5CSYA

Disproportionating enzyme 1 from arabidopsis - acarbose soak
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
517
structure length
506
Chain Sequence
b'SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 180
structure length 506
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5csyA01
4UOZA 4P8WA 3DECA 2BV9A 5GQBA 3UESA 1UKSA 2C0HA 1SYTA 3AIWA 2EO7A 2Y8VA 1HKJA 3GZAA 1PAMA 1JZ8A 3SCUA 2WHKA 2WC4A 3CHEA 4UFHA 4ZXOA 4LYPA 1JFHA 4PSPA 4AZGA 1C8QA 4ZFMA 1UG6A 4LXFA 4PSRA 2E9MA 2V38A 5C70A 2ZX7A 1ITXA 3GXIA 3NSMA 1EGZA 2VX5A 4J3SA 3RCNA 2WYSA 3DHUA 2CIPA 4WF7A 3RMEA 3QR3A 4HMEA 2BXYA 5AYBA 1UWIA 5AC5A 2MANA 1HN1A 4PMRA 4BS0A 1VEOA 1OT1A 4E8DA 2WBGA 3BAKA 5A8MA 3GYCA 5FOOA 3L2MA 5E0CA 1IZKA 4UR9A 2VRKA 1HL8A 1WDSA 3BCDA 4W7VA 1EDGA 4UTFA 1ODZA 3BC9A 3CZGA 3W27A 1E4LA 3AI0A 2XVKA 3CGTA 1J9YA 2XSBA 3CHCA 3SCQA 1BYCA 1QHPA 5CLTA 2J25A 4GO8A 2JEPA 5E6YA 4K68A 1MXGA 1V6WA 3CHFA 1UWSA 1HJSA 1G5AA 1LF1A 4GPNA 5EBAA 1ISXA 1CGXA 1IZJA 3VIGA 1JI2A 2FGZA 2WMGA 5A8OA 5CGTA 1CNVA 1V6YA 4ZE4A 1R8LA 4RE2A 1XCWA 3WNOA 1KXTA 2GJXA 1RPKA 3AIQA 2WCAA 1F4AA 3TTYA 3WNLA 3ZJKA 2QF8A 3OZOA 1B3YA 5A8NA 2XVNA 3CLWA 3TP4A 4GINA 1UKOA 3IJ7A 3SURA 1GPFA 2WHLA 5BYWA 1V3KA 2D0FA 1UUQA 2JEQA 1J0JA 1WZMA 4UQCA 4MPKA 1JZ5A 3VGHA 1G0CA 2ZWZA 3GH5A 4D71A 3VD3A 3U57A 4Z2IA 2G3MA 4PMXA 5I6SA 2VX6A 4W5ZA 3WD4A 3FN9A 3MSGA 2XIIA 2AOSA 4GIAA 2NT1A 1C91A 1TCMA 1BGGA 3ALGA 1ZU8A 3WN6A 1E4IA 1E55A 5HPOA 2G4FA 1UQZA 2CBVA 3A4WA 3WL0A 4J3UA 1JD7A 1V6VA 3ZR5A 3B9AA 3W25A 3ZT5A 5BXPA 1PJ9A 5I23A 3MV01 2G3IA 1R85A 2WC3A 2BVTA 1O6IA 1JL8A 2IUZA 4XZWA 1W9UA 1FOBA 1V3HA 5A94A 1EDTA 5KEZA 1JXJA 3WQ4A 1W9VA 2YA1A 1AVAA 1C93A 3VD5A 1UH2A 5C71A 2CKRA 4J7RA 1UR9A 1VFFA 2BVYA 1BFNA 2UY3A 2CHOA 3TTOA 2Y4SA 1JNDA 3FXYA 1PX8A 4WKHA 5A6AA 4F8XA 1VBRA 1EIBA 1OBAA 2ZX6A 5CGMA 1VENA 3L4UA 1B2YA 1V0KA 4M8UA 1XH0A 1LG2A 3B9EA 4U2ZA 1UA7A 1UD2A 2WVTA 3GDBA 2XM1A 1PPIA 3TTSA 3EDJA 2PWGA 4TXEA 3VUPA 3A4XA 1Q6GA 3BLKA 2EPNA 2JALA 4NRRA 1DWJM 1ZJAA 4KH2A 1EO5A 4X0NA 1XSKA 1DP0A 4DUWA 2WHJA 3VILA 3VU2A 3U7VA 1QHZA 1J0IA 4V28A 3PZQA 5D9NA 3W53A 1BAGA 1HJVA 3W6LA 1UD4A 2E4TA 2J75A 3OLIA 1B3ZA 3SCSA 4AIEA 1J0ZA 1TA3A 1QI3A 3PZTA 4IM4A 1EH9A 1AQ0A 2VO5A 2J7GA 1UKPA 5A6BA 4AEEA 5LA1A 5IFTA 1BLIA 1J18A 1HP5A 2Y8KA 5CSYA 1DHKA 1TG7A 4TX6A 2YBTA 1V6UA 1MW0A 1U2YA 4P7NA 3RDKA 2VVSA 2VCBA 4HZ8A 5A3HA 5BXSA 4HOXA 4WKFA 2VRJA 3WFLA 3WF3A 5AYIA 2W62A 4U33A 1V3IA 3WQ6A 4CN1A 1GOIA 1N82A 1GOQA 2W63A 1V3LA 4HP5A 2B31A 2GFTA 4JFVA 1HIZA 2UY2A 1JZ4A 4HA1A 4YN5A 2E8ZA 1WKYA 2VNCA 2VVNA 3WDJA 4QDMA 1V0LA 1FH9A 6TAAA 1E4NA 2CBUA 2BY1A 8CGTA 3OIHA 4TX8A 4AZ6A 5F7UA 3AS0A 1NP0A 3L4WA 3DHPA 2QPUA 3WDIA 4R27A 1BG9A 3WH6A 4YPJA 4CD7A 3FNDA 3VGDA 3J7HA 1HP4A 4IPNB 3LPOA 4WSJA 3TOPA 1KWGA 4M81A 5HBFA 3PTKA 1E43A 4TVCA 2ZXQA 5CJ5A 4HTYA 1ZBCA 3F5LA 3GH4A 3S2CA 5HPCA 1SMAA 2DSVA 1JF5A 4ATLA 3AISA 3WNMA 1Q6DA 3RO8A 1OIFA 2BVDA 4OKDA 3B8SA 2WMFA 4JCMA 4BQ4A 3WNNA 5JBDA 1XSIA 4AMCA 1E3ZA 3OG2A 1Q6EA 4JZ5A 3RM4A 1HJWA 2D3LA 2Y5EA 3WMCA 4U31A 3RIKA 4CCDA 2WXDM 2WLZA 3SCVA 1NQ6A 2PI6A 5HXMA 1UWQA 2ZUMA 4CGTA 2OSXA 1OGGA 3N15A 4LYRA 3GNOA 1JG9A 5A2CA 3PZMA 1MQQA 3AIEA 4ATWA 3W0KA 5CPTA 4CD6A 4Z2GA 8A3HA 5EB8A 2A3HA 3NDZA 1M04A 5A6SA 3PZ9A 1K9FA 4R5EA 3G6MA 4URIA 3OBAA 5IDIA 2ZICA 4AWEA 4MTVA 1M53A 3ZOAA 2WWDA 4C7FA 3SCNA 1E1EA 5ABFA 1BQCA 3WD3A 1V6XA 2ZXAA 1UYQA 2CHNA 2EQDA 6A3HA 5D9PA 5A6MA 3IANA 4BF7A 3A3HA 3EDFA 4M1RA 3UR8A 2J74A 2DEPA 1OB0A 2PBOA 4HA3A 1JAKA 2C8NA 1M01A 3POHA 3WEMA 1LL6A 5M03A 1AQMA 3VGFA 4LQ1A 1EOMA 1E9LA 2VQTA 4PMNA 4JFSA 2XSAA 1V02A 1OGSA 1SFSA 5FKYA 1GQLA 1ISVA 2OYKA 4C7GA 5I78A 5EFDA 2V3EA 2VURA 1E70M 1WZLA 1ZB5A 1QNOA 1VJZA 2X2YA 4KRUA 1E6ZA 1B3XA 1OD8A 1KCKA 1RP9A 1KBBA 1WDQA 1XYFA 3OA5A 5D9OA 3ZIZA 2D0GA 3VDHA 1KQYA 1JGIA 3NCOA 3JUGA 4H8UA 2Z1SA 2W92A 1KB3A 3ARQA 4KMQA 2BHYA 1GQJA 4E8CA 1GVIA 4AZBA 1X6LA 5ABEA 2CNCA 2WSKA 3N9KA 3AXXA 1V02E 2JIWA 4WIWA 4D6CA 4AC1X 3NYDA 2AAAA 4DWSA 2XJ7A 3AZTA 1JZ3A 3FAWA 2JF6A 3WUEA 2GSJA 4B15A 4PMZA 2QV4A 2D23A 2V3GA 4QCEA 1TUXA 1H2JA 4IPLA 4W84A 1QHOA 3ARUA 4AZHA 4FLSA 4UQDA 3AS2A 3OLDA 3BCFA 3AROA 5DMYA 3L4TA 1WDRA 1JFXA 1KGUA 2DT2A 1BPLB 3RILA 1HVQA 2RGMA 1LWHA 3VIKA 1MYRA 2V5CA 4A3YA 4ACZA 5C8BB 2JF7A 3N04A 4PTVA 3F5JA 1KXHA 1W1PA 2G3JA 2D2OA 2V5DA 4E2OA 1MQPA 4S3KA 1L8NA 4GO9A 3VDCA 1DTUA 1VB9A 2W66A 3VMOA 1JF6A 1JDDA 5E70A 1GOKA 3T2QA 1XH1A 2J7EA 3W26A 1U30A 3SUTA 2J8GA 1BVNP 2CPUA 2VQUA 2ZE0A 3A4AA 3UG4A 5A1AA 2YDSA 4W86A 3CH9A 1EHNA 1W2VA 4P8UA 2X8RA 2QMJA 1G01A 4MAZA 2ZXDA 2CEQA 2W67A 4V27A 1H11A 1J10A 1O7AA 2J79A 1ZBWA 3LPGA 4P7RA 3ZJ8A 3GXDA 1NOFA 3CTTA 3BAWA 3CUIA 1GOOA 1LLOA 2EJ1A 4Z2HA 3GTNA 4H41A 3AIVA 3FHQA 2VRQA 2VZOA 3CPUA 3WUGA 5BWFA 4HOZA 1XD0A 4JHOA 1VF8A 3M46A 1E5JA 4H7VA 4JCLA 4MDOA 4M29A 3WNKA 3MKKA 5BROA 1MXDA 4YHGA 4EKJA 5I3DA 3T0BA 4RL3A 1FFQA 2ZUVA 2XFYA 3F5KA 4ZENA 4PMYA 2VOTA 4EE9A 1HKKA 1DWAM 1NOUA 3DYPA 4E4PA 1UHVA 3K1DA 2WPGA 2WNWA 3VOCA 4MAVA 4W87A 3VIIA 2E9LA 1NWSA 1H41A 1JXKA 3M07A 4FMVA 1I1XA 