5CS5A

The structure of the nk1 fragment of hgf/sf complexed with pipes
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
173
structure length
173
Chain Sequence
TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 43
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 5cs5A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 5cs5A01
2LL3A 1W81A 2K4RA 4A5TS 2Q8AA 1HPKA 2PK4A 1HPJA 2J8JA 3U73A 3HMRA 4Z0EA 2Z8WA 4R1CA 1KIVA 2Y8RA 3HMSA 5CP9A 2YIOA 5HPGA 2I9AA 2PF1A 2DOHX 3ZLEA 1KRNA 5CS5A 4Z0DA 1KDUA 4O03A 4D3CA 3SP8A 3ZWZA 3LAQA 2HPQP 3NXPA 3K65A 2I9BA 1KI0A 1PKRA 5CT3A 2PF2A 2HGFA 2Z8VA 2L0SA 3E6PL 4BVVA 4BV5A 1B2IA 2DOIA 1NL1A 2F83A 4DURA 2K13X 1GMOA 1CEBA 2YILA 1I5KA 1I8NA 1GP9A 2QJ4A 3KIVA 3SRIA 1BHTA 4NZQA 1HKYA 1CEAA 5COEA 4BVDA 4UAOA 4APMA 2FEBA 1PMLA 1PK4A 4BVCA 4BV7A 2FD6A 5CSQA 1A0HA 1PK2A 2Q8BA 4Z0FA 1JFNA 1PMKA 4KIVA 2SPTA 2K51A 4UV6A 3BT1A 1YXEA 5EOKA 5I25A 5CS1A 2HPPP 1TPKA 5CS9A 5CT1A 2YIPA 2J8LA 4CIKA 3HN4A 4APLA 5CT2A 1Z40A 2QJ2A 2KJ4A 4R19A 4R1BA 3HMTA 1URKA 1NL2A 4HZHA 3MKPA 1NK1A 4BVWA 1I71A 1W8KA 4Z09A 1GMNA 4IUAA 5CS3A 5EODA 4R1AA 2LL4M 2KNFA 2X2ZA 3SRJA 3BT2A
chains in the Genus database with same CATH superfamily
2LL3A 1W81A 2K4RA 4A5TS 2Q8AA 1HPKA 2PK4A 1HPJA 2J8JA 3U73A 3HMRA 4Z0EA 2Z8WA 4R1CA 1KIVA 2Y8RA 3HMSA 5CP9A 2YIOA 5HPGA 2I9AA 2PF1A 2DOHX 3ZLEA 1KRNA 5CS5A 4Z0DA 1KDUA 4O03A 4D3CA 3SP8A 3ZWZA 3LAQA 2HPQP 3NXPA 3K65A 2I9BA 1KI0A 1PKRA 5CT3A 2PF2A 2HGFA 2Z8VA 2L0SA 4YIVA 3E6PL 4BVVA 4BV5A 1B2IA 2DOIA 1NL1A 2F83A 4DURA 2K13X 1GMOA 1CEBA 2YILA 1I5KA 1I8NA 1GP9A 2QJ4A 3KIVA 3SRIA 1BHTA 4NZQA 1HKYA 1CEAA 5COEA 4BVDA 4UAOA 4APMA 2FEBA 1PMLA 1PK4A 4BVCA 4BV7A 2FD6A 5CSQA 1A0HA 1PK2A 2Q8BA 4Z0FA 1JFNA 1PMKA 4KIVA 2SPTA 2K51A 4UV6A 3BT1A 1YXEA 5EOKA 5I25A 5CS1A 2HPPP 1TPKA 5CS9A 5CT1A 2YIPA 2J8LA 4YIZA 4CIKA 3HN4A 4APLA 5CT2A 1Z40A 2QJ2A 2KJ4A 4R19A 4R1BA 3HMTA 2KL5A 1URKA 1NL2A 4HZHA 3MKPA 1NK1A 4BVWA 1I71A 1W8KA 4Z09A 1GMNA 4IUAA 5CS3A 5EODA 4R1AA 2LL4M 2KNFA 2X2ZA 3SRJA 3BT2A
chains in the Genus database with same CATH topology
