The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
172
|
structure length |
172
|
Chain Sequence |
TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hormone
|
molecule keywords |
Hepatocyte growth factor
|
publication title |
Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
40
|
structure length |
172
|
sequence length |
172
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2015-07-23 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00024 | PAN_1 | PAN domain |
A | PF00051 | Kringle | Kringle domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Plasminogen Kringle 4 | Plasminogen Kringle 4 | ||
Alpha Beta | 3-Layer(bba) Sandwich | Hepatocyte Growth Factor | Hepatocyte Growth Factor |
#chains in the Genus database with same CATH superfamily 1HKY A; 1CEA A; 5CT3 A; 2QJ4 A; 4BV7 A; 3BT1 A; 2J8L A; 4O03 A; 4IUA A; 1W8K A; 2YIL A; 2I9B A; 4BVW A; 3ZWZ A; 4CIK A; 4DUR A; 1HPK A; 3SP8 A; 4D3C A; 5I25 A; 3HMT A; 2K13 X; 5EOD A; 2DOI A; 4APM A; 1URK A; 1GMN A; 1NL2 A; 1W81 A; 2YIP A; 3ZLE A; 2SPT A; 2DOH X; 3E6P L; 2PK4 A; 2PF1 A; 4Z0F A; 1Z40 A; 4BV5 A; 1KI0 A; 4BVC A; 2L0S A; 4A5T S; 1PMK A; 4BVD A; 1I8N A; 1B2I A; 1GP9 A; 2Y8R A; 2Z8V A; 4BVV A; 3SRJ A; 1BHT A; 2Q8B A; 2LL4 M; 1I71 A; 5COE A; 2J8J A; 2PF2 A; 2K4R A; 5CS1 A; 2Q8A A; 2X2Z A; 1CEB A; 5HPG A; 1GMO A; 1HPJ A; 1KDU A; 5CT2 A; 1NK1 A; 4HZH A; 2Z8W A; 3BT2 A; 1PK4 A; 2YIO A; 3LAQ A; 4KIV A; 1JFN A; 1PKR A; 3NXP A; 2FD6 A; 5CSQ A; 3HMS A; 4Z09 A; 5CS3 A; 2QJ2 A; 4R1C A; 1KRN A; 4R1A A; 2HPQ P; 1I5K A; 1PML A; 2HGF A; 4R1B A; 1NL1 A; 2FEB A; 3SRI A; 2K51 A; 4Z0E A; 5CT1 A; 2F83 A; 2HPP P; 1YXE A; 4R19 A; 1TPK A; 4Z0D A; 1PK2 A; 3U73 A; 2LL3 A; 5CS9 A; 3MKP A; 5CP9 A; 1A0H A; 2I9A A; 1KIV A; 3KIV A; 4APL A; 3HN4 A; 4NZQ A; 3K65 A; 3HMR A; 4UV6 A; 2KNF A; 5CS5 A; 4UAO A; 5EOK A; 2KJ4 A; #chains in the Genus database with same CATH topology 1HKY A; 1CEA A; 5CT3 A; 2QJ4 A; 4BV7 A; 3BT1 A; 2J8L A; 4O03 A; 4IUA A; 1W8K A; 2YIL A; 2I9B A; 4BVW A; 3ZWZ A; 4CIK A; 4DUR A; 1HPK A; 3SP8 A; 4D3C A; 5I25 A; 3HMT A; 