3EMQA 2PWFA 4CN4A 3WL1A 4UQEA 1NWUA 2WSPA 2WVVA 4AZCB 3VM7A 1XGZA 3BMWA 4MJ2A 4D6GA 4W5UA 2C7FA 1W9DM 2NSXA 2FHCA 4PTWA 3AMDA 1E5NA 4BA0A 4P7OA 4F79A 5A8PA 1W91A 2E40A 1E4MM 4UOQA 3WBEA 4YHEA 1VEPA 4D6JA 1CXIA 1KGWA 4NF7A 2DSWA 4EANA 1H09A 2UY4A 4PBGA 2GVYA 3L4ZA 2YBUA 3NSNA 2BY2A 3PZNA 4P7QA 3W38A 4PYSA 4HU0A 4WK9A 1GCYA 4X0VA 3VDAA 4AISA 5D8ZA 1HKIA 2XFRA 4XB3A 1YQ2A 4F66A 3BLPX 1UWUA 2WB5A 3MMDA 1ZS2A 2O92A 2W91A 2XPKA 1FFRA 2EPLX 5KZ6A 3NJ3A 2A3EA 3II1A 5I79A 1CIUA 2V3DA 1GW1A 3WF0A 4JHZA 3T08A 3AFBA 3WEOA 1JYVA 2J7BA 4JFUA 4UQAA 4DUVA 2EPMX 4IUGA 3RPMA 2FHBA 4QAWA 3T0DA 3LPFA 1GQIA 1R87A 5GPRA 1XD1A 1E0XA 3CHDA 5EMYA 3EMCA 1J0HA 1VBUA 2WMKA 3PN8A 4FLQA 3NSXA 1E1FA 2XWEA 4KGJA 3WD1A 2OWCA 2CYGA 3CBWA 3PBGA 2EPOA 1CDGA 1EQCA 5EFFA 4M24A 1ZBKA 1TE1A 1ISWA 2XFFA 3O2LA 2X0YA 1C90A 3T2PA 2WBKA 3GXFA 3S6TA 4OBSA 5CLWA 4DWSD 1TFVA 4PMOA 1OD0A 1D7FA 1C92A 3WSUA 3CUGA 4PUEA 3L4VA 2WHMA 3AIRA 1EHAA 1Y7VA 4JKKA 2YDRA 4ML4A 2XG9A 2BHZA 4GI6A 4CUCA 3MMWA 3LPPA 3WF2A 2WK2A 1I1WA 3A47A 4W8BA 3W4RA 1VFOA 2WW5A 3PZUA 4Z2KA 1WP6A 1NH6A 5CZKA 2BXZA 4CVUA 4J27A 2CETA 3WMSA 2F2HA 4HA4A 1XH2A 1CXEA 3OB8A 3U5YA 4XZBA 1JZ2A 3G6LA 3B9DA 4QFUA 1D3CA 2IXVA 1CTNA 1WNOA 2DH3A 3WENA 4W7UA 4QP0A 2J47A 3T2OA 1MFVA 1TVPA 1ZJBA 3OLEA 4AEFA 4TTGA 2J7HA 1LL4A 4MB4A 3MSDA 1CGYA 2ZXBA 4WSKA 1J12A 2A3CA 2QPSA 3MUZ1 5M5DA 2AMGA 1KXQA 1FA2A 2PWHA 3ECQA 4JL2A 1JAEA 4GXPA 2UWFA 1V0NA 3VIJA 2WMIA 3ARYA 3W24A 3VO0A 1ZL1A 1JYWA 4BZYA 3W81A 5JBEA 4DM2A 3N13A 3QOKA 4FF5A 3CMGA 2GK1B 1H0GA 4OIFA 4WJXA 2WVUA 3ZT6A 1F4HA 2O9PA 1HL9A 3VNYA 4D6FA 3UG5A 3WUBA 1NWTA 5D4YA 1HJQA 1UQYA 2D0HA 4B9YA 1D2KA 3L2LA 3UR7A 3E1F1 4U2YA 2O9TA 2W4XA 3POCA 1WZKA 1WCGA 1EXPA 2WZHA 4AZ7A 3KZSA 2J62A 5HOSA 1UZ4A 3CIVA 3HMCA 4P8VA 4XX6A 2HISA 1YHTA 1GJUA 1CLVA 4AIOA 3BAYA 3U7BA 1E73M 1P6WA 1I75A 1SMDA 1JDAA 1E3XA 2FDMA 3IK2A 5E0FA 4J3XA 2VJXA 2OWWA 7A3HA 2XM2A 1UR8A 3IAPA 2G3NA 3SUVA 2O9OA 4HU8A 5ECUA 1TA3B 4B16A 2VCAA 4OZOA 5IXEA 3ZMRA 2GJPA 1MW1A 1US3A 3AOFA 2OLHA 4MADA 3AICA 1GHSA 3O9NA 2PWEA 3ARTA 3BAJA 3AMKA 1JD9A 4AZ5A 3SCPA 5I24A 3PZIA 4MB1A 5AY7A 3KL3A 4CU8A 2BY0A 3VD9A 3SCWA 2UY5A 1C7TA 3I3DA 1J0KA 3BGAA 1BYDA 1PX3A 1W9PA 3SCTA 5FL0A 4AD1A 2E0PA 1WDPA 4H2CA 2GJRA 3ARPA 1IT0A 2X09A 1AQHA 1FH7A 2EXOA 3WMBA 3ZR6A 4PN2A 2VTFA 4QLLA 1OCQA 2CCRA 3WQ8A 4D72A 1BF2A 1E15A 2WM0A 1LG1A 3CUHA 4MNLA 3EMZA 2CITA 3VNZA 3QOMA 3UEQA 1KBKA 1QI4A 1W3HA 1LWJA 2CERA 2DSKA 1ECEA 3GXMA 1NARA 3AYSA 3VGBA 3SIMA 2G41A 5A8QA 4J3VA 5A2AA 3QHOA 1R86A 3WDHA 1Z32X 2FGLA 4Q7NA 3ARWA 1K9EA 3AMGA 3VDBA 1MFUA 2PF0A 3ALFA 1WAWA 1XYZA 3AJ7A 1DWFM 3WKZA 1NM9A 2WKLA 1GHRA 3AS3A 3SUSA 3VMNA 2VZTA 4LX4A 1HVXA 1MWOA 1QNRA 3VMPA 4L4OA 2YL5A 4W93A 2OYMA 3AXIA 1WZAA 3K8LA 2W61A 2D3NA 3NUKA 4RE4A 2VMFA 2WMJA 1GVYA 2VCCA 5TD4A 3AXHA 4JFWA 1OINA 4CD8A 3T09A 5I5RA 4EK7A 3D3AA 2QMKA 1CYGA 5BRPA 4OBRA 2VX4A 5I2UA 3WIJA 4N42A 1QI2A 1UR1A 5DEZA 1CWYA 1HKMA 4CVWA 3M6DA 2W5FA 4F9DA 5CXPA 2YIHA 2FHFA 2CXGA 2NT0A 1GNXA 1B0IA 1UD6A 5ABFB 1OT2A 4MJ4A 4MB5A 1GOMA 3TA9A 1W9BM 4AD3A 3N1AA 2QLYA 4OOZA 4NSBA 5I0DA 4W7WA 1NOWA 1E6QM 3VTRA 3PTMA 2WLYA 2Z1KA 1VIWA 1E40A 1UR0A 4PRWA 2E9BA 2ZUWA 3GBDA 4TTUA 3TTQA 3SUWA 1PZ3A 3OZPA 4B3KA 3EYPA 1XV8A 3N11A 2XVLA 2VZUA 2WZIA 1BGAA 2VR5A 2Q8XA 1E71M 4AYSA 1UH3A 4TOQA 2ZWYA 1UWTA 1VFMA 4GZIA 3ZJ6A 1ISZA 4AD0A 1W3JA 7TAAA 4J3TA 3CMJA 2EEXA 5A69A 3CO4A 4UFIA 4OJYA 1E56A 2TAAA 3AQUA 4NI3A 4UQ9A 3IAQA 2OYLA 1TR1A 4MNJA 4WKAA 3UCQA 5DT7A 4GQQA 1TVNA 1CECA 2YDQA 1JNEA 3PZVA 1H1NA 4DWSB 4AXNA 1X6NA 4HPGA 3DYMA 3HU7A 4M56A 2XUCA 4JL1A 1V3JA 3VGEA 1BYAA 1PEZA 3WFZA 2D20A 4JKMA 3RM9A 1QVBA 3K8KA 3KL0A 4MNKA 2ZUUA 1L0PA 4Q22A 1NWRA 4HPHA 2CBIA 3APGA 3VD4A 4PMVA 4ACZB 2X1IA 1GUVA 1UZ1A 3IJ9A 3CZLA 1G94A 1B1YA 3W6MA 3VM5A 4TVUA 3GNPA 4OUEA 3W82A 3VINA 3VIHA 4QCFA 1A3HA 1CEOA 2A3BA 1E6RA 1QNSA 2DT1A 2BFGA 4A4AA 2XGIA 2VX7A 3RJXA 2FH6A 3AZRA 5JIWA 2YLAA 2ZOXA 3BSGA 3VVGA 5D9MA 1E6SM 3W37A 2XHYA 3FHAA 4NRSA 3VGGA 3O6AA 1FHDA 2PWDA 3KWXA 3WH7A 4JAWA 4H8HA 1VJSA 4XV0A 4JIEA 3AIBA 1CZ1A 5M3WA 3BXWA 2EPKX 1QBAA 1UKTA 3VX1A 2YL8A 1V03A 1J0YA 2ESCA 4UFKA 4PCSA 1TZ7A 5ABHA 1W32A 3KL5A 4CCEA 1X1NA 2FH8A 3ARSA 4S3JA 1QNQA 4W8LA 5AC4A 4CN6A 4CU7A 1ODUA 4ATDA 4UQBA 2VT0A 1EO7A 5E09A 3AHTA 1ITCA 2OSWA 1RD6A 3NDYA 4ZXLA 5A6KA 4CD4A 1KQZA 4U3CA 1EQPA 1KGXA 3SCOA 2DGAA 1OGBA 2WWCA 4GZEA 3I3EA 2WVSA 1MW2A 3I3BA 5BCAA 1CGVA 2A3AA 3ZQ9A 1XSJA 3THDA 4QLJA 4P7LA 4U5KA 5IHRA 1JZ7A 1B3VA 3BMVA 1UD5A 4DWSC 1RH9A 1HF6A 5DF0A 3ZSTA 2DT3A 1VRXA 3A6OA 3ARRA 2WVVB 3WDQA 5FL1A 2DIEA 2VUYA 3W29A 2XTKA 4GQRA 3AS1A 5LYRA 1CLXA 4LPCA 2XVGA 4AW7A 2WCSA 4PUDA 3PHAA 4W88A 5A2BA 1OIMA 4JFTA 4Y7EA 1A47A 1FH8A 3VD7A 1V0MA 5JIPA 3AHZA 3MS8A 3UERA 4C7DA 1EOKA 2VR4A 4W8AA 1B9ZA 3F4VA 3QGVA 2E8YA 3AHXA 3VIOA 3WUFA 4DM1A 2GJXB 4CD5A 2GK1A 3CZ8A 2YL6A 1J11A 3ARVA 4D6HA 4D6DA 1B31A 3WH9A 3LMYA 1NP2A 1UH4A 1GQKA 4AY1A 1K9DA 5E9AA 3ARXA 5M17A 3BAXA 1H4PA 1WO2A 5ABGA 3WF4A 1RP8A 4BQ5A 1WB0A 7CGTA 2G8ZA 3K46A 1QI0A 1LL7A 3THCA 2XGBA 1M7XA 