5CSQA

The structure of the nk1 fragment of hgf/sf complexed with mops
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
173
structure length
173
Chain Sequence
TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 39
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 5csqA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 5csqA01
2QJ4A 3HMTA 3BT2A 2YIPA 1GP9A 2I9BA 1W81A 3U73A 2J8LA 5CS3A 4Z0EA 2K13X 2DOIA 1I71A 1URKA 1PK2A 2J8JA 2KNFA 2Y8RA 1GMNA 1KDUA 4R19A 5COEA 4Z0FA 1HKYA 5I25A 2K4RA 5CP9A 3KIVA 4CIKA 2Q8BA 2Q8AA 2HGFA 4BVCA 2HPPP 4R1CA 3HN4A 2HPQP 1B2IA 1KRNA 4NZQA 3BT1A 1CEBA 2SPTA 1YXEA 5EODA 1GMOA 2I9AA 2KJ4A 3SP8A 4BVVA 1W8KA 2Z8VA 1HPKA 4Z0DA 2YILA 2X2ZA 4Z09A 3SRIA 4APMA 1NL1A 1PKRA 1A0HA 1KIVA 1HPJA 4APLA 4KIVA 2YIOA 1KI0A 1TPKA 2PK4A 3K65A 5CS5A 1JFNA 4UV6A 1PK4A 2LL4M 1Z40A 3SRJA 5CS9A 2QJ2A 1I8NA 1I5KA 5CT2A 3NXPA 2LL3A 1CEAA 2L0SA 4IUAA 3E6PL 1NK1A 3ZLEA 1NL2A 4D3CA 2PF1A 3MKPA 4DURA 2Z8WA 4BVDA 2DOHX 3HMSA 1PMLA 4A5TS 4BV7A 2FD6A 2K51A 3ZWZA 1PMKA 2PF2A 4BVWA 4O03A 5CS1A 3LAQA 5EOKA 3HMRA 4HZHA 2F83A 4R1BA 5CT3A 4R1AA 5HPGA 5CT1A 5CSQA 4UAOA 4BV5A 1BHTA 2FEBA
chains in the Genus database with same CATH superfamily
2QJ4A 3HMTA 3BT2A 2YIPA 1GP9A 2I9BA 1W81A 3U73A 2J8LA 5CS3A 4Z0EA 2K13X 2DOIA 1I71A 1URKA 1PK2A 4YIZA 2J8JA 2KNFA 2Y8RA 1GMNA 1KDUA 4R19A 5COEA 4Z0FA 1HKYA 5I25A 2K4RA 5CP9A 3KIVA 4CIKA 2Q8BA 2Q8AA 2HGFA 4BVCA 2HPPP 4R1CA 3HN4A 2HPQP 1B2IA 1KRNA 4NZQA 3BT1A 1CEBA 2SPTA 1YXEA 5EODA 1GMOA 2I9AA 2KJ4A 3SP8A 4BVVA 1W8KA 2Z8VA 1HPKA 4Z0DA 2YILA 2X2ZA 4Z09A 3SRIA 4APMA 1NL1A 1PKRA 1A0HA 1KIVA 1HPJA 4APLA 4KIVA 2YIOA 1KI0A 1TPKA 2PK4A 3K65A 5CS5A 1JFNA 4UV6A 1PK4A 2LL4M 1Z40A 3SRJA 5CS9A 2QJ2A 1I8NA 1I5KA 5CT2A 3NXPA 2LL3A 1CEAA 2L0SA 4IUAA 3E6PL 1NK1A 3ZLEA 1NL2A 4D3CA 2PF1A 3MKPA 4DURA 2Z8WA 4BVDA 2DOHX 3HMSA 1PMLA 4A5TS 2KL5A 4BV7A 2FD6A 2K51A 3ZWZA 1PMKA 2PF2A 4BVWA 4O03A 5CS1A 3LAQA 5EOKA 3HMRA 4HZHA 2F83A 4R1BA 4YIVA 5CT3A 4R1AA 5HPGA 5CT1A 5CSQA 4UAOA 4BV5A 1BHTA 2FEBA
chains in the Genus database with same CATH topology