2K13 X; 5EOD A; 2DOI A; 4APM A; 1URK A; 1GMN A; 1NL2 A; 1W81 A; 2YIP A; 3ZLE A; 2SPT A; 2DOH X; 3E6P L; 2PK4 A; 2PF1 A; 4Z0F A; 1Z40 A; 4BV5 A; 1KI0 A; 4BVC A; 2L0S A; 4A5T S; 1PMK A; 4BVD A; 1I8N A; 1B2I A; 1GP9 A; 2Y8R A; 2Z8V A; 4BVV A; 3SRJ A; 1BHT A; 2Q8B A; 2LL4 M; 1I71 A; 5COE A; 2J8J A; 2PF2 A; 2K4R A; 5CS1 A; 2Q8A A; 2X2Z A; 1CEB A; 5HPG A; 1GMO A; 1HPJ A; 1KDU A; 5CT2 A; 1NK1 A; 4HZH A; 2Z8W A; 3BT2 A; 1PK4 A; 2YIO A; 2KL5 A; 3LAQ A; 4KIV A; 1JFN A; 1PKR A; 3NXP A; 2FD6 A; 5CSQ A; 3HMS A; 4Z09 A; 5CS3 A; 2QJ2 A; 4R1C A; 1KRN A; 4R1A A; 2HPQ P; 1I5K A; 1PML A; 2HGF A; 4YIV A; 4R1B A; 1NL1 A; 4YIZ A; 2FEB A; 3SRI A; 2K51 A; 4Z0E A; 5CT1 A; 2F83 A; 2HPP P; 1YXE A; 4R19 A; 1TPK A; 4Z0D A; 1PK2 A; 3U73 A; 2LL3 A; 5CS9 A; 3MKP A; 5CP9 A; 1A0H A; 2I9A A; 1KIV A; 3KIV A; 4APL A; 3HN4 A; 4NZQ A; 3K65 A; 3HMR A; 4UV6 A; 2KNF A; 5CS5 A; 4UAO A; 5EOK A; 2KJ4 A; #chains in the Genus database with same CATH homology 1HKY A; 1CEA A; 5CT3 A; 2QJ4 A; 4BV7 A; 3BT1 A; 2J8L A; 4O03 A; 4IUA A; 1W8K A; 2YIL A; 2I9B A; 4BVW A; 3ZWZ A; 4CIK A; 4DUR A; 1HPK A; 3SP8 A; 4D3C A; 5I25 A; 3HMT A; 2K13 X; 5EOD A; 2DOI A; 4APM A; 1URK A; 1GMN A; 1NL2 A; 1W81 A; 2YIP A; 3ZLE A; 2SPT A; 2DOH X; 3E6P L; 2PK4 A; 2PF1 A; 4Z0F A; 1Z40 A; 4BV5 A; 1KI0 A; 4BVC A; 2L0S A; 4A5T S; 1PMK A; 4BVD A; 1I8N A; 1B2I A; 1GP9 A; 2Y8R A; 2Z8V A; 4BVV A; 3SRJ A; 1BHT A; 2Q8B A; 2LL4 M; 1I71 A; 5COE A; 2J8J A; 2PF2 A; 2K4R A; 5CS1 A; 2Q8A A; 2X2Z A; 1CEB A; 5HPG A; 1GMO A; 1HPJ A; 1KDU A; 5CT2 A; 1NK1 A; 4HZH A; 2Z8W A; 3BT2 A; 1PK4 A; 2YIO A; 2KL5 A; 3LAQ A; 4KIV A; 1JFN A; 1PKR A; 3NXP A; 2FD6 A; 5CSQ A; 3HMS A; 4Z09 A; 5CS3 A; 2QJ2 A; 4R1C A; 1KRN A; 4R1A A; 2HPQ P; 1I5K A; 1PML A; 2HGF A; 4YIV A; 4R1B A; 1NL1 A; 4YIZ A; 2FEB A; 3SRI A; 2K51 A; 4Z0E A; 5CT1 A; 2F83 A; 2HPP P; 1YXE A; 4R19 A; 1TPK A; 4Z0D A; 1PK2 A; 3U73 A; 2LL3 A; 5CS9 A; 3MKP A; 5CP9 A; 1A0H A; 2I9A A; 1KIV A; 3KIV A; 4APL A; 3HN4 A; 4NZQ A; 3K65 A; 3HMR A; 4UV6 A; 2KNF A; 5CS5 A; 4UAO A; 5EOK A; 2KJ4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...