1PX4A 2YLLA 4CU6A 2VZVA 2RGLA 3BSHA 1DWHM 1R7AA 4EAMA 1H0IA 1C7SA 1J01A 4RE3A 1U33A 1XRVA 4NZCA 1PIFA 4Z2LA 1IV8A 1CXLA 4AZIA 2GDVA 4FK9A 1G1YA 3ZSSA 2ZX9A 4B3LA 2D1ZA 1HJUA 1KWKA 1VEMA 1JYXA 2OSYA 3VX0A 2QHAA 4W85A 1XCXA 1H49A 3WELA 3K4DA 3NIYA 1QBBA 4UFJA 4BQ3A 2JE8A 1EDQA 5JUVA 3T0AA 4CKQA 5HNNA 3W28A 3BAIA 2WC7A 1TMQA 1OM0A 3KE0A 1CPUA 1UR4A 4ZE5A 1CBGA 4XUYA 4PEEA 2J7DA 4UOJA 4X9YA 2BHUA 3MUIA 1K9TA 2XIBA 5DFAA 2YA0A 1CENA 4CCCA 3MUY1 1HX0A 2VI0A 5D8WA 4H8VA 1UWRA 3L4XA 4ACYA 4UZUA 3UETA 3SCRA 4KWUA 1R7OA 2YOCA 3AMCA 4H04A 1DWIM 1C8YA 1CGTA 1PBGA 3WD0A 3HN3A 4B9ZA 2GDUA 2YA2A 3VPLA 2D22A 4MB3A 3GBEA 1OSEA 1H3GA 3TONA 2ZUNA 3EDEA 5I77A 4F9JA 2BNJA 1XHGA 2J7CA 3AIUA 1JZ6A 1G9HA 3QHMA 4JKLA 4UCFA 3ZT7A 4LYQA 1V3MA 2V3FA 3CUJA 4PMUA 3HJEA 2E3ZA 4PMQA 2WZEA 3WDRA 2ZUTA 3WEZA 1W9XA 3WDPP 2XWDA 4AD4A 4M80A 4HMDA 2J8FA 5DO8A 2BS9A 2DPEA 2VC9A 4MDPA 1KR0A 4PMDA 3UG3A 1JI1A 1GOWA 3QHNA 4D1JA 5JBFA 2IXUA 3M7SA 4PTXA 3ZJ7A 5CPSA 4KRTA 1KR1A 2WMHA 1BYBA 2DQXA 1JIBA 2JIEA 1MQRA 1ZBVA 4Z2JA 2OWXA 3WNPA 3MMUA 4HZ6A 4M82A 3WH5A 2ZX5A 1HT6A 3OLGA 5IHSA 5CQ1A 1UR2A 2WMIB 2F8QA 3RJYA 1Q6FA 1W3KA 2PBGA 1V08A 3EDKA 4UNIA 4ZEPA 3MV11 3SUUA 2O9RA 1PZ2A 4UFMA 5LA0A 1ISYA 3OGVA 1B3WA 5HDRA 2HVMA 1E0WA 4D6EA 1KXVA 1QNPA 1FHLA 4L4PA 2WAGA 1E72M 2EBNA 1Q6CA 1QW8A 3EBVA 1BG4A 4PCTA 1EA9C 4OOUA 1DEDA 2XVPA 4HZ7A 1BHGA 2CESA 1W1VA 5GNYA 4AIUA 5FCZA 3AHVA 3OGRA 1GZJA 3GH7A 5IFPA 4PTMA 3BH4A 4UZSA 1QW9A 3FW6A 4V2XA 4HMCA 5CG0A 2YKKA 1UKQA 3N17A 4AD5A 6CGTA 4BCEA 1CGUA 1C8XA 2DDXA 4D6IA 4FLRA 1OWQA 3AHYA 4N0RA 1WPCA 3GNRA 4TUFA 1UA3A 2DSUA 3ARZA 1HJXA 3N18A 2YJQA 1CXFA 3MUAA 5A95A 2X05A 1B30A 4D1IA 3KEHA 1XC6A 3VIFA 3ZM8A 3MANA 3D5HA 1FP8A 1UOKA 3MO4A 1E6XM 4W89A 3AZSA 2DIJA 2CBJA 2WCGA 4UFLA 3CZJA 4FLOA 1S46A 1JYNA 5LA2A 4J28A 3K4AA 3WQ5A 1KCLA 1MW3A 3WQVA 5FIPA 5CSUA 3MU7A 1E6PA 5BRQA 3CZEA 1LJYA 2JFEX 1W3LA 1W1TA 2Y2WA 2Y24A 4HOWA 2DH2A 1VAHA 1C3FA 3FY1A 2ZX8A 3WH8A 5A6JA 3EDDA 4KGLA 4IISA 4GZJA 1W1YA 1DWGM 5BXTA 2YL9A 3WD2A 1VFUA 2J78A 5BXRA 3VIMA 3CUFA 3N12A 1BVZA 1UD8A 1QI5A 2BY3A 1W2PA 3WBAA 1JDCA 1GONA 3SEPA 2DT0A 4U5IA 3OGSA 5GNZA 3WQWA 1H5VA 2WKGA 3L4YA 4WLCA 3IJ8A 2ZUSA 2VZSA 2X0HA 3DC0A 1CXHA 1E6NA 5A6LA 4A3HA 1Q4NX 2PB1A 5A6BD 3AYRA 1US2A 3CZKA 1BTCA 4J3WA 1GJWA 3AMLA 2WANA 3PZOA 1UD3A 2CKSA 4GKLA 1FP9A 5E6ZA 1QPKA 3VKKA 4GI9A 2F61A 2PC8A 2J77A 3GM8A 4GI8A 4LGXA 4AZCA 4U3AA 1B90A 4MNMA 3DYOA 3ZO9A 1WE5A 1BSIA 2ZIDA 3VIPA 9CGTA 5CPQA 5DT5A 1HXJA 2NW0A 1HNYA 1KFWA 1MVYA 2GUYA 2D24A 2J4GA 1AMYA 1PIGA 4TVDA 3RM8A 1E0VA 2J7FA 1CXKA 1M03A 4BQ2A 3K8MA 3PZGA 1CGWA 3WY1A 5GNXA 3FAXA 5FD0A 1QOXA 4P8XA 1LQ0A 4DUXA 1SR0A 1K6AA 1GORA 3WF1A 4QLKA 2XYLA 3U5UA 2DSZA 3PTQA 4AD2A 1ESWA 2VL4A
chains in the Genus database with same CATH superfamily
4UOZA 2V68A 3H26A 1K6WA 3UESA 2C0HA 3P2VA 1TCDA 2DVUA 5MKGA 5HUOA 5E5CA 4DIAA 2WHKA 1F7BA 5AHMA 4UFHA 3TK7A 3V35A 3CIXA 3F1QA 2DV0A 4NJGA 1R2SA 1C8QA 5EU9A 1MSSA 1UUOA 3UYIA 5TIMA 1DIEA 5C70A 1FWIC 1ITXA 1EGZA 2VX5A 5I00A 1YDYA 1O60A 1P43A 1M41A 4AWTA 5DMNA 4WF7A 1RALA 3RMEA 1WAUA 4IQEA 1O5RA 1UWIA 3CC1A 3P0XA 5AHIA 4JXCA 2RAGA 5A8MA 3GYCA 4HNVA 5FOOA 5CAHA 4IHCA 2W3ZA 5E0CA 1P1MA 3ICJA 3N4AA 4Q6JA 1OCJA 1T0OA 2VRKA 4L1GA 1EDGA 1SU5A 4XKYB 4C6JA 2FJUB 4MY1A 1ZP3A 3AI0A 2XVKA 1UOZA 3L0KA 1ITUA 2XSBA 3SCQA 5CLTA 4C6KA 2NWSA 3ZLGA 1H1ZA 4GO8A 4BWLA 3INPA 3GTHA 3PWIA 4RZ6A 1ISXA 1CGXA 3V1PA 1XYBA 4WY0B 1WUFA 2FGZA 2E5BA 5A8OA 5CGTA 3T42A 1A80A 1R8LA 4DXKA 3WNOA 1ZJIA 3NVTA 3S46A 2WCAA 2CU0A 3NAVA 1F4AA 4WQ6A 4RNIA 3LXBA 3OZOA 3TP4A 3FOKA 5CCZA 3IJ7A 3IRSA 4Q8OA 5BOEA 2XH0A 3WLSA 1J0JA 4MPKA 3TYUA 1SZEA 1EC9A 4Q6XA 4QEEA 4AG0A 1Z6KA 3VD3A 3U57A 2ACSA 3PB2A 2MNRA 5I6SA 3FEQA 3MSGA 7TIMA 4GABA 3BG3A 3BLIA 1E4IA 1E55A 1BF6A 1UQZA 5HR6A 1QPQA 3RCYA 3WL0A 1PDYA 1JD7A 1V6VA 3ZR5A 3B9AA 3ZT5A 1PJ9A 2G3IA 2G3FA 4DBSA 3A24A 2CZDA 2WC3A 2BVTA 3C56A 1US0A 1W9UA 5HQEA 4DF2A 2VFGA 4YCOA 4HK6A 2NX9A 1JRCA 5A94A 1XLEA 1EDTA 5KEZA 1XF0A 3WQ4A 1IXQA 3W71A 1AVAA 1DXFA 2QVHA 3MC5A 3B8TA 3O15A 3PFRA 1VFFA 2YBVA 2WOQA 4M7SA 1BFNA 2IPGA 4UTWC 3PJTA 2ZVRA 3H2NA 3KCJA 4WKHA 1PCWA 1EIBA 5HMFA 1OBAA 2ZX6A 1V7AA 4I7WA 2PCEA 4GVHA 5DMMA 1THFD 2Z2BA 4AFYA 3T8QA 4U2ZA 4Q4PA 5LSMA 5C55A 3RUBL 2WVTA 1UB3A 3GDBA 1EP2A 3TTSA 3EDJA 3B8DA 3A4XA 4CQBA 1ZJAA 2HPMA 2RDXA 3LSBA 3VILA 1E9IA 2O4MA 4KEVA 4B5UA 1DPMA 1K70A 3A12A 1U22A 4Q8PA 5D9NA 5REQB 1Q6OA 3RYSA 1HJVA 2PDFA 1JR1A 3B0PA 1UD4A 2J75A 4K8HA 3OLIA 5HATA 1DE5A 3T78A 3S2MA 1J0ZA 1TA3A 1QI3A 4GIRA 1ALDA 4HPNA 1AQ0A 3F2DA 2VO5A 1ZAHA 3LCIA 3NPVA 4AEEA 2QDHA 2QV5A 1J18A 3JS3A 1T41A 4GVFA 3G18A 4J4KA 1FDJA 2VVSA 2VCBA 4TX9A 3ZLHA 4HZ8A 1OK4A 3EOLA 1GVFA 1UCWA 3VNMA 3WFLA 5AYIA 4F40A 2W62A 4U33A 4CN1A 1EUAA 3P3BA 3ITTA 2B31A 1C29A 1DOSA 4YN5A 2F84A 1JJKA 2VNCA 1AZ1A 2FJKA 3WDJA 1A5BA 4QDMA 2P5NA 4ZOBA 4MZYA 1E4NA 3LQLA 1RBOB 2BY1A 3OIHA 1TE6A 1XC4A 4KERA 4XAPA 2J6VA 2QPUA 2X16A 1BG9A 2YYUA 3MCNA 2FB2A 3M43A 2PTZA 1PDZA 1QASA 1YE6A 3LRMA 4YPJA 4N7QA 5AC6A 3NQEA 4E38A 3E9AA 2I16A 