2QJ4A 3HMTA 3BT2A 2YIPA 1GP9A 2I9BA 1W81A 3U73A 2J8LA 5CS3A 4Z0EA 2K13X 2DOIA 1I71A 1URKA 1PK2A 4YIZA 2J8JA 2KNFA 2Y8RA 1GMNA 1KDUA 4R19A 5COEA 4Z0FA 1HKYA 5I25A 2K4RA 5CP9A 3KIVA 4CIKA 2Q8BA 2Q8AA 2HGFA 4BVCA 2HPPP 4R1CA 3HN4A 2HPQP 1B2IA 1KRNA 4NZQA 3BT1A 1CEBA 2SPTA 1YXEA 5EODA 1GMOA 2I9AA 2KJ4A 3SP8A 4BVVA 1W8KA 2Z8VA 1HPKA 4Z0DA 2YILA 2X2ZA 4Z09A 3SRIA 4APMA 1NL1A 1PKRA 1A0HA 1KIVA 1HPJA 4APLA 4KIVA 2YIOA 1KI0A 1TPKA 2PK4A 3K65A 5CS5A 1JFNA 4UV6A 1PK4A 2LL4M 1Z40A 3SRJA 5CS9A 2QJ2A 1I8NA 1I5KA 5CT2A 3NXPA 2LL3A 1CEAA 2L0SA 4IUAA 3E6PL 1NK1A 3ZLEA 1NL2A 4D3CA 2PF1A 3MKPA 4DURA 2Z8WA 4BVDA 2DOHX 3HMSA 1PMLA 4A5TS 2KL5A 4BV7A 2FD6A 2K51A 3ZWZA 1PMKA 2PF2A 4BVWA 4O03A 5CS1A 3LAQA 5EOKA 3HMRA 4HZHA 2F83A 4R1BA 4YIVA 5CT3A 4R1AA 5HPGA 5CT1A 5CSQA 4UAOA 4BV5A 1BHTA 2FEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ4 A;  3HMT A;  3BT2 A;  2YIP A;  1GP9 A;  2I9B A;  1W81 A;  3U73 A;  2J8L A;  5CS3 A;  4Z0E A;  2K13 X;  2DOI A;  1I71 A;  1URK A;  1PK2 A;  2J8J A;  2KNF A;  2Y8R A;  1GMN A;  1KDU A;  4R19 A;  5COE A;  4Z0F A;  1HKY A;  5I25 A;  2K4R A;  5CP9 A;  3KIV A;  4CIK A;  2Q8B A;  2Q8A A;  2HGF A;  4BVC A;  2HPP P;  4R1C A;  3HN4 A;  2HPQ P;  1B2I A;  1KRN A;  4NZQ A;  3BT1 A;  1CEB A;  2SPT A;  1YXE A;  5EOD A;  1GMO A;  2I9A A;  2KJ4 A;  3SP8 A;  4BVV A;  1W8K A;  2Z8V A;  1HPK A;  4Z0D A;  2YIL A;  2X2Z A;  4Z09 A;  3SRI A;  4APM A;  1NL1 A;  1PKR A;  1A0H A;  1KIV A;  1HPJ A;  4APL A;  4KIV A;  2YIO A;  1KI0 A;  1TPK A;  2PK4 A;  3K65 A;  5CS5 A;  1JFN A;  4UV6 A;  1PK4 A;  2LL4 M;  1Z40 A;  3SRJ A;  5CS9 A;  2QJ2 A;  1I8N A;  1I5K A;  5CT2 A;  3NXP A;  2LL3 A;  1CEA A;  2L0S A;  4IUA A;  3E6P L;  1NK1 A;  3ZLE A;  1NL2 A;  4D3C A;  2PF1 A;  3MKP A;  4DUR A;  2Z8W A;  4BVD A;  2DOH X;  3HMS A;  1PML A;  4A5T S;  4BV7 A;  2FD6 A;  2K51 A;  3ZWZ A;  1PMK A;  2PF2 A;  4BVW A;  4O03 A;  5CS1 A;  3LAQ A;  5EOK A;  3HMR A;  4HZH A;  2F83 A;  4R1B A;  5CT3 A;  4R1A A;  5HPG A;  5CT1 A;  5CSQ A;  4UAO A;  4BV5 A;  1BHT A;  2FEB A; 
#chains in the Genus database with same CATH topology
