5CSYA

Disproportionating enzyme 1 from arabidopsis - acarbose soak
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
517
structure length
506
Chain Sequence
SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 180
structure length 506
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5csyA01
2WZEA 2XG9A 1LWHA 1E4IA 3U5UA 4CUCA 8CGTA 4H04A 2BVTA 1H41A 4OJYA 4RE4A 2JEQA 1GNXA 1WKYA 5CGTA 1V3JA 2WW5A 2O92A 4JCLA 1US3A 5EMYA 2ZUMA 2YBUA 3VD3A 3G6MA 2YDQA 2A3BA 3WEMA 3AIRA 1BYDA 2DSUA 3ZSSA 3NSMA 4PCTA 4JCMA 5AY7A 1UH3A 2WCGA 3WD1A 3GXMA 3OG2A 4JZ5A 5IHRA 1W9DM 3EDJA 4TOQA 3FW6A 1GHRA 2VX7A 4PMXA 3L4ZA 3SCSA 3ZJ7A 4B9ZA 2C8NA 3CHEA 3IAQA 3VGHA 2C7FA 1YQ2A 7A3HA 1B3WA 2PWEA 2G41A 4KH2A 1UZ1A 1CPUA 1PPIA 3GTNA 1UD4A 2YL8A 1ESWA 1MQPA 2AAAA 4N42A 4K68A 4B16A 4XV0A 4P8XA 1V6WA 1CIUA 2DT1A 3SUSA 3WMBA 2WPGA 5DEZA 3EYPA 2HVMA 2GJXA 3AJ7A 4H41A 5A2CA 3RPMA 2O9TA 4JAWA 3VDAA 3VGGA 1NARA 4YHGA 3MSGA 1C7SA 1ZJAA 1WE5A 2BVDA 2ZX8A 2G3JA 3L2LA 1ZBVA 3RIKA 3MUY1 4FLOA 3BAKA 2WKLA 1JYXA 2AMGA 2ZUSA 3DYPA 3FN9A 1CLVA 5GPRA 1XD0A 3BSGA 2Z1SA 4AZGA 4LGXA 1DWAM 1J0KA 1KGUA 1XGZA 3MMUA 1H5VA 1AVAA 1KR0A 3ARZA 2ZE0A 5GQBA 1HL9A 2QMKA 4R27A 1E6XM 2FHBA 1E0WA 4P7QA 4PMYA 2EPNA 4AC1X 1VFMA 2ZUUA 4PMDA 3AIEA 4Q7NA 6CGTA 1KWKA 1GVYA 3GH7A 3WNNA 5CJ5A 3SIMA 1KXQA 5HXMA 2EPLX 3PZQA 4CCDA 4QLJA 2VQUA 3RM4A 1H11A 2CPUA 1JIBA 2OLHA 4M29A 1BLIA 5CG0A 3RJXA 2PBOA 5A8OA 3OGSA 2O9PA 2XVPA 3ZIZA 5FL1A 1DTUA 2NSXA 1M03A 1CGXA 3VIMA 4NZCA 3FHQA 7TAAA 1DWFM 1PX8A 1RP8A 1JYVA 4QAWA 3AYSA 4PMVA 4AZBA 1J0HA 2ZXBA 3AMKA 2BXZA 3WNPA 1AQ0A 1FH7A 2CBIA 1GOWA 3QHMA 1HJVA 3CZGA 3UESA 4V28A 3UR7A 4AYSA 2W5FA 4PMRA 2GJPA 2WYSA 1OM0A 3OLIA 5DT7A 4D72A 3FAWA 4X0NA 3THDA 1FHDA 4RL3A 1H0GA 4H8UA 2Y2WA 1SMAA 4ZXOA 3VILA 3AMCA 1E0XA 1UD2A 2JALA 3VDHA 1BYBA 3BCFA 1BPLB 1WPCA 2G3MA 2YLAA 4PMNA 3WH9A 1B90A 1IV8A 2YOCA 5JBEA 2CBVA 4AIOA 4D6CA 1KR1A 1UD5A 4HOWA 3N04A 1JYWA 2G8ZA 2QMJA 1EHNA 1CGWA 3VGFA 1DWGM 1QHZA 3PTKA 1GOQA 4DUXA 3QR3A 3CIVA 1QW8A 3K4DA 5JBFA 5DT5A 4D6DA 4CCEA 3LPPA 4HA4A 5C70A 1GUVA 4CU7A 1KB3A 2MANA 3IJ9A 1U33A 4J3XA 5A8MA 4DWSB 3M07A 1XCXA 3WH5A 1VB9A 3AFBA 1H49A 5HNNA 3EMQA 7CGTA 4Z2LA 4W89A 5I5RA 5AYIA 4P7NA 1CYGA 4EK7A 1S46A 4PRWA 3RJYA 2BY3A 4AIEA 4ZE4A 1KXHA 2XPKA 3UG4A 3AS2A 4L4OA 1UR8A 2WMHA 1OT2A 5A2AA 3VMOA 2CKSA 2ESCA 3PZ9A 1CGTA 2BVYA 3BSHA 1R85A 1MQRA 5BCAA 4UCFA 3VX1A 1E56A 1JG9A 1V6UA 1MW3A 2ZUNA 2W4XA 5LA0A 4LPCA 3OGRA 3RM8A 1I1WA 1DWHM 3WBAA 2QF8A 2D0GA 2WB5A 2WVUA 4GZJA 2GK1A 5IXEA 3GYCA 4XZWA 5I77A 1J10A 3MS8A 1WNOA 2F8QA 2E9MA 3OB8A 1Z32X 3T0DA 5M5DA 4BF7A 2DSZA 1UWRA 2PF0A 4UFKA 2EO7A 4UQDA 1KWGA 4JKLA 3VD5A 4U2ZA 3BH4A 4BQ3A 1W1TA 1WCGA 3W24A 5A6LA 2IUZA 2FH6A 2EJ1A 2EPMX 4PN2A 3ZT5A 4H7VA 5BXPA 2VZVA 4GO8A 1JYNA 4D1IA 2VUYA 3U7BA 3A6OA 4WSKA 3VDCA 3CBWA 1JI1A 4OOUA 1UKPA 4PMZA 1UQZA 4W5UA 1XH2A 1VBUA 2X1IA 4MAVA 2WMGA 2E9BA 4BQ4A 3AXHA 3WF2A 4HMDA 1B3VA 1PX4A 4GI8A 5E0CA 3O9NA 1V0KA 1FHLA 4J3WA 1EDGA 4MDOA 1WZAA 4HA3A 1BFNA 3A4AA 2Y5EA 1SR0A 4ZENA 3T0AA 3MO4A 4WSJA 2E9LA 4FLRA 1G01A 1GHSA 2TAAA 5LYRA 1E6NA 3EMZA 1EDTA 2XFYA 2DT2A 1E71M 2XWEA 3I3BA 2VNCA 3EDEA 4OZOA 1HX0A 4PSPA 1W9PA 2ZWZA 2ZX6A 1JAKA 3VIJA 3B9DA 4A3YA 3DYMA 4V2XA 2EEXA 3SCTA 1UUQA 4EKJA 4PMUA 1E6ZA 2O9OA 2WMFA 3AIQA 4MJ4A 1D2KA 3GXFA 2WVSA 5A8PA 3CLWA 4HP5A 4UOZA 3CTTA 2WC3A 4AZIA 5A2BA 2WWCA 2XVLA 3VIHA 4GZIA 1UR2A 2CNCA 5CXPA 5GNZA 5IHSA 2BXYA 4CN6A 3WF4A 5M3WA 2VVSA 4PUDA 4UFHA 1ISZA 3AHZA 4DM2A 1JZ2A 2V3EA 3ZSTA 3MKKA 3M7SA 4OKDA 3FY1A 2DGAA 3W25A 2EBNA 2J7DA 1CECA 1LLOA 1Q4NX 5CLWA 2G3NA 6TAAA 2ZIDA 4ZE5A 1JZ5A 4KRTA 3O6AA 1JL8A 3AHYA 1HJXA 3BCDA 1MFUA 2VURA 1NM9A 4NI3A 3TTSA 1W2VA 2DQXA 1HIZA 1LG2A 2E3ZA 2OWCA 3W28A 4BA0A 1VFUA 1HJSA 1GONA 4PTXA 2WVVA 2XJ7A 4Z2IA 3SURA 4AZ7A 1E43A 1GJWA 1WDSA 4LX4A 4YPJA 1DWJM 4AXNA 1V3IA 2UY4A 2NW0A 