPG A;  2J8J A;  1CEB A;  4UV6 A;  1I71 A;  4R1C A;  5EOD A;  2LL3 A;  2YIO A;  4A5T S;  1URK A;  3KIV A;  5CS3 A;  1PK2 A;  1PMK A;  1PK4 A;  3HMS A;  4CIK A;  5CT1 A; 
#chains in the Genus database with same CATH topology
 4UAO A;  2Q8A A;  3U73 A;  2F83 A;  2K4R A;  1NL2 A;  3NXP A;  2K51 A;  1JFN A;  4R1B A;  4Z09 A;  3SRI A;  5CS5 A;  4YIZ A;  2SPT A;  1PKR A;  2DOI A;  3BT1 A;  4BV7 A;  1HKY A;  3HN4 A;  5CS1 A;  3E6P L;  5COE A;  2YIL A;  3HMT A;  1KI0 A;  1W81 A;  1YXE A;  2KL5 A;  1W8K A;  3K65 A;  2PF1 A;  2HPP P;  3SP8 A;  3BT2 A;  1BHT A;  4NZQ A;  3MKP A;  4KIV A;  1NK1 A;  2PK4 A;  4BVV A;  5EOK A;  4IUA A;  2DOH X;  2FEB A;  2QJ2 A;  4BVC A;  2J8L A;  1B2I A;  5CT3 A;  2LL4 M;  4BVW A;  5CSQ A;  1HPJ A;  2Z8W A;  1TPK A;  1KDU A;  1A0H A;  1GMN A;  5CT2 A;  1Z40 A;  1PML A;  4Z0D A;  4Z0E A;  2X2Z A;  4APL A;  2KNF A;  2L0S A;  4O03 A;  1I8N A;  3HMR A;  4BVD A;  2QJ4 A;  5CS9 A;  4BV5 A;  2HGF A;  4Z0F A;  3ZLE A;  4DUR A;  2KJ4 A;  2HPQ P;  5I25 A;  1HPK A;  2Q8B A;  5CP9 A;  1KRN A;  4YIV A;  1GMO A;  1I5K A;  4R19 A;  2Z8V A;  4HZH A;  1NL1 A;  2FD6 A;  2K13 X;  3LAQ A;  2Y8R A;  3ZWZ A;  1GP9 A;  4R1A A;  1CEA A;  2I9B A;  4D3C A;  1KIV A;  2PF2 A;  4APM A;  2YIP A;  3SRJ A;  2I9A A;  5HPG A;  2J8J A;  1CEB A;  4UV6 A;  1I71 A;  4R1C A;  5EOD A;  2LL3 A;  2YIO A;  4A5T S;  1URK A;  3KIV A;  5CS3 A;  1PK2 A;  1PMK A;  1PK4 A;  3HMS A;  4CIK A;  5CT1 A; 
#chains in the Genus database with same CATH homology
 4UAO A;  2Q8A A;  3U73 A;  2F83 A;  2K4R A;  1NL2 A;  3NXP A;  2K51 A;  1JFN A;  4R1B A;  4Z09 A;  3SRI A;  5CS5 A;  4YIZ A;  2SPT A;  1PKR A;  2DOI A;  3BT1 A;  4BV7 A;  1HKY A;  3HN4 A;  5CS1 A;  3E6P L;  5COE A;  2YIL A;  3HMT A;  1KI0 A;  1W81 A;  1YXE A;  2KL5 A;  1W8K A;  3K65 A;  2PF1 A;  2HPP P;  3SP8 A;  3BT2 A;  1BHT A;  4NZQ A;  3MKP A;  4KIV A;  1NK1 A;  2PK4 A;  4BVV A;  5EOK A;  4IUA A;  2DOH X;  2FEB A;  2QJ2 A;  4BVC A;  2J8L A;  1B2I A;  5CT3 A;  2LL4 M;  4BVW A;  5CSQ A;  1HPJ A;  2Z8W A;  1TPK A;  1KDU A;  1A0H A;  1GMN A;  5CT2 A;  1Z40 A;  1PML A;  4Z0D A;  4Z0E A;  2X2Z A;  4APL A;  2KNF A;  2L0S A;  4O03 A;  1I8N A;  3HMR A;  4BVD A;  2QJ4 A;  5CS9 A;  4BV5 A;  2HGF A;  4Z0F A;  3ZLE A;  4DUR A;  2KJ4 A;  2HPQ P;  5I25 A;  1HPK A;  2Q8B A;  5CP9 A;  1KRN A;  4YIV A;  1GMO A;  1I5K A;  4R19 A;  2Z8V A;  4HZH A;  1NL1 A;  2FD6 A;  2K13 X;  3LAQ A;  2Y8R A;  3ZWZ A;  1GP9 A;  4R1A A;  1CEA A;  2I9B A;  4D3C A;  1KIV A;  2PF2 A;  4APM A;  2YIP A;  3SRJ A;  2I9A A;  5HPG A;  2J8J A;  1CEB A;  4UV6 A;  1I71 A;  4R1C A;  5EOD A;  2LL3 A;  2YIO A;  4A5T S;  1URK A;  3KIV A;  5CS3 A;  1PK2 A;  1PMK A;  1PK4 A;  3HMS A;  4CIK A;  5CT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...