 2QJ4 A;  3HMT A;  3BT2 A;  2YIP A;  1GP9 A;  2I9B A;  1W81 A;  3U73 A;  2J8L A;  5CS3 A;  4Z0E A;  2K13 X;  2DOI A;  1I71 A;  1URK A;  1PK2 A;  4YIZ A;  2J8J A;  2KNF A;  2Y8R A;  1GMN A;  1KDU A;  4R19 A;  5COE A;  4Z0F A;  1HKY A;  5I25 A;  2K4R A;  5CP9 A;  3KIV A;  4CIK A;  2Q8B A;  2Q8A A;  2HGF A;  4BVC A;  2HPP P;  4R1C A;  3HN4 A;  2HPQ P;  1B2I A;  1KRN A;  4NZQ A;  3BT1 A;  1CEB A;  2SPT A;  1YXE A;  5EOD A;  1GMO A;  2I9A A;  2KJ4 A;  3SP8 A;  4BVV A;  1W8K A;  2Z8V A;  1HPK A;  4Z0D A;  2YIL A;  2X2Z A;  4Z09 A;  3SRI A;  4APM A;  1NL1 A;  1PKR A;  1A0H A;  1KIV A;  1HPJ A;  4APL A;  4KIV A;  2YIO A;  1KI0 A;  1TPK A;  2PK4 A;  3K65 A;  5CS5 A;  1JFN A;  4UV6 A;  1PK4 A;  2LL4 M;  1Z40 A;  3SRJ A;  5CS9 A;  2QJ2 A;  1I8N A;  1I5K A;  5CT2 A;  3NXP A;  2LL3 A;  1CEA A;  2L0S A;  4IUA A;  3E6P L;  1NK1 A;  3ZLE A;  1NL2 A;  4D3C A;  2PF1 A;  3MKP A;  4DUR A;  2Z8W A;  4BVD A;  2DOH X;  3HMS A;  1PML A;  4A5T S;  2KL5 A;  4BV7 A;  2FD6 A;  2K51 A;  3ZWZ A;  1PMK A;  2PF2 A;  4BVW A;  4O03 A;  5CS1 A;  3LAQ A;  5EOK A;  3HMR A;  4HZH A;  2F83 A;  4R1B A;  4YIV A;  5CT3 A;  4R1A A;  5HPG A;  5CT1 A;  5CSQ A;  4UAO A;  4BV5 A;  1BHT A;  2FEB A; 
#chains in the Genus database with same CATH homology
 2QJ4 A;  3HMT A;  3BT2 A;  2YIP A;  1GP9 A;  2I9B A;  1W81 A;  3U73 A;  2J8L A;  5CS3 A;  4Z0E A;  2K13 X;  2DOI A;  1I71 A;  1URK A;  1PK2 A;  4YIZ A;  2J8J A;  2KNF A;  2Y8R A;  1GMN A;  1KDU A;  4R19 A;  5COE A;  4Z0F A;  1HKY A;  5I25 A;  2K4R A;  5CP9 A;  3KIV A;  4CIK A;  2Q8B A;  2Q8A A;  2HGF A;  4BVC A;  2HPP P;  4R1C A;  3HN4 A;  2HPQ P;  1B2I A;  1KRN A;  4NZQ A;  3BT1 A;  1CEB A;  2SPT A;  1YXE A;  5EOD A;  1GMO A;  2I9A A;  2KJ4 A;  3SP8 A;  4BVV A;  1W8K A;  2Z8V A;  1HPK A;  4Z0D A;  2YIL A;  2X2Z A;  4Z09 A;  3SRI A;  4APM A;  1NL1 A;  1PKR A;  1A0H A;  1KIV A;  1HPJ A;  4APL A;  4KIV A;  2YIO A;  1KI0 A;  1TPK A;  2PK4 A;  3K65 A;  5CS5 A;  1JFN A;  4UV6 A;  1PK4 A;  2LL4 M;  1Z40 A;  3SRJ A;  5CS9 A;  2QJ2 A;  1I8N A;  1I5K A;  5CT2 A;  3NXP A;  2LL3 A;  1CEA A;  2L0S A;  4IUA A;  3E6P L;  1NK1 A;  3ZLE A;  1NL2 A;  4D3C A;  2PF1 A;  3MKP A;  4DUR A;  2Z8W A;  4BVD A;  2DOH X;  3HMS A;  1PML A;  4A5T S;  2KL5 A;  4BV7 A;  2FD6 A;  2K51 A;  3ZWZ A;  1PMK A;  2PF2 A;  4BVW A;  4O03 A;  5CS1 A;  3LAQ A;  5EOK A;  3HMR A;  4HZH A;  2F83 A;  4R1B A;  4YIV A;  5CT3 A;  4R1A A;  5HPG A;  5CT1 A;  5CSQ A;  4UAO A;  4BV5 A;  1BHT A;  2FEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...