5CS5A

The structure of the nk1 fragment of hgf/sf complexed with pipes
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
173
structure length
173
Chain Sequence
b'TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 43
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 5cs5A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 5cs5A01
4O03A 4Z0EA 1KDUA 1KIVA 2PK4A 2Z8VA 2HGFA 2J8LA 3ZWZA 2LL3A 2X2ZA 1PMLA 2I9BA 4UV6A 5HPGA 4R1BA 5EOKA 2I9AA 1NL1A 1GMOA 1PKRA 3NXPA 5CSQA 3U73A 4A5TS 2KJ4A 3HN4A 1PK2A 3BT1A 2LL4M 2PF1A 2HPQP 1HPJA 3K65A 3KIVA 4Z0DA 2Q8AA 1GMNA 1W8KA 2KNFA 3BT2A 3HMTA 3HMRA 4R1CA 2DOHX 1I71A 4Z0FA 1YXEA 1PK4A 2YIOA 5COEA 4KIVA 1JFNA 2F83A 2YIPA 1TPKA 5CS9A 2Y8RA 2Q8BA 1PMKA 2FD6A 3ZLEA 4D3CA 2SPTA 1NL2A 2K13X 1I5KA 1W81A 3SRJA 5CS1A 3MKPA 3E6PL 1CEBA 2PF2A 1URKA 1NK1A 4R19A 2QJ2A 5CT1A 1HPKA 5CS3A 2FEBA 2QJ4A 2J8JA 4Z09A 2HPPP 1CEAA 2DOIA 4BVDA 5I25A 5CT3A 4R1AA 2K51A 2K4RA 4DURA 4BV5A 3LAQA 1A0HA 4BVWA 5EODA 1Z40A 4UAOA 4APMA 2L0SA 3HMSA 4NZQA 1B2IA 2YILA 4CIKA 1I8NA 5CS5A 4BVCA 2Z8WA 4APLA 5CP9A 1KRNA 4HZHA 5CT2A 4BVVA 3SRIA 1BHTA 1KI0A 4IUAA 3SP8A 4BV7A 1GP9A 1HKYA
chains in the Genus database with same CATH superfamily
4O03A 4Z0EA 1KDUA 1KIVA 2PK4A 2Z8VA 2HGFA 2J8LA 3ZWZA 2LL3A 2X2ZA 2KL5A 1PMLA 2I9BA 4UV6A 5HPGA 4R1BA 5EOKA 2I9AA 1NL1A 1GMOA 1PKRA 3NXPA 5CSQA 3U73A 4A5TS 2KJ4A 3HN4A 1PK2A 3BT1A 2LL4M 2PF1A 2HPQP 1HPJA 3K65A 3KIVA 4Z0DA 2Q8AA 1GMNA 1W8KA 2KNFA 3BT2A 3HMTA 3HMRA 4R1CA 2DOHX 1I71A 4Z0FA 1YXEA 1PK4A 2YIOA 5COEA 4YIZA 4KIVA 1JFNA 2F83A 2YIPA 1TPKA 5CS9A 2Y8RA 2Q8BA 1PMKA 2FD6A 4YIVA 3ZLEA 4D3CA 2SPTA 1NL2A 2K13X 1I5KA 1W81A 3SRJA 5CS1A 3MKPA 3E6PL 1CEBA 2PF2A 1URKA 1NK1A 4R19A 2QJ2A 5CT1A 1HPKA 5CS3A 2FEBA 2QJ4A 2J8JA 4Z09A 2HPPP 1CEAA 2DOIA 4BVDA 5I25A 5CT3A 4R1AA 2K51A 2K4RA 4DURA 4BV5A 3LAQA 1A0HA 4BVWA 5EODA 1Z40A 4UAOA 4APMA 2L0SA 3HMSA 4NZQA 1B2IA 2YILA 4CIKA 1I8NA 5CS5A 4BVCA 2Z8WA 4APLA 5CP9A 1KRNA 4HZHA 5CT2A 4BVVA 3SRIA 1BHTA 1KI0A 4IUAA 3SP8A 4BV7A 1GP9A 1HKYA
chains in the Genus database with same CATH topology
