5CS9A

The structure of the nk1 fragment of hgf/sf complexed with mes
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
172
structure length
172
Chain Sequence
TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 40
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 5cs9A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 5cs9A01
1PMKA 2PF1A 4Z0FA 4O03A 4BVCA 2J8JA 2PK4A 1I5KA 5CP9A 4BVDA 1KDUA 1I71A 2X2ZA 1PKRA 1W81A 2I9BA 1BHTA 4BV7A 2HPQP 1HPJA 3NXPA 2LL3A 3HMTA 4Z0DA 1GMOA 1KRNA 4BVWA 2Z8VA 3E6PL 3SP8A 1NK1A 4BV5A 4UV6A 5EOKA 2DOHX 1NL2A 2KJ4A 2Y8RA 4R1BA 1I8NA 1KI0A 2K4RA 1HKYA 1B2IA 3U73A 5CS9A 2K13X 2Z8WA 1YXEA 4R1AA 5I25A 1HPKA 2QJ4A 4BVVA 2LL4M 1KIVA 2FEBA 3SRJA 3LAQA 2HGFA 3HMRA 2YIOA 3KIVA 4UAOA 4APLA 2QJ2A 4APMA 2KNFA 5CS1A 3HMSA 2FD6A 1GMNA 3MKPA 3ZLEA 5HPGA 4HZHA 4R19A 1W8KA 3K65A 5COEA 5CT2A 4D3CA 2F83A 5CS5A 5CT3A 2SPTA 4IUAA 2YIPA 1CEBA 1PK2A 4R1CA 1URKA 2Q8BA 2K51A 5CSQA 4A5TS 5CS3A 1PK4A 4KIVA 1JFNA 2Q8AA 5EODA 2DOIA 2I9AA 1Z40A 1GP9A 1NL1A 3BT2A 4Z09A 4CIKA 1TPKA 1PMLA 3BT1A 2PF2A 2YILA 4Z0EA 5CT1A 2L0SA 2J8LA 3SRIA 1A0HA 4DURA 3HN4A 1CEAA 3ZWZA 2HPPP 4NZQA
chains in the Genus database with same CATH superfamily
1PMKA 2PF1A 4Z0FA 4O03A 4BVCA 2J8JA 2PK4A 1I5KA 5CP9A 4BVDA 1KDUA 1I71A 2X2ZA 1PKRA 1W81A 2I9BA 1BHTA 4BV7A 2HPQP 1HPJA 3NXPA 2LL3A 3HMTA 4Z0DA 1GMOA 1KRNA 4BVWA 2Z8VA 3E6PL 2KL5A 4YIZA 3SP8A 1NK1A 4BV5A 4UV6A 5EOKA 2DOHX 1NL2A 2KJ4A 2Y8RA 4R1BA 1I8NA 1KI0A 2K4RA 1HKYA 1B2IA 3U73A 5CS9A 2K13X 2Z8WA 1YXEA 4R1AA 5I25A 1HPKA 2QJ4A 4BVVA 2LL4M 1KIVA 2FEBA 3SRJA 3LAQA 2HGFA 3HMRA 2YIOA 3KIVA 4UAOA 4APLA 2QJ2A 4APMA 2KNFA 5CS1A 3HMSA 2FD6A 1GMNA 3MKPA 3ZLEA 5HPGA 4HZHA 4R19A 1W8KA 3K65A 5COEA 5CT2A 4D3CA 2F83A 5CS5A 5CT3A 2SPTA 4IUAA 4YIVA 2YIPA 1CEBA 1PK2A 4R1CA 1URKA 2Q8BA 2K51A 5CSQA 4A5TS 5CS3A 1PK4A 4KIVA 1JFNA 2Q8AA 5EODA 2DOIA 2I9AA 1Z40A 1GP9A 1NL1A 3BT2A 4Z09A 4CIKA 1TPKA 1PMLA 3BT1A 2PF2A 2YILA 4Z0EA 5CT1A 2L0SA 2J8LA 3SRIA 1A0HA 4DURA 3HN4A 1CEAA 3ZWZA 2HPPP 4NZQA
chains in the Genus database with same CATH topology