1PX3A 2WSKA 2DEPA 2GVYA 3NJ3A 2B31A 2X2YA 4TX8A 1V3MA 1E5NA 2V3GA 4PTVA 5BXTA 4XZBA 3ARTA 1E72M 2CCRA 3WDHA 5I0DA 4B3LA 1BG9A 2PWDA 2FGZA 1QHOA 8A3HA 3WMSA 3T2OA 3LPOA 3HJEA 4MNMA 4AD5A 5FL0A 1UR0A 3L4UA 4P8WA 2DT0A 3T2QA 3QHOA 1QHPA 1E1FA 1OD8A 4EANA 1QI2A 1ZBWA 5JBDA 1CEOA 1E15A 3CUGA 5FIPA 4E2OA 1EHAA 2W67A 3UERA 2ZX7A 3ECQA 1M01A 1MXGA 3G6LA 1HVXA 5GNYA 3VNZA 3AS1A 5HPOA 1HKIA 1FFRA 1R7OA 4WJXA 1UYQA 1PJ9A 2DSKA 4P7LA 4W7UA 3L4VA 3O2LA 3MANA 4FF5A 4UNIA 2AOSA 2WCAA 1W9XA 3U57A 1BSIA 1KQZA 1TA3A 4PCSA 3UG5A 3PZVA 2J7BA 5EFDA 3T0BA 3FAXA 3AI0A 3QHNA 2XGBA 2E0PA 1JF6A 2O9RA 4XB3A 4QLLA 1TCMA 3ZJ8A 1HN1A 3M6DA 3AIWA 4IPLA 5DFAA 4HZ6A 4CU6A 1CZ1A 4JL1A 1PEZA 1GZJA 1V6VA 3TA9A 3WNLA 4IUGA 5EBAA 1C93A 3BGAA 5A69A 3WDQA 4FLQA 3AMDA 2WK2A 3AYRA 1H09A 1UWQA 2XTKA 5A6SA 3BAIA 3W27A 4D6IA 1V0MA 3L4TA 4W5ZA 2VQTA 2E8ZA 2GFTA 3I3EA 1NWUA 2CBJA 2OYMA 1EOKA 3F4VA 1XHGA 4ZXLA 2X0HA 5ABFA 4S3KA 4TX6A 1TA3B 1JFXA 3SCOA 1WZMA 1WO2A 2Y4SA 5IFPA 5KEZA 4OUEA 5A3HA 3IJ7A 3L4YA 2D3LA 3B9EA 3SCWA 3RCNA 1TE1A 1HKKA 1W9BM 4Y7EA 3GXIA 3T09A 5IFTA 3VPLA 3VO0A 4HMCA 5HDRA 1EH9A 4IISA 3AS3A 3AHVA 1R8LA 1MFVA 1TUXA 2D1ZA 2VCBA 1E4MM 4PMOA 4NF7A 4W86A 5A6BA 4HOZA 4MNLA 2WKGA 2XSBA 4LYRA 2XVNA 4CU8A 2FDMA 1W91A 4QDMA 1V0LA 1W1VA 4UQAA 1HF6A 3N17A 1C92A 1A47A 1XSJA 3BAXA 4HU8A 1MQQA 1P6WA 4GPNA 3OZPA 1HKMA 2BHUA 1C91A 2BS9A 1CXEA 1E6QM 1NQ6A 2C0HA 5FKYA 1Q6CA 1DWIM 5ABFB 2BY1A 4YN5A 3FXYA 1EA9C 2GUYA 4X9YA 1L8NA 2V5DA 1E40A 1G9HA 1CWYA 2VZUA 3AZSA 2V3FA 3DC0A 3W4RA 2Y8KA 3ARSA 3WFLA 3SCUA 4W88A 3ARYA 5BYWA 1J0JA 4B15A 3OLGA 3ZJKA 1RH9A 3WEZA 2CIPA 5A8QA 2WCSA 3WQ6A 4UOQA 1E70M 4ACYA 1W3JA 3T08A 4E4PA 1R86A 1XD1A 4MNJA 1DHKA 1MW0A 4CD6A 1D3CA 1TVNA 2XSAA 1VF8A 4CVUA 2ZICA 4UR9A 2VC9A 1OIFA 2WLZA 4GZEA 1LF1A 3NSNA 4UFIA 2FGLA 1V6YA 5AYBA 1MW2A 2Q8XA 4QFUA 3RM9A 4W7WA 3ARXA 3ARPA 1DP0A 1PZ3A 1ODZA 2ZXQA 2YA2A 5AC4A 4DWSA 2W91A 4AMCA 3VIKA 3WD2A 1CXFA 4QP0A 1BGGA 3BMVA 4F9DA 4JKMA 3VIPA 2DIEA 1VEMA 1ISXA 3S2CA 4HPGA 1O6IA 4AZHA 2JEPA 4ZFMA 1BVZA 2YBTA 3AXIA 1RP9A 2DDXA 1KFWA 2A3HA 4PBGA 4CVWA 2EXOA 1QI3A 3CHFA 1NWRA 4W8LA 4B3KA 3WNOA 3AIUA 3WUBA 3WL1A 1HJUA 4RE2A 3EDFA 4W87A 1UH2A 3MUZ1 2VX4A 1VJZA 1W1PA 4JHOA 4OBSA 4PTMA 4H8VA 4J7RA 5E70A 2XGIA 3VOCA 1CXIA 1XRVA 4CN1A 2YL5A 5BXRA 2J8GA 1BYCA 1B1YA 1J18A 5ABGA 4XX6A 1TVPA 3ARRA 1NP2A 1XYFA 4D6FA 4AISA 3W26A 1CTNA 1XH1A 3WDIA 1X1NA 2OWWA 4AZCB 1XSIA 1ISWA 4MAZA 5I3DA 4U5KA 1V08A 2YA0A 1HVQA 4P7RA 3W37A 1G0CA 4LYPA 4U3CA 1EXPA 4LXFA 2RGMA 1XC6A 2UY2A 3ZM8A 5I2UA 3PBGA 1YHTA 1JGIA 2PWGA 5A6JA 4M8UA 6A3HA 4F79A 1WB0A 5A1AA 1MW1A 3SUUA 4QCEA 1C7TA 1KGWA 4NSBA 2EQDA 3WQ4A 3PN8A 1K6AA 5JUVA 4U3AA 1UWSA 4D6HA 1JNEA 5LA2A 3PZTA 1Y7VA 1GPFA 4DWSC 1JI2A 2XIBA 4GQQA 4BQ5A 1UKOA 1CXLA 5DO8A 3MUIA 4HMEA 1WAWA 1UD3A 5FOOA 2J4GA 3CPUA 3VX0A 1UQYA 3CUIA 1JZ4A 1FA2A 5BRPA 4MPKA 3B9AA 2HISA 2VT0A 1CGUA 2W62A 2CEQA 1JZ6A 5F7UA 1GQJA 2OWXA 3WNKA 1UH4A 4BQ2A 2XM1A 1V02A 3CUFA 2BNJA 4CD5A 4W7VA 3OIHA 4CD7A 3K8MA 4UQCA 1E4LA 4MDPA 3TOPA 5DMYA 3KEHA 4JL2A 5A6AA 3K8LA 1C8QA 3CUJA 4BS0A 4E8CA 1LJYA 4ATLA 3CO4A 1EO7A 5I6SA 1KCKA 2X8RA 2X05A 4M82A 3MV01 2UY5A 1K9EA 4ATWA 2QHAA 3AIVA 4KWUA 3L4XA 2OSWA 1B3ZA 4GI9A 4WIWA 4GQRA 1OT1A 3PZNA 3N9KA 1G5AA 1E73M 4J27A 1HP4A 4AZ6A 3WH8A 4UFMA 1UR9A 3IAPA 3N18A 4HU0A 2V38A 3WBEA 1UWIA 2D24A 3BAWA 2CHOA 1ITCA 4MTVA 3GM8A 1B31A 3T2PA 5EB8A 4JKKA 3DHPA 4C7GA 4AY1A 3SCRA 1C8YA 2WBGA 5IDIA 4KGJA 5CZKA 3K1DA 3J7HA 1CXHA 3NSXA 2WHKA 2JIEA 1MXDA 1H1NA 1LL7A 1VIWA 5CQ1A 3VNYA 2J47A 1VENA 9CGTA 1QNPA 3CZ8A 5HOSA 3SUVA 1G1YA 1QBBA 2WMKA 1HP5A 1GCYA 4MJ2A 3F5KA 1OSEA 2BY2A 4U5IA 3ZT7A 3UG3A 2GJRA 1B0IA 3LPFA 3SCPA 4PTWA 5CPTA 4URIA 2J62A 3ZR6A 4PYSA 5E9AA 2BHZA 3WENA 1WP6A 2CKRA 3AHXA 4Z2JA 3HN3A 3SEPA 4TXEA 3WNMA 1CNVA 3IJ8A 3VD7A 3RMEA 1UD8A 3ARUA 4ACZB 4W93A 1ZJBA 4KGLA 1LL6A 1ZS2A 