4O03A 4Z0EA 1KDUA 1KIVA 2PK4A 2Z8VA 2HGFA 2J8LA 3ZWZA 2LL3A 2X2ZA 2KL5A 1PMLA 2I9BA 4UV6A 5HPGA 4R1BA 5EOKA 2I9AA 1NL1A 1GMOA 1PKRA 3NXPA 5CSQA 3U73A 4A5TS 2KJ4A 3HN4A 1PK2A 3BT1A 2LL4M 2PF1A 2HPQP 1HPJA 3K65A 3KIVA 4Z0DA 2Q8AA 1GMNA 1W8KA 2KNFA 3BT2A 3HMTA 3HMRA 4R1CA 2DOHX 1I71A 4Z0FA 1YXEA 1PK4A 2YIOA 5COEA 4YIZA 4KIVA 1JFNA 2F83A 2YIPA 1TPKA 5CS9A 2Y8RA 2Q8BA 1PMKA 2FD6A 4YIVA 3ZLEA 4D3CA 2SPTA 1NL2A 2K13X 1I5KA 1W81A 3SRJA 5CS1A 3MKPA 3E6PL 1CEBA 2PF2A 1URKA 1NK1A 4R19A 2QJ2A 5CT1A 1HPKA 5CS3A 2FEBA 2QJ4A 2J8JA 4Z09A 2HPPP 1CEAA 2DOIA 4BVDA 5I25A 5CT3A 4R1AA 2K51A 2K4RA 4DURA 4BV5A 3LAQA 1A0HA 4BVWA 5EODA 1Z40A 4UAOA 4APMA 2L0SA 3HMSA 4NZQA 1B2IA 2YILA 4CIKA 1I8NA 5CS5A 4BVCA 2Z8WA 4APLA 5CP9A 1KRNA 4HZHA 5CT2A 4BVVA 3SRIA 1BHTA 1KI0A 4IUAA 3SP8A 4BV7A 1GP9A 1HKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O03 A;  4Z0E A;  1KDU A;  1KIV A;  2PK4 A;  2Z8V A;  2HGF A;  2J8L A;  3ZWZ A;  2LL3 A;  2X2Z A;  1PML A;  2I9B A;  4UV6 A;  5HPG A;  4R1B A;  5EOK A;  2I9A A;  1NL1 A;  1GMO A;  1PKR A;  3NXP A;  5CSQ A;  3U73 A;  4A5T S;  2KJ4 A;  3HN4 A;  1PK2 A;  3BT1 A;  2LL4 M;  2PF1 A;  2HPQ P;  1HPJ A;  3K65 A;  3KIV A;  4Z0D A;  2Q8A A;  1GMN A;  1W8K A;  2KNF A;  3BT2 A;  3HMT A;  3HMR A;  4R1C A;  2DOH X;  1I71 A;  4Z0F A;  1YXE A;  1PK4 A;  2YIO A;  5COE A;  4KIV A;  1JFN A;  2F83 A;  2YIP A;  1TPK A;  5CS9 A;  2Y8R A;  2Q8B A;  1PMK A;  2FD6 A;  3ZLE A;  4D3C A;  2SPT A;  1NL2 A;  2K13 X;  1I5K A;  1W81 A;  3SRJ A;  5CS1 A;  3MKP A;  3E6P L;  1CEB A;  2PF2 A;  1URK A;  1NK1 A;  4R19 A;  2QJ2 A;  5CT1 A;  1HPK A;  5CS3 A;  2FEB A;  2QJ4 A;  2J8J A;  4Z09 A;  2HPP P;  1CEA A;  2DOI A;  4BVD A;  5I25 A;  5CT3 A;  4R1A A;  2K51 A;  2K4R A;  4DUR A;  4BV5 A;  3LAQ A;  1A0H A;  4BVW A;  5EOD A;  1Z40 A;  4UAO A;  4APM A;  2L0S A;  3HMS A;  4NZQ A;  1B2I A;  2YIL A;  4CIK A;  1I8N A;  5CS5 A;  4BVC A;  2Z8W A;  4APL A;  5CP9 A;  1KRN A;  4HZH A;  5CT2 A;  4BVV A;  3SRI A;  1BHT A;  1KI0 A;  4IUA A;  3SP8 A;  4BV7 A;  1GP9 A;  1HKY A; 
#chains in the Genus database with same CATH topology