1PMKA 2PF1A 4Z0FA 4O03A 4BVCA 2J8JA 2PK4A 1I5KA 5CP9A 4BVDA 1KDUA 1I71A 2X2ZA 1PKRA 1W81A 2I9BA 1BHTA 4BV7A 2HPQP 1HPJA 3NXPA 2LL3A 3HMTA 4Z0DA 1GMOA 1KRNA 4BVWA 2Z8VA 3E6PL 2KL5A 4YIZA 3SP8A 1NK1A 4BV5A 4UV6A 5EOKA 2DOHX 1NL2A 2KJ4A 2Y8RA 4R1BA 1I8NA 1KI0A 2K4RA 1HKYA 1B2IA 3U73A 5CS9A 2K13X 2Z8WA 1YXEA 4R1AA 5I25A 1HPKA 2QJ4A 4BVVA 2LL4M 1KIVA 2FEBA 3SRJA 3LAQA 2HGFA 3HMRA 2YIOA 3KIVA 4UAOA 4APLA 2QJ2A 4APMA 2KNFA 5CS1A 3HMSA 2FD6A 1GMNA 3MKPA 3ZLEA 5HPGA 4HZHA 4R19A 1W8KA 3K65A 5COEA 5CT2A 4D3CA 2F83A 5CS5A 5CT3A 2SPTA 4IUAA 4YIVA 2YIPA 1CEBA 1PK2A 4R1CA 1URKA 2Q8BA 2K51A 5CSQA 4A5TS 5CS3A 1PK4A 4KIVA 1JFNA 2Q8AA 5EODA 2DOIA 2I9AA 1Z40A 1GP9A 1NL1A 3BT2A 4Z09A 4CIKA 1TPKA 1PMLA 3BT1A 2PF2A 2YILA 4Z0EA 5CT1A 2L0SA 2J8LA 3SRIA 1A0HA 4DURA 3HN4A 1CEAA 3ZWZA 2HPPP 4NZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PMK A;  2PF1 A;  4Z0F A;  4O03 A;  4BVC A;  2J8J A;  2PK4 A;  1I5K A;  5CP9 A;  4BVD A;  1KDU A;  1I71 A;  2X2Z A;  1PKR A;  1W81 A;  2I9B A;  1BHT A;  4BV7 A;  2HPQ P;  1HPJ A;  3NXP A;  2LL3 A;  3HMT A;  4Z0D A;  1GMO A;  1KRN A;  4BVW A;  2Z8V A;  3E6P L;  3SP8 A;  1NK1 A;  4BV5 A;  4UV6 A;  5EOK A;  2DOH X;  1NL2 A;  2KJ4 A;  2Y8R A;  4R1B A;  1I8N A;  1KI0 A;  2K4R A;  1HKY A;  1B2I A;  3U73 A;  5CS9 A;  2K13 X;  2Z8W A;  1YXE A;  4R1A A;  5I25 A;  1HPK A;  2QJ4 A;  4BVV A;  2LL4 M;  1KIV A;  2FEB A;  3SRJ A;  3LAQ A;  2HGF A;  3HMR A;  2YIO A;  3KIV A;  4UAO A;  4APL A;  2QJ2 A;  4APM A;  2KNF A;  5CS1 A;  3HMS A;  2FD6 A;  1GMN A;  3MKP A;  3ZLE A;  5HPG A;  4HZH A;  4R19 A;  1W8K A;  3K65 A;  5COE A;  5CT2 A;  4D3C A;  2F83 A;  5CS5 A;  5CT3 A;  2SPT A;  4IUA A;  2YIP A;  1CEB A;  1PK2 A;  4R1C A;  1URK A;  2Q8B A;  2K51 A;  5CSQ A;  4A5T S;  5CS3 A;  1PK4 A;  4KIV A;  1JFN A;  2Q8A A;  5EOD A;  2DOI A;  2I9A A;  1Z40 A;  1GP9 A;  1NL1 A;  3BT2 A;  4Z09 A;  4CIK A;  1TPK A;  1PML A;  3BT1 A;  2PF2 A;  2YIL A;  4Z0E A;  5CT1 A;  2L0S A;  2J8L A;  3SRI A;  1A0H A;  4DUR A;  3HN4 A;  1CEA A;  3ZWZ A;  2HPP P;  4NZQ A; 
#chains in the Genus database with same CATH topology
