5CSYA

Disproportionating enzyme 1 from arabidopsis - acarbose soak
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
517
structure length
506
Chain Sequence
SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
total genus 180
structure length 506
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5csyA01
1VAHA 4HPHA 2YL5A 3IJ9A 4MPKA 4DWSD 1KXHA 4Q22A 2VRKA 2VT0A 3VDHA 3KWXA 3T0DA 1FH8A 4ZFMA 1BAGA 2YOCA 4W85A 2HVMA 1V3MA 3NUKA 1OD8A 2UY3A 1R87A 2JIWA 3CZKA 1BPLB 4AYSA 4OOZA 1CXHA 2D20A 3UEQA 1J0ZA 5GNXA 2VNCA 5M3WA 1E72M 1UUQA 1QW9A 3AS1A 4C7GA 2GSJA 1UR4A 3VMPA 1W9PA 1WZKA 3FY1A 1PPIA 1TA3B 4WF7A 4QCFA 1E1EA 2WWDA 2PWFA 2DGAA 2DEPA 4AW7A 1TG7A 1JI1A 1OGGA 3VO0A 4ATWA 1W32A 2QLYA 1TVPA 2DQXA 3F4VA 1KCKA 1GOOA 2X1IA 4HZ7A 2ZX6A 1WPCA 3A6OA 2YJQA 4AWEA 2WBKA 3PZGA 2X2YA 1JYNA 4UNIA 1CDGA 1M01A 4KH2A 1OIMA 2W61A 2QV4A 2WVVA 3VGFA 4RE4A 3RPMA 3ZJKA 4M24A 1D3CA 4V28A 4F9DA 1CXFA 3AMKA 3CIVA 4WSJA 3CBWA 1MFVA 1CWYA 4QFUA 5E9AA 3TTQA 4DM1A 1SR0A 2WLYA 5JBDA 4U3CA 1KBKA 3VIGA 2W66A 2CHOA 1XYZA 2J7BA 1UWRA 1R85A 3T0BA 3OGVA 4CD7A 1B1YA 4OBSA 4H2CA 4XZBA 5CPQA 2XVGA 1KCLA 3L4TA 2GVYA 1BYCA 2J7HA 5E0CA 2D1ZA 2WC3A 5I24A 2W62A 1W2PA 1J0YA 2VZUA 5BXPA 4QCEA 1JYWA 3AHYA 4MNLA 1UWQA 1V3KA 5FKYA 1V6YA 1E6ZA 1DHKA 5HPCA 2B31A 4CCCA 2F2HA 2WMIA 3MKKA 1PIFA 4TX8A 4D71A 5IFPA 3WUGA 3FHQA 3VD4A 3VD3A 5CZKA 5ABFB 2JFEX 1E4IA 2BHZA 3RM4A 3F5LA 4BCEA 4BQ5A 1TMQA 3OZPA 2J7GA 3FNDA 2YDSA 2UY4A 1W9DM 2V3EA 1PX3A 3VDCA 1H11A 1JD7A 5DT7A 1JDDA 3M7SA 4OOUA 4GXPA 1MVYA 2GDUA 2HISA 3AZTA 4PMNA 1R7OA 4GO8A 4HU8A 4PN2A 1W91A 1NOFA 2NSXA 2BY2A 2DSKA 1WAWA 4U33A 3D5HA 5DMYA 2A3BA 1TE1A 1BGAA 4UFKA 3QOMA 5I0DA 4ZE4A 2AOSA 3AYRA 1JXJA 1EQPA 5HPOA 4P7QA 4MJ4A 5CGTA 4GIAA 2F61A 3WDJA 1HF6A 4U2YA 4H04A 1UG6A 2JIEA 3N13A 1V6WA 4D6GA 3CMGA 3CHEA 3CZLA 2C7FA 1ZJAA 1XGZA 1M7XA 1C8XA 3WNOA 2JEQA 3SUTA 1E40A 4GI9A 1RD6A 2FH6A 3ARZA 1OM0A 3UESA 1WDSA 2OYKA 4UZSA 3SUWA 1JYVA 2FDMA 3AIVA 1CYGA 3NYDA 2CEQA 1VB9A 4JFSA 4ZXLA 2WXDM 1CXLA 2WMJA 2YKKA 1JD9A 4J3TA 1B3XA 4MNMA 1VIWA 1QOXA 1E0VA 4AMCA 1WDPA 3T0AA 1TZ7A 3WF2A 5ABGA 1MWOA 4TUFA 3A4XA 1DWFM 1Q6FA 2OYMA 5JIPA 2XG9A 1XH2A 4EAMA 3T2QA 3N15A 1US2A 1B30A 1E73M 2XSBA 5BXSA 5C71A 1WZAA 3ZT6A 3OIHA 1JZ7A 3WQWA 2G3NA 4PMDA 3N04A 1LLOA 3SEPA 3SCSA 5AYIA 3VD5A 1HJVA 1ISVA 4AISA 5A6LA 2PBOA 2GJPA 1OSEA 1MQRA 4ZE5A 1Q6EA 1DWGM 1E5NA 1XHGA 2VO5A 4CD6A 4NSBA 1M03A 2XFYA 2EPMX 3WMBA 4AZCA 1KFWA 1KR0A 2VVSA 2UY5A 2VUYA 1C92A 5A8PA 4L4PA 4MJ2A 2BV9A 1P6WA 1JZ2A 1HJUA 2GJXA 3IAPA 2WSKA 1GONA 1W3JA 4IUGA 5C8BB 2J75A 4GO9A 1MYRA 3PHAA 1NQ6A 4B9ZA 3T2PA 4OJYA 5D9PA 4B9YA 1RP8A 4CN4A 1OGSA 1QI3A 5A69A 2PWEA 4WIWA 3BSGA 3SURA 3VKKA 3W53A 1GVYA 1F4AA 4W5ZA 2BHYA 1DWAM 2GFTA 3VIIA 2XWDA 1WP6A 4J7RA 4UZUA 3PZOA 1JI2A 4AZGA 4PTMA 3TTOA 5I3DA 3WBAA 4UOZA 2OSYA 5GQBA 1HKIA 4XX6A 5A6JA 3CGTA 3B8SA 5CPSA 4J28A 1ZU8A 5A94A 1ODZA 5FIPA 1MW2A 2BXZA 1QHPA 3UR8A 4PMXA 1CECA 4P7NA 1V3IA 3L2MA 2E3ZA 1ISYA 3ARYA 3DYMA 4H8VA 3W81A 1BHGA 2VMFA 2F8QA 3N18A 3RMEA 2D0HA 3SCVA 1AQ0A 1LWHA 2Y24A 1Q4NX 2WZEA 2C8NA 1J0HA 3ARPA 2VZTA 3W24A 2PC8A 1L0PA 3VMOA 1FH7A 1GHSA 2DT2A 1JNEA 1GQJA 3WNNA 5FOOA 2XVLA 4AZIA 1W9XA 3FAWA 5EB8A 1JNDA 3WDHA 4FK9A 1D7FA 2O9PA 3CH9A 3TOPA 5LYRA 3TTSA 1E4LA 2FHBA 3LPPA 3L4YA 7TAAA 4W93A 4CCEA 5LA0A 2JF6A 2QHAA 3AMLA 1WE5A 3WQ5A 1J18A 3VD7A 1GQKA 4Z2KA 2G3IA 4P7RA 3N1AA 3WF1A 1W9UA 3UG5A 4F8XA 3DYOA 3FHAA 4MB4A 1HIZA 3MUIA 2VCAA 2XFRA 1HKKA 4JHZA 1V6UA 3ARWA 4D6CA 1C7SA 4FLQA 1UOKA 3AROA 3CUFA 2Z1SA 2JEPA 5A2CA 1CGVA 3W6LA 3VINA 1BVNP 1CXEA 5A1AA 1KGXA 3GH7A 4B16A 1CTNA 1GVIA 1A3HA 4UFIA 1C8YA 2JF7A 3O9NA 1J10A 3WMCA 3CHFA 4PMZA 3BAKA 3N9KA 2G3MA 3WNMA 1EDTA 3MV11 5D4YA 4NI3A 2WM0A 4UQEA 3MS8A 3ZO9A 1FA2A 2CITA 1WKYA 2YDQA 3U7BA 1CNVA 2J7CA 2D24A 1ZBVA 3BAIA 4UQ9A 1KGUA 5FL0A 1V0MA 3GM8A 2GK1A 1BYAA 5GPRA 1UD5A 5D9MA 1JZ4A 3M07A 1FFQA 4LYPA 3QHMA 3SCTA 3EDDA 4HA1A 3BAJA 1B0IA 3ZMRA 1NWRA 4DM2A 4W7VA 5JBFA 1W3LA 1E1FA 4EK7A 1OCQA 1PX8A 3VX0A 1I1WA 1NWUA 1J01A 4J3UA 2ZXQA 3K8MA 1O6IA 3CZJA 4F66A 1BGGA 1C91A 1HVQA 3WN6A 3VIHA 1NWSA 1EA9C 1N82A 2E8YA 1K6AA 2YDRA 2XWEA 3OGSA 4Y7EA 3UR7A 4DWSA 1XSKA 1QVBA 4CD8A 1GORA 4JFTA 4UQAA 4R27A 5BRPA 2O9OA 3I3DA 4PMRA 2WMGA 4PEEA 1C93A 3K8LA 1EDQA 3U7VA 1U30A 1XYFA 3WH5A 1H0GA 3BH4A 1HVXA 1KQYA 1E3ZA 3FAXA 2XJ7A 4D6JA 3L4UA 1WDQA 1CLXA 3W38A 1C7TA 2DH3A 4NZCA 1UR1A 3IJ7A 1UR2A 1GUVA 1XCXA 1E43A 1EO7A 1V3JA 1VJZA 4AEEA 1QI2A 2PWDA 3KL5A 3ZT7A 1EHAA 3VGGA 3U57A 2O9RA 3WDRA 2TAAA 4Q7NA 4BQ3A 2ZOXA 3GYCA 3GXDA 1NWTA 1BTCA 1UD3A 5A6KA 3RDKA 1W1VA 5A6BA 1EOKA 1AQHA 2CPUA 4U5KA 3G6LA 1VEPA 4C7FA 4IISA 4TVUA 4D72A 3IAQA 1US3A 2VCBA 4CUCA 4A3HA 2V38A 2E9LA 4LYQA 3MMUA 4CGTA 1E70M 4HMCA 3KE0A 3WD0A 1V3HA 5I6SA 3AJ7A 3ZIZA 4GQRA 4WSKA 3AZSA 1LG2A 4CKQA 1BQCA 5DF0A 1QHZA 1Z32X 3OA5A 2BHUA 3AOFA 4X9YA 1HNYA 4ZENA 1JFHA 4UQCA 1H1NA 3ZM8A 2WCSA 1JF6A 5FCZA 4DUXA 3MUY1 1BLIA 1H0IA 2VZVA 3WL1A 2QMKA 2XM1A 1JFXA 1EDGA 1EHNA 2EPKX 2D2OA 1E6RA 2DT1A 2DSVA 1V6XA 3THDA 3UG4A 2IUZA 1MFUA 