4WSJA 5HNUA 3T05A 3PTKA 3UGVA 1YDOA 2ZXQA 5CJ5A 1LWIA 2GVGA 3MI3A 4JTFA 2IW0A 5HPCA 4HHPA 1D7KA 4PRTA 4MWAA 4HU4A 2YXGA 3NQFA 3WNMA 2E67A 4B90A 5J5RA 3WNNA 2WKJA 3UWZA 4AMCA 3P5ZA 3GS6A 1E3ZA 1V5XA 4EF8A 3QRHA 4I9MA 3WMCA 4CCDA 3HV9A 5DQPA 3WLPA 1UWQA 1H50A 3N15A 3WQFA 4DRSA 1EEXA 3NEVA 4Z42C 2CLKA 3MCMA 4ICCX 1HKVA 4Z2GA 8A3HA 5EB8A 2WQDA 4YTSA 2PDNA 4FX7A 2NUXA 2A3LA 4MJZA 3VYLA 3SCNA 3O05A 3GAYA 5ABFA 1BQCA 1EGVA 4JTIA 1RR2A 1R9ZA 2PSNA 3CUXA 3EDFA 4C6BA 3JW7A 6REQA 2DEPA 8TIMA 3L5AA 2OKOA 1JAKA 2PDJA 4LAUA 1ML1A 2P10A 2QDDA 4GQ0A 4ZTXA 1AH4A 2DZTA 3GW3A 2YCKX 2QCCA 3B8WA 4PMNA 1V02A 2Z6JA 2OKTA 3NA8A 4IJRA 1TSIA 1LRNA 4IG2B 1MDLA 3LN3A 4QISA 1V6TA 3HG5A 2ZA1A 2PTWA 3TWBA 1B3XA 1RP9A 3ME3A 3OHMB 4IL2A 3O6DA 3ZIZA 3R58A 2FTPA 3R8RA 4NU7A 3LBOA 4AVFA 1R3RA 4HN8A 1WDDA 4E8CA 1ICSA 2CNCA 2C3ZA 3AXXA 2JIWA 5F2IA 4D6CA 3EZ4A 1Q8AA 4QQ3A 3HG4A 1P0EA 2TPSA 4AHOA 3HMJG 4H4IA 1KLZA 3CV7A 3R2GA 6PTDA 1H2JA 4RXFA 1QHOA 3ARUA 2YCIX 4AZHA 1RPXA 3OLDA 3OZMA 3AROA 2I57A 1JFXA 3RILA 1HVQA 2RGMA 1LWHA 5AVHA 2ZQ0A 5C8BB 2QAFA 4N6FA 2V5DA 1DJYA 4E2OA 4S3KA 3NYZA 5D05A 4ECLA 4GO9A 3VDCA 2C1IA 2VEMA 1TPFA 3THUA 3P8IA 2DVXA 5E70A 3SFWA 2VQUA 3MMTA 5KZMA 2D2JA 3CH9A 1EHNA 3ABSA 4WGHA 3HZ3A 4FO4A 2X8RA 3TQ0A 3NZRA 3PULA 2QMJA 3ZWTA 1RVGA 2HCVA 2OEMA 3JU2A 1LLWA 4MAZA 1OFAA 3DFQA 3PBWA 4RZBA 3TE9A 2J79A 3CS2A 5AOUA 4P7RA 5IRPA 3ZJ8A 1P0DA 5HULA 1HTIA 4RNHA 3CUIA 2C18A 4MZ1A 3AU2A 2EJ1A 4AMAA 3W2KA 1XRFA 3LG3A 1HW6A 2Y0FA 4JHOA 1E5JA 3BOFA 4M29A 3MKKA 5BROA 3RX4A 4DB7A 3IGXA 4RR4A 5I3DA 3EGJA 1R3YA 5EPDA 4O15A 1B3OA 4PMYA 1YPIA 5AHFA 1DWAM 1NOUA 4HYRA 4S3EA 3RCMA 4E4PA 4KWVA 1UHVA 4I6VA 2ISDA 3BW3A 1X1OA 2PDWA 5D30A 2H8XA 3VIIA 1IGSA 5LNVA 1NWSA 3T9PA 1RUSA 3LRLA 3TLQA 1A0DA 3WLKX 1I1XA 3TMQA 1XYCA 3C0QA 4CN4A 1NJJA 3EA2A 3PSVA 1M5WA 4W5UA 4NI8A 2Z24A 1FWFC 4PTWA 3TYBA 2FDSA 2YCLB 4BA0A 2ZCGA 3DG6A 2IQ0A 4F79A 4GMEA 4YHEA 4D6JA 2P3EA 4G7FA 2Y8UA 3UCCA 4NF7A 2J9XA 3KVKA 5CZ0A 3E96A 4PBGA 1VS1A 3YPIA 3NL2A 3W38A 2ABAA 2D2GA 4WK9A 5IBXC 3M6YA 4XB3A 2D73A 3TZNA 1XBZA 2CLHA 4ZB0A 1UWUA 1U1JA 2ON3A 3UY8A 2A3EA 2V3DA 3AFBA 1JYVA 2YYTA 2Z2UA 1YNPA 1RK5A 1ONWA 3A5FA 2RJHA 3LPFA 1RJPA 1R87A 5D2TA 1F76A 2YX0A 2WMKA 3W7OA 2Z1VA 3IGUA 5KTLA 4DNHA 4FLQA 2XN1A 3NSXA 3WD1A 3PBGA 1LDCA 2X7VA 4QDPA 1CDGA 5FACA 3MYPA 1TE1A 2RFGA 3W7GA 2XFFA 2YXXA 2HXTA 3T2PA 1OD0A 1D7FA 1C92A 3BZJA 4DXXA 1H63A 4PUEA 3L4VA 4KWOA 3LTSA 4HYVA 4DAIA 4RDZA 4NILA 4GI6A 3DC8A 1IR1A 1TRIA 1H7NA 3WF2A 1TYGA 4W8BA 1FCBA 3W4RA 1VFOA 1Q13A 2OOGA 3LI1A 1XDLA 2QUUA 2Q8ZA 2OLSA 5LKYA 2C1GA 1Y65A 2NX3A 4IH3A 3VZZA 2B7OA 5G1TA 3WJXA 1LUCA 3D0CA 4QG6A 1XH2A 1CXEA 4H6RA 2ZTKA 2AGTA 1S5VA 4K36A 2J6XA 4NJJA 4PUUA 3WENA 1NDVA 4GBUA 5BW6A 3ONBA 1OCNA 3T2OA 2RDUA 1MFVA 2PDGA 5C54A 1TVPA 2J7HA 4J3ZA 2V5KA 4MB4A 2GVEA 1DJQA 4E0CA 3CB8A 1J12A 1PTGA 2A3CA 4XIMA 2WNZA 2OT1A 3MUZ1 5CPOA 4UR7A 2PWHA 4AF0A 1IT7A 4L4MA 2R14A 3IIVA 4MIMA 3BOXA 1TX0A 3VIJA 2WMIA 4JYDA 3W24A 2GZXA 1JYWA 2B7NA 2Q01A 3O0KA 3MP4A 4FF5A 3CMGA 1Q45A 3L68A 3TR9A 1G4TA 3EPNA 1F73A 1HJQA 3C2VA 1NELA 2OQHA 3GK0A 4LVBA 4LWWA 2IKHA 1D2KA 3UR7A 3VK5A 3E1F1 1MMFA 1XYAA 4FNTA 2IPFA 1VFSA 2W4XA 1XLCA 3POCA 2I9EA 3ABRA 4LCRA 2I56A 4YVPA 4JQ3A 4L6OA 1UROA 3RN6A 4XX6A 3HPAA 3DEQA 5AC7A 4X61A 1VIZA 2CZVA 2HE5A 4NKCA 1E73M 1PB0A 3LK6A 1G69A 1LOLA 1JDAA 1E3XA 2FDMA 3IK2A 1FWNA 1W1ZA 4DI9A 1YDNA 2O9OA 1EPXA 1TA3B 4JQ1A 4B16A 1XLIA 2VCAA 4OZOA 2GJPA 1L6YA 2TODA 4EXQA 4PCNA 4PZVA 4PB4A 4MADA 3TVAA 1SJCA 3BAJA 4PA8A 2QS8A 1XRSA 3LENA 1R9YA 2E25A 1QCWA 1VC4A 4ZMGA 5LXEA 4GX8A 1YE4A 2YFOA 4K1WA 1NIUA 1PX3A 4XZNX 3G1VA 4GUIA 2E0PA 1WDPA 2GJRA 3OG3A 2BDQA 3LHTA 1TRDA 1FH7A 2EXOA 3SY8A 3ZVHB 1GG1A 1G4PA 3WMBA 4G56A 1YTKA 3LXAA 1X7FA 3WQ8A 3CM4A 4MNLA 2CITA 3QOMA 3RG6A 1W3HA 1LWJA 2DSKA 1H51A 1UP2A 5A8QA 5A2AA 2DJLA 3U8GA 1DYSA 2FGLA 4Q7NA 4LW7A 3AMGA 2V9DA 5HWJA 2PF0A 3I68A 2PRLA 4MWAB 4XSLA 3LNPA 1XYZA 4IX0A 3QLLA 3E2VA 1RY0A 3VMNA 3E0WA 4A29A 4FSAA 2YL5A 3GLCA 2OYMA 4W93A 3K8LA 1JDEA 1JCJA 2XINA 3NUKA 2H6RA 3CXOA 3F2CA 3ATZA 4HCDA 4JFWA 4LEFA 1QT1A 5I5RA 4EK7A 1O5KA 4J2PA 4XZHA 1CYGA 2FMNA 4L9XA 1QI2A 1UR1A 4A8LA 2HV5A 2GOKA 2F6KA 3M6DA 3BMXA 2E6FA 2YIHA 5FI8A 4WR3A 2RH9A 5AYYA 2HROA 2NT0A 1UD6A 4ZSTA 5C9ZA 5ABFB 3H2OA 3DN5A 4MB5A 3HFYA 4FEZA 1GOMA 4XISA 4GNKB 5F4XA 3SADA 2QLYA 3QPZA 2F6XA 2HDJA 5K7JA 1Q7ZA 4HK5A 1VIWA 4IIFA 3LBMA 4MJMA 1VFHA 3GBDA 3TTQA 4MM1A 2Q3OA 3QY6A 3CPRA 1BVWA 1HFBA 2Q3RA 3GYEA 4UTWA 1QPNA 3EYPA 3BK0A 4UMCA 3N11A 1A3WA 4C1LA 2WZIA 4UWMA 1QOPA 1YDVA 4KCVA 2PDXA 2CFFA 2Y5JA 4PB3A 3PC0A 3ZJ6A 1AD4A 4R34A 5G4WA 1W3JA 5E1QA 1XP3A 3O16A 7TAAA 2EEXA 1G6CA 1EWEA 2I9UA 3FKKA 2A7NA 3SZ8A 3W9ZA 1VYSX 1E56A 2OO0A 2TAAA 3AQUA 4NI3A 2F9RA 3IAQA 4IMFA 3WLOA 1TR1A 4MNJA 2OZ8A 4GQQA 3L2IA 3PZVA 5AZ1A 1H1NA 4YL2A 2IMRA 4JQAA 4HPGA 3HU7A 3FGCA 5U4NA 5EMLA 3WJZA 4F4RA 1A5SA 3KP0A 3WFZA 4JBRA 1Z41A 3H4WA 6ALDA 3C0SA 3V5CA 3KL0A 2ZUUA 4GKTA 1ONEA 3BLDA 3G24A 4GHRA 5H8UA 2WZMA 3CZLA 3GUGA 3TWAA 3W7HA 3W7DA 5K9CA 2V81A 4FNUA 3VM5A 4FNSA 