4V27A 2XVKA 4TTUA 4TVUA 1MVYA 1HT6A 4Z2GA 4W8BA 3WEOA 2BFGA 1KGXA 3SCQA 2PC8A 3EDDA 5BWFA 3VD4A 2G4FA 3L2MA 3WY1A 3AS0A 1H0IA 3TP4A 5I79A 4LQ1A 3NUKA 3AZTA 1JXJA 4GIAA 4OBRA 1HNYA 3KL3A 1J0YA 1MYRA 4KRUA 1W2PA 2D3NA 1QPKA 3D3AA 2CERA 3AIBA 2VZTA 1QI5A 4M24A 1B2YA 2NT0A 3WF3A 4MB4A 3VDBA 1BVNP 3TTQA 5E6YA 5D4YA 1W3LA 3BAJA 1RPKA 1UG6A 1VAHA 5BRQA 4J3TA 4HOXA 1VBRA 1CGVA 2WSPA 1PZ2A 4EAMA 3NDYA 2VR5A 1JDDA 2J7CA 4J3SA 1IT0A 3N13A 3AMLA 1VFOA 2ZUTA 2WNWA 1JZ8A 5AC5A 2XYLA 4R5EA 3U5YA 3AOFA 4DUVA 1WDQA 1J0ZA 1OIMA 3WELA 1M7XA 3AROA 2WC4A 2DIJA 2DSWA 1FOBA 4GINA 1SYTA 2V5CA 1VFFA 4X0VA 3SUTA 4EE9A 2Y24A 1PBGA 4TVDA 1V03A 3M46A 2ZXDA 1E55A 4MB1A 1JFHA 2A3CA 2DH3A 3OA5A 3PTMA 4PUEA 2FH8A 5JIWA 1GOOA 1C90A 3A47A 3SUWA 5DF0A 3U7VA 4HA1A 1N82A 3WF0A 1R7AA 1I75A 1UR4A 2YL9A 3EDKA 3NDZA 1UA3A 1KBBA 4D6GA 2BY0A 1XV8A 1JZ3A 1JDCA 3L4WA 3PZMA 1J9YA 1HJQA 1QI4A 2YDRA 3BC9A 1JAEA 5C71A 5ECUA 1GQLA 3QOMA 1ODUA 3LMYA 2A3AA 2D23A 2BV9A 2PB1A 4U31A 1GJUA 1UA7A 4GKLA 5A6MA 4H8HA 3W81A 5ABHA 5BXSA 4F66A 2J77A 3N12A 2ZOXA 1AQHA 3N1AA 1U30A 3ALFA 1WZKA 1J12A 4U33A 1NOUA 3KL0A 4WK9A 5GNXA 3WQWA 3GNPA 2GDVA 4M1RA 2J7HA 4GI6A 2WHMA 2DH2A 2J7GA 2D0FA 5A8NA 2VOTA 3VD9A 3ZT6A 5BROA 5HBFA 4PMQA 3NYDA 1EQCA 4JHZA 4ATDA 1E9LA 4CCCA 4U2YA 3APGA 4OIFA 3LPGA 2W63A 1U2YA 4UZSA 3MMDA 1KBKA 3GXDA 4P8UA 2WLYA 3EBVA 2VCAA 3VMNA 1WDPA 4HZ7A 3MUAA 3AQUA 3WN6A 3VM5A 1F4HA 1ZL1A 5CGMA 2OSYA 2D2OA 4UFLA 2JE8A 1J0IA 5CPSA 3UEQA 5D9NA 2EPKX 4C7DA 2E8YA 1QNOA 2GSJA 2J7FA 4KMQA 5TD4A 1UZ4A 3CMJA 2W66A 2VRJA 1AMYA 1Q6EA 1GQIA 2J75A 5FD0A 1OINA 3K46A 1E3XA 4Z2KA 2ZUWA 4UQEA 3MMWA 3WD4A 1W9UA 1C3FA 1O7AA 1M53A 3FNDA 2QV4A 3W53A 1V3KA 3NIYA 3N15A 4CN4A 1E6PA 3ALGA 4AD0A 2D22A 2VZSA 2J78A 2EPOA 2XFRA 1NP0A 3RDKA 4L4PA 1ISYA 2VO5A 2X0YA 3TONA 4J3VA 1JNDA 3K8KA 3BAYA 2WHJA 3SCNA 3MSDA 4DUWA 5LA1A 1SMDA 3RO8A 1QNRA 3IK2A 4JFTA 1JZ7A 1FP8A 1C8XA 3GZAA 2YA1A 1F4AA 3VIIA 1Q6GA 3PZOA 1BTCA 1QBAA 3BLKA 1W3KA 4Q22A 1W32A 2J8FA 3ZJ6A 1GOMA 3GH5A 2CYGA 2YIHA 3DYOA 1UOKA 3GNRA 3WDJA 4UQBA 4D6JA 1OWQA 3ZR5A 1NOWA 1W3HA 2RGLA 3ARQA 2VTFA 3AISA 3OLEA 2D0HA 1QOXA 3VVGA 1KQYA 2OSXA 1PAMA 2VL4A 3VKKA 5D9MA 2ZUVA 1XYZA 1WZLA 4WKFA 1UWUA 1QI0A 1XSKA 4AZCA 4JFVA 1DEDA 3K4AA 2XUCA 4JFWA 1V0NA 3I3DA 5M03A 4DM1A 3ARWA 3CZKA 3VIGA 2GJXB 3F5JA 3W0KA 2FHCA 4M80A 3W82A 3WUGA 1UHVA 1GOIA 1TZ7A 4CD8A 4CD4A 3WD3A 2VX5A 4WKHA 5D8ZA 4YHEA 3E1F1 1UD6A 5I78A 1LWJA 3WH6A 1VJSA 2WAGA 4A3HA 4UTFA 1B3XA 4Z2HA 4C7FA 3VIOA 1E6RA 3W6LA 1JXKA 4JIEA 1SFSA 2J74A 2IXVA 3ZMRA 2XWDA 5CSUA 2WXDM 4AZ5A 4S3JA 1E5JA 2D20A 1AQMA 3II1A 3N11A 1GQKA 1FFQA 1ITXA 1BQCA 1V6XA 2W61A 1NH6A 2YJQA 3CHDA 3OZOA 2BHYA 1ECEA 3AICA 3CZEA 1H2JA 3AXXA 4IM4A 1PIGA 1BF2A 4FK9A 4QCFA 2DT3A 5A95A 1BGAA 1OD0A 1E0VA 2QPSA 2CITA 4MB5A 5E6ZA 1VEPA 1J11A 3QGVA 4MADA 3ARVA 3CGTA 4AW7A 2ZX9A 3AZRA 3WSUA 3SCVA 2PWHA 3TTOA 1OCQA 2VCCA 2V3DA 2CETA 4ZEPA 2YKKA 2WWDA 4LYQA 4TUFA 4E8DA 1GW1A 2Z1KA 1UKTA 2WBKA 5ABEA 3NCOA 1FH9A 2WHLA 1QVBA 2E4TA 3PHAA 1GOKA 2Y8VA 3WD0A 3WQ5A 3VIFA 4HZ8A 1CDGA 3KE0A 2WANA 1QNQA 2JF6A 2G3IA 2E40A 1UKQA 2VX6A 5A6BD 3OLDA 1D7FA 1KXVA 2XFFA 1V3HA 4J28A 1R87A 2JIWA 3CHCA 3VINA 1EIBA 4WF7A 3GBEA 1B30A 1CLXA 3DECA 1E4NA 4CKQA 3PZGA 4ML4A 1L0PA 2UWFA 1OGSA 4W8AA 3ZQ9A 4AD3A 3WQ8A 2JF7A 1CENA 1CXKA 1LL4A 1H4PA 2VI0A 3WH7A 3FHAA 2X09A 1A3HA 5D9OA 2PWFA 1IZJA 4AWEA 2WM0A 2YL6A 4N0RA 1J01A 2F61A 4JFUA 3ZO9A 4FLSA 3MU7A 3A4WA 1NOFA 3GDBA 1BHGA 3PTQA 2UY3A 1K9DA 3WUFA 3WF1A 3VGEA 4A4AA 3DHUA 3W6MA 2WMIA 1HJWA 1CBGA 1OGGA 2J7EA 1IZKA 1ZBKA 3QOKA 5E09A 3AHTA 3POHA 3HMCA 2VJXA 1JD7A 1BYAA 2PBGA 1KXTA 3VMPA 1UWTA 2VZOA 1BG4A 3THCA 1ZU8A 2OYLA 1B9ZA 4ACZA 4AD2A 3PZIA 1LG1A 2OYKA 1QW9A 1WDRA 3WQVA 2NT1A 5M17A 1UKSA 2DSVA 1JDAA 4UZUA 3BXWA 3KWXA 1XH0A 1UR1A 2J79A 2CBUA 1KCLA 5C8BB 3A4XA 5CPQA 2GK1B 3VM7A 5D8WA 2PI6A 4FMVA 3CZLA 