5BWFA 3WUFA 4W86A 4EKJA 3GNOA 4BZYA 1QPKA 1FP8A 1WB0A 1V3LA 2ZIDA 1W9VA 1TCMA 3PZTA 5DO8A 1MQQA 3AQUA 3WKZA 2MANA 3ARVA 1EIBA 3IK2A 1UWUA 3VM5A 2CBUA 1CGTA 1ZBCA 4MNJA 4M1RA 4NRRA 2WVSA 3QHOA 2ZUSA 3NDYA 1QI4A 1XD1A 1PZ2A 4MTVA 4UFLA 3WH8A 2DSWA 4IM4A 2ZXAA 2VR5A 4BQ2A 4UFHA 4W84A 1V08A 3AXHA 3WQ8A 4DWSC 2E4TA 4PUEA 5HDRA 1GOMA 4GZEA 2J25A 1D2KA 3GDBA 5M03A 4E8CA 1AQMA 1LWJA 1V02A 4MB1A 3RO8A 4U5IA 1B3WA 4OZOA 2QMJA 3BCFA 4M56A 3T08A 2BXYA 2FH8A 3VIOA 4HP5A 2YLAA 3UCQA 1GJWA 1NM9A 1O7AA 4YN5A 1GOWA 4B15A 1UKOA 2VX6A 4Z2HA 1R8LA 2J79A 1UQYA 2CKRA 1NOWA 3AYSA 1EH9A 3A3HA 5HNNA 1GOKA 5CSUA 1B3ZA 2VC9A 3A47A 2V5CA 1GNXA 1WDRA 1FP9A 3VUPA 1EO5A 4PBGA 1VBUA 3SUUA 1HJQA 3CLWA 2OLHA 4ACZB 5BXRA 3DHPA 3GXIA 2QPUA 4QDMA 5DT5A 4H7VA 4AZ7A 1Q6DA 4CU7A 3APGA 5ABHA 3ARXA 1FH9A 1J0JA 3MMWA 2E8ZA 2YL8A 5BXTA 4B3KA 1WZMA 3OLGA 2GDVA 2WZHA 3POCA 1UH3A 3SCPA 1M04A 1UWTA 2RGLA 3NIYA 4GQQA 2EPNA 1G0CA 2VURA 2ZX7A 5IHSA 1LL7A 3JUGA 1BVZA 3SUVA 4N0RA 2WHMA 4Z2LA 2PF0A 3MANA 2CHNA 2W92A 1HP5A 2BY1A 3ZJ6A 2WLZA 3WD2A 2ZICA 1H3GA 1NP0A 2J47A 3VIPA 4E2OA 4HU0A 4DUWA 2XFFA 4S3JA 3VGBA 2PWHA 3WELA 3F5JA 5BROA 3AMDA 4EE9A 2EJ1A 5HBFA 4B3LA 3LPGA 5IXEA 4GINA 2PB1A 4PMOA 2WSPA 4J3SA 1VFOA 4M80A 4M29A 3T2OA 1R7AA 1ITCA 3BGAA 1ESWA 2VL4A 5CSYA 4E8DA 2WK2A 3AIEA 2E40A 5I79A 2J7EA 2ZX8A 1E0WA 3BSHA 4JHOA 4KMQA 4HOWA 1WNOA 2QPSA 4AZ6A 4JFVA 3KZSA 2CBJA 3OLIA 1OBAA 5A8MA 2W5FA 2BY3A 2CETA 3FW6A 1WZLA 1H09A 4WKFA 3KL3A 3BMVA 1HJWA 1CZ1A 2VI0A 1JDCA 2G41A 1B90A 2YIHA 1TFVA 3RM8A 1UKPA 3AMCA 1EQCA 4QLLA 4PMUA 4FMVA 2EEXA 4UCFA 3GBEA 4GKLA 1GCYA 4URIA 1XH1A 2WB5A 1C90A 3W37A 5AY7A 2D22A 2D23A 3WFLA 4D6HA 2NT1A 2BS9A 1UKSA 4KGJA 1IV8A 3GXFA 4CCDA 1W3KA 3ZJ8A 1WCGA 5A6AA 3PZVA 3PZIA 2BFGA 1PZ3A 2ZXBA 3GBDA 4X0NA 2WCGA 1I75A 1QNPA 3VIJA 5I23A 1VENA 2WMHA 4W88A 3BMWA 3CZEA 1E71M 1QBAA 3AISA 4KRUA 4CU8A 5EMYA 2VZSA 2BVDA 4UQBA 3DECA 3AHVA 2Z1KA 2Q8XA 1DWIM 4MAZA 1F4HA 2G8ZA 1ISZA 1XSIA 2AMGA 3EDKA 3TP4A 2XVPA 1PBGA 2X09A 2C0HA 1HKMA 3EMQA 1ZJBA 4XV0A 2VQTA 1HJSA 2QF8A 3WMSA 1E5JA 5CGMA 1J0KA 1HXJA 2CYGA 5D8ZA 5EFFA 1A47A 1UZ1A 4TXEA 1OINA 4MAVA 4Z2GA 3RCNA 3S2CA 2XM2A 4P8WA 2WVTA 3WDQA 2O92A 3HJEA 1HN1A 3W6MA 1UD4A 3WDIA 4BF7A 1OGBA 4M8UA 5TD4A 3RILA 1ZBWA 3GH4A 3WFZA 2EXOA 2CNCA 2VX5A 3K4DA 4NRSA 1KR1A 1B3VA 2DT3A 3L2LA 2D3NA 3B9AA 1HT6A 1JF5A 1LL4A 4PMVA 5FD0A 2DIJA 3WL0A 3O2LA 3AXIA 3VGEA 3WH7A 3LPFA 3VNYA 1JYXA 1M53A 3D3AA 4AD5A 2W67A 1KGWA 7A3HA 1QI0A 5I5RA 1ISWA 1XRVA 3W26A 1PJ9A 4RE3A 3AS3A 3EDFA 3CPUA 1CEOA 3ZQ9A 3PN8A 1H41A 2D3LA 3WIJA 6CGTA 1FHLA 2ZUNA 4HZ8A 1EXPA 3PZNA 2WNWA 2J7DA 4LYRA 3SCOA 1SMDA 2GK1B 4OIFA 3ZSTA 3TTYA 4XZWA 1K9FA 4JAWA 2A3EA 3VGDA 1E15A 4AIEA 4PCSA 3K8KA 3N17A 3LMYA 3WD4A 3WDPP 1EOMA 1GHRA 3E1F1 5E6ZA 2AAAA 3A4AA 3ALGA 4TOQA 3I3EA 4W8BA 2W4XA 4D6IA 1E6SM 1E4MM 4RL3A 1MXGA 3OGRA 2Y2WA 1W2VA 2WW5A 2E0PA 4HOXA 1W1TA 3W28A 3EMZA 1CENA 5GNYA 1V6VA 2XVNA 4JCLA 1UR9A 4P8XA 3AIQA 4AIOA 4YHGA 2ZUWA 3I3BA 3ZR6A 1AMYA 3AHZA 4GPNA 5D9NA 4YPJA 5CLTA 2J77A 2BVTA 2VRJA 2G4FA 4KWUA 1B3YA 2WHKA 4ATLA 5IFTA 4W87A 3AXXA 3VX1A 3EMCA 5AYBA 3S6TA 2J62A 2OSWA 4CN6A 3VNZA 1I1XA 1CGUA 2XPKA 4FLRA 4GI6A 1XV8A 4JL1A 4IPLA 1PEZA 4R5EA 1JG9A 4QLKA 2YL6A 2Y5EA 3WEMA 2Y8VA 3SUSA 6TAAA 2FHCA 2NT0A 1XC6A 3CHDA 1UWIA 3CTTA 2X0HA 1XSJA 1B31A 2PBGA 3TA9A 3HMCA 3NSXA 1VFUA 5JIWA 1IZKA 1W3HA 3AMGA 8A3HA 1UA7A 1RH9A 2ZUVA 3WBEA 1PX4A 3N12A 3WEOA 1J9YA 5FL1A 4MNKA 1L8NA 2GUYA 2VOTA 2V5DA 4UFMA 1GJUA 3BC9A 4AZCB 2WKGA 2A3CA 2XUCA 2VZOA 2J4GA 1OIFA 3WENA 3WQVA 2DH2A 1E9LA 4J3VA 4UOJA 3KL0A 4BA0A 1E56A 3NSNA 4UTFA 2VCCA 2G3JA 1W1YA 5BRQA 2WAGA 3ARUA 2IXUA 1SMAA 5ABFA 4HTYA 3O6AA 1CLVA 4JKLA 1JDAA 3THCA 1ITXA 1KQZA 2CCRA 2O9TA 4LXFA 1GQLA 4PYSA 1XH0A 4MB5A 3EBVA 5EBAA 1DTUA 1UA3A 5KZ6A 2EBNA 1KXTA 4AD3A 1GOQA 1TVNA 1W9BM 4PSPA 1QHOA 3BCDA 3VGHA 1LJYA 2X0YA 4J27A 1JZ6A 1YQ2A 3CUHA 3CO4A 1Q6CA 2WKLA 1QBBA 1X6NA 2WBGA 5A95A 2VJXA 5E09A 1HKJA 1PAMA 1BYBA 1IZJA 2WANA 4L4OA 2WHJA 1MW1A 3CUJA 5CG0A 4XB3A 4AXNA 4ZEPA 2OWWA 3GZAA 3LPOA 4QLJA 3W29A 1HL9A 3L4ZA 1HL8A 1XCWA 4A3YA 4UR9A 2YLLA 4A4AA 3NCOA 4H8HA 1UH2A 4D6FA 1UR8A 4P7LA 3AHXA 3VIMA 2DIEA 1NOUA 5A6BD 4WLCA 1R86A 4AC1X 1LF1A 1FOBA 1V0KA 2J8FA 3SCRA 2YL9A 4LQ1A 4PUDA 4TVDA 3OLDA 4AIUA 4KRTA 4D1JA 1UQZA 1YHTA 3J7HA 4IPNB 3CMJA 4MDPA 5DFAA 4J3XA 4PTVA 5D9OA 1BYDA 4W89A 3ECQA 1TUXA 2DSZA 4F79A 5A2BA 4AD2A 3GNRA 5A6MA 2V3DA 1ISXA 5BCAA 3DC0A 5EFDA 1UD8A 2WCAA 4JFUA 3WNKA 1BFNA 2WWCA 1CXIA 1J0IA 1K9EA 3RM9A 2CKSA 2XHYA 3AIRA 4AZHA 3G6MA 1DWHM 3DHUA 1CPUA 4OBRA 3QGVA 2XIIA 2CESA 2CBVA 3WNPA 4AD1A 1JIBA 1V0LA 1S46A 5KEZA 3CZGA 5LA1A 2WMKA 3HU7A 2UY2A 3BLPX 4DUVA 2WZIA 2Y4SA 4RE2A 2X05A 1Y7VA 3HN3A 5A8NA 2OSXA 3AIBA 1GZJA 3WSUA 2V3FA 1CIUA 1ECEA 1B9ZA 2WMFA 2XSAA 4KGLA 3QR3A 4WK9A 4BQ4A 3M6DA 4M81A 1LG1A 2WPGA 3KEHA 4H41A 1K9TA 1ODUA 4W8AA 4HA4A 3TONA 1KXQA 3MV01 1E0XA 3BAXA 2CXGA 3AZRA 3NJ3A 4CVWA 4Z2JA 4W8LA 5BYWA 3IANA 3GXMA 1H49A 1SYTA 4AD0A 4PRWA 3WD3A 2OWCA 4LPCA 4BS0A 2D0FA 2W91A 1BSIA 3SCWA 2BY0A 3L4XA 1QNRA 