 1PMK A;  2PF1 A;  4Z0F A;  4O03 A;  4BVC A;  2J8J A;  2PK4 A;  1I5K A;  5CP9 A;  4BVD A;  1KDU A;  1I71 A;  2X2Z A;  1PKR A;  1W81 A;  2I9B A;  1BHT A;  4BV7 A;  2HPQ P;  1HPJ A;  3NXP A;  2LL3 A;  3HMT A;  4Z0D A;  1GMO A;  1KRN A;  4BVW A;  2Z8V A;  3E6P L;  2KL5 A;  4YIZ A;  3SP8 A;  1NK1 A;  4BV5 A;  4UV6 A;  5EOK A;  2DOH X;  1NL2 A;  2KJ4 A;  2Y8R A;  4R1B A;  1I8N A;  1KI0 A;  2K4R A;  1HKY A;  1B2I A;  3U73 A;  5CS9 A;  2K13 X;  2Z8W A;  1YXE A;  4R1A A;  5I25 A;  1HPK A;  2QJ4 A;  4BVV A;  2LL4 M;  1KIV A;  2FEB A;  3SRJ A;  3LAQ A;  2HGF A;  3HMR A;  2YIO A;  3KIV A;  4UAO A;  4APL A;  2QJ2 A;  4APM A;  2KNF A;  5CS1 A;  3HMS A;  2FD6 A;  1GMN A;  3MKP A;  3ZLE A;  5HPG A;  4HZH A;  4R19 A;  1W8K A;  3K65 A;  5COE A;  5CT2 A;  4D3C A;  2F83 A;  5CS5 A;  5CT3 A;  2SPT A;  4IUA A;  4YIV A;  2YIP A;  1CEB A;  1PK2 A;  4R1C A;  1URK A;  2Q8B A;  2K51 A;  5CSQ A;  4A5T S;  5CS3 A;  1PK4 A;  4KIV A;  1JFN A;  2Q8A A;  5EOD A;  2DOI A;  2I9A A;  1Z40 A;  1GP9 A;  1NL1 A;  3BT2 A;  4Z09 A;  4CIK A;  1TPK A;  1PML A;  3BT1 A;  2PF2 A;  2YIL A;  4Z0E A;  5CT1 A;  2L0S A;  2J8L A;  3SRI A;  1A0H A;  4DUR A;  3HN4 A;  1CEA A;  3ZWZ A;  2HPP P;  4NZQ A; 
#chains in the Genus database with same CATH homology
 1PMK A;  2PF1 A;  4Z0F A;  4O03 A;  4BVC A;  2J8J A;  2PK4 A;  1I5K A;  5CP9 A;  4BVD A;  1KDU A;  1I71 A;  2X2Z A;  1PKR A;  1W81 A;  2I9B A;  1BHT A;  4BV7 A;  2HPQ P;  1HPJ A;  3NXP A;  2LL3 A;  3HMT A;  4Z0D A;  1GMO A;  1KRN A;  4BVW A;  2Z8V A;  3E6P L;  2KL5 A;  4YIZ A;  3SP8 A;  1NK1 A;  4BV5 A;  4UV6 A;  5EOK A;  2DOH X;  1NL2 A;  2KJ4 A;  2Y8R A;  4R1B A;  1I8N A;  1KI0 A;  2K4R A;  1HKY A;  1B2I A;  3U73 A;  5CS9 A;  2K13 X;  2Z8W A;  1YXE A;  4R1A A;  5I25 A;  1HPK A;  2QJ4 A;  4BVV A;  2LL4 M;  1KIV A;  2FEB A;  3SRJ A;  3LAQ A;  2HGF A;  3HMR A;  2YIO A;  3KIV A;  4UAO A;  4APL A;  2QJ2 A;  4APM A;  2KNF A;  5CS1 A;  3HMS A;  2FD6 A;  1GMN A;  3MKP A;  3ZLE A;  5HPG A;  4HZH A;  4R19 A;  1W8K A;  3K65 A;  5COE A;  5CT2 A;  4D3C A;  2F83 A;  5CS5 A;  5CT3 A;  2SPT A;  4IUA A;  4YIV A;  2YIP A;  1CEB A;  1PK2 A;  4R1C A;  1URK A;  2Q8B A;  2K51 A;  5CSQ A;  4A5T S;  5CS3 A;  1PK4 A;  4KIV A;  1JFN A;  2Q8A A;  5EOD A;  2DOI A;  2I9A A;  1Z40 A;  1GP9 A;  1NL1 A;  3BT2 A;  4Z09 A;  4CIK A;  1TPK A;  1PML A;  3BT1 A;  2PF2 A;  2YIL A;  4Z0E A;  5CT1 A;  2L0S A;  2J8L A;  3SRI A;  1A0H A;  4DUR A;  3HN4 A;  1CEA A;  3ZWZ A;  2HPP P;  4NZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...