1X39A 2B7QA 4PFHA 4PRRA 1H62A 2Y70A 5HMSA 4F2TA 1X8FA 1A3HA 2A3BA 2GUUA 3H8AA 1W5NA 4WRHA 3C0LA 2HSAA 3GR8A 5HWNA 3W37A 2XHYA 5DXYA 4M6UA 4S3CA 4P2VA 4JAWA 2VDGA 3DZ1A 1YX1A 5DBUA 1IWAA 1CZ1A 2QJHA 3FJ6A 1UKTA 1KNWA 1V03A 2XN0A 4B4FA 4PH6A 3AYVA 3M5XA 1TZ7A 5ABHA 3QEZA 1ZFJA 2Z7KA 3KL5A 1HUVA 3S5SA 4S3JA 5HK4A 1AJ2A 4K8EA 4RDYA 4ATDA 3FXGA 3EKZA 1LT7A 5LIKX 2REQA 4I90A 3OHIA 5HWMA 5E09A 3TXVA 1OVDA 1RD6A 3OYZA 2XH7A 1XIHA 3CTLA 1TTIA 4CD4A 1FDYA 1KQZA 1QK2A 1XLMA 3QM3A 4P61A 4LH8A 4HGXA 3BCJA 1OGBA 3I3EA 1DE6A 3FA3A 2YR1A 1JPHA 1XSJA 3PNZA 5IHRA 4U5KA 2BOFX 3BMVA 3GU9A 5D2XA 2R91A 1RH9A 3GRIA 4C6PA 5DF0A 4XZLX 1C8VA 1AJZA 1FUYA 4Z1BA 3GU1A 5FF2A 4E2DA 2XTKA 1CLXA 4GK8A 2WCSA 2RDTA 1OIMA 3H7VA 4Y7EA 3EPOA 1FH8A 1V0MA 5JIPA 4C7DA 1W8SA 5FAGA 4O0KA 1EOKA 1DJGA 2PLMA 2BVWA 4ALDA 3W7MA 3QV6A 4CNNA 3V4BA 2YL6A 3ES7A 1M3UA 4FOKA 4YS1A 3TC7A 3HBLA 5CPMA 2VKZG 4FXJA 1UH4A 1ADDA 1M7PA 3BAXA 4RZ4A 1WB0A 7CGTA 3EOSA 5T8GA 3E74A 3CASA 1QDSA 1Q4WA 3BSHA 2GOUA 4HMNA 3QN3A 2P53A 4ZZ9A 2V8ZA 1X1ZA 4HK7A 1FXQA 3H53A 1PIFA 2AL2A 3G1SA 4Z2LA 1CXLA 3KTXA 3M44A 4Z0SA 1HG3A 1TIMA 1G1YA 3ZSSA 2J88A 1JUEA 5D32A 3KDNA 3TJ4A 4DJDA 1BSLA 1UJPA 1JYXA 3K13A 2OSYA 5BMXA 4ZO8A 4W85A 2F6UA 1F3WA 3OQEA 1JCNA 4DZ5A 1KFKA 1QJWA 1QBBA 3NIYA 2JE8A 3UGRA 3KW3A 1PUDA 1M6JA 2I5GA 3SO7A 4CKQA 4YVVA 1T5AA 5HNNA 3W28A 3ZWSA 4RPPA 2WC7A 1CPUA 1AW2A 1W5PA 3W7KA 3QQ1A 4X9YA 5DFAA 3MUIA 1K9TA 2XIBA 1X8CA 3VC6A 4RCXA 1OC6A 2R94A 1UWRA 1AODA 1W3NA 1XGDA 3QZAA 4JTQA 2YOCA 3AMCA 2CWNA 1SM9A 3S1VA 4NHVA 4H04A 4Y6GA 2WO5A 5FEPA 2D22A 1AA1B 3KCOA 3OP2A 3M47A 3NPWA 3TONA 1LUCB 2PPGA 4JTKA 3AIUA 3FS2A 3QHMA 4CNSA 4UCFA 4LBRA 3OO2A 3G1DA 2V3FA 5T26A 5E93A 2E3ZA 1P7TA 2WZEA 4IPJA 3EOOA 2NQJA 3MW7A 4QE5A 1AL7A 3W7QA 1P4CA 3KM8A 3UWUA 3LERA 2VC9A 4MDPA 3VNKA 2QJIA 3V18A 3NQ6A 5JBFA 4PTXA 4U4MA 4KRTA 4HNUA 1BYBA 2DQXA 3AXKA 5AN7A 1PO9A 3N9SA 4EAYA 4IMCA 2Z0IA 5EL1A 1ZBVA 3TX9A 2OWXA 3TSDA 4AF0B 5M2FX 4Y9NA 1RCXB 3OLGA 1M9HA 1UR2A 2WMIB 1SQ7A 1IE7C 2PRMA 3RJYA 4QNEA 4OWGA 3RK8A 4GYJA 1V08A 2Z00A 3DFHA 4UNIA 5AB3A 3MV11 4DJFA 3MUCA 5LA0A 4UFMA 1ISYA 3T44A 3OGVA 2OLAA 1B3WA 3KBWA 3PS7A 1E0WA 1Y0EA 4D6EA 3C8FA 4DZHA 5I07A 4ZA0A 4ZOEA 3USBA 1WXYA 3N2BA 2R1PA 2XVPA 4HZ7A 4MWAE 1BHGA 3GU2A 2CESA 2HNHA 1W1VA 5GNYA 4O16A 3G8EA 2GYIA 3Q67A 1J93A 3O6YX 1GZJA 1GGOA 3GH7A 3G77A 2E5CA 4PGLA 4UZSA 3TV8A 1R5YA 4JDBA 3W7RA 3CLMA 5CG0A 3W70A 2YKKA 3P0WA 3F7JA 3E0LA 1CGUA 4D6IA 4FLRA 4I7VA 3GNRA 1UA3A 3ARZA 3Q45A 4UXDA 3SFKA 1L6FA 3KEHA 4C6CA 2BZNA 4Q3MA 1DTNA 2X0SA 1FWDC 5FEXA 4IZGA 2QUTA 3LQGA 4W89A 4UFLA 3TYZA 1S46A 3LLFA 3K4AA 3KWSA 1MW3A 3WQVA 3MU7A 3CZEA 3GC5A 4HZMA 3NGJA 1M1BA 3WO8A 4PL1A 3BLLA 1J6OA 2DH2A 1Q6QA 1VAHA 1QAPA 3WH8A 1RXOB 2ADAA 4KGLA 3WCZA 4ERGA 4GZJA 2G0WA 4GQBA 1W1YA 2C0AA 5BXTA 2YL9A 4NNCA 3WD2A 5BXRA 4L1XA 2YZ5A 3CUFA 3KLLA 3FA4A 1BXCA 3W85A 4HD5A 1GONA 4L65A 2DT0A 5I3KA 3FCPA 4LUIA 5FJPA 1LROA 3SAZA 2V82A 1KA9F 2VZSA 5A6LA 3TN5A 5A6BD 3AYRA 1TWIA 3W01A 1MNZA 1US2A 4KRZA 2E6AA 1GJWA 2GWNA 3AMLA 4IT1A 4ROQA 1UD3A 3MPGA 4JX5A 3GR7A 4H9MA 2ZRZA 1QPRA 1QXLA 3H55A 4L64A 3FEMA 2ZIDA 3VIPA 3NO1A 5CPQA 5DT5A 2PF8A 2R82A 1L8PA 2GUYA 2D24A 2J4GA 3PJXA 1DIOA 1DL3A 2DUXA 4TVDA 3W2NA 1LORA 1CXKA 3W22A 5AZ0A 4LUJA 2QJNA 1QOXA 4EPEC 4US5D 3WF1A 4QLKA 2XYLA 3U2OA 1S39A 2VL4A 4Q7IA 4P8WA 4U28A 3VXGA 2BV9A 2A5HA 5GQBA 1UKSA 3AIWA 1FBAA 3KS6A 3CB3A 4ZQOA 1A3XA 4HA0A 1A5CA 1O95A 2BMBA 2WC4A 1PKNA 2V67A 4LYPA 4PSPA 1BRLB 4ZFMA 1UG6A 2V38A 2ZX7A 3LBCA 4S3GA 4GC4A 4E3TA 4JX4A 1N8IA 4O50A 3W2JA 2P76A 1FDZA 2Y61A 4Q7BA 3LA4A 1G67A 4DJEA 2NXIA 3QR3A 1Q66A 3TYCA 1ADOA 2MANA 3STCA 1CCWB 4BS0A 1VEOA 1OT1A 5D2VA 1Q8JA 3L2MA 3FKRA 1SZRA 1DORA 3BCDA 4W7VA 1LRQA 4WDXA 3GW0A 4UTFA 1ODZA 3CZGA 1TPDA 4TMCA 1KCZA 3LZ5A 3PB0A 1QHPA 2ZA3A 2RUSA 2BOEX 1TWZA 3NQAA 1R47A 2JEPA 5E6YA 2SFPA 5D04C 2INEA 4GPNA 5EBAA 2R24A 2DZUA 2FZMA 4IJBA 2R1KA 5G4EA 3R6IA 2ALDA 4ZE4A 4RE2A 1KXTA 1T96A 2YW3A 2J13A 3S5ZA 4QJ1A 4H00A 3TTYA 4UTLA 3WNLA 2GGGA 2VENA 2QF8A 2J24A 3CLWA 4L1WA 1UKOA 3KHJA 3LI0A 4WJEA 1GVRA 4AUBA 3HGOA 2OT0A 3FGCB 1WZMA 4IPIA 3PBMA 1Z69A 3NQVA 1G0CA 2ZWZA 3H2AA 3UXAA 3HGRA 4Z2IA 5I3IA 4N6EA 3R8HA 3H7UA 2G3MA 3FN9A 3GIQA 4REQA 3KOFA 1EPVA 2VWTA 4LAOA 4LS1A 1RLCL 4Q4KA 1TCMA 3WBWA 2Q02A 3DBPA 1ZU8A 3OU8A 4CQAA 3LEPA 2O7QA 1RK6A 4O53A 5DMLA 3S5NA 4A3RA 4YJ5A 2ZKMX 1VBHA 2GSHA 3W1PA 1HO4A 4XBKA 4OV9A 4Z1CA 3AALA 2PTXA 1JL8A 4XZWA 4IIEA 1JCLA 3EB3A 3UY7A 3QGAC 1W5MA 3HG3A 3M0XA 1XLDA 1I9CB 3GDRA 4X9SA 2A6LA 4NAFB 2YA1A 3U4AA 5DN1A 3R5EA 1C93A 1IIGA 4Y8FA 3VD5A 3K1GA 5C71A 1F07A 1A5MC 4ZFCA 1H60A 4OVXA 4RNFA 1GTEA 7REQA 2UY3A 3DGRA 1TPUA 3TTOA 3M4HA 1PX8A 1Q7QA 4F8XA 4XD3A 3GDMA 3NL5A 1RVKA 3N2XA 5CGMA 3CPGA 1VENA 2FQIA 1LG2A 4UTHA 1PIIA 3VE7A 1F2JA 5HMEA 1UD2A 4BFAA 5GVJA 4LVAA 3P60A 2XM1A 3PBUA 5AHLA 3VUPA 3BLKA 3GHTA 2JALA 4KH2A 1DP0A 1NF0A 3HG2A 3BQ6A 3U7VA 1QHZA 1R38A 1J0IA 2PRHA 1YADA 2A21A 4ICMA 3SR7A 3KTCA 4XBSA 3EOUA 4P5UA 3RXZA 4JICA 4IM4A 3QZ6A 3P93A 4OBTA 5KZEA 1FWBC 1BLIA 5FJJA 