3AIUA 2A3AA 1KBBA 3WD1A 2J8GA 4J3WA 4PCTA 1G9HA 1LQ0A 1U2YA 2WC7A 3PZQA 1UH4A 4S3KA 5I2UA 1CXKA 1X1NA 3MMDA 3PTMA 1E6PA 3EDEA 5D8WA 2XIBA 4GZJA 2J7FA 4N42A 3SCUA 3AICA 3B9EA 3SIMA 3VVGA 1X6LA 3ZR5A 1G1YA 5DEZA 1ZS2A 2FGZA 3AS2A 1OT1A 1ZB5A 2WC4A 1LL6A 1JGIA 4H8UA 4P8VA 2WVVB 4GI8A 1J12A 1JXKA 2YA2A 1VFFA 5ABEA 5E0FA 1V03A 4FLOA 4LX4A 3MUAA 1CGYA 2DT0A 1QNSA 1QW8A 2ZUUA 2ZXDA 1Q6GA 1QNOA 1C8QA 1DP0A 5CQ1A 4AD4A 1VBRA 3W4RA 1JAEA 2VTFA 4CN1A 5M5DA 4GZIA 1BG4A 1XD0A 2CBIA 1CGXA 3UERA 4FLSA 5C70A 1V0NA 2XGIA 3VMNA 1GPFA 4AY1A 3AIWA 4CD5A 3L4WA 1UKTA 3VPLA 3VIFA 1JZ5A 1K9DA 5JUVA 1MXDA 3VOCA 4UQDA 2ZWZA 4MDOA 3UG3A 3VIKA 3VDAA 3WH6A 3W82A 1KB3A 2YA0A 1UYQA 5CXPA 1DWJM 2EPLX 3MSGA 3EDJA 4NF7A 1E6NA 3DYPA 4V27A 3L4VA 3QHNA 2BVYA 3UETA 3SCNA 2A3HA 5CJ5A 3ZOAA 4F9JA 2YA1A 4QP0A 1E3XA 3WF4A 1HX0A 2ZE0A 2YBUA 2EPOA 3AS0A 3T09A 1UD2A 4JKMA 5HOSA 3CZ8A 2ZWYA 2RGMA 3ARTA 3BXWA 4OUEA 4TVCA 1JL8A 3BAWA 2IXVA 5A6SA 1EGZA 4Z2IA 5CLWA 5JBEA 4U3AA 2JE8A 3VM7A 2VR4A 5M17A 5AC5A 1FHDA 2BNJA 3MSDA 2Y8KA 2EQDA 2CIPA 2VX4A 4D1IA 1KWKA 4E4PA 1VJSA 3PTKA 3A4WA 4HMEA 4JZ5A 4LGXA 3CHCA 1BF2A 2ZUMA 1VEOA 2WMIB 3QOKA 1B2YA 2OYLA 3PTQA 2GJXB 4JCMA 3FN9A 3RJYA 4K68A 4FF5A 5A8QA 4W7UA 2OWXA 3WQ6A 1SFSA 4PSRA 3NSMA 4QAWA 3RIKA 5E6YA 4JL2A 3MU7A 1MQPA 4HZ6A 1DEDA 1CBGA 3GNPA 2E9MA 3EYPA 1BG9A 5CPTA 3OLEA 3WQ4A 3N11A 4AZBA 1JAKA 2FHFA 5AC4A 1FFRA 1ZBKA 2VQUA 1QI5A 1E6XM 1W1PA 2XGBA 4XUYA 4C7DA 1VFMA 4V2XA 2V3GA 4JKKA 3VU2A 3VDBA 3B9DA 1UWSA 4ACZA 1JZ3A 1MW3A 1VF8A 2J74A 5HXMA 4OKDA 5LA2A 5I77A 5IHRA 2ZX5A 1J11A 3K46A 6A3HA 2CERA 1NARA 3AI0A 3BLKA 2FGLA 1CGWA 4PTXA 3F5KA 1VRXA 3AFBA 5F7UA 3W27A 4P8UA 2UWFA 4CD4A 4HPGA 1E4NA 2DSUA 4UOQA 1ZL1A 4YHEA 1QNQA 2ZUTA 1NH6A 1H4PA 3PZ9A 2XYLA 4AEFA 4ACYA 3WF0A 3VD9A 4WKAA 3MO4A 3WF3A 1H5VA 1VEMA 4ZXOA 1C3FA 3ARQA 1KWGA 1RP9A 4HOZA 2WYSA 3OBAA 1PIGA 3ZT5A 4D6DA 2XVKA 2PI6A 3ARRA 1KXVA 3MUZ1 3WEZA 1G5AA 3OB8A 3SCQA 3WH9A 1TA3A 2ESCA 3WY1A 3PZUA 2WHLA 8CGTA 3II1A 4P7OA 4MB3A 3U5UA 9CGTA 3GTNA 5GNZA 4U2ZA 1UZ4A 4WKHA 1OT2A 2EO7A 3NDZA 1E55A 3RJXA 4PTWA 4TTGA 4TTUA 3WNLA 4TX6A 1NP2A 4CVUA 2NW0A 3BAYA 1HJXA 3W25A 1E6QM 1JZ8A 1U33A 4MADA 2VRQA 3CUIA 4JFWA 5A3HA 4W5UA 2X8RA 4D6EA 4M82A 1UR0A 4PMQA 5E70A 2VVNA 4HA3A 3VILA 4DWSB 2XTKA 5IDIA 1MW0A 2JALA 4AZ5A 2W63A 2D0GA 1OWQA 4CU6A 1AVAA 3M46A 3FXYA 1OD0A 5A2AA 3POHA 4WJXA 3PZMA 2YBTA 3ALFA 1GOIA 1G94A 2VX7A 3OZOA 1H2JA 1G01A 3IJ8A 4ATDA 3U5YA 1V02E 4HMDA 5I78A 4X0VA 3AHTA 3W0KA 4ML4A 2J78A 4JIEA 5A8OA 3K4AA 4EANA 1UHVA 2GJRA 4PMYA 3OG2A 1GQIA 2WVUA 2DDXA 5ECUA 1IT0A 7CGTA 1UKQA 3PBGA 4U31A 1WO2A 1GW1A 1HP4A 3K1DA 1OB0A 3ARSA 2DPEA 2ZX9A 3WUEA 3GH5A 4W7WA 3WUBA 2PWGA 3CUGA 3ZJ7A 1RPKA 4UFJA 2E9BA 3VTRA 1TR1A 3ZSSA 1UD6A
chains in the Genus database with same CATH superfamily
3IJ9A 1XUUA 2Z4GA 4Q22A 1FH8A 4ZFMA 1BAGA 3QYQA 1S5VA 3LY0A 2JIWA 2Q8LA 3CZKA 4CNNA 4KERA 4AYSA 4LVGA 3ITCA 1J0ZA 3G3DA 3O7UA 4UCGA 2OEKA 2GSJA 3E49A 1WZKA 1TA3B 4Q7IA 4WF7A 4DO7A 4LALA 5AZ0A 3W7PA 3GK0A 3WCZA 5M2FX 1SO3A 1TG7A 4GJJA 3W71A 1JI1A 2QLYA 2GOUA 4CEXC 2KX9A 4B5UA 1KCKA 2X1IA 1EWDA 1HKVA 2XIMA 4HJWA 4RXFA 1WPCA 4FXJA 1XG4A 1JYNA 4UNIA 3MKCA 1O12A 3U3HA 2VEIA 1JGMA 1I2QA 2W61A 4L56A 2WVVA 2XIOA 3RPMA 3W70A 5DN1A 1V8EA 2VD8A 3DI1A 3NQ6A 1CWYA 1NAL1 4QFUA 5E9AA 3CL7A 3JVAA 1OK4A 5HQLA 4U3CA 1EJVC 3LS9A 3TEVA 3ENLA 2CHOA 1XIJA 4F2UA 2J7BA 3LCIA 1MEHA 1B1YA 4OBSA 1QXLA 3SN4A 3PUDA 2J9XA 1FWTA 4Q33A 3R8RA 4RDWA 3GW0A 4GKTA 4FI4A 3WFAA 2GVYA 5E0CA 1F6YA 1A5BA 4GYKA 4DPQA 5K2ZA 5BXPA 1EYEA 3ABSA 2PZNA 4DQWA 3N29A 4IMAA 3TYCA 4KKXA 1YLVA 3NO1A 1E9ZB 2F2HA 4C6NA 3NTYA 4AFYA 3PWIA 4D71A 3SI9A 3FHQA 1JULA 4LY4A 4ZQMA 1X7IA 2ANUA 1XYMA 3VD3A 3H2OA 2YCKX 4H01A 4BQ5A 4S3EA 3RNDA 3OZPA 4G1KA 3SIZA 2J7GA 3FNDA 4YYFA 1UIPA 1SQ7A 1WUEA 1QOQA 4M6PA 1YKWA 2NUYA 2PTYA 1OFQA 5LIKX 1JDDA 2X42A 5LXXA 3B8UA 5AYZA 1RQEA 4GO8A 4HU8A 1ME7A 3WJWA 2NSXA 1RPXA 4B3ZA 4U33A 3USZA 4IFKA 3DUGA 4XBSA 5I0DA 4DYJA 2AOSA 3PNZA 1JXJA 2PDBA 4MJ4A 3EWYA 1LRTA 4GIAA 5CGTA 2F61A 5CAKA 2I1OA 4H04A 1UG6A 3DESA 3TYBA 4L7ZA 2XIQA 3CMGA 1FWEC 3N6QA 3PUOA 2Y7GA 1K7EA 1ZJAA 1M7XA 4FSAA 3CT2A 2FH6A 5AYXA 4MWAB 1EC8A 1R46A 3UESA 1WDSA 1JYVA 1JEZA 3EA1A 2FDMA 5FAGA 2O0TA 4GUJA 3MP4A 4JFSA 3KTXA 2DIKA 3OBEA 3LM7A 4BI6A 4MWAC 1B3XA 1VIWA 1TX2A 4AMCA 1X7FA 4FALA 4AVOA 3T0AA 1TZ7A 1GTEA 3WF2A 5ABGA 2Y5JA 3QPZA 4ZQCA 4NXSA 4EAMA 2BXVA 3N15A 1E73M 1GWJA 2PDMA 3OIHA 1JZ7A 1SO6A 1XIIA 3WQWA 4PMDA 4DI8A 2PS2A 3EX6A 4GI4A 4GMEA 3W1UA 2NXGA 3U6WA 1JCTA 5EMUA 1DWGM 1E5NA 1XHGA 4CD6A 4NSBA 2EPMX 3WMBA 2A3LA 1KFWA 2ZC1A 3DN5A 1TTIA 2BV9A 3IAPA 4AF0A 2QQ6A 1GONA 1RA0A 4KWSA 2J75A 3FJLA 3TSMA 3LA4A 4KW2A 3PHAA 1NQ6A 4IIBA 1W5OA 4NXKA 4OJYA 3IPWA 2OLAA 2B7OA 1ICSA 2PWEA 3GC4A 1GVYA 2Q8ZA 1F4AA 3ITOA 4N9EA 1PWLA 3CQKA 3VIIA 4BEUA 1QR7A 1VC4A 1WKDA 4J7RA 4K7VA 5CGQA 4GH3A 3KBMA 3PUGA 2RAGA 4MY8A 1ME8A 3NZPA 1VLIA 3DOPA 3OP2A 4XX6A 3PY2A 3OYXA 5A94A 3WMLA 1AL7A 2UZ9A 1O94A 4P7NA 1N8IA 3QYSA 3ARYA 1K77A 5HMEA 4RV3A 2E1WA 1K70A 1TTQA 1NY1A 4RLIA 