2LL3A 1W81A 2K4RA 4A5TS 2Q8AA 1HPKA 2PK4A 1HPJA 2J8JA 3U73A 3HMRA 4Z0EA 2Z8WA 4R1CA 1KIVA 2Y8RA 3HMSA 5CP9A 2YIOA 5HPGA 2I9AA 2PF1A 2DOHX 3ZLEA 1KRNA 5CS5A 4Z0DA 1KDUA 4O03A 4D3CA 3SP8A 3ZWZA 3LAQA 2HPQP 3NXPA 3K65A 2I9BA 1KI0A 1PKRA 5CT3A 2PF2A 2HGFA 2Z8VA 2L0SA 4YIVA 3E6PL 4BVVA 4BV5A 1B2IA 2DOIA 1NL1A 2F83A 4DURA 2K13X 1GMOA 1CEBA 2YILA 1I5KA 1I8NA 1GP9A 2QJ4A 3KIVA 3SRIA 1BHTA 4NZQA 1HKYA 1CEAA 5COEA 4BVDA 4UAOA 4APMA 2FEBA 1PMLA 1PK4A 4BVCA 4BV7A 2FD6A 5CSQA 1A0HA 1PK2A 2Q8BA 4Z0FA 1JFNA 1PMKA 4KIVA 2SPTA 2K51A 4UV6A 3BT1A 1YXEA 5EOKA 5I25A 5CS1A 2HPPP 1TPKA 5CS9A 5CT1A 2YIPA 2J8LA 4YIZA 4CIKA 3HN4A 4APLA 5CT2A 1Z40A 2QJ2A 2KJ4A 4R19A 4R1BA 3HMTA 2KL5A 1URKA 1NL2A 4HZHA 3MKPA 1NK1A 4BVWA 1I71A 1W8KA 4Z09A 1GMNA 4IUAA 5CS3A 5EODA 4R1AA 2LL4M 2KNFA 2X2ZA 3SRJA 3BT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LL3 A;  1W81 A;  2K4R A;  4A5T S;  2Q8A A;  1HPK A;  2PK4 A;  1HPJ A;  2J8J A;  3U73 A;  3HMR A;  4Z0E A;  2Z8W A;  4R1C A;  1KIV A;  2Y8R A;  3HMS A;  5CP9 A;  2YIO A;  5HPG A;  2I9A A;  2PF1 A;  2DOH X;  3ZLE A;  1KRN A;  5CS5 A;  4Z0D A;  1KDU A;  4O03 A;  4D3C A;  3SP8 A;  3ZWZ A;  3LAQ A;  2HPQ P;  3NXP A;  3K65 A;  2I9B A;  1KI0 A;  1PKR A;  5CT3 A;  2PF2 A;  2HGF A;  2Z8V A;  2L0S A;  3E6P L;  4BVV A;  4BV5 A;  1B2I A;  2DOI A;  1NL1 A;  2F83 A;  4DUR A;  2K13 X;  1GMO A;  1CEB A;  2YIL A;  1I5K A;  1I8N A;  1GP9 A;  2QJ4 A;  3KIV A;  3SRI A;  1BHT A;  4NZQ A;  1HKY A;  1CEA A;  5COE A;  4BVD A;  4UAO A;  4APM A;  2FEB A;  1PML A;  1PK4 A;  4BVC A;  4BV7 A;  2FD6 A;  5CSQ A;  1A0H A;  1PK2 A;  2Q8B A;  4Z0F A;  1JFN A;  1PMK A;  4KIV A;  2SPT A;  2K51 A;  4UV6 A;  3BT1 A;  1YXE A;  5EOK A;  5I25 A;  5CS1 A;  2HPP P;  1TPK A;  5CS9 A;  5CT1 A;  2YIP A;  2J8L A;  4CIK A;  3HN4 A;  4APL A;  5CT2 A;  1Z40 A;  2QJ2 A;  2KJ4 A;  4R19 A;  4R1B A;  3HMT A;  1URK A;  1NL2 A;  4HZH A;  3MKP A;  1NK1 A;  4BVW A;  1I71 A;  1W8K A;  4Z09 A;  1GMN A;  4IUA A;  5CS3 A;  5EOD A;  4R1A A;  2LL4 M;  2KNF A;  2X2Z A;  3SRJ A;  3BT2 A; 
#chains in the Genus database with same CATH topology