1B3YA 4DWSD 1K9FA 2VRQA 1LQ0A 1EDQA 1FP9A 3W29A 1EGZA 5A94A 4HTYA 5E0FA 2YDSA 4F8XA 1W9VA 5EFFA 2GDUA 3ZOAA 3WKZA 2W92A 1PIFA 2FHFA 3WIJA 4CGTA 4D6EA 1E3ZA 2VVNA 2ZX5A 4UOJA 2WMIB 4MB3A 3WL0A 3VUPA 3CH9A 4GO9A 3BMWA 4QLKA 3UETA 5I24A 4IPNB 2J25A 2A3EA 1HXJA 1EO5A 1VEOA 1GVIA 3VTRA 1US2A 2VRKA 4H2CA 4PSRA 4UFJA 2WC7A 3JUGA 4D71A 1W1YA 1E6SM 1RD6A 5FCZA 5D9PA 1V3LA 2YLLA 3TTYA 1ZBCA 2WZIA 3PZUA 4PEEA 1TFVA 5CSYA 1XCWA 4OOZA 4RE3A 4GXPA 3RILA 1MWOA 1BAGA 4D1JA 2XM2A 1ZB5A 3S6TA 1H3GA 2QPUA 4BCEA 5JIPA 3EMCA 3WDPP 2XHYA 4AIUA 1NWTA 2VR4A 1EQPA 4TTGA 4HPHA 1TMQA 4AEFA 2DPEA 1Q6FA 4NRRA 1FH8A 3WUEA 4P8VA 5A6KA 4BZYA 4P7OA 4W85A 1EOMA 1K9TA 2WZHA 1OGBA 1OB0A 4F9JA 1ISVA 5KZ6A 4AD4A 1OBAA 2ZWYA 4J3UA 4B9YA 3UR8A 3OBAA 1X6NA 3KZSA 3KL5A 3HU7A 1JD9A 3WFZA 3OGVA 4WLCA 2CESA 5I23A 3IANA 3A3HA 2XVGA 2WMJA 4UQ9A 3AMGA 3GH4A 2JFEX 3F5LA 1QNSA 5CLTA 1HKJA 4MNKA 1V02E 2QLYA 1NWSA 1TG7A 2CXGA 4M56A 3CZJA 2XIIA 1VRXA 1M04A 2IXUA 2VMFA 2WVVB 1JF5A 3D5HA 3WMCA 3WDRA 4AD1A 1G94A 4WKAA 3BLPX 3VGDA 3POCA 4XUYA 1HL8A 1Q6DA 3CUHA 1CGYA 3UCQA 4AEEA 3B8SA 1I1XA 3GBDA 4W84A 3W38A 1GORA 2ZXAA 1X6LA 4JFSA 3GNOA 4TVCA 3CMGA 1TR1A 1E1EA 2WVTA 3VGBA 3MV11 5HPCA 4NRSA 2CHNA 2F2HA 4M81A 3VU2A
chains in the Genus database with same CATH superfamily
3VFLA 1TUFA 1LWHA 4CUCA 3S2NA 4H04A 2ZA3A 4OJYA 3T81A 5CC6A 4RE4A 4CQAA 5CGTA 3G3MA 1V3JA 4JCLA 3CL7A 4F2TA 2NWRA 2QCMA 1H7PA 5LGXA 3VD3A 1MDRA 2YDQA 1EIXA 2OZTA 3WEMA 3AIRA 2DSUA 1PKLA 2DJLA 3WD1A 3GXMA 2BX7A 2Z28A 4JZ5A 5IHRA 3WCZA 3O7UA 3A9BA 4V1XA 3LXBA 3SCSA 3QYSA 3BDKA 3M6YA 3IAQA 3N3TA 3VGHA 4NNCA 3T4WA 3TXVA 5DCEA 4JIPA 1BRLA 1ONWA 3W9ZA 3DKLA 1Z3NA 1MQPA 1M6JA 3VC5A 4PCNA 1POKA 4K68A 4XV0A 5HWJA 3UVIA 1V6WA 1CIUA 2A7PA 4BWLA 4FA3A 1Q63A 2WPGA 3QPYA 4ICCX 5DEZA 3CL6A 3UP8A 3SN0A 1XC4A 3W7CA 3TMLA 4GCXA 3M5YA 3VGGA 1TWDA 4XD3A 2V9DA 1D3GA 5D38A 2BVDA 4WY0B 2G3JA 1ZBVA 3RIKA 3DIPA 4KW2A 1I2NA 2WKLA 2AMGA 1XIMA 2Q71A 5DCDA 4WQ6A 1PSCA 3LGDA 2Z1SA 4AZGA 4C6DA 3H8AA 3KBNA 3GIPA 1AW5A 3MMUA 3NQ2A 4HT3A 5GQBA 2Y7FA 4LRSA 3GTHA 1MSSA 4R27A 1M7JA 3E38A 3QGKC 4PMYA 3KLKA 4PMDA 3E12A 6CGTA 4I3GA 3IIZA 3GR7A 3WNNA 2VQUA 3RM4A 1KV5A 4UTUA 1IQ8A 4M29A 4KESA 3RJXA 3OO2A 4JD4A 2NSXA 1M03A 3LCHA 3NQCA 3VIMA 4HGXA 1DWFM 1RP8A 2PCQA 4LEQA 4QAWA 5D2VA 5H8PA 3AYSA 3USZA 2PTYA 1BKHA 3AMKA 5C2CA 3HBLA 2W3ZA 1JRBA 4I90A 4EP8C 3UESA 4FO4A 1CLKA 1JVNA 4AYSA 2W5FA 1UROA 5AZ1A 1OM0A 1W3NA 2Y2WA 3WLPA 1SMAA 3WYZA 4YCPA 4L6HA 3GVVA 3LLFA 3RPTA 3VILA 2JALA 3VDHA 2F84A 2QAFA 5CPMA 2G3MA 1KFKA 2YLAA 3R8GA 3WH9A 4R85A 1K4HA 2GVJA 2QUUA 3C8FA 1UD5A 2DZSA 4HJWA 1EHNA 3KP1A 1CGWA 2Y0FA 3VGFA 1DWGM 1L6SA 2QIWA 1Q6OA 4DUXA 2PGWA 3CIVA 3Q67A 4I9MA 4NZJA 1M7PA 5JBFA 4CCEA 2Y70A 3QN3A 2IQ0A 3I6TA 4CU7A 8RUCA 3IJ9A 5CC3A 2OQLA 3UF9A 3LB0A 4LTSA 3B0VC 5HNNA 3EMQA 4Z2LA 4EK7A 1KLZA 5MKGA 4NYUA 4FB7A 2E5DA 4O57A 4QITA 4GBUA 3W2UA 3O0KA 1KXHA 3H21A 1QUMA 2O7SA 3AS2A 5JU6A 1UR8A 2RDWA 1OT2A 5A2AA 4P5UA 2QJJA 1GTEA 1K8YA 4YCOA 2ESCA 4N9BA 1OABA 1P43A 3TN3A 1PTGA 4NX5A 2C18A 6XIMA 1XLGA 4F0KA 4A22A 3VX1A 1E56A 1JG9A 3N9SA 1EWEA 2WSQA 4LPCA 4RJEA 3PWGA 3RM8A 3UXIA 1R3YA 1X1ZA 1HL2A 1ZY9A 3PVFA 4B91A 3TNOA 2WB5A 1K02A 2WZMA 5AC8A 4AXKA 1WNOA 1KA9F 1OCBA 3CAKA 3T0DA 5M5DA 3AC0A 2PF0A 4X60A 1GEHA 1FWRA 1MZRA 2VC6A 1SO5A 4JKLA 3MKVA 3H2OA 4RV3A 4XWUA 1XP3A 5HR6A 2FZ8A 3R79A 3VNJA 3W24A 2X16A 3VKAA 1T0OA 1FWJC 5A6LA 1P0DA 4DRSA 2EJ1A 5HJLA 3ZT5A 4AHPA 2VZVA 3WLTA 4GO8A 2AL2A 3CU2A 4QHRA 3PAJA 4XBSA 3TC6A 4D1IA 3RLGA 3STPA 2FQIA 3CBWA 3CC1A 5EMLA 4W5UA 1XH2A 1VBUA 2P3ZA 1WDWA 2WMGA 3W23A 2FYMA 4QJ3B 4HMDA 4UTKA 1FHVA 2HEJA 2X7VA 3O9NA 5D04C 3W2JA 4J3WA 3IIPA 1U1HA 1VCVA 4UB9A 3B97A 2Y5EA 3NL3A 2CC0A 3QV7A 4XIAA 3ZLGA 1WOBA 4LALA 3DGRA 3EMZA 1XIIA 1E71M 1L8PA 2QUVA 3SR7A 1K8CA 2VFHA 4OZOA 1HX0A 4PSPA 1W9PA 1YADA 2QCDA 4HMNA 2REQA 1M9HA 4PMUA 