4XZNX 4IP5A 1G69A 3N18A 1VYPX 2D0HA 1XBYA 5LGXA 4JTHA 5A6TC 2POZA 3NPUA 2XFWA 3AALA 2WZEA 3OYZA 3MHGA 5FACA 4R85A 3W24A 2A21A 3GDRA 1L0PA 2R1PA 4MVAA 5E1QA 1D7KA 1GHSA 4MHBA 5AHNA 2DT2A 3CUXA 1DOSA 1LDCA 4RZ5A 1W9XA 5EB8A 3WDHA 1D7FA 3TTSA 3W7EA 3D47A 4IHCA 4IMDA 4W93A 2OZ8A 3MWCA 4CCEA 1MDLA 4YWIA 1L2QA 3WQ5A 3VD7A 1GQKA 4Z2KA 5CZSA 1ZP3A 1LBLA 4HTBA 3UG5A 4F8XA 3DYOA 4ZSUA 3ONCA 4NAFB 2V8ZA 4MB4A 1W1A1 1RJRA 3RLHA 3MUIA 5G1TA 4GWEA 3GIQA 4JDYA 2XFRA 3SJ3A 4H2HA 4KCTA 5CAHA 4D6CA 1DJQA 3T42A 2FZ8A 2JEPA 1CGVA 2GVEA 1Z41A 4X2RA 1KGXA 2X41A 4JIRA 1J10A 3WMCA 1F73A 3C8FA 4NIRA 1Z69A 3W86A 3WNMA 1EDTA 4J2MA 3UWQA 1FWFC 3MS8A 1E0TA 1FA2A 1XISA 3QKZA 4EACA 3S0CA 1S5WA 3LTPA 3PBVA 1ZBVA 2QV5A 3N2OA 4NI8A 2J6VA 4MY1A 3BDKA 3BOLA 3GM8A 2GK1A 4XAZA 1MDRA 5GPRA 3NXLA 5D9MA 3W1NA 3C3NA 4JHMA 1AD1A 4LYPA 4PB4A 1M5WA 2HE8A 1EJ7L 2B81A 1JQVA 1B0IA 3ZMRA 3XINA 1E1FA 1I1WA 3NDOA 2ZXQA 3K8MA 5CBJA 3FSUA 4F66A 1BGGA 4XD6A 3C86A 3GXNA 2I9UA 4HGXA 5D37A 3PPGA 3V1PA 3E5PA 1K4HA 1SUXA 2ZTKA 4Y7EA 1XSKA 3GHRA 4R27A 5BRPA 2IQTA 1LBMA 4PEEA 3K8LA 1DJIA 1TREA 1OCJA 4KETA 3WH5A 3BH4A 1UB3A 4LB3A 1I4NA 1B4EA 3RUBL 3GTIA 3ABZA 4D6JA 4J35A 3W38A 4CNOA 4NZCA 2DH3A 4ZTXA 1UR1A 4GJ1A 4N6EA 1RAKA 3SRDA 1E43A 1V3JA 1QI2A 1QW7A 4HHHA 2ISFA 3BW3A 2OKOA 3MTWA 3ZT7A 2FZMA 3BW4A 3WDRA 1FWAC 3IUDA 5CZTA 3NZGA 3LK6A 3NXFA 1GZ1A 3GYCA 4GCXA 1BTCA 5HWJA 3T07A 5A6KA 3UFYA 3FYYA 1T96A 4JXCA 4C7FA 4ZO9A 4ONVA 2JBMA 1E9YB 1GK8A 4O10A 2VCBA 5GJNA 4CUCA 1ZPTA 2WJFA 3MMUA 3INPA 4RKAA 3KE0A 3B9NA 4AH7A 3WD0A 3YPIA 3UXAA 5I6SA 4GABA 4I8DA 3NO3A 1M3UA 1KLZA 1PCKA 2ZA1A 1BQCA 1FCVA 1OEPA 5M1TA 3K1GA 1OC7A 2BHUA 4DELA 4ZENA 2PP3A 4E4FA 1AFSA 5FCZA 2PTWA 3NO5A 3LBCA 3NM3A 2VZVA 4I8YA 5E93A 2C91A 4GUIA 1NIUA 4LAUA 3KLKA 2V67A 2EPKX 1UP3A 3QQ1A 2DT1A 1KNWA 1V6XA 3MJMA 3UG4A 2IUZA 2HJPA 5BWFA 4W86A 2X7WA 2ZRVA 5DCEA 3VKJA 4KQNA 3C4UA 4BZYA 1R6WA 3R89A 1WAUA 3SECA 4O28A 1GVQA 4JTSA 4C6BA 1MQQA 4PE8A 1EJRC 3VZXA 3IK2A 4YTSA 1XLAA 6REQB 2CBUA 1MEIA 2FZBA 1CGTA 2VHLA 4M1RA 3RN6A 3UQNA 1I9CB 1CCWB 1BWKA 4WHBA 3MZ2A 2PZ0A 4MTVA 2DSWA 4IM4A 4QSFA 3R94A 2CZFA 4UFHA 1PZ1A 1V08A 3AXHA 1JCMP 2J25A 4XAGA 3GDBA 5M03A 2OFJA 1AQMA 1LWJA 1V02A 1V5XA 4U5IA 3GY1A 4OZOA 1XLKA 2BDQA 3SDOA 4UTWC 3PANA 2FH8A 3M4HA 3O16A 3A13A 3H7RA 1GJWA 1O7AA 3PAOA 1UKOA 4JICA 2J79A 3AYSA 1SZNA 2ZRYA 4XG1A 4JTQA 4GVIA 3NWRA 5CSUA 2PGRA 3GVGA 2VC9A 5CPMA 2TPSA 2ZA2A 1EL3A 2ZRZA 3F4NA 2C3ZA 1EO5A 4PBGA 4TV5A 3W2NA 3S6OA 4AY7A 2OLHA 3A5FA 2NVCA 4BKNA 1Q6DA 4A3UA 4UTKA 1W5NA 4L80A 5ABHA 1S5MA 1MI3A 3P93A 3GU9A 5BXTA 4B3KA 3DIPA 4IL0A 3SCPA 1M04A 2RGLA 2EPNA 3QZAA 3G1VA 4JIIX 1PKYA 3MANA 1S3TC 4YVVA 1W3NA 4IMCA 1H3GA 2J47A 2XFFA 5D09A 2R1LA 5PTDA 2FJKA 3WELA 4BHYA 3AMDA 5J5RA 3H70A 3R0KA 4B3LA 3LPGA 3MSYA 5IXEA 4O1AA 2CLKA 4M29A 1XLJA 1Z9AA 3K13A 4RE0A 5G4HC 4E8DA 1ZCOA 5I79A 3HPFA 1BXNA 4JHOA 3H22A 1DE6A 2A7NA 1IIHA 4K8HA 4K1GA 3EXTA 1OBAA 2OT1A 2CETA 3DKLA 3FW6A 1RXOB 1WZLA 2QZRA 1Q6OA 4WKFA 3KL3A 1UC4A 4HIBA 5HR7A 4O13A 1CZ1A 3H2FA 4B91A 2G41A 4G7EB 3SW6A 3LM3A 5EMLA 1ZAIA 4LS0A 4REQA 5I09A 3S1UA 4Y9NA 4I7VA 4O52A 3BL3A 3MB9A 3P81A 4LNYA 2ZKMX 3EOUA 3UXDA 3TYDA 1KC7A 3B04A 4ZL1A 3W37A 2D22A 4QBXA 1Q7QA 2NT1A 2BS9A 1VQTA 4KGJA 1IV8A 3ZJ8A 1EXBA 3WQOA 5A6AA 2BFGA 4S2BA 3IVTA 2ZXBA 5DCDA 1VENA 3EXSA 3E96A 2P88A 3CZEA 2CWNA 3AAMA 3GYEA 3R6IA 4DPPA 2ASHA 1BXCA 2MUCA 3CV2A 4K8GA 4LW7A 1Y8BA 5G2IA 1TWWA 2Q8XA 2QJNA 2VEFA 4L4LA 1ISZA 1XSIA 3U2OA 3F2CA 3I6EA 3TN6A 3RU6A 2XVPA 2W9MA 1L8PA 3U2EA 1HKMA 3DFSA 1IR1A 3TMQA 3PJWA 4L6HA 5C2GA 1HJSA 3CQJA 1JCXA 4UNKA 4MJMA 2V68A 4OV9A 1EZWA 2Z1VA 4GUHA 4Z2GA 2XM2A 1LOSA 5FAJA 1HN1A 2FGBA 3H24A 1UD4A 1Q3NA 2NQLA 1EJTC 1RVGA 3WDIA 3W2KA 2E5DA 1OGBA 1QAPA 5TD4A 4Z0SA 2OKTA 2NVDA 3KHDA 3M5YA 1XLCA 2V5JA 3WFZA 1FXQA 2OOGA 4FXFA 2EXOA 5AOUA 4OV4A 2DY3A 3GVWA 4JEJA 4NRSA 3V7PA 6REQA 3VE7A 4J9JA 4KWWA 2OZ0A 3B9AA 3LX9A 1JRCA 4L9YA 3WL0A 5KZMA 4LEQA 4DF0A 4Q4MA 4JEQA 5HA7A 3GR7A 1JYXA 1M53A 4LCRA 7A3HA 1QI0A 3H55A 3W26A 1PKMA 3WQFA 1CEOA 3RXZA 3KW3A 4QM1A 3H12A 4NJHA 1Q63A 6CGTA 1OFOA 1EXPA 1K7FA 3I10A 2VC7A 3V16A 2J7DA 4QJ4B 2GK1B 3TTYA 1K9FA 3ES8A 2A3EA 2PDHA 2BOEX 3LU2A 4PCSA 1XIGA 4YTQA 3ITLA 4M7TA 3IS4A 1LLWA 1JR1A 3G77A 3WD4A 1EOMA 3VCNA 3E1F1 1EPVA 1LM1A 3W7KA 2CC0A 1KFCA 4J1OA 2E67A 4RL3A 1MXGA 1RHCA 1W2VA 3W28A 3E0FA 1A5OC 5GNYA 1H60A 4A05A 3HG4A 3QSTA 4G56A 4JCLA 3AIQA 2BOFX 3EKLA 1KFKA 3ZR6A 2NQJA 5JVLA 1MUCA 3E12A 5D2TA 5D9NA 4YPJA 5CLTA 3C8NA 2VRJA 2G4FA 1DQWA 3FEMA 1FWSA 1XPGA 1B3YA 3UZWA 4W87A 5KTLA 3AXXA 3M0KA 5AYBA 3S6TA 2J62A 2QKFA 3HGRA 2RJHA 4GI6A 1XV8A 4GOAA 3URAA 4QLKA 4NX5A 3L23A 4MOZA 1RSCA 1UWIA 3CTTA 4MFEA 3H2MA 3Q94A 2ZQ0A 4O11A 2PBGA 2IKHA 3GZ3A 1AQFA 3N73A 2PDKA 1ZGDA 3C0SA 5MKGB 2ZUVA 1PX4A 3N12A 3WEOA 3PWAA 3WLHA 3ATYA 4R9OA 1EIXA 4KIRA 4K6AA 1GJUA 3BC9A 4AZCB 2VZOA 1ZTVA 3ANUA 1OIFA 3WQVA 1Q45A 2DH2A 3V5FA 3AC0A 2VDIA 3P8JA 3KL0A 1D8CA 3KVMA 4CCZA 1YDNA 3PJXA 4UTFA 1TRIA 4LEFA 4DXKA 3HTWA 4LRSA 1ZUAX 2F38A 3IACA 4WD0A 2HBVA 1FY6A 4DJDD 3NPVA 