2Y8KA 1EFZA 1TG7A 5CH9A 1NDYA 1KC7A 3RLGA 3RDKA 3IVTA 5C0QA 3O0FA 3UA3A 5A3HA 2VRJA 1XIEA 3CUZA 3IVSA 1GOQA 2GFTA 4JFVA 1EZ2A 2UY2A 3GZ3A 4GYPA 1WKYA 4AXKA 1OYBA 2VVNA 3S0CA 4MF4A 3TDFA 1EYEA 4UTTC 3GDTA 5EMKA 3T4CA 1TX2A 1YLVA 3L0GA 3LGEA 5ENLA 4A2SA 3L4WA 3DHPA 4R27A 4QS5A 3ZS4A 2FGBA 4H9YA 5K9DA 3PBYA 3UNDA 2R9RA 3FNDA 1TZ9A 4LF1A 3BICA 2ZC8A 4HCLA 1QNVA 3HB9A 3MKVA 2AL2B 1LOQA 3LMZA 3LPOA 5HBFA 1F9CA 1E43A 3C2RA 3PNUA 1ZBCA 3GH4A 4R53A 1TR9A 3O7UA 1SMAA 3QKZA 1OY0A 3FJNA 3WYZA 4GLEA 3MI2A 3IVUA 1OIFA 4OKDA 2WMFA 4JCMA 1UP3A 2NUWA 3RHGA 2GVJA 1EUNA 2CZ5A 2FPVA 2JK2A 2WJZA 3U9IA 3GDKA 3RM4A 1KW1A 4WGXA 1UPPA 4JQ2A 3UZXA 2NV1A 3OBEA 3RIKA 3SCVA 3BQ5A 4LY4A 3ITCA 2PI6A 3CH0A 5HXMA 4DNMA 1XG4A 1EKOA 2AMXA 3GNOA 1JG9A 5A2CA 3PZMA 2ZADA 2V5LA 4ATWA 3M41A 3UJ2A 4CD6A 3IS4A 4XD6A 3LGGA 3VCRA 3NDZA 1M04A 2PP3A 4DXVA 4JYFA 4TMBA 5G2WA 4DYKA 1XLAA 2EAWA 4MTVA 2WWDA 4IGHA 5FJIA 7PTDA 1XYMA 1UC5A 2J27A 4BEUA 2EQDA 4NP7A 5D9PA 6A3HA 3IANA 4BF7A 1EJ7L 1P7TB 3A3HA 3RU6A 2J74A 1OB0A 2PBOA 2J8TA 3TJIA 2ZE3A 2FYMA 1OFQA 1O5QA 3VGFA 2FZ8A 1Z7AA 1EOMA 3D3FA 1E9LA 2XSAA 3RF9A 1SFSA 5FKYA 1GQLA 4DX3A 2WNNA 3TW9A 4C7GA 2OJPA 1S2TA 5I78A 3V75A 1AUSL 2V3EA 3CAQA 1E70M 1Q3NA 4L9ZA 2GLKA 1ZB5A 1QNOA 4HHLA 2X2YA 4KRUA 1J5SA 1T99A 1OD8A 1OFRA 3I65A 4M6QA 1GKPA 2OEKA 1KQYA 1JVNA 3NCOA 4H8UA 1ME7A 2Z1SA 3F03K 1KB3A 4K7VA 2ZYFA 3MTWA 4AZBA 3VKBA 5ABEA 3NQ7A 1MZHA 4ZO9A 2WSKA 3HPXA 3G22A 1SFLA 4GVIA 4IL0A 4AC1X 2D69A 4MLJA 2XJ7A 4NJKA 1JZ3A 3FAWA 3WUEA 2GSJA 3KOZA 2JKPA 3G1FA 2QV4A 2D23A 2V3GA 4QCEA 3L23A 4IPLA 1KFBA 4FLSA 4QE1A 3F4NA 5DMYA 2DT2A 3OTRA 1Z9AA 4S39A 4IXHA 1E0UA 3VIKA 4A3YA 3BJSA 4PTVA 1KTCA 2QR6A 4JTHA 3RLUA 1VB9A 4IIDA 2Q8LA 4ILSA 5AC8A 4HHMA 1JDDA 1UIPA 3T2QA 1A5UA 4K8GA 5E0KA 2J8GA 4AHPA 3A4AA 4X22A 3UG4A 2CLPA 1S1PA 5A1AA 2YDSA 4W86A 2OEJA 4P8UA 1FWHC 4XD5A 5K3VA 1G01A 4BEQA 2ZXDA 4I5RA 3QR0A 3OYXA 1OFBA 3S2NA 4IFKA 1O7AA 4Z17A 1FWTA 1ZBWA 2ISVA 2ATSA 3CTTA 3SIZA 2VGBA 3BAWA 1XBXA 1EXBA 5EMMA 3LHYA 2VC6A 4Z2HA 4JIIX 4MWAC 4H41A 3FHQA 2VRQA 1D9EA 3CPUA 3WUGA 1Z42A 3PR2A 1VF8A 3G0SA 1XM3A 3C2FA 3WNKA 4XG1A 1R30A 5EA9A 4FB7A 3BV7A 4H7CA 3T0BA 4RL3A 1FFQA 1Q7MA 3F5KA 3KOYA 1OZMA 4ZENA 4O18A 1XW8A 2AQOA 4KCTA 4WD0A 5DRIA 3KVMA 1B4EA 2WNWA 2OGJA 4KIEA 1LBLA 2RJGA 3N3MA 2VEGA 1LBMA 3E5PA 4GD0A 3ATYA 1R3QA 3EMQA 4KKXA 4A8IA 1KFEA 1NWUA 4UQEA 3VM7A 1OEPA 3TEVA 4NZ3A 4MJ2A 2DUZA 5EMUA 1IQ8A 1YPFA 1J4EA 3A3XA 2Z29A 3RRXA 2QGYA 4ZQCA 2FHCA 4F48A 1SJDA 1A5OC 3M5YA 3GNDA 1BQGA 3R4IA 4RK8A 4WXZA 4S3DA 4UOQA 3KRZA 1CXIA 3O8AA 2DSWA 1YPXA 1P0NA 3U48A 2UY4A 2GVYA 4WZHA 4XK2A 4IMDA 3L4ZA 5BMWA 2BSLA 2YBUA 2HBXA 3NSNA 4AAJA 3PZNA 4P7QA 4ZQPA 4PYSA 4HU0A 1RZMA 3NWRA 5FF7A 3MJMA 4AISA 2C79A 2XFRA 3R0DA 1IZCA 4F66A 3E2RA 2WB5A 3MMDA 2O92A 3E02A 1FFRA 3NJ3A 2A1YA 3II1A 1CIUA 3WF0A 4UTMA 3T08A 3V1HA 3WEOA 3RU8X 2W6RA 2EPMX 1PSCA 4GJJA 4IUGA 1XD1A 1E0XA 3S47A 3EEZA 4M7TA 3PN8A 2XH2A 3NXFA 5CC5A 4HKPA 4A2RA 4J1OA 2V2DA 4KGJA 2OWCA 5REQA 1TJ1A 5DCEA 1SZNA 2CLIA 1ZCCA 1EQCA 3WLQA 4M24A 1ZBKA 3KBMA 4LAMA 1BXNA 5IM51 3TKFA 3WSUA 3CUGA 1TMLA 1TQJA 2WHMA 3AIRA 3RAOA 5EYWA 1ZZMA 3GHRA 4ML4A 3RNDA 3W7EA 3FFSA 4IWWA 4KWWA 1JCXA 1XIMA 3MMWA 2DZWA 3GB6A 2GL5A 2WK2A 4NJIA 1PL9A 3PZUA 4Z2KA 3THQA 4H7ZA 1K8CA 4UR8A 3WLHA 4C6NA 4UTJA 5CZKA 3C6CA 3AYTA 3B4YA 2VFIA 3T8LA 4HA4A 2PODA 3DFPA 1QPOA 3OB8A 4F0MA 4XZBA 1TV3A 1VZWA 2OG9A 1J6PA 3G6LA 4QFUA 2OELA 4NYYA 3G1AA 2IXVA 2Z1XA 4AWUA 2PP0A 4QP0A 4REQB 3PUGA 3W73A 4AEFA 1LL4A 1GZGA 2QCNA 1VFTA 1CGYA 1Y5WA 5FJTA 4MKNA 2HEJA 5CPLA 4WSKA 4YWIA 1KXQA 2P50A 1FA2A 4O52A 4S2BA 1XFBA 4O12A 5HINA 3ECQA 1TKKA 3LLDA 3SGUA 3IIZA 4NXKA 4ADUA 2JBMA 2IKIA 1QRQA 2QEZA 2AQVA 1J2BA 3VO0A 1UP0A 1ZL1A 3PP7A 1ZP4A 4NJHA 1UMLA 2E6DA 2XSXA 5CSRA 4NZ4A 1F05A 4OIFA 3T40A 3ZT6A 2ZRWA 5C2XA 2OZ3A 3EX6A 5FJOA 1KM5A 2FVKA 1BWVA 2P8BA 3RLHA 7REQB 4B9YA 1H7OA 1UBPC 3HURA 1KM3A 2O9TA 1GVSA 4QS6A 1WZKA 4NZ5A 3NVDA 1TV8A 3GY1A 1IEIA 4LC6A 4AZ7A 3KZSA 3WQOA 2YPIA 3ITGA 3KVLA 2XZ9A 4C5YA 4MKVA 3PK7A 3CL8A 3BAYA 3U7BA 2KX9A 2IQDA 2PA6A 2QW5A 1OYCA 4J3XA 4NZFA 4IP5A 3IAPA 3SUVA 3W7NA 4QNWA 4MVAA 4QEHA 4HU8A 3P7YA 5ECUA 4RV8A 4LRTA 3GTIA 3IEBA 4CNUA 4YVXA 3ZMRA 2QGHA 1K4GA 2QPXA 3AOFA 2OLHA 3AICA 5LXXA 1GHSA 5BOFA 1JCTA 3O9NA 2PWEA 3SCPA 3I4KA 4O11A 3VOIA 3GFZA 4MB1A 1KRCC 2BY0A 3EWBX 2UY5A 1C7TA 1J0KA 3LHZA 3CWOX 4ZVJA 1AK5A 5HUPA 3KRSA 4L9YA 3SCTA 1ZUAX 3TW6A 1FHUA 1GQNA 1AQHA 6TIMA 2YZRA 3DUGA 3I7SA 3QPEA 2VTFA 2A79A 1OCQA 1BF2A 1MUCA 4YYFA 1KO0A 3VNZA 4LAZA 3ORWA 2PWUA 3L9CA 1KBKA 1QI4A 2CERA 1ECEA 3GXMA 1NARA 3PJWA 4O10A 4Y9OA 3FX4A 1LOSA 2NQLA 5BNKA 1ZSXA 3AJ7A 3WKZA 2PAJA 1K7EA 2TSYA 2VZTA 1HVXA 1MWOA 2BP1A 5FAJA 2D3NA 3UPWA 5IDZA 2PDUA 4HNCA 5E9XA 1GVYA 2QULA 1R6WA 2PURA 5TD4A 4C6EA 3E0IA 3AXHA 2QCEA 1UR3M 4CD8A 4DO5A 3D3AA 1REQB 1W56A 3BG9A 2RDWA 4OBRA 3R43A 4JN8A 4N42A 2VM8A 1CWYA 4CVWA 2INZA 4Q8TA 3PPCA 1UJQA 2G95A 3WJWA 3QYQA 3PUEA 1GNXA 1B0IA 5BRBA 1PVNA 1QO5A 4XVDA 4AD3A 2FFIA 3N1AA 2V30A 4NSBA 5H1WA 4W7WA 1NOWA 1IEXA 5TAOA 3VTRA 