2IKGA 2X2GA 2O9OA 1BVWA 1D2KA 3ZVHB 2XIMA 2VC5A 1MNSA 2WC3A 1A5LC 3G1VA 3H2MA 5CXPA 2FJUB 2TSYA 3WF4A 3W74A 4PB4A 1ISZA 1R2RA 3P82A 4DM2A 2C19A 3DXIA 2V3EA 1XLLA 1KNWA 4JTSA 4LT9A 3C0SA 3OTRA 2J7DA 4ZL1A 3WO8A 4IICA 6TAAA 4Y9AA 4ZE5A 1JZ5A 3LCIA 3G1DA 3OG3A 3BCDA 1HIZA 1DJIA 2E3ZA 2OWCA 4CQ9A 2I9EA 3QZEA 4Z1CA 2XJ7A 4QISA 1DIEA 3SURA 1PTAA 1WDSA 4YPJA 2CFFA 2Y1HA 2UY4A 2NW0A 1PX3A 3BGJA 4YWIA 3U4AA 5C9WA 2OCZA 2GVYA 2B31A 2H9AB 3VNLA 3WLRA 3BWWA 3IRDA 5FEXA 2E09A 1LT7A 1E9IA 1XG3A 2ZRWA 4U28A 3VCNA 2BOEX 1E72M 2FMOA 4B3LA 5K2ZA 8A3HA 1DJWA 4O16A 3WMSA 2X42A 2CHRA 1VBJA 1BEUA 4Q8NA 3T8LA 1UR0A 3GB6A 2DT0A 3MDUA 1ZBWA 3EOOA 3NEVA 4XUGA 5FIPA 4XKYB 3LTSA 1MXGA 3GDLA 5GNYA 1BD0A 2QJHA 4AVNA 1PTDA 2C3ZA 4FSAA 3W71A 1UYQA 3NQ6A 4W7UA 2C1GA 1H7OA 1L6GA 4FF5A 3SSJA 5F1VA 1A4MA 1TA3A 4BJHA 4DNMA 1XIJA 3TQ0A 2DZVA 1JF6A 2X30A 4KEZA 4EF9A 3PP7A 5DFAA 4HZ6A 2HVOA 2XISA 3MI6A 2PDHA 1EC7A 1GZJA 2VYOA 1C93A 3UJEA 7PTDA 2GQ8A 1QRQA 1RSCA 3TJXA 2VFDA 3CUXA 3SRHA 3BAIA 3TYDA 1IEQA 1GEQA 1Q6QA 2CBJA 1EOKA 3SSZA 4Q3MA 3C2YA 5ABFA 4S3GA 1JFXA 3SCOA 3C0LA 3ITXA 2Y4SA 3W7IA 5F4WA 1IYXA 3IJ7A 4L1GA 3U9IA 3L4YA 3ZLFA 1HKKA 4BFAA 2Z0IA 3L65A 4HSHA 2RDXA 3VPLA 3VO0A 3NA8A 2OZ8A 3AYTA 3GTXA 4IISA 1EXBA 3N14A 3N2XA 2D1ZA 3PBMA 4NNBA 1NDVA 4GCAA 4PMOA 1G69A 1RD5A 3RR1A 3VAVA 5A6BA 1EPXA 2ATSA 4NJIA 4HOZA 4MNLA 4N4QA 1O94A 3LZ3A 4LYRA 5HQLA 1YTDA 1W1VA 4ZOEA 3QY6A 4K7VA 4AHQA 4RW3A 3BAXA 4HU8A 3CIXA 3OZPA 1HKMA 2BHUA 3RRAA 2BS9A 3FEQA 3G8RA 1E6QM 2AKZA 5JMUA 1NQ6A 3W02A 1F3WA 4N7QA 4X9YA 3MI3A 1CWYA 5ECVA 4XAYA 3W4RA 1GYMA 4Z42C 4IFKA 3W75A 3LENA 5BYWA 1Z6KA 3OLGA 4WUIA 4YXGA 3WEZA 1YX1A 3DEQA 3TWBA 4HNUA 1OC7A 4DPPA 2J88A 4IMCA 3H2NA 2YSWA 2QQ6A 1UUOA 3VKBA 3BPWA 2XSAA 5C54A 4L7ZA 4UR9A 3S6DA 4GZEA 1LF1A 3NSNA 3PPGA 4EPEC 3SJNA 1EJSC 1OY0A 3GAKA 3O8AA 3BG3A 4W7WA 3ARXA 3Q4DA 5FEPA 2PDJA 2YA2A 1TPEA 2E28A 5AC4A 4XSMA 1LYXA 1NVMA 2W91A 3NFUA 5K3VA 4N6FA 3CQKA 4ZVJA 4LUJA 3KM8A 4ZTXA 4JTHA 3M5ZA 1R9ZA 3FJ6A 3VIPA 1VEMA 2JEPA 3K1GA 3OA3A 1K03A 3BQ6A 4PBGA 3MWAA 4CVWA 1QI3A 3CHFA 4C6FA 1SFLA 5CPNA 4FOJA 1TSIA 4RE2A 4W87A 1YYAA 3RLHA 3QH2A 2OZ3A 4ERAA 2HS8A 3R12A 4PTMA 4H8VA 1OVDA 3VCCA 1CXIA 4EIVA 2YL5A 1B1YA 1J18A 5DY2A 3R0KA 3ARRA 1QW7A 4YTUA 1JPIA 1W0MA 4NNAA 1CTNA 1XH1A 2OWWA 4AZCB 3QW3A 1KCXA 3DBNA 3KBVA 1HVQA 3U2OA 4WJEA 4QIUA 4LYPA 1US0A 1EXPA 5HINA 3KBMA 2XH7A 1H7WA 4M8UA 2NXIA 2QNEA 4GRSA 4F79A 1WB0A 3SUUA 5E1QA 1UMYA 4NSBA 1Q13A 2ALDA 2ZA1A 3O6DA 2PD9A 3ATZA 4AYGA 1VPYA 5D2TA 4H00A 1G67A 1GPFA 5IDZA 3NVDA 4MJZA 1I2PA 1Q66A 3MVTA 1CXLA 5DO8A 1H7RA 2VWSA 2DUZA 2F6UA 3CPUA 4F2BA 3VX0A 5E0KA 1JZ4A 1KM2A 1IT7A 1ELSA 3SADA 3S46A 3GLCA 3FJ4A 3LEPA 4HCDA 2GJNA 3CB8A 3U48A 3DH7A 4O52A 5F7UA 3GU2A 3KHJA 1GQJA 4D9PA 1JQXA 4HNCA 5CPOA 3QPZA 2XM1A 1V02A 3CUFA 3QQ0A 2E6FA 2NUXA 3GAYA 3MVIA 3K8MA 2P88A 4GIEA 3V18A 1YPIA 3GDMA 5A6AA 3RHGA 1C8QA 1D8CA 1N8FA 4ZO8A 2AGTA 3P8IA 1CT5A 2RHGA 3EWYA 1UIOA 4O13A 1GVOA 4E8CA 1LJYA 1EO7A 3T0CA 4NJGA 1YRRA 3NEHA 2OLSA 4G7EA 1S1RA 2QHAA 3EXRA 4CNPA 2NV2A 3L4XA 2OSWA 4NI8A 3QV6A 4AEOA 1OT1A 3URQA 3SRDA 3OBKA 4QE1A 1JPMA 3JR2A 3TYZA 4WXZA 1HP4A 1GW9A 4H83A 3BJFA 2V38A 3UA4A 3P2VA 2JK2A 2I14A 1EYWA 3BAWA 4B4FA 2VFFA 2CHOA 4DO7A 4KEVA 3S5YA 4Y9PA 3U2CA 3KDOA 3VUSA 1IT8A 4F40A 1FWNA 2ODOA 3DHPA 3EX2A 4B5VA 4QGCA 3N34A 3SCRA 2FVLA 1C8YA 4NKCA 2WBGA 3UWUA 2WJZA 1A49A 1JPHA 2QW5A 3K1DA 3V4BA 1P5BA 4DLFA 3IEBA 1F7BA 3PWIA 9CGTA 2OKOA 2BMBA 2WMKA 1HP5A 3CB3A 5FAJA 4MJ2A 1F74A 3ZT7A 2A79A 5T26A 3SCPA 3HGJA 4URIA 2J62A 3NQFA 3ZR6A 3S5SA 2RH9A 3WENA 3LA4A 4NYYA 1TPC1 3P81A 3AHXA 4O1BA 3HN3A 3WNMA 4IMGA 1CNVA 2WV8A 3VD7A 4ACZB 4W93A 1ZJBA 1GWJA 3A3WA 4KGLA 1I2QA 2XVKA 4TVUA 2C91A 1QO2A 2HPMA 1TZZA 1WV2A 5LNRA 3WEOA 3SGUA 2BFGA 4HD5A 3LI1A 1N8WA 1WKDA 2CLFA 2PC8A 5BWFA 1VFTA 5AVHA 4HN8A 2HCVA 4JTEA 3AS0A 1BWLA 2HMCA 