2O9TA 3MHFA 1GQLA 3KBJA 3B03A 3T8QA 4A8IA 4MFDA 2NV1A 1XIDA 4HNUA 1OG6A 3EKZA 1KXTA 1NF7A 1W9BM 3SGUA 1WBHA 3NQDA 3VGHA 1LJYA 1ZFJA 4J27A 3W23A 2HZGA 4QNEA 1Q6CA 4WXYA 3COTA 4H00A 4IP4A 1FWGC 2VJXA 3PF3A 1BYBA 4FR1A 1IZJA 2WANA 1KCZA 3W1TA 3GUGA 4ZEPA 5D05A 1K8YA 3OG3A 3VOHA 2HPIA 3NCOA 3SN1A 4A8LA 2XIJA 1NOUA 5HUPA 3P74A 1V0KA 3KS6A 2BSLA 1A5UA 4DHGA 4PUDA 4TVDA 2OVLA 3MT1A 4AIUA 4D1JA 4IPNB 3CMJA 3HV8A 3TN5A 3TJLA 5DFAA 3QJAA 4JTRA 1BYDA 2C16A 4TO8A 4N9BA 4AD2A 3WBXA 3GNRA 3QMRA 4PCNA 2NQZA 2IPFA 1UD8A 2O7QA 1TUFA 3R2GA 4GH1A 3WNKA 1VJIA 5DXYA 2WWCA 1J0IA 3RM9A 1TPEA 1VH7A 5JXQA 1GG1A 3AIRA 3G6MA 3DHUA 3B8TA 1CPUA 4OBRA 2H8XA 1XDMA 1AJZA 4AD1A 3N2CA 5I07A 2E28A 1S46A 1LCOA 1EGMA 3HU7A 3QTGA 2NWRA 4ZB0A 2G5WA 3EWUA 2PDWA 3MVIA 4DUVA 1Y7VA 3TE9A 1PTAA 4I9MA 3JRKA 1GZJA 4Z1BA 1UIOA 4MIMA 5EKYA 1ZJHA 1KFBA 4Y8FA 1CIUA 1OCBA 1FCBA 2XSAA 3MP3A 1ECQA 2VFGA 2VC6A 3BVJA 2EG6A 1K9TA 4IIHA 1PB0A 3T44A 2QUMA 1XLBA 1FRBA 1VCFA 4IJCA 1E0XA 1DJWA 1YE6A 1PV8A 4CVWA 3UJSA 3CPRA 2OT0A 3IRDA 2YDAA 4RXGA 2PTZA 3C2YA 4EPKA 5CPNA 3N34A 3ABOA 3F2DA 1QNRA 3TNBA 5LNRA 1LBFA 4R33A 2A3AA 1PHQA 1KRBC 1I2OA 5LHFA 3IJLA 4GBUA 3STEA 2WC7A 3PZQA 5I2UA 3PTMA 3NVTA 2CHRA 5D8WA 2XIBA 4GYPC 2I17A 3HOJA 2J7FA 1GEHA 3QRHA 4O17A 1U22A 4IH3A 1S2WA 1BXBA 5AVNA 3SIMA 1X6LA 1D8WA 3ZR5A 3EPNA 3MBDA 4MKVA 1OT1A 1ZB5A 1NF0A 2WVVB 4GI8A 1ZLPA 1X38A 1YPFA 3GVRA 3C3UA 1V03A 4FLOA 1QMLA 3MUAA 5I03A 4XSLA 2ZXDA 1C8QA 4OWGA 5CQ1A 2PDFA 3W4RA 1MRAA 2VTFA 1FUYA 4WEVX 1ZENA 3CAQA 1X98A 4MZYA 4ZOAA 3EWXA 3EWZA 5T9BG 4HPJA 2CBIA 5AKQA 2XGIA 1FWBC 3VMNA 1OFBA 1GPFA 2QS8A 2VGBA 3EKGA 4CD5A 1NSJA 1LQAA 3VPLA 2QULA 3VIFA 4MWAA 5JUVA 4CQCA 4IGMA 3EX1A 3UG3A 1GEQA 2JKAA 3HFTA 3VDAA 3WH6A 4IMEA 1X39A 2H6RA 1UASA 1KB3A 3GAKA 4DJED 4U10A 4Y9OA 4YNGA 1UYQA 3EDJA 2NQ9A 1E6NA 3H2EA 4HSOA 2QEZA 3I7QA 3SCNA 3UXKA 2A3HA 1XXXA 4HCLA 4DBSA 4C6DA 2CLFA 2RJGA 1R9ZA 1V79A 3EB2A 2WNQA 2YA1A 4QP0A 3IVSA 1PDZA 3ZYZA 4ERAA 1I8JA 2WJEA 2XGZA 3CZ8A 2ZWYA 2RGMA 1XJBA 3BXWA 3DFQA 4MWAD 3BICA 5A6SA 1PDYA 3MI2A 4Z2IA 3EOSA 5JBEA 1UUOA 4U3AA 4LY8A 5M17A 1FHDA 1U1JA 2GVGA 4H6EA 4B5XA 4D1IA 4L1XA 1KWKA 2IPWA 4ZB5A 4E4PA 4GE8A 1UWAA 1VJSA 2Z2AA 4RJEA 4Z0JA 2V69A 3A4WA 3R79A 1Q4WA 4LVFA 3CQ0A 1XFCA 2ZVRA 1YMYA 3BJTA 1R2SA 1VYRA 2WMIB 3QOKA 1B2YA 4HSHA 3KVKA 5FJTA 3T7VA 1KBLA 3FN9A 3KOWA 5A8QA 4R3UA 3PNUA 4PSRA 4O8AA 2XH7A 3P67A 3V1HA 5AECA 3PWGA 4P61A 2I57A 3GO2A 1CBGA 3OLEA 3QW4B 1JAKA 1H7RA 4KEMA 2H90A 1FFRA 4FX6M 3R10A 1ME9A 1QI5A 3BLLA 1GKPA 3UF9A 4XUYA 4C7DA 3SY8A 1OABA 1VGAA 4V2XA 2FB3A 1F7BA 1SJCA 3WJZA 1UWSA 4ACZA 1JZ3A 5DY3A 5HXMA 5IHRA 2VKZG 1FDYA 2CERA 3K30A 1NARA 3VNLA 1A3WA 4R34A 1TMHA 1XLGA 1EP3A 4LUSB 3REQA 3IARA 1VRXA 3AFBA 2J27A 2GUUA 3S2JA 2UWFA 4MPQA 4HPGA 4EXAA 4B90A 3CEUA 4TMCA 4YHEA 5C54A 1J6OA 4C6QA 1NH6A 3GDKA 2X30A 4AEFA 1M7PA 3GTXA 3PK7A 2NX3A 3V3WA 3WF3A 1RJQA 4JBRA 5D30A 1KWGA 2WYSA 1PIGA 1UP0A 4D6DA 2XVKA 3W2MA 3I6RA 5FSDC 3MUZ1 1G5AA 3W7IA 3SCQA 3WH9A 2ESCA 1Z48A 5C9RA 3RGTA 1MRQA 3U5UA 5FF2A 9CGTA 4WKHA 1P0KA 3O63A 3HGOA 3UYIA 3W7GA 2EO7A 1KW1A 1OX5A 3NDZA 4LFYA 4TTUA 4TX6A 4CVUA 1RR2A 4DJEC 1NVMA 1U33A 4MADA 5A3HA 2QJHA 3CNYA 1XYCA 1DIKA 3R1ZA 1UR0A 3UGVA 4G7EA 1MW0A 2GVJA 3UJRA 1P1MA 4AZ5A 3ITXA 1T8QA 2D0GA 2PRMA 1A53A 1AVAA 3M46A 3FXYA 3GLCA 4B5WA 5HMFA 3GHSA 2OQLA 2YBTA 2Q02A 4DBEA 2G37A 1GOIA 3FJ4A 1H2JA 4PRTA 4LUJA 5G4WA 3LZ3A 3N2MA 2P8CA 4LH8A 4ML4A 3UZ5A 1R3YA 4ZB2A 2J78A 5KINA 2J88A 4PEKA 4UTMA 4FZIA 5AFDA 2DDXA 1YNPA 3PBGA 1OB0A 4N02A 4GVHA 2WM1A 2WZTA 3W7CA 3WUEA 3FKRA 4I6VA 1J6PA 1M41A 2E9BA 2YZ5A 4GJIA 4XO7A 3OQ8A 3ZSSA 3KOFA 4HPHA 2YL5A 4MPKA 2KAUC 3U4AA 1FWRA 3NZRA 1LORA 4EXBA 3KWXA 3T0DA 4Q7BA 4W85A 1AL8A 3WQGA 4O0ZA 3T55A 1YE4A 3NUKA 5B7YA 2UY3A 2JK2A 3S9YA 4HNLA 1BPLB 1DJGA 4PB3A 2E6DA 2DZPA 3URQA 1UUQA 4JTAA 3FS2A 1QW9A 2WSRA 3AS1A 2YSWA 1PE1A 4C7GA 2RDXA 4WJ8A 2RHGA 4CQBA 4HMNA 1MZRA 3VMPA 1D9EA 2QUUA 2Y5SA 4XWUA 4QCFA 2VR2A 3N14A 1E1EA 2E5BA 2WWDA 5ENLA 2DGAA 5JQ9A 1DIEA 2DEPA 1VCVA 2VDGA 2DU2A 3THUA 5D03A 1UMLA 1TVPA 3LHTA 4FR6A 3MC5A 2VDHA 5HWMA 3F4VA 1IXPA 3T8LA 3QPYA 2ZX6A 3PSVA 2YJQA 3GKFA 1K8ZA 2WBKA 1K4GA 2RFGA 1M01A 5F1UA 3W7NA 4KH2A 1OIMA 1G4EA 1XQLA 3BGJA 5AB3A 1BSLA 2QDGA 4F9DA 2PU0A 3R7MA 3EWCA 4OUIA 1RCOB 4DJEA 4DM1A 3WO8A 2G50A 1O1ZA 1KBKA 2Y7EA 3VIGA 1XYZA 3T0BA 3OGVA 1ICQA 1J8VA 2PP0A 4XZBA 1HW6A 1XBVA 3EWDA 3M7WA 1P0DA 2J7HA 2D1ZA 2WC3A 4YYCA 5LHEA 2W62A 3WLLA 3T05A 1JYWA 4GCAA 2GGGA 2NWSA 4GC4A 5D2YA 1V3KA 2HXUA 5FKYA 3C2RA 1V6YA 2OLSA 4GD0A 1E6ZA 1G6CA 3KM8A 4QJ5B 4I9AA 2B31A 3ABQA 2BP1A 1EBHA 5IRPA 1YX1A 3M0ZA 1PIFA 3VD4A 1VFSA 2HQAA 2A5HA 1CLKA 1OYBA 3A22A 5FJPA 4Z1YA 2JFEX 3RM4A 1KFLA 3TQKA 3PPFA 1UW9A 3KOYA 3SRHA 1TMQA 3R8HA 1QO2A 4UTWA 5T26A 4IFKB 1VD6A 3UG8A 2GQAA 1QJWA 4QXIA 1W9DM 2H3DA 1TWDA 4DIAA 1PX3A 5HK4A 1P48A 1F3WA 1ENUA 2AL2A 3M7SA 4GXPA 1MVYA 2OGYA 3BOFA 2A1YA 1P6CA 3HPAA 3DBNA 3TWAA 1GQNA 3W1XA 4O0QA 5MF5A 2A3BA 1SR9A 1TE1A 3JS3A 4UFKA 3RLGA 3QOMA 4XIMA 1JQXA 1EQPA 4NZ3A 5HPOA 1HF6A 2AKZA 2JIEA 1DHPA 