4PE8A 2WLYA 3TN6A 4A21A 1E40A 2ZUWA 3GDLA 3DAQA 2Y7EA 1XPGA 3QY8A 3KAOA 2GGEA 1PZ3A 4AB4A 1FWSA 2XGZA 1XLFA 4KWSA 1L6SA 1DIKA 4PTDA 2VZUA 4XZ9A 1ELSA 2BB0A 1BGAA 3UJSA 1XKYA 3SY1A 1EJSC 1BD0A 5C7VA 1A50A 3O1NA 3EPMA 4TR9A 1EGMA 1UWTA 3KBNA 4AD0A 1A5NC 3A5VA 1SPQA 3OW1A 3CMJA 1JUBA 1ENUA 3TN4A 1S5NA 5D2YA 3M0ZA 2OYLA 2ZZ4A 5LIUX 4NX5A 4A8RA 1E0TA 5DT7A 3OQ8A 1JNEA 4BKNA 4MOZA 4LU0A 3UQNA 4M56A 5C9UA 1PEZA 2LLEA 3NZQA 5I7GA 3WFAA 3S6DA 4IQDA 3RM9A 1GPWA 4MNKA 5G1MA 1KBJA 3RGTA 1L0PA 1LCOA 4MFEA 5MF5A 3EWYA 2CBIA 2I1OA 3KBVA 3HPSA 1T8QA 3VD4A 4LALA 1PKYA 2VDIA 1OG0A 1UZ1A 1B1YA 1JCYA 2X1TA 4O1EA 3W82A 3E6EA 1ZQ5A 4INFA 3VINA 1XJBA 4JTDA 4QCFA 4FZIA 1I60A 1CT5A 4CCZA 1RD5A 1QNSA 2BFGA 4KIRA 1S5WA 3S2JA 4UTTA 1E9ZB 4TQTA 3XINA 1U5VA 1MXSA 4FPSA 1PZ0A 3MO7A 5HANA 3BSGA 4YLWA 1E6SM 2A7RA 5GJPA 1JGMA 4CLMA 4JS3A 5T9CE 3O6AA 2Y88A 2PWDA 1A0CA 4GGHA 1IHIA 4IFKB 3I10A 2O4QA 2EPKX 4LVDA 1J0YA 3GE7A 3HQ1A 4UFKA 4PCSA 2BASA 3GVWA 1W32A 2P0OA 3N2MA 1X1NA 2FH8A 3SGGA 3ARSA 4CU7A 1XDJA 3B0XA 4Q8UA 2VT0A 3MI6A 1XIJA 2DUAA 4H2HA 3TJXA 2WJEA 3AHTA 1ITCA 1XLHA 4AHQA 2JKAA 1G4SA 2ZZ5A 2ZC1A 4U3CA 1F3XA 2Y63A 3SCOA 1WQ5A 2WWCA 4GZEA 2YB4A 1S38A 4V1YA 1CGVA 2A3AA 2YDAA 3UVIA 2WNQA 2QKFA 3N6HA 3UF9A 3MZ2A 4QLJA 1NFGA 4EOUA 1TTJA 4DWSC 3N14A 1WBHA 3TSBA 3ZSTA 5DY3A 1IEWA 3A6OA 5JH2A 4AH7A 1GG0A 4LB3A 5K2ZA 2YSWA 1WKEA 4RZ5A 2ZFAA 3NL3A 3W29A 4PL2A 3BG5A 4K7YA 3E38A 4ZQRA 3AS1A 3OEXA 5LYRA 5KINA 4QSHA 4LPCA 1R2RA 4GCAA 1NEYA 3GIPA 4R9OA 4B5SA 5A2BA 1FWJC 2H3BA 2ISWA 3L5LA 4JFTA 1A47A 3VD7A 1B9ZA 3QGVA 4PUJA 3WUFA 3T4WA 4DM1A 2GJXB 2ACRA 3MHFA 5C7HA 3CZ8A 3M0LA 3ARVA 4Y9PA 4O4VA 4DPQA 3PM6A 4JD4A 1W5OA 1NP2A 1EC7A 3EKLA 3P80A 2IQTA 2ZRVA 1M7JA 3WF4A 1RP8A 1WX0A 3DESA 3MHGA 1QI0A 2XU2A 3WLRA 5JXQA 1PX4A 3NPUA 3KX6A 1GYMA 2YGYA 4EAMA 1UIOA 1J01A 4GNVA 4JQ4A 4RE3A 1U33A 3W3OA 1XRVA 4NZCA 3BGJA 4XSMA 1OHLA 5MHBA 2NXGA 3HM7A 3ANVA 4FK9A 1P0KA 2ZX9A 2W9MA 2D1ZA 1BEUA 4O28A 1VEMA 1LZOA 3H2CA 3KRBA 4WDTA 3I6TA 3VX0A 1KTNA 2QHAA 3OVRA 3WELA 4G1KA 2C1HA 1EDQA 3T0AA 1LQAA 3DGBA 3ABZA 3BAIA 1OM0A 2ZZ1A 1TPC1 4XUYA 1GK8A 4PEEA 1Y5XA 2J7DA 4UOJA 2BHUA 2YA0A 1M68A 1HX0A 5D8WA 3KUMA 3UETA 3PWAA 1A49A 2E5DA 1XIFA 3KLKA 3NZPA 2FZBA 1C8YA 1CGTA 3SJ3A 3NO5A 3WD0A 5AHEA 2GDUA 1OSEA 4KQNA 1EX1A 5RUBA 1H3GA 3EDEA 3ZVHA 1XHGA 1OABA 1PE1A 2EG7A 1G9HA 3ZT7A 4LYQA 1V3MA 5C6MA 3CUJA 4PMUA 3HJEA 3PAJA 3PY2A 4PMQA 4EIVA 4B5WA 4OGZA 4DELA 5DRCA 2XIJA 4IOTA 2ZUTA 3WEZA 3TA6A 4C5ZA 2XWDA 2BS9A 2DJXA 4PMDA 3U2EA 1GOWA 5CPSA 1JQVA 3W74A 1JIBA 2B81A 3P8JA 2O56A 5CAKA 3RPTA 3WQCA 3UXLA 4Z2JA 1UBSA 3WNPA 4QM1A 3MMUA 4JIHA 4HZ6A 4M82A 2ZX5A 1HT6A 2ZRUA 1E1CA 5IHSA 3UFYA 2F8QA 1W3KA 1ZJHA 2VC5A 2GJNA 4ZEPA 2BODX 4GY1A 1PZ2A 3AJXA 3XIMA 4JDYA 1XIDA 4ROPA 5HDRA 2HVMA 1KXVA 1QNPA 2G50A 2WAGA 1E72M 2EBNA 1Q6CA 1QW8A 3IIXA 1BG4A 3TMLA 4N02A 2QCHA 1BWLA 3GTXA 5FCZA 1LT8A 4X60A 4UMAA 3N73A 4POCA 3QW3A 1LLZA 4FX8A 5IFPA 4PTMA 2QIIA 3FW6A 4AY7A 1HL2A 1UKQA 2ZRXA 3WMLA 3N17A 1K02A 1TWSA 4Z08A 4BCEA 1AW1A 1JDFA 1OWQA 3AHYA 3S4TA 3UVAA 4E4UA 4TUFA 2DSUA 2YJQA 5A95A 4RX0A 1B30A 3VIFA 3MANA 3IWPA 1IEQA 3W1RA 4RW5A 4G7EA 1UOKA 1SFTA 1EX5A 2CBJA 3CZJA 4FLOA 1JYNA 2EKGA 4K38A 3WQ5A 5CSUA 2C91A 3CYVA 3WBXA 5BRQA 4HSOA 4OQVA 1GEHA 4C91A 1W1TA 1LM1A 1EJUC 4IISA 4DJDC 3LNMA 3N6JA 4WDWA 3B3DA 5F1UA 1VFUA 4NZ1A 3VIMA 1VHCA 3UXIA 1CB7B 4DJDD 1QI5A 2BY3A 1PWLA 1JDCA 4WJ8A 4MMWA 2QYGA 3SEPA 1WKDA 4IICA 4ZGYA 3OGSA 3NTYA 5TNVA 1H5VA 2WKGA 1JRBA 3B05A 1KM1A 4MFDA 2PB1A 2PDHA 4IIHA 4JTSA 4DWDA 3VFLA 3P74A 4GX9A 4EF9A 3EX4A 3CZKA 2PCQA 4GKLA 3GWQA 1QPKA 3EA3A 4GI9A 2PDLA 5D33A 2F61A 3TW7A 3MT1A 1XISA 2GDQA 4GI8A 1S3TC 1F6PA 1B90A 2XN2A 3N6QA 1BSIA 9CGTA 2NW0A 1KFWA 3M1ZA 1MVYA 2C15A 1AMYA 3FYOA 4DY1A 4QSFA 4X2PA 1QW7A 3K8MA 3PZGA 3BW2A 1M7OA 3FSUA 5BOOA 4LUYA 4M6PA 1S5MA 3U5UA 3ZZ1A 3PTQA 4AD2A 3CT2A 1ESWA 2BHZA 1EWDA 4H19A 1SYTA 2EO7A 1N8FA 1HKJA 2Z6IA 3GZAA 1LBFA 3SCUA 4DO7A 3NURA 3LHUA 3MSRA 3UYCA 3C86A 3S8HA 3UWVA 4B3ZA 3QQ0A 4R33A 1GOXA 4NYUA 4AZGA 3TZFA 1VYRA 3OODA 1KV8A 4GISA 3TFCA 4LXFA 2E9MA 1F8MA 1JPKA 1Q63A 1MEWA 3TQVA 3NSMA 5LZLA 4ZB2A 3VKDA 4WSHA 4WY0F 3UWQA 4J3SA 4DJFC 5G2IA 4V33A 3IUHA 4KFNA 2FB3A 4H9VA 4HMEA 3K30A 2BXYA 5AYBA 4QGCA 5AC5A 2NVAA 4JEJA 3APTA 1HN1A 4HNLA 2WBGA 3SQSA 5JMUA 1IZKA 2FZNA 3HF3A 4UR9A 3SM0A 1HL8A 3BC9A 4XO7A 3W27A 1KV5A 3CGTA 4FF7A 4E8GA 1YYAA 4F0HA 1BYCA 4XVEA 3HGSA 4K68A 1W1B1 2CWXA 1MXGA 1HJSA 1Q5MA 1TQXA 5F4SA 3VIGA 1JI2A 1XICA 2ZTJA 2WMGA 1CNVA 4Y90A 1TELA 3SJNA 4JY8A 4W4QA 3B4UA 5L9FA 3TAOA 3IJLA 3AIQA 4XZIA 3Q58A 4H01A 3ZJKA 1B3YA 1ZY9A 5A8NA 4GINA 3GX9A 5C2GA 2CZEA 3SURA 3PAOA 3SN0A 5I02A 5BU9A 1GPFA 3GXTA 2BWGA 2INFA 4C6OA 2WHLA 4Y2WA 5BYWA 1UUQA 2BTMA 2OFJA 4IFRA 1XLGA 3QMRA 3VGHA 3N3TA 4OHQA 4XTDA 3A21A 2VUNA 3GH5A 4QROA 4D9PA 4D71A 4MG4A 4OV4A 4PMXA 2A0NA 3WD4A 4W5ZA 1QFEA 2XIIA 1E9YB 2AOSA 5CZTA 2NT1A 1C91A 4KESA 4DUOA 2OTDA 4KF1A 1Y8BA 3QLDA 2G4FA 4GH3A 1A53A 2CBVA 3VOGA 1JUKA 5LHEA 4J3UA 2XDFA 2NWRA 3TUUA 3GUWA 2FPTA 1R85A 5H8MA 3C0JA 