 4O03 A;  4Z0E A;  1KDU A;  1KIV A;  2PK4 A;  2Z8V A;  2HGF A;  2J8L A;  3ZWZ A;  2LL3 A;  2X2Z A;  2KL5 A;  1PML A;  2I9B A;  4UV6 A;  5HPG A;  4R1B A;  5EOK A;  2I9A A;  1NL1 A;  1GMO A;  1PKR A;  3NXP A;  5CSQ A;  3U73 A;  4A5T S;  2KJ4 A;  3HN4 A;  1PK2 A;  3BT1 A;  2LL4 M;  2PF1 A;  2HPQ P;  1HPJ A;  3K65 A;  3KIV A;  4Z0D A;  2Q8A A;  1GMN A;  1W8K A;  2KNF A;  3BT2 A;  3HMT A;  3HMR A;  4R1C A;  2DOH X;  1I71 A;  4Z0F A;  1YXE A;  1PK4 A;  2YIO A;  5COE A;  4YIZ A;  4KIV A;  1JFN A;  2F83 A;  2YIP A;  1TPK A;  5CS9 A;  2Y8R A;  2Q8B A;  1PMK A;  2FD6 A;  4YIV A;  3ZLE A;  4D3C A;  2SPT A;  1NL2 A;  2K13 X;  1I5K A;  1W81 A;  3SRJ A;  5CS1 A;  3MKP A;  3E6P L;  1CEB A;  2PF2 A;  1URK A;  1NK1 A;  4R19 A;  2QJ2 A;  5CT1 A;  1HPK A;  5CS3 A;  2FEB A;  2QJ4 A;  2J8J A;  4Z09 A;  2HPP P;  1CEA A;  2DOI A;  4BVD A;  5I25 A;  5CT3 A;  4R1A A;  2K51 A;  2K4R A;  4DUR A;  4BV5 A;  3LAQ A;  1A0H A;  4BVW A;  5EOD A;  1Z40 A;  4UAO A;  4APM A;  2L0S A;  3HMS A;  4NZQ A;  1B2I A;  2YIL A;  4CIK A;  1I8N A;  5CS5 A;  4BVC A;  2Z8W A;  4APL A;  5CP9 A;  1KRN A;  4HZH A;  5CT2 A;  4BVV A;  3SRI A;  1BHT A;  1KI0 A;  4IUA A;  3SP8 A;  4BV7 A;  1GP9 A;  1HKY A; 
#chains in the Genus database with same CATH homology
 4O03 A;  4Z0E A;  1KDU A;  1KIV A;  2PK4 A;  2Z8V A;  2HGF A;  2J8L A;  3ZWZ A;  2LL3 A;  2X2Z A;  2KL5 A;  1PML A;  2I9B A;  4UV6 A;  5HPG A;  4R1B A;  5EOK A;  2I9A A;  1NL1 A;  1GMO A;  1PKR A;  3NXP A;  5CSQ A;  3U73 A;  4A5T S;  2KJ4 A;  3HN4 A;  1PK2 A;  3BT1 A;  2LL4 M;  2PF1 A;  2HPQ P;  1HPJ A;  3K65 A;  3KIV A;  4Z0D A;  2Q8A A;  1GMN A;  1W8K A;  2KNF A;  3BT2 A;  3HMT A;  3HMR A;  4R1C A;  2DOH X;  1I71 A;  4Z0F A;  1YXE A;  1PK4 A;  2YIO A;  5COE A;  4YIZ A;  4KIV A;  1JFN A;  2F83 A;  2YIP A;  1TPK A;  5CS9 A;  2Y8R A;  2Q8B A;  1PMK A;  2FD6 A;  4YIV A;  3ZLE A;  4D3C A;  2SPT A;  1NL2 A;  2K13 X;  1I5K A;  1W81 A;  3SRJ A;  5CS1 A;  3MKP A;  3E6P L;  1CEB A;  2PF2 A;  1URK A;  1NK1 A;  4R19 A;  2QJ2 A;  5CT1 A;  1HPK A;  5CS3 A;  2FEB A;  2QJ4 A;  2J8J A;  4Z09 A;  2HPP P;  1CEA A;  2DOI A;  4BVD A;  5I25 A;  5CT3 A;  4R1A A;  2K51 A;  2K4R A;  4DUR A;  4BV5 A;  3LAQ A;  1A0H A;  4BVW A;  5EOD A;  1Z40 A;  4UAO A;  4APM A;  2L0S A;  3HMS A;  4NZQ A;  1B2I A;  2YIL A;  4CIK A;  1I8N A;  5CS5 A;  4BVC A;  2Z8W A;  4APL A;  5CP9 A;  1KRN A;  4HZH A;  5CT2 A;  4BVV A;  3SRI A;  1BHT A;  1KI0 A;  4IUA A;  3SP8 A;  4BV7 A;  1GP9 A;  1HKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...