3NAVA 3LBOA 3TP4A 3WK0A 4I7WA 1J0YA 3TYUA 1MDLA 4UIOA 4J4KA 1KBJA 3AIBA 4OE7A 1B2YA 2DZWA 1GYLA 2NT0A 3WF3A 5E6YA 1AFSA 3T44A 1RPKA 1B4EA 3OZMA 1VAHA 5BRQA 1H1YA 3LK6A 1QU4A 4J40A 4RW5A 2WSPA 5T9CE 1GVEA 1JDDA 2AQOA 3IUHA 2DW7A 2PURA 1IT0A 2VOMA 1VFOA 5AC5A 4IMAA 2XYLA 3U5YA 1HKWA 3S2JA 1CCWB 4AWSA 1O66A 4YIWA 2PU1A 1M7XA 5DXYA 1FCVA 3AAMA 3TWAA 4F0RA 3O16A 2V82A 1E55A 4MB1A 4AF0A 3PTMA 4PUEA 1GOOA 1RY0A 1C90A 3A47A 3SUWA 2X1RA 3B03A 3HZ3A 3MDWA 1LORA 3RAOA 1R7AA 2V0TA 2YL9A 4XVDA 4D6GA 2B4GA 1Q5MA 3GIYA 3PZMA 3BC9A 2YDRA 1XRSA 1JAEA 4IMDA 3OVGA 3LSCA 1ODUA 4Y9NA 1UR3M 3CPRA 2DY3A 3KTSA 4XZ9A 5A6MA 5BXSA 2J77A 4IMEA 7REQA 2ZOXA 1PKNA 1M1BA 3ALFA 1J12A 3UFYA 4U33A 3MW7A 1NOUA 3WQGA 4GUFA 4WK9A 1RA5A 3GNPA 4AWUA 2PDIA 1OJXA 4M3PA 1KTBA 3EOEA 4L4MA 9RUBA 2DH2A 1KTCA 2ATMA 3VD9A 2ZBTA 5BROA 4PMQA 4WDXA 1H7NA 2IQDA 3R0DA 3VE9A 2ADAA 3VNIA 3OQ8A 4U2YA 3APGA 4OIFA 3LPGA 4JQ4A 3TDFA 1KBKA 2H6RA 2PPGA 4P8UA 1QXLA 1LLZA 3NNTA 3VMNA 4L80A 1WDPA 4HZ7A 1K77A 2BVWA 3NWRA 1FKWA 1ZLPA 3AQUA 3WN6A 5FJIA 1ZL1A 4DPQA 3BLOA 1W8SA 2D2OA 2DZXA 2E8YA 1QDSA 2J7FA 3W86A 4ZO7A 4GHRA 4IGMA 1DXIA 1RQBA 3FKRA 1AMYA 3GW0A 1RVKA 2J75A 3QPEA 3TR9A 2PRHA 1C3FA 1O7AA 4MSSA 4AX7A 3FNDA 2AKMA 2QV4A 4MZYA 2D22A 3DG6A 3L68A 4C1NA 3W7RA 4L4PA 2X0YA 3TONA 4A2SA 3K5XA 4XG1A 4H19A 3EX6A 3MSDA 3RX2A 1SMDA 1AH0A 4G2DA 1QNRA 4LCSA 1EJVC 4XBKA 1THFD 1FWWA 3AU6A 1F4AA 3R4IA 2HS6A 3VIIA 1Q6GA 1BTCA 5K4ZA 3SQMA 3N73A 1J2WA 3GH5A 2CYGA 3NURA 3DYOA 3N4AA 1WA3A 4DBWA 1JUKA 1W17A 5I3GA 1QK2A 3GNRA 4MY9A 4C1LA 4D6JA 2RGLA 4C6KA 3W1MA 1RCQA 1WXYA 3DOPA 3ARQA 3G1SA 3OLEA 3SY8A 2VHLA 4C5YA 5C5YA 3VKKA 4HHHA 1D8WA 3DX5A 3WJXA 3FOKA 4WKFA 2BB0A 1LDCA 1BQGA 1XSKA 4QROA 1DEDA 3K4AA 2GUUA 3NQ8A 4JFWA 2V5KA 1FVPA 3THAA 3CZKA 1ZZMA 3C0JA 4EPKA 5MHBA 3W1PA 4F4RA 3W82A 4HIBA 1XGEA 1TZ7A 4CD4A 2DFAA 4RKAA 3BJSA 2YCJA 5FA5A 1VJSA 3FJNA 4L6OA 1FUYA 2YXXA 1TWZA 3JU2A 3EKLA 1LUCA 2GYIA 4S3JA 3FGCB 5CBIA 2E25A 4PTNA 1K7XA 1NH6A 4YLWA 2BHYA 1X7IA 1SW3A 3R89A 3AXXA 5CC7A 1FCQA 3MHFA 3BSMA 4QCFA 2RDTA 3ZR4A 1E0VA 4LBRA 2QPSA 6ENLA 4GH1A 4IP7A 1VEPA 4CQBA 2FJKA 2VFIA 2IW0A 4MADA 4DYKA 2ZZ5A 4DJDC 5I7GA 1P1MA 3TUUA 3ZZ1A 1CW2A 2PWHA 1OCQA 1FWAC 2TODA 2I5IA 2V3DA 1H60A 3H23A 2XH4A 3AWNA 5CPLA 2WWDA 4LYQA 4TUFA 5FAGA 1UKTA 4QX4A 3NCOA 5KSWA 4Q4KA 1FH9A 4R3UA 2E4TA 4K36A 4QG8A 4L6DA 2MNRA 2XSXA 3TXZA 3KE0A 4C90A 1QNQA 4HNLA 3LZ5A 5A6BD 1OYCA 1FWGC 2WNQA 1BTMA 1JPDX 1R87A 3DENA 5EMJA 1SU5A 4QNEA 1GOXA 2H3DA 1CLXA 5AHMA 3TV8A 4ML4A 3W7DA 2UWFA 3ZQ9A 3WQ8A 3QMSA 2VI0A 3WH7A 2RUSA 1W6TA 4XZMX 3QR0A 4RUBA 1FWEC 4HCLA 1RK5A 4AWEA 5BOOA 2VKZG 2I56A 2WM0A 4N0RA 1K8XA 4FNQA 1UUMA 4EXQA 4JTLA 4AQLA 3WLKX 1DV7A 1XKYA 4FLSA 4QRNA 3IGXA 1BHGA 3PTQA 5EU9A 1OQFA 3AXMA 4JQ1A 3VGEA 3FVDA 3W22A 3BCJA 2R94A 3W1RA 2ONEA 1SQ7A 4RDZA 3QV9A 2J7EA 1DIDA 6ALDA 3ITLA 1ZBKA 3QOKA 5E09A 2INFA 2V5LA 4JXCA 3VMPA 3FDGA 4MYAA 1B9ZA 2WJDA 1K6WA 1UKSA 2DSVA 4US5D 3CXOA 4UZUA 2ISFA 2Z1XA 2J79A 4M6UA 2AGKA 2O4MA 1RUSA 5D8WA 1WBJA 3SQSA 3CZLA 2E1DA 2HE5A 2VRQA 1EDQA 3H70A 1P48A 1FP9A 2V63A 3W29A 2W9MA 2V5JA 5A94A 1VFHA 4E3TA 1W9VA 4L9XA 2W92A 4M7TA 2FHFA 3SQLA 4JYDA 3C61A 4CGTA 4YTRA 3USBA 2A3LA 1V77A 5G4EA 4DYJA 2HNEA 3UXDA 4CNTA 3WL0A 2CW6A 3VUPA 2Z00A 2FGBA 3G18A 3WQDA 4O0QA 3UETA 5D09A 1KC7A 1LOLA 3PJUA 2YFOA 1W31A 4RDYA 3BOLA 1LQ2A 2QJGA 1GVIA 1VD6A 4Q4MA 2PE4A 3HB9A 1VLWA 2OT0A 4IP5A 2WC7A 3G5EA 4TMBA 1W1YA 2FZMA 5FCZA 5D9PA 1IXOA 3TQKA 1GVSA 5CSYA 3RILA 1OYBA 1BAGA 1ZB5A 4RPPA 2I9UA 2WNNA 1NY1A 4A8NA 1EUNA 3WQPA 2P53A 2PODA 3UZWA 1FXPA 5JIPA 3KVMA 2PGRA 2PCEA 4AIUA 2A2IA 1NWTA 4S3BA 3A5VA 2VR4A 4LB4A 3GHTA 5L6UA 1RLCL 1MEHA 1TMQA 4AEFA 3W1LA 1FH8A 3KUMA 4NILA 2BOGX 5LXXA 1X8CA 2WZHA 2ASHA 1UC4A 4JX6A 4NZ1A 5IM51 4CNOA 3ITGA 5KZ6A 4AD4A 3ICJA 3SBFA 4J3UA 5H8UA 3UR8A 4Q32A 4RE0A 1X6NA 3UJ2A 3KZSA 3HU7A 3WFZA 