3GG0A 1RLDA 4GH1A 4JIRA 1FOBA 2CZFA 1BXBA 1W9VA 1O94A 3V3WA 5ECVA 1EJWC 1TUFA 3KDOA 1U1UA 3R0UA 3VZYA 1S2VA 1UH2A 1KKOA 1JCMP 2CKRA 1G7UA 3MVTA 3C2EA 3VUSA 2Y89A 2A2IA 2BVYA 4JR5A 1VD6A 2X1RA 3LM3A 2CHOA 4MGGA 1K4HA 1JNDA 5A6AA 1VKFA 1VBRA 2VGIA 3IJQA 2I14A 4H9UA 5DCBA 3GXPA 4OE7A 1B2YA 4NAEA 1V0KA 4M8UA 1XH0A 3B9EA 1MEIA 1UA7A 4KETA 4NQ1A 3WJYA 2D2HA 4BJHA 1VCGA 4FALA 2FLIA 1DXIA 2WSRA 2EJAA 2EPNA 3H24A 1EO5A 3VFCA 2POZA 2WHJA 3VU2A 1XBVA 3GSMA 3BURA 4HNNA 2VELA 3KBSA 3W53A 2ODOA 1BAGA 3DERA 1CB2A 2E4TA 1POJA 1B3ZA 3SCSA 3PZTA 1EH9A 4GUFA 2WJFA 5J04A 3W72A 1A5LC 3L12A 1GJPA 2J7GA 1Z48A 3U2CA 5A6BA 4LCQA 3EX3A 1HP5A 4S3AA 4K3ZA 1ADSA 3S83A 3IJIA 1TPVA 1V6UA 2QCGA 3ABOA 4P7NA 4RV3A 1X6UA 2OODA 4ZQNA 1YRRA 4C90A 1RBAA 4HOXA 4WKFA 5LNRA 1V3IA 3WQ6A 4DJEC 3IGHX 2W63A 2XIQA 1PCKA 4HP5A 1TPB1 3URAA 4US6A 1HIZA 1JZ4A 4E5TA 4HA1A 2FZ9A 5FEZA 4RXGA 3FJLA 1JQXA 1FH9A 6TAAA 3W07A 4TX8A 4AZ6A 4HNOA 4PTNA 2W0UA 3AS0A 1NQKA 4H83A 1NP0A 4A6GA 5HJYA 4AVOA 5D38A 3MWCA 3WDIA 1F6YA 1QATA 1AH0A 2W27A 3IPWA 4LYKA 2ASHA 3KS5A 3J7HA 2PD9A 3G1RA 3TOPA 9RUBA 4F0KA 4TVCA 3N2TA 5T91A 3NEHA 3F5LA 3N4FA 5F2MA 4BF5A 2DSVA 5EY5A 3AISA 1XLLA 3O63A 2JKEA 1R46A 3SW6A 3NGFA 1Q6DA 5FSDC 1QU4A 3B8SA 1XG3A 4Y96A 1T40A 5KZDA 1XUZA 4QDWA 4DYEA 1PYFA 4QIUA 1Q6EA 1HJWA 1FWGC 3TQKA 4U31A 3XISA 1QTWA 2WLZA 3TSMA 5HMDA 3TOYA 4GNJA 1NQ6A 2NVCA 5D37A 2ZUMA 2OSXA 1OGGA 4GUHA 4LYRA 1MQQA 1B9BA 3BSMA 2A3HA 3V16A 4L4LA 5A6SA 4LC8A 1K9FA 3S9YA 4URIA 3LTPA 4PBEA 3V0TA 5IDIA 2ZICA 4AWEA 3URQA 4Q8WA 3ZOAA 4C7FA 3THAA 2QJJA 3U6WA 3ANYA 5ABTA 1T8XA 1V6XA 1UYQA 3H2MA 2CHNA 1VLIA 1OJXA 5A6MA 2ANUA 3UR8A 1XGEA 4KEZA 3L21A 3S2LA 4HA3A 1XQLA 1SZFA 2IS7A 4RDVA 1M01A 3M0KA 3WEMA 2PU1A 1LL6A 5M03A 5FA5A 1W8GA 5EKYA 1DJZA 5LGZA 1TWWA 1W1IE 4LQ1A 4JOMA 1B4KA 3R12A 5CZSA 4AX7A 3HPFA 3TCEA 4BI5A 4HPXA 3PUOA 3R25A 1E1CB 1OF8A 3CV1A 3UZ5A 4JTTA 2BGQA 1E6ZA 5XIAA 3O6CA 3OA5A 5D9OA 4MKSA 2QZRA 4ZB5A 2HTMA 1HGYA 3VABA 3VDHA 2ZBTA 1JGIA 3EWXA 4V1XA 3LRKA 4KMQA 2BHYA 1GQJA 1TPEA 4PODA 1GVIA 3QSRA 1TJ2A 1DV7A 4DWSA 4B5TA 4UB9A 4ORMA 3T6CA 4K1GA 3LLXA 1EC8A 2JF6A 1LRTA 3TNBA 4B15A 3ISIX 1TUXA 4O17A 4W84A 2ISSA 1BRLA 1OX4A 3BCFA 1SO6A 4AC7C 2NV2A 3ITLA 2C6QA 1WDRA 1KGUA 2NUYA 2GQ9A 1MYRA 1U1HA 2V5CA 3HOJA 4ACZA 2JF7A 2DY3A 3TROA 2D2OA 4DQWA 3TC6A 1ME8A 2YFNA 2C14A 2OR2A 1A5KC 1L8NA 1PXGA 2V5JA 1DTUA 1WXZA 4GYPC 4YMZA 2W66A 3G1XA 4EX4A 4Q4SA 3TN3A 1XH1A 3W26A 4G7EB 1U30A 3W1MA 1SVDA 4ZCWA 1BVNP 2TRSA 2ZE0A 4HTBA 3W7IA 1FCUA 4HPJA 1G4EA 1W2VA 4NX0A 5HA7A 1AMKA 4IUOA 1U83A 4KFPA 7XIMA 3TU9A 3EWZA 5DCDA 2R8WA 4EWND 1J10A 1SZGA 4LSBA 3NQ8A 3LPGA 1NOFA 4L61A 4GACA 4XTIA 3GTNA 1EJTC 3AIVA 4GOAA 2VZOA 5A5WA 2E28A 3B40A 3WK0A 1XD0A 3GKFA 4ZO7A 1DJHA 2HS8A 4MDOA 4ZR8A 4EKJA 2GQAA 4K2SA 1NFPA 1TIWA 2R1MA 2VOTA 1HKKA 3K1DA 3SRKA 3VOCA 4MAVA 5J8LA 4WVXA 3G0UA 2E9LA 2O7SA 4UMBA 1EBGA 4TIMA 3M07A 4FMVA 2AKMA 2PWFA 2WSPA 2WVVA 3CJPA 3V7PA 3BMWA 1W54A 4D6GA 5AYXA 2C7FA 3D47A 4IIGA 1PZ1A 2NSXA 4G1NA 1KM4A 4GI4A 4P7OA 4E2BA 3W83A 1EP3A 5A8PA 3TTEA 3GTFA 2PDCA 4NAFA 2HS6A 2QDGA 4E4FA 2YXOA 1H09A 2JGYA 2HJPA 4ERIA 1PWMA 2BY2A 5LNWA 1TWDA 1GCYA 3VDAA 4DYJA 5D8ZA 2PZ0A 1YQ2A 7ENLA 3I4EA 1XYLA 3BLPX 1WDWA 1ZS2A 3SRFA 2P88A 3GQYA 2EPLX 5I79A 4AQLA 1GW1A 4JHZA 1GT8A 3HQOA 2J7BA 2FPYA 2FVLA 3B9OA 4S2CA 4DUVA 4XAZA 4U10A 3LHWA 2XFWA 4QAWA 3T0DA 1GQIA 2X2GA 5EMYA 1MZRA 3G2GA 1YXYA 4WXYA 1E1FA 5I09A 1M65A 2CYGA 3CBWA 3DHFA 3EB4A 3ITYA 2EPOA 3FJ4A 5EFFA 1W6TA 1P5BA 4C6DA 1ISWA 3O2LA 2X0YA 1C90A 4LRSA 4L5ZA 3SQMA 4I7UA 2WBKA 3GXFA 3S6TA 4OBSA 5SWUA 4QE4A 1FKWA 3GKAA 3N29A 1IWBA 4UCGA 4NL1A 3E5BA 1Y7VA 3W87A 2XG9A 3EXRA 4GRSA 4AIBA 3HA1A 4QRNA 2GQ3A 4KEMA 2A7PA 1NFBA 2QAPA 3LU2A 4LNYA 3W00A 4DO6A 2BXZA 2DP3A 3GHSA 2F2HA 3P6LA 1EEPA 3NQCA 1H1YA 1WV2A 4FAMA 1JZ2A 3B9DA 1D3CA 3R11A 1CTNA 4D8LA 4W7UA 3G1YA 3BDKA 3GVQA 4RNJA 1AQFA 3R0KA 3A64A 3VI2A 1ZJBA 4TTGA 1F3TA 3WQGA 3MKCA 1W1A1 1NAL1 3G1HA 4I5UA 4X2RA 5C9WA 2QPSA 3HPZA 5M5DA 2AMGA 1SFJA 3S5YA 2C71A 2QNEA 3FDKA 4LUSA 3EKGA 4JTAA 4JL2A 1JAEA 1V0NA 3ARYA 4BF9A 3IJDA 4GIEA 4LEQA 3M5VA 3F4WA 4QAIA 3W81A 4DM2A 3AU6A 3PWGA 4EXAA 3N13A 3QOKA 2GK1B 2OX4A 1H0GA 4WJXA 2WVUA 2UBPC 4FR1A 1F4HA 2O9PA 4NXSA 1HL9A 3B97A 3UG5A 3HGJA 3WUBA 1NWTA 3N19B 4ZODA 5LNUA 3RRAA 3B0UX 1CLKA 4GXMA 1EYWA 3H2EA 4NAEB 1WCGA 3CWHA 1EXPA 2WZHA 3W23A 2J62A 5HOSA 3U3HA 3HMCA 4Z1AA 4P8VA 2ONEA 2HISA 5HQMA 4N9DA 1YHTA 5DXXA 5AHNA 4AIOA 3IV8A 2Z7GA 1SW7A 3R89A 3GG8A 3P62A 3GFXA 3GVGA 7A3HA 1R3VA 2XM2A 1DHPA 1UR8A 1TZZA 1BKHA 1MRQA 3R8GA 2OMAA 3CIWA 1GVOA 4GJ1A 3SBFA 1XCFA 5IXEA 3WLJA 1US3A 5LIYX 4H6QA 3LDVA 4IP4A 1XPYA 1FWRA 3MBFA 3A4JA 4GJIA 3HQNA 3AMKA 3W75A 3PZIA 1TJRA 2FZDA 1ZLPA 1UZHA 5AY7A 1RAKA 4N4PA 4CU8A 4GUGA 3VD9A 3U0HA 2VP8A 3SCWA 1W3TA 3QTPA 4GE8A 3BGAA 2NLYA 3CT7A 1W9PA 4CNOA 2PC4A 3FA5A 2HMCA 5FL0A 4AD1A 4FNPA 3W7LA 4Q8NA 3ARPA 3V0SA 3WBYA 2NX1A 1SJBA 2QXWA 9XIAA 4WHBA 1KBLA 2VXNA 1V7YA 2YW4A 3JZUA 1GYNA 4KT2A 4XZMX 3ZR6A 4HYWA 4ENLA 2E7FA 4PN2A 2G96A 4JTRA 4N4QA 2CCRA 3T1GA 1EJVC