4D6GA 1PKLA 3DFNA 4IWWA 5C6MA 4HBKA 3CZLA 4LNCA 2Z6JA 3CIXA 1POKA 3SUTA 2NZLA 2GGJA 2W27A 1RD6A 5HJLA 2D2GA 3CXOA 2CEQA 4LV9A 3IJIA 2WMJA 4GHRA 2YKKA 1JD9A 5FJOA 4EOUA 4HHPA 1TPFA 4DI9A 2PGFA 1WDPA 3AU6A 1SZEA 4TR9A 1WYIA 1Q6FA 3ANYA 4IF2A 1XH2A 2XSBA 1SJBA 3NQ2A 2Y70A 4GFSA 2G3NA 3N04A 1XBZA 4EWND 4E6MA 3VD5A 5AYIA 1HJVA 1ISVA 4D2JA 5A6LA 1SZRA 4DB7A 1MQRA 4AXKA 4D8AA 1M03A 4AZCA 4LVAA 5DANA 1KR0A 2UY5A 2VUYA 1YXCA 5A5WA 1AW2A 1DV7A 3S5YA 1P6WA 4O19A 5REQA 1JZ2A 1HJUA 3W1MA 5MKGA 2VP8A 5C8BB 4GO9A 4DJFC 4B9ZA 4B9YA 1OGSA 2PRLA 5BU6A 1QI3A 4YS1A 5A69A 3UWVA 2FYMA 1DPMA 3HGJA 3SURA 3VKKA 5FJRA 3GG8A 2REQA 2DVTA 3R43A 3MZNA 4W5ZA 2BHYA 1DWAM 4Q4SA 2GFTA 3A5VA 4GIEA 3TCEA 1EJXC 4L5ZA 1JI2A 1YPXA 4QSHA 2QR6A 3HURA 2PDLA 4LUTB 2R91A 4UOZA 2OSYA 1RK6A 1HKIA 4BFAA 5A6JA 3CGTA 5CPSA 4EAYA 1DIDA 3IIPA 1ODZA 3EWWA 2CZVA 5KSWA 1MW2A 2BXZA 1QHPA 1CT5A 4PMXA 5TAOA 1ISYA 2AQOA 3DYMA 2IQDA 1REQB 2WO5A 1BHGA 3BLDA 4DAFA 5CEWA 1R3SA 1TV2A 3BLEA 1TPC1 3VOFA 1Q4NX 1AW1A 4JIQA 3U2ZA 2EPHA 1J0HA 2PC8A 3HPSA 1Z3NA 6TIMA 1KFEA 1GQJA 4PC8A 4AZIA 3E5BA 3BG5A 1JNDA 2C1IA 2O9PA 5LYRA 4AQLA 1WV2A 1E4LA 1FWNA 3L4YA 3S2MA 4FNQA 2QHAA 4NKCA 4TMBA 1GOXA 3H53A 3A12A 3WF1A 4O4VA 4FP1A 5U4NA 5AC6A 5LNWA 3AUOA 1VIZA 2VCAA 1HKKA 5GJMA 2X1UA 5I3GA 3MBFA 1V6UA 1C7SA 1OFAA 4FLQA 3KTSA 4N4PA 2CLHA 1W5QA 4NNAA 5CBBA 1BVNP 1HO4A 4B16A 1CTNA 1UUMA 1GVIA 4H9UA 1A3HA 2JF7A 1VRDA 2DZXA 3CHFA 3BAKA 3LMZA 1WUFA 2BG5A 2WM0A 4UQEA 4QIUA 2FPTA 2YDQA 1CNVA 2D24A 3BAIA 4S3CA 4H19A 2PODA 2V9DA 5FL0A 1R9YA 1YADA 1XIHA 3TN3A 1BYAA 1FHVA 2Q6ZA 1KBIA 4HKPA 1OF8A 3FJ6A 3AWNA 3SCTA 1ADSA 3QC0A 4HA1A 4DM2A 4W7VA 1XG3A 1W3LA 4EK7A 2F6XA 1J01A 4LAKA 4ZO6A 1KM4A 3ITYA 3TZFA 6XIMA 4IPJA 3G1DA 2DZUA 3SQSA 4PMJA 4UC5A 2YXOA 3VIHA 1ZHAA 4O16A 4GNVA 3MCOA 2YDRA 2XWEA 3UR7A 4ADTA 4E0CA 1GORA 4JFTA 2INZA 5L6UA 5BMWA 2V5KA 4DNHA 2O9OA 4RDZA 1Q7ZA 2WMGA 4NJGA 2IPGA 3H8AA 1U30A 3TROA 4G1NA 1HVXA 3G1XA 2QCCA 1RV8A 1OC6A 1WDQA 3G0XA 3W2LA 3SSJA 1RD5A 3IJ7A 1GUVA 4AEEA 1EO7A 1VJZA 7ODCA 3PBUA 2D69A 1TRDA 4LB4A 3B0PA 3H2CA 3SRFA 4UTHA 4Q7NA 3BG9A 1NJJA 2ZOXA 3CWOX 1UD3A 3PP7A 4KIEA 3MCNA 3DFOA 1EOKA 1A0DA 1AQHA 2CPUA 1TV3A 2Z1BA 1DQXA 3LXBA 4A3HA 4Q8OA 2V38A 2E9LA 2VFFA 1P0NA 4HMCA 3SN0A 2YGYA 2A6LA 2P5NA 4NQ1A 3AJ7A 3IJQA 1I0BA 2VC5A 4GQRA 2O56A 1LG2A 3PC0A 4CKQA 3M0MA 4AF0B 1AD4A 3WLPA 1Z32X 3N25A 3OA5A 3AOFA 3OVRA 1QO5A 4Q8VA 1HNYA 1JFHA 4UQCA 3UZYA 2WCSA 1OC5A 4UXDA 4DUXA 3A9BA 1H0IA 2TSYA 1DJNA 3TA6A 5H8MA 4QG8A 1EDGA 4KBXA 1XRFA 1UR3M 4NZJA 3SM0A 5G5IA 2D2OA 1E6RA 1DJXA 4O8RA 1MFUA 4ZMGA 3M64A 4FIRA 2QNEA 5F2GA 3WUFA 1LYXA 2FMNA 3KLLA 1R2RA 4J2PA 1M6JA 1S1PA 3GNDA 5HQMA 4LUIA 1H7PA 3LNPA 1TCMA 5DMNA 3PZTA 4FS9A 4W4QA 5DO8A 3WKZA 3W88A 3QY8A 3DXIA 1HG3A 4JQ4A 1EIBA 4JYFA 1UWUA 3R12A 4EPEC 3GC2A 1EEXA 4XZ9A 2WVSA 4ENLA 4NHVA 3C0LA 3QHOA 1QI4A 3LHYA 1BQGA 1PZ2A 4UFLA 1V93A 3E0WA 3WH8A 2VR5A 4BQ2A 1WA3A 1TELA 5C2CA 2E4TA 5HDRA 1AJ0A 3W1QA 3PB0A 1VPQA 4YCOA 4E8CA 3HA1A 3RO8A 3D0CA 4IMGA 2O55A 2VWSA 4K3ZA 2PTDA 3PBYA 3M41A 4M56A 3VKDA 3WLIA 1YDVA 2YPIA 4JOMA 1N8FA 1NM9A 1CB7B 3NQMA 4CNUA 4Z2HA 3E2SA 2CKRA 5LKYA 1S5TA 4RNJA 4H9VA 4FB7A 5HNNA 1B3ZA 4JNMA 1GNXA 4RV8A 1FP9A 3SJNA 3VI2A 1VBUA 1LRQA 2VEKA 2C13A 4ACZB 5BXRA 3GXIA 3GG1A 4QDMA 3L65A 3AO0A 5HUOA 4CU7A 5G4EA 4JX6A 5HINA 3THAA 3MMWA 2E8ZA 1Q8AA 2YW3A 1W6TA 2GDVA 2QYGA 4JPGA 1UZHA 5JH2A 2ISVA 1P0EA 2VURA 1JCNA 5IHSA 1LL7A 3JUGA 1BVZA 4HHLA 3SUVA 3KTCA 4Z2LA 1VP5A 2PF0A 3F1QA 3ZJ6A 2WLZA 2ZICA 1S39A 2Q3OA 4HU0A 4DUWA 3H7VA 3PAJA 3CK5A 4A8NA 3O6CA 3S8HA 1L6WA 2EJ1A 1X8CA 3W1RA 3UU0A 3NQ7A 1VBJA 5D38A 2PB1A 1R3TA 2NXIA 4PMOA 4J3SA 3T2OA 4QRNA 2O4QA 2CZEA 3BGAA 5CSYA 1K8CA 3SY1A 2NV2A 4X2PA 3DHDA 3AIEA 1E0WA 4KMQA 5T8GA 5KETA 1WNOA 1VR6A 3KVJA 3KZSA 4H9ZA 2OEJA 4JIPA 8XIMA 5E5CA 2BY3A 3L5MA 4EXQA 3QBUA 3G8RA 1RVKA 2BASA 3RO6A 1JDCA 1EX1A 5D2XA 2YIHA 4ZO7A 1WOBA 3PSWA 1VHNA 4E3TA 5A8GA 3LCLA 1JPHA 1TO3A 1J2BA 2VOMA 4NJIA 4PMUA 4FMVA 3UWYA 4LC8A 1CW2A 2EEXA 4UCFA 1GCYA 4URIA 2DZVA 3WX7A 3IGUA 2WB5A 4ALDA 5AY7A 3M47A 2D23A 4QEEA 5BOEA 4Q4RA 3OW1A 3G22A 5EPDA 2GGIA 3GXFA 4JY8A 4C6CA 1IF2A 3PZVA 1R9XA 5C9ZA 4IFOA 1PZ3A 3WLQA 4JTDA 4ADUA 1I75A 1QNPA 3BZGA 2R1MA 2OCZA 3N9RA 1E71M 2QUTA 1QBAA 3LRKA 4KRUA 2RH9A 3P5ZA 1FHUA 4CU8A 3QMSA 1QK0A 2QDEA 3AHVA 2Z1KA 3VKAA 4DEFA 1KO0A 1LT8A 3NFUA 4MAZA 1F4HA 1GT8A 2C1HA 3CC1A 4GVGA 5FJIA 1DQUA 3TV8A 3JR2A 2C0HA 2GGHA 3NNTA 5DCBA 2C19A 4JDBA 5BW6A 1H61A 5HULA 2QF8A 3WMSA 3TAOA 4B5NA 4WQ6A 1HXJA 1UJQA 2CYGA 3W87A 1A47A 3KHJA 4P8WA 2WVTA 5E0KA 3WDQA 2O92A 3HJEA 2E1DA 4NZ5A 4BF7A 4M8UA 2Y7FA 2PFHA 4RW5A 3R0UA 4NX0A 3LLDA 3RILA 2Z2BA 3GH4A 2R1NA 1Q2SA 3DX5A 3TFXA 3ZLGA 4HQVA 2DT3A 1EGVA 2QVNA 3TXVA 1JF5A 1LL4A 4PMVA 5FD0A 3WLJA 2DIJA 1S2AA 3AXIA 5AVHA 3WH7A 3VNYA 3D3AA 2W67A 2ZZ5A 3RCMA 3S9IA 1PJ9A 1H5YA 1B4KA 4RE3A 1W17A 1BWLA 3SADA 1Y5XA 3PN8A 2PDIA 1H41A 1ZP4A 1Z8AA 2GVLA 4N9DA 3WIJA 4HZ8A 3LI0A 3UVIA 2PLCA 3PZNA 2HMCA 4LYRA 3IRSA 4QX4A 4JAWA 3F4DA 3E0IA 1Z89A 3QGKC 1IR2A 5F2LA 3P7YA 3GFXA 