1QT1A 3OGVA 2MUCA 3W7LA 2CESA 3FSUA 1SJAA 3QY7A 2WMJA 4NASA 4F3HA 2JFEX 4UMCA 3GSMA 3N25A 4MM1A 5CLTA 4I8YA 3GNXA 3M0LA 2Y85A 1OC6A 3E0IA 1NWSA 3CWHA 4PUUA 2PGEA 1M04A 2IXUA 2QCGA 4Y96A 2WVVB 3GXPA 1JF5A 8TIMA 3D5HA 4AG0A 3WMCA 1LBLA 3QLLA 3WDRA 4ZB0A 4AD1A 1G94A 1LRTA 1U1UA 2BXVA 1EP3A 2GLKA 4JEQA 3BLFA 4DVOA 5C9ZA 4I5UA 4JIRA 3NG3A 4NAFA 5AHIA 3CUHA 3UCQA 5G2IA 3E2SA 2XN0A 3W38A 3RLUA 3KAOA 1GORA 2ZXAA 1X6LA 1AG1O 2ZRUA 2E67A 1L6FA 4HNNA 3CMGA 1RQEA 1OFPA 3V35A 4FALA 1G7UA 1EFZA 1F6YA 1TTPA 1TVLA 1S2CA 1GGOA 6XIAA 1SPQA 4UC5A 5HPCA 4NRSA 2HWGA 3I7RA 4NHVA 2XZ9A 4M81A 1J93A 2WZEA 2XG9A 1P1XA 3U5UA 4LUSA 4ZOCA 2I7GA 3M0IA 4DXXA 2Y8UA 2WW5A 4XO6A 1AW1A 1SJBA 3G6MA 1NU5A 4R9XA 3VZXA 3E9AA 1X8FA 1IEWA 2Y62A 1QK0A 1S5NA 2WCGA 1ZENA 3VOGA 3RXZA 3H55A 2ISSA 3VKJA 1W9DM 3EDJA 4U10A 3FW6A 1GHRA 3APYA 3TAKA 4IGSA 3N2OA 3L4ZA 3ZJ7A 2C8NA 4DN1A 2IPFA 2P1FA 3M5XA 4JOMA 1YQ2A 3CMFA 4DBDA 2PWEA 3NXFA 3ZWSA 1CPUA 4K6AA 4JTGA 1UD4A 3PULA 4GQ0A 1Z69A 4EF8A 4N42A 1T41A 1DJZA 4L5ZA 3STFA 4G8TA 3L5MA 4S2BA 3W07A 2DZBA 2Z1VA 4H4IA 5REQA 4P8XA 3UY7A 3T1GA 1CB2A 5CJNA 3CQ0A 3WMBA 1JUBA 3V3WA 4GVGA 1AZ1A 2HVMA 1QPNA 2GJXA 3QQWA 4AHOA 3RPMA 1XLIA 1GKPA 1NARA 1IEIA 2J6XA 3MSGA 1ZJAA 3PAOA 3LLDA 4MLJA 2B7OA 3L2LA 2NX3A 5HMFA 3P61A 4O8AA 5HA7A 4GWEA 4FLOA 3BAKA 1XLFA 1JYXA 4IL2A 4GUJA 2ZUSA 2PLCA 3W84A 2Z1BA 3EWCA 1RBLA 5CCZA 3QLDA 1XD0A 1J0KA 3LHWA 1H5VA 1NTHA 1KR0A 3KW3A 3ARZA 4JTRA 3IIXA 4JBRA 1VPXA 5HULA 5L9FA 1RJRA 1SZRA 3T0TA 1E0WA 4PMJA 1O5XA 4BI6A 2GUBA 3AJXA 3PPFA 4FNPA 4Q7NA 1KWKA 2NQ9A 3KRBA 3V1PA 3QBUA 2CWXA 3S47A 4PL1A 4GXMA 5JVLA 2NXHA 2GVGA 3PZQA 5HXMA 3F2BA 3I68A 2BBFA 1DJQA 1BLIA 1I0BA 2XVPA 3ZIZA 5FL1A 4K8EA 3PPHA 3UWZA 3G8EA 4PMVA 2GGHA 1J0HA 4MWAD 2BXZA 3WNPA 1AQ0A 2QGHA 5CJMA 1FH7A 5JXQA 2WKJA 1LCOA 4V28A 4NZ3A 2Y7EA 4YU1A 3TYAA 4JS3A 2FTPA 5DT7A 4D72A 4LYKA 1YDYA 1W5OA 3FAWA 4RL3A 3IV3A 1ZP3A 4DELA 1S2AA 4ZXOA 1XDMA 3MQTA 1P0EA 2D2HA 4PUNA 2NV1A 4DBSA 1F6KA 3BLLA 4H6RA 1UD2A 1HFBA 4BK9A 2PP1A 3W7HA 3OU8A 3FVMA 1B90A 2YOCA 5JBEA 2HXUA 2EKCA 1KR1A 4GVHA 1PVNA 3N04A 6TIMA 2IPGA 1XQKA 1QHZA 1UJQA 2FIQA 1UBSA 2P0IA 2OO0A 5LGZA 4ES4A 4NVTA 3K4DA 5DT5A 1GUVA 2MANA 4I9AA 4J3XA 3E0LA 4OGZA 2DW6A 3M07A 4HU3A 1IXNA 4KEUA 1H49A 5C7HA 5I5RA 5AYIA 1GZ1A 2XN2A 4PRWA 3MJMA 2VFGA 1WXJA 3CT7A 1AD1A 3VMOA 2CKSA 2XH2A 3IS4A 3MYOA 3N3MA 2BVYA 1ITUA 3BSHA 3C56A 2BOFX 3KRUA 4O0KA 1KTNA 2YBVA 3P3BA 4UCFA 4Q4QA 3D3FA 1LRNA 1MNZA 2ZUNA 3DFOA 5LA0A 1I1WA 3PWAA 4CCZA 4ZQPA 3F1QA 5I3JA 2QF8A 4NT0A 3RG6A 4B5SA 3GYCA 5I77A 1L6WA 2WSYA 3MS8A 4UTHA 2E9MA 4X63A 3DFQA 3LUTA 4Q33A 1LT8A 4U2ZA 5C55A 3BH4A 3S1UA 2IPJA 1W1TA 5FJTA 1AA1B 3P7YA 4DUOA 3C2OA 3NDOA 2PDCA 4PN2A 3S2LA 3W2KA 3KCLA 4PA8A 4DZ5A 5BXPA 4L64A 1JYNA 2PWUA 4EX4A 3FK4A 3P6LA 2VUYA 3U7BA 1JI1A 2Z2AA 1KM6A 3OVRA 1UKPA 1UQZA 5DXXA 1V4YA 4MAVA 2QEZA 2E9BA 1I0DA 3WF2A 1PX4A 3D47A 4GI8A 5DRIA 1V0KA 3ABQA 1FHLA 5C0QA 4S3AA 2D73A 1W1IE 4XAZA 4HA3A 2IS7A 1SR0A 4ZENA 4FLRA 2PDUA 4O19A 1ZHAA 1ZGDA 1OFAA 1S2TA 4EWJA 1EDTA 4GI4A 1R3VA 3F4WA 4L4LA 4DYEA 3IACA 3I3BA 2OXNA 5AOUA 2ZWZA 2ZX6A 3DHFA 3VIJA 4A3YA 3S0CA 4IIGA 2EEXA 1E6ZA 4GVIA 2WMFA 1OZMA 2ACRA 5A8PA 3QTPA 3CLWA 4UOZA 3QC0A 4DEFA 3BICA 1XBZA 2VEPA 2WSRA 1UR2A 5GNZA 3VA8A 1YBQA 3G77A 4HYRA 3P74A 2VD9A 4WX2A 4PUDA 2HK1A 3STEA 4IPPA 4OT7A 4H2HA 3ZSTA 5T91A 4IQJA 3FY1A 2A0NA 3GVGA 1M7OA 3MC5A 1CECA 3RK8A 1JCTA 3VCRA 4AIBA 2VEFA 1X7FA 4KRTA 3EA1A 1JL8A 1HJXA 3CM4A 2G95A 3TTSA 2DQXA 3W28A 4UWMA 1AMKA 1LBFA 3IUIA 1XICA 4E6MA 1S2UA 4PTXA 3TEVA 4Z2IA 3KOFA 2QCDB 4AZ7A 1TTQA 3T4CA 4DZAA 2OLAA 2REQB 3MP4A 4ZQNA 4ZO6A 1DWJM 4JN7A 3E0FA 1HG3A 5CC5A 1PHWA 2E7FA 4JEJA 3QKZA 3BOXA 3TQPA 3NJ3A 3WQEA 3H4WA 2X2YA 2F38A 2HRWA 1TPVA 2V3GA 3C2VA 5I09A 3BW3A 5BXTA 1W3IA 3THQA 3M1ZA 4IMFA 5EYWA 1BG9A 1DXEA 3TLLA 2WZTA 1QHOA 1PCKA 5G2HA 1PXGA 3CWOX 4ZB5A 