 2LL3 A;  1W81 A;  2K4R A;  4A5T S;  2Q8A A;  1HPK A;  2PK4 A;  1HPJ A;  2J8J A;  3U73 A;  3HMR A;  4Z0E A;  2Z8W A;  4R1C A;  1KIV A;  2Y8R A;  3HMS A;  5CP9 A;  2YIO A;  5HPG A;  2I9A A;  2PF1 A;  2DOH X;  3ZLE A;  1KRN A;  5CS5 A;  4Z0D A;  1KDU A;  4O03 A;  4D3C A;  3SP8 A;  3ZWZ A;  3LAQ A;  2HPQ P;  3NXP A;  3K65 A;  2I9B A;  1KI0 A;  1PKR A;  5CT3 A;  2PF2 A;  2HGF A;  2Z8V A;  2L0S A;  4YIV A;  3E6P L;  4BVV A;  4BV5 A;  1B2I A;  2DOI A;  1NL1 A;  2F83 A;  4DUR A;  2K13 X;  1GMO A;  1CEB A;  2YIL A;  1I5K A;  1I8N A;  1GP9 A;  2QJ4 A;  3KIV A;  3SRI A;  1BHT A;  4NZQ A;  1HKY A;  1CEA A;  5COE A;  4BVD A;  4UAO A;  4APM A;  2FEB A;  1PML A;  1PK4 A;  4BVC A;  4BV7 A;  2FD6 A;  5CSQ A;  1A0H A;  1PK2 A;  2Q8B A;  4Z0F A;  1JFN A;  1PMK A;  4KIV A;  2SPT A;  2K51 A;  4UV6 A;  3BT1 A;  1YXE A;  5EOK A;  5I25 A;  5CS1 A;  2HPP P;  1TPK A;  5CS9 A;  5CT1 A;  2YIP A;  2J8L A;  4YIZ A;  4CIK A;  3HN4 A;  4APL A;  5CT2 A;  1Z40 A;  2QJ2 A;  2KJ4 A;  4R19 A;  4R1B A;  3HMT A;  2KL5 A;  1URK A;  1NL2 A;  4HZH A;  3MKP A;  1NK1 A;  4BVW A;  1I71 A;  1W8K A;  4Z09 A;  1GMN A;  4IUA A;  5CS3 A;  5EOD A;  4R1A A;  2LL4 M;  2KNF A;  2X2Z A;  3SRJ A;  3BT2 A; 
#chains in the Genus database with same CATH homology
 2LL3 A;  1W81 A;  2K4R A;  4A5T S;  2Q8A A;  1HPK A;  2PK4 A;  1HPJ A;  2J8J A;  3U73 A;  3HMR A;  4Z0E A;  2Z8W A;  4R1C A;  1KIV A;  2Y8R A;  3HMS A;  5CP9 A;  2YIO A;  5HPG A;  2I9A A;  2PF1 A;  2DOH X;  3ZLE A;  1KRN A;  5CS5 A;  4Z0D A;  1KDU A;  4O03 A;  4D3C A;  3SP8 A;  3ZWZ A;  3LAQ A;  2HPQ P;  3NXP A;  3K65 A;  2I9B A;  1KI0 A;  1PKR A;  5CT3 A;  2PF2 A;  2HGF A;  2Z8V A;  2L0S A;  4YIV A;  3E6P L;  4BVV A;  4BV5 A;  1B2I A;  2DOI A;  1NL1 A;  2F83 A;  4DUR A;  2K13 X;  1GMO A;  1CEB A;  2YIL A;  1I5K A;  1I8N A;  1GP9 A;  2QJ4 A;  3KIV A;  3SRI A;  1BHT A;  4NZQ A;  1HKY A;  1CEA A;  5COE A;  4BVD A;  4UAO A;  4APM A;  2FEB A;  1PML A;  1PK4 A;  4BVC A;  4BV7 A;  2FD6 A;  5CSQ A;  1A0H A;  1PK2 A;  2Q8B A;  4Z0F A;  1JFN A;  1PMK A;  4KIV A;  2SPT A;  2K51 A;  4UV6 A;  3BT1 A;  1YXE A;  5EOK A;  5I25 A;  5CS1 A;  2HPP P;  1TPK A;  5CS9 A;  5CT1 A;  2YIP A;  2J8L A;  4YIZ A;  4CIK A;  3HN4 A;  4APL A;  5CT2 A;  1Z40 A;  2QJ2 A;  2KJ4 A;  4R19 A;  4R1B A;  3HMT A;  2KL5 A;  1URK A;  1NL2 A;  4HZH A;  3MKP A;  1NK1 A;  4BVW A;  1I71 A;  1W8K A;  4Z09 A;  1GMN A;  4IUA A;  5CS3 A;  5EOD A;  4R1A A;  2LL4 M;  2KNF A;  2X2Z A;  3SRJ A;  3BT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...