3DENA 3A4AA 1VFHA 3I3EA 4L4MA 4W8BA 2W4XA 2ZZ6A 3T81A 3ZR4A 1E4MM 3OGRA 4XAYA 4I7WA 3CH0A 2E0PA 1RBLA 4NZ4A 3QV6A 1UR9A 3NURA 4P8XA 4AIOA 4E8GA 4PCFA 4IGSA 3EPMA 1IIGA 2QCLA 1AMYA 3AHZA 4GPNA 4C6EA 1ZAJA 1N55A 2BVTA 4H9TA 4L64A 4CNTA 1XIBA 4PB5A 1FCUA 1XINA 1GPWA 2WHKA 3OHIA 5IFTA 4C6OA 5I3HA 1H1ZA 3DGRA 5CZJA 4J5NA 4DUOA 1I1XA 1W3TA 2X1TA 1F6KA 2TRSA 3VNKA 2YL6A 3Q45A 3WEMA 1IYXA 3IV8A 3CHDA 4KCVA 5H91A 2J66A 5CJNA 2TODA 2X0HA 1ALDA 1B31A 3HMCA 3O3RA 3LN3A 3NSXA 5JIWA 1EEPA 3QH2A 3AMGA 8A3HA 3G24A 4TV6A 1SZFA 5DELA 3RHGA 4MNKA 3DERA 4ZZ9A 1F2JA 4GIYA 4WUIA 1T0OA 3GHUA 4JYDA 3OQEA 3QXBA 3UA3A 2J4GA 3QZ6A 1E9LA 3AYTA 4UOJA 5KITA 4BA0A 1E56A 2G3JA 3WJYA 1W1YA 1RALA 2IXUA 1XFBA 1AJ2A 5F4SA 4AHQA 3V5OA 4HTYA 3LRLA 3MP5A 4S23A 2CLEA 5T9CE 3ID7A 3O6AA 4JKLA 1XLLA 3THCA 3K4WA 3KRUA 4JN6A 1XR2A 1TZZA 3UY7A 2GL5A 1MEWA 2AQVA 2F7FA 5EBAA 1IXOA 3ZZ1A 2JKPA 4S3AA 2EBNA 3WBWA 4WDUA 4LTSA 4PSPA 1LQ2A 3BCDA 2A7RA 3IVUA 1JZ6A 4M6QA 1YQ2A 3DU0A 1KM5A 2VGGA 4UBPC 3S9ZA 5A95A 5BOOA 1HKJA 3SZ8A 2VFHA 4ZQRA 4HSNA 2WHJA 4HJFA 1F07A 5CG0A 1E1CA 4AXNA 3GZAA 3LPOA 4UTTA 1XW8A 4QLJA 3WZ0E 1HL9A 3L4ZA 1XCWA 1RJPA 2DZAA 1GGOA 3BUVA 2UBPC 4H8HA 4UB9A 1UR8A 3AHXA 3MHUA 2DIEA 1TPVA 4WLCA 4AC1X 3MO7A 3V4BA 3SCRA 5I3KA 2JGYA 3W7RA 3OLDA 4XZHA 2POTA 3J7HA 1JCYA 1XF0A 4MDPA 4LU0A 3MI3A 4PTVA 5D9OA 4W89A 3ECQA 2DSZA 5BU9A 4H6KA 4N4QA 4F3HA 5A2BA 5A6MA 5AN7A 2V3DA 4DVOA 3L0GA 4UMAA 4PULA 1S1RA 2WCAA 1XX1A 4LF1A 4MUZA 1FWDC 4LCQA 4LAMA 2HDJA 1CXIA 2WKJA 1K9EA 1SW7A 5LZLA 1RQHA 2XHYA 4WDWA 1O68A 4HCDA 3WQDA 2CESA 1UBSA 3TKFA 2YCJA 4U28A 3OZYA 2WZIA 2Y4SA 3ANVA 3AIBA 3F7JA 4BWLC 3QGAC 4I7UA 2IMRA 1ECEA 1ZJIA 3MMTA 4LS1A 3S83A 4F0HA 1J79A 2WMFA 3DDMA 5XIMA 3N2TA 4DZIA 1H51A 3S1GA 3VOGA 4M81A 1LG1A 1TWSA 2WPGA 3KEHA 1ODUA 1PYFA 4PTNA 3TONA 1KXQA 1YTDA 3BAXA 3UD6A 3AZRA 3NJ3A 1K3UA 4Z2JA 4JTKA 1XIFA 3EEZA 3IANA 4GVFA 1SYTA 2X1SA 4AD0A 2Z26A 4PRWA 3WK1A 3WD3A 2ZA3A 4O1EA 4JNYA 4FIQA 4YTRA 3NL6A 3N2BA 1GYMA 2BB0A 4LPCA 1ZNNA 5EA9A 4BS0A 2W91A 1GVSA 2BY0A 1GKRA 3AIUA 5LGZA 4NILA 4J3WA 4H8NA 1LQ0A 3AXKA 4EPDC 1UH4A 4V15A 3FJNA 3MWAA 3EDEA 2V0TA 3WYZA 3O07A 4AWTA 1F8IA 1TIWA 3CMFA 2B7QA 4N42A 4TU1A 3H7UA 3KS5A 4J4KA 4QQUA 3B9EA 4WY0B 3VVGA 4MZ8A 1N2VA 5ABTA 2EJAA 1RZMA 5D33A 1ZS2A 2FGZA 3AS2A 2GDQA 3OTRA 4I5XA 4P8VA 1T8XA 3I65A 5K3VA 1JXKA 3CTLA 1VFFA 4IIFA 4FNSA 3M5VA 2E6YA 5ABEA 4F2BA 4UR8A 4A3QA 1CGYA 2DT0A 1QNSA 4AG0A 3LQLA 4XIAA 4A22A 4AD4A 2EGZA 1VBRA 4IMFA 5C2XA 3LNMA 2DVXA 4H7CA 2C18A 3VC5A 1DIOA 5HANA 2HWGA 4IL2A 3UZXA 3UERA 2PD9A 3TYAA 5C70A 2NX1A 1RY8A 3IIOA 2V63A 3S3GA 3GG0A 4XBKA 4AY1A 1BRLB 3AIWA 3VFLA 1MXDA 4GK8A 4UQDA 3OIXA 3TC3A 3W82A 2YB1A 2DP3A 1ZAHA 5CXPA 3NPWA 4NF7A 4K39A 3DYPA 4GRSA 2ZZ2A 3UETA 2ONEA 4CLMA 3RF9A 5CJ5A 1GVFA 2QCGA 2Y6ZA 3CWNA 4S38A 4E2VA 3ZOAA 4ZSTA 1IXQA 4F9JA 1E3XA 1QPQA 1HX0A 2XISA 4HVXA 4R7WA 1SSDA 2ZE0A 2YBUA 4LANA 1UD2A 3I4EA 5BWAA 2REQB 3GIYA 3RRXA 4OHQA 3SSZA 4O12A 1JL8A 1IHIA 2IXVA 3CB8A 3O06A 1A80A 4RZ6A 4QE4A 3QN3A 1W1B1 1DE5A 3VNJA 2BNJA 1TYGA 2EQDA 4LOCA 2INEA 2CIPA 2QGYA 1WKFA 2VX4A 3GTFA 3NPXA 1YXYA 3V0SA 3E3HA 3C2VA 3PTKA 2Z7KA 1GVRA 3UWEA 4ZQPA 2ZUMA 3KUMA 1TQJA 2HS6A 4U4MA 4JY9A 4Z17A 5D2VA 4M0XA 2HS8A 1PTDA 4Y9AA 3ABXA 4W7UA 1SFSA 3NSMA 4PUJA 2C6QA 2Q09A 3EAUA 5IM51 4ZOBA 3GNPA 2E9MA 2CLLA 3N11A 1EBGA 2FHFA 2JQXA 1CI1A 2Y1HA 5AC4A 1EJSC 1EJUC 3A21A 2XGBA 1K02A 1VFMA 2V3GA 4JKKA 3VU2A 1B3OA 3CUZA 3CL8A 3B9DA 3Q67A 4PBFA 5I77A 3ERPA 2VYOA 2G97A 3TJ4A 1LOQA 2X2GA 1QRQA 4HN4A 2DW7A 3AI0A 4US5A 4JD4A 4FNUA 4PTXA 1DXEA 3UJ2A 5LNUA 5F7UA 1XLHA 3W27A 4I5UA 4P8UA 3TNOA 3BMXA 3H2NA 4B2DD 1VPXA 2ZBTA 4G5DA 4N6FA 3HV9A 4GISA 1SW3A 5LXEA 4QQ3A 3LLXA 1O5QA 1T99A 1WXYA 3C0JA 3LHZA 1H4PA 3HB9A 4JR5A 4JYEA 1L6SA 2XYLA 4ACYA 3WF0A 1Y65A 4MM1A 1VEMA 3ARQA 4HOZA 4JTIA 2PI6A 3ARRA 1KXVA 2GZXA 3WEZA 4AUBA 4H6QA 3WY1A 3PZUA 8CGTA 4DXVA 4K36A 1XICA 4MB3A 2IPJA 4JX4A 2F84A 2FIQA 3GXPA 4ICCX 2VXNA 1LWIA 2DUZA 3W25A 4Y90A 2VRQA 1QUMA 1KM1A 4FOJA 4M82A 1LUCB 3UW6A 4HA3A 1XDLA 4DWSB 5EGRA 3UXIA 2ZZ3A 4OU1A 2W63A 3GQYA 1ZSXA 4BI7A 2Y62A 2Z00A 4IQLA 4HHMA 5CH9A 5IBXA 3POHA 3T0TA 2NLIA 4F48A 3ALFA 5HAOA 2HE5A 1G01A 3GS6A 5F1VA 1V02E 3CV1A 2QVHA 4DZ5A 4RUBA 3SQLA 4JIEA 5A8OA 3K4AA 4DZAA 4O1DA 2EG7A 5AC8A 2WVUA 4IX0A 1LROA 1IT0A 4XO6A 1WO2A 3DAQA 3K1DA 2XU2A 3BCJA 3E0VA 3IIXA 3ZJ7A 3QV8A 2PDNA 4FNPA 4UFJA 3VTRA 3TOYA 1Z6KA 1W54A 2J13A 1QFEA 1UD6A 1QASA 1KXHA 1TMLA 2VRKA 2VT0A 3IJDA 2FTWA 1MNSA 2FQIA 3VDHA 1J5TA 4XK2A 1V3MA 4WJEA 1R87A 2YYTA 2NXHA 3FLUA 4OOZA 2F9RA 2R8WA 3HQPA 1NDVA 2D20A 5GNXA 2VNCA 3LCHA 5M3WA 2FVKA 4F40A 3OA3A 4I5RA 1X1ZA 3W1LA 1UR4A 3CV6A 1EWEA 1PPIA 1A50A 3EOLA 3PFRA 4J3ZA 4POCA 3O6DA 3G1HA 1V77A 3DBPA 3ITVA 1OGGA 3VO0A 3W01A 3NQVA 1W32A 3U48A 2DQXA 1UC5A 5D32A 2NV9A 3MUCA 1GOOA 3IGXA 4IXHA 3SAZA 3P60A 2X40A 2X2YA 1CDGA 2GQ9A 2QV4A 3VGFA 2ZRUA 1IEIA 1D3CA 4V28A 4CQ9A 1JPMA 5K7JA 3CIVA 3VFCA 3CBWA 2AGKA 2OO0A 1E51A 1SR0A 3CYJA 2WLYA 5JBDA 2XN0A 1A49A 3KXQA 1QATA 3WG6A 3FDKA 2W66A 4FF7A 3SFKA 4FPSA 5FF4A 1R85A 1H1YA 3NQFA 1ONWA 4AAJA 1Q13A 4H2CA 3AUJA 5CPQA 3L67A 2YB4A 3HPZA 1BYCA 3PJTA 1K1DA 1J2WA 1Q5MA 5I24A 2PP1A 4ICMA 3HIJA 3OPSA 2VZUA 3LBMA 3W7DA 4QCEA 1G4PA 3VNMA 1TQXA 1G7VA 2DFAA 1DHKA 4GA8A 2BGNE 4IP7A 1LT7A 2WMIA 2Z0IA 3KVLA 4JQ2A 2D2JA 3MKKA 1TPDA 2FVLA 5FJJA 4TX8A 3ELFA 3TDFA 2G4JA 3F4WA 4A6GA 2B4GA 3RU8X 2FPYA 2CW6A 3KX6A 3TQPA 2VEPA 4P2VA 3VC6A 5CZKA 5ABFB 2BHZA 1U83A 4L9ZA 4V1XA 4BCEA 2ZE3A 1IWAA 3TFCA 1XLMA 2YDSA 3R8GA 1NDYA 3FA5A 3E2QA 1EB3A 3WLRA 3VDCA 3RITA 3D46A 1H11A 2OQYA 5DT7A 4OOUA 3E2VA 4PMNA 3AZTA 2VWTA 1R7OA 2ISWA 3H2AA 4PN2A 1XGDA 2BY2A 2DSKA 1KA9F 1WAWA 4EPBC 3D5HA 5DMYA 4Z08A 3FFSA 3DG3A 3I68A 3UNDA 3W7MA 4ZE4A 1VBGA 4X22A 2ADAA 2YFOA 4HYVA 4P7QA 4KPLA 3CQIA 4GZ7A 2FKPA 1QT1A 1LP6A 2BMBA 4ZCWA 4RR4A 1OZMA 3C5QA 3W1PA 3N13A 1V6WA 3NA8A 1XKYA 4C1NB 4H3DA 1XGZA 3PFMA 1C8XA 3WNOA 3FVMA 1F61A 4Q8TA 3S46A 2OYKA 4UZSA 3SUWA 4KEZA 4AC7C 2VENA 4ERGA 1W31A 1OFPA 5LIUX 4GXMA 1VB9A 4I3GA 4ZXLA 3LENA 3SGZA 3B8WA 1F76A 4S2CA 4J3TA 4Q6JA 3L5AA 3NGFA 4MNMA 1QOXA 4LBSA 1E0VA 3OOQA 3LV6A 4WY0F 4O1BA 2HVOA 3UWUA 3A4XA 4ML9A 1DWFM 5JIPA 2OTDA 3VZZA 3CAWA 1B30A 3E6EA 4AY8A 5BXSA 1PKNA 4B5TA 5EMMA 3VOIA 4G9PA 5BZAA 1VPYA 1XBXA 4AISA 4RW3A 1SGJA 2GJPA 1OSEA 1KTNA 1RCQA 1Q6EA 4ZO8A 2XFYA 3GKAA 1F6PA 1C92A 4HNVA 4L4PA 4MJ2A 5C9WA 4KEUA 5G1MA 2VEGA 1EUAA 4HNNA 3GHTA 4L65A 4DNMA 5D9PA 3FEQA 1RP8A 3QPEA 2IKGA 2QUNA 1T5AA 4WIWA 3BSGA 3W53A 3HQNA 4XISA 3VKCA 1Z7AA 2QXWA 3DI0A 1S3HA 2V6AA 3HGSA 3TSDA 4GY1A 2PURA 4PR4A 2ATSA 4AMAA 1WP6A 5AC7A 1XP3A 2YX0A 2V82A 1O60A 3PZOA 4AZGA 4PTMA 3TTOA 4JQ3A 4US6A 3WBAA 5GQBA 1XQKA 3B8SA 1ZU8A 4ICNA 5FIPA 3UPMA 1TPUA 3RX3A 4QROA 3L2MA 3W7LA 3UZZA 4XAPA 4MF4A 2QJGA 5EL1A 7ENLA 4H8VA 4QITA 1R5YA 4CQAA 2VM8A 3BWWA 2VMFA 3EPOA 3RMEA 3PVFA 2XH2A 3SCVA 8RUCA 3W3OA 4YTTA 1LWHA 1AQ0A 2Z27A 3QTPA 1DJHA 1QOPA 4C5ZA 1V6TA 1AG1O 2C8NA 3ARPA 2VZTA 3HPXA 2J6XA 5CC7A 3VMOA 1O1HA 1FH7A 1JVNA 1PS9A 3WNNA 3B06A 3GR8A 3TU9A 1BWVA 3FAWA 2DVUA 3CH9A 1PSCA 4GNJA 4JTEA 4MSSA 3TOPA 4ROQA 3LPPA 3ZVHA 2YYUA 3DFTA 1MUWA 4AB4A 3UPBA 3W2JA 1NDWA 5I3IA 3EXRA 3M44A 3AMLA 3N4FA 1WE5A 4E3VA 3P5YA 1J18A 4P7RA 3EX3A 4K7YA 2PDYA 4BR1A 2Z2UA 3S2NA 4MGGA 1R2TA 4EX4A 2QPXA 2R1KA 4JHZA 1VBHA 2NSOA 1SFLA 1Z44A 2XN1A 3ARWA 1UOKA 2Z1SA 1P43A 5A2CA 3W6LA 3VINA 3LOTA 5LNSA 3B0VC 1TV8A 3FSTA 4UFIA 1C8YA 3GXTA 3N2XA 3O9NA 4IXXA 4PMZA 1RBOB 2IS7A 3KCLA 3N9KA 4UIOA 4DXXA 2G3MA 4IPIA 3ZO9A 2CITA 3U9IA 2J7CA 3RAOA 3RYSA 1V0MA 3QQWA 4D8ZA 5I00A 3N6HA 4C1KA 5CC3A 1JZ4A 3O1NA 3M07A 3TTEA 3FGCA 9XIMA 2Y8UA 1W0MA 1QK2A 2QCFA 3FVDA 3EZ4A 3BAJA 3QR0A 5JBFA 3A3XA 1OCQA 3HBLA 1NWUA 4J3UA 3T4WA 1QPOA 3CZJA 3TIMA 1C91A 4HA0A 4NT0A 4CNPA 3WN6A 4AX6A 1SPQA 3FGCB 4H6RA 4HU4A 1ZZMA 1NWSA 1EA9C 1N82A 2E8YA 3GB6A 3NQ8A 1K6AA 4KS0A 3LQGA 3OGSA 2VEMA 4DWSA 1OVDA 4CD8A 4UQAA 5DXXA 1T40A 3L2IA 4PMRA 7PTDA 5C55A 1VS1A 1C93A 3B4UA 1O5RA 1XYFA 4PUNA 1H0GA 3B4YA 5C9XA 1E3ZA 2P50A 3L4UA 3PR2A 3R13A 3W7QA 4MY9A 5FJUA 5CSRA 1UR2A 1XCXA 4AZHA 3I7SA 3WQEA 2PWDA 4GYPA 3V5CA 3KL5A 4GLEA 2B7PA 3NOEA 3PUEA 2P53A 1DBTA 3VGGA 2ZRXA 1ML1A 3U57A 2YCIX 2PDQA 2TAAA 4M51A 4GC3A 1G4SA 1NWTA 2BTMA 1W1VA 2UV8G 4TVUA 3IUIA 3XIMA 2YCLB 2NX9A 4XSMA 3S4TA 2HTMA 1YTEA 3UWWA 1POJA 1L6FA 4LYQA 4M6UA 1V3HA 3CEPA 3ZIZA 2P1FA 4WSKA 1F8MA 4FNRA 2I14A 4DAIA 1UCWA 4NASA 5DF0A 3USBA 1QHZA 2PRHA 1B54A 1KKOA 2OO6A 4V1YA 5F4XA 3ZM8A 3MUY1 4NL1A 5CCZA 4O4WA 3WL1A 4KF1A 2XM1A 1EHNA 2DORA 3TR9A 3QY7A 4H4IA 1QWKA 3WQPA 3H6OA 1EPXA 4EF8A 5B7ZA 2CLPA 4EKJA 3GNOA 5HWNA 1FP8A 1U5HA 3H54A 1V3LA 2ZIDA 3GR4A 5K9XA 1V51A 1SU5A 4XKMA 2G3FA 3BLOA 3AQUA 1AH0A 4IUOA 2MANA 4KFOA 1P7TB 4R9XA 4GACA 1ZBCA 4NRRA 3LBOA 2OEMA 4YMZA 2PDUA 3NDYA 2OZTA 3D3FA 1H7NA 1X97A 4PGLA 1TSIA 1I2NA 3O0FA 3B8VA 2ZXAA 1LTDA 2EKGA 4GY0A 2HEJA 4A2RA 1DJZA 3WQ8A 4DWSC 4PZVA 2PDGA 4GZEA 3WQCA 3HO8A 1Q85A 4WR3A 3URBA 1GG0A 5RUBA 1XYAA 4NAFA 2ZTJA 1D2KA 2FMOA 4MB1A 4QAIA 1B3WA 3DEQA 1AH4A 4GIRA 2ALDA 2QMJA 3BCFA 2BXYA 4PUMA 4OGZA 4HP5A 3IIVA 4NG3A 3SY5A 4GX9A 4F4RA 3DCPA 3SR7A 4YN5A 1GOWA 1JJKA 2PTXA 1KKRA 4Q8PA 1R8LA 4D8LA 2EAWA 3UVAA 4YWSA 2A6NA 3BQ6A 3M5ZA 5G1YA 3UPWA 3VUPA 2INFA 1F3XA 3SUUA 1HJQA 1OX6A 3U4FA 3VAVA 1W1IE 3CIWA 2QPUA 4AZ7A 1JCLA 1TE6A 2PAJA 5TBOA 6ENLA 4OVXA 3DFYA 2OB3A 1J0JA 2PSNA 4A3RA 2E7FA 2YL8A 3UBPC 3BANA 1WZMA 3CS2A 3OLGA 1UPPA 1Q6QA 3GAYA 2ZYFA 1UH3A 5FA5A 4I9JA 3NM1A 1IEWA 5BRBA 3R58A 1F9CA 1TJPA 2Z1WA 4N0RA 3LV5A 2OU4A 3T6CA 3RFAA 1HP5A 2OELA 2BY1A 3WD2A 2P0OA 1XCFA 2HBXA 1AK5A 5DY2A 4O53A 4S3JA 4LSBA 3F5JA 5BROA 1FDZA 4F2TA 4GINA 1RBAA 3RMJA 3R25A 2VUNA 1VFOA 4M80A 1ITCA 5HNRA 1ESWA 2IKIA 3LTSA 4DX3A 3TAKA 1P7TA 2E40A 2ZX8A 3BSHA 1Z42A 2V2CA 1A0EA 2FZNA 1GYLA 2P10A 2JKEA 5A8MA 4XTDA 4LBRA 2W5FA 3N4AA 1ONXA 2PEVA 2C1GA 1H09A 3QFEA 3QSRA 4UTIA 3B0XA 2VI0A 4E2DA 3WLNA 3EA2A 3NL3A 4A35A 3BSMA 2OQHA 3QEZA 1B90A 4MJZA 4IQDA 2WV8A 4MYXA 1TFVA 2BBFA 3AMCA 3QY6A 4Z1CA 1EQCA 4QLLA 4DJFA 3GBEA 1XLFA 4GKLA 3UR5A 1IWPA 4K37A 1C90A 3UGRA 4OBTA 2E25A 3WFLA 1M7OA 2WOQA 4ORIA 1UKSA 3HG2A 2W0UA 4L6OA 1W3KA