2FZBA 4YMZA 1ZQ5A 2PTWA 4MNMA 4AD5A 1VFLA 4KFPA 3L4UA 1QPOA 1WUEA 1OD8A 1G4PA 5U4NA 2OX1A 4HZMA 1UC5A 3MMTA 4E2OA 1OCJA 4JTKA 2W67A 3ECQA 3ABOA 1M01A 4DO6A 3GTFA 1FFRA 4Q4PA 1DORA 4GX8A 3L4VA 4UNIA 4DWDA 3U57A 1TV5A 4LCQA 2VGBA 3MKCA 1TV3A 4H7ZA 3PZVA 4FZIA 2C16A 3LY0A 3QHNA 5JH2A 3S42A 3QC3A 3AIWA 2CZFA 5I3KA 2HV5A 1CZ1A 3GHUA 3LX9A 4WVXA 4JL1A 1UW9A 3HQNA 4IUGA 1SZGA 4FNUA 4XAGA 4FLQA 4LW7A 4LH8A 5FF4A 3AYRA 4GABA 1H09A 3E5PA 1UWQA 2XTKA 2YPIA 3UWVA 5A6SA 3W27A 1YNQA 3V7PA 1TRDA 3SZ8A 4W5ZA 2DQWA 3P8JA 5DLCA 1Y5WA 1XHGA 4ZXLA 1MMFA 4S3KA 3DGBA 4WY0A 4IP4A 1PZ0A 1TA3B 5DANA 4AU0A 4QXIA 1WO2A 5KEZA 4YWSA 2CLIA 1TE1A 5D2XA 2PDYA 1W9BM 4Y7EA 1UASA 3R6IA 4UMAA 4RCXA 1QATA 3GK0A 8XIAA 3LNPA 5HDRA 1T6MA 4DXKA 1XIFA 3AS3A 4NL1A 3AHVA 1MFVA 1TUXA 2VCBA 4QJ5B 4P61A 2ZZ3A 4NF7A 4E4UA 4UTWC 2DIKA 3O3RA 4HVXA 4WCJA 2XVNA 4CU8A 3DG7A 2EPHA 3KHDA 3UA3A 1HF6A 1ZP4A 3N17A 2YYTA 3BLIA 3KOXA 4GPNA 3HJZA 4H9UA 2EG8A 2J8TA 5ABFB 2BY1A 2XFWA 1XGDA 3FXYA 3PFMA 4MWAC 4A3UA 1L8NA 3MHGA 4GGHA 2NLIA 5CZTA 1OG6A 2VZUA 4BF5A 2Y8KA 4AY7A 3WFLA 3ARYA 4GH3A 1J0JA 3ZJKA 3BURA 1J96A 1RH9A 1IZCA 1A5NC 1R2SA 4MKVA 3TZNA 4IIDA 5I3IA 1DHKA 1MW0A 4CD6A 5LIYX 1TV8A 1UPMB 2ZICA 3U2ZA 4JR5A 3ITVA 2QDGA 3HPSA 3FLUA 5CGQA 4XAFA 3CTLA 1OIFA 3VABA 2FGLA 1AL8A 2Q8XA 2I57A 1Q3NA 4QFUA 3EOSA 4IUOA 1HZYA 4GOAA 5AC6A 5F2GA 5M2FX 5LIWX 1NELA 5DBUA 3GC5A 1XFBA 4ZO9A 1XBXA 2P3EA 4AMCA 4X22A 1O95A 3WD2A 1BGGA 3H2CA 1F3XA 1SFTA 4IFKB 1XUUA 4F9DA 1SZEA 3SB0A 4ICNA 1S39A 4QBXA 1ISXA 4IGNA 3DAQA 3FJLA 2GOKA 4ZFMA 4GD0A 5C2XA 4HCHA 3AXIA 3W7QA 2ZZ4A 4XKMA 2HBXA 1KFWA 3SIZA 2A3HA 3RLVA 2HQAA 3LERA 3LOTA 3WNOA 3NTYA 3MUZ1 2WJEA 3B05A 3ZLHA 2VX4A 2QCNA 4JHOA 5I03A 5BOFA 4ENLA 4KERA 1CI1A 3REQA 5BXRA 1BYCA 1U1JA 3KCJA 5LXEA 3E0VA 3W26A 1R38A 1EA0A 1R46A 2JKAA 1KRCC 3O07A 1U83A 4P7RA 1G0CA 1VJIA 4UTMA 3ANYA 2RGMA 1XC6A 3H12A 2JQXA 5I2UA 3PBGA 1Q8JA 1NEYA 4Q6XA 1YHTA 2PWGA 5XINA 1F05A 1LQAA 3I6RA 6A3HA 1WX0A 3R8RA 3GX9A 1NDWA 4X2RA 3G3DA 1IIHA 1UB3A 1QTWA 3WLLA 3S8HA 4U3AA 1UWSA 4I7VA 2INEA 1Y7VA 1AZ2A 4GYPC 1R3RA 3LRMA 2GDQA 2XIBA 4BQ5A 1UKOA 2I5GA 1MUMA 3MUIA 4M5PA 4LC6A 2TYSA 4HMEA 5F2LA 2QZRA 2J4GA 1P6CA 3MA8A 4ZA0A 1OX4A 3INPA 5BRPA 3B9AA 3OBEA 3OYXA 3EWUA 2VT0A 4PRTA 1CGUA 1JZ6A 2A1YA 1R9YA 2LLEA 2OWXA 2QT3A 3WNKA 4W7VA 3ZVHA 1JCYA 4UQCA 1P4CA 4MDPA 3CIWA 5DMYA 3CEPA 1ICSA 3K8LA 4XISA 4ZTYA 3MP3A 1A5MC 1TIWA 3CUJA 1S3TC 2O0TA 1H7XA 3H2AA 4ATLA 3CO4A 2X8RA 1EJ7L 4L56A 1TPUA 1K9EA 4KWUA 3B40A 1B3ZA 4GI9A 4S39A 2YXOA 4XQ6A 5FJJA 4UCGA 4GQRA 3N9KA 1G5AA 2OGJA 4HK6A 1XL9A 1E73M 4GUIA 5BMXA 2OMAA 2JKEA 1I9CB 4MKSA 3Q58A 3PNUA 1EPVA 5CBJA 1HO4A 2J9YA 4LS1A 4X2PA 4C1KA 4QQUA 4LCRA 1SUXA 3TC3A 3E5BA 3R5EA 3D0CA 4JKKA 3NZQA 4A35A 5HNRA 2H9AA 1LP6A 1XLDA 2Z7KA 1KM1A 2IQTA 3NSXA 2WHKA 5E93A 3VDGA 4JYFA 1MXDA 1LL7A 5CQ1A 3FIGA 4OVXA 1QNPA 4ADSA 4R7OA 4O54A 5HOSA 1GCYA 3F5KA 2HTMA 2J27A 3LG3A 4U5IA 3UG3A 1N2VA 3NQDA 2C71A 3TC7A 4A8RA 1F76A 1SO4A 1WP6A 2CKRA 2R6OA 2BLEA 4TXEA 4LY4A 3ARUA 1LL6A 1ZS2A 3C5QA 3UJRA 1DPMA 5G5IA 4XKYA 4Z2GA 1KGXA 3SCQA 3KCOA 2ALRA 1ZCCA 5AB3A 1TQXA 3WY1A 1Y8BA 3W87A 4M1BA 2X7WA 5I79A 4LQ1A 3AZTA 1YDNA 1JCLA 4GIAA 1TJPA 5AYYA 1HNYA 3R2GA 2DJXA 1M65A 5HK4A 3UD6A 3VZYA 1W2PA 2D3NA 5F2MA 4FOUA 1PDYA 1E0TA 1H50A 1XYBA 3GC2A 1BVNP 3TIMA 1W37A 1F61A 3TTQA 1W3LA 3BAJA 3GWQA 5BWAA 3V5OA 1ML1A 1VBRA 1TWWA 4GYJA 3CT2A 3B0PA 1JCJA 2ISDA 1LWIA 3TNBA 2V5BA 2OJPA 1TELA 4J35A 3DKJA 2GQAA 4R5EA 1SVDA 4DUVA 4QS6A 3TN6A 5CBBA 3AROA 4YYFA 3DFHA 4MY1A 1F8MA 4I9TA 5BRBA 4RDWA 2GQ3A 4X0VA 4LVGA 2Y24A 1PBGA 4C6EA 1FKXA 2DH3A 3OA5A 2FH8A 4GQBA 1TRIA 1TKKA 4US6A 4HA1A 4GISA 4YVXA 1UR4A 1M68A 4YS1A 4JICA 5BMWA 3GDRA 1UA3A 1KBBA 4LAKA 2XIQA 2BP1A 4PL2A 4HNTA 3ITOA 3UNTA 2BY0A 1JDCA 1A5AA 1G4EA 5C71A 4U4MA 5ECUA 3QOMA 4U31A 1UOZA 1GJUA 1TPDA 3ZFHA 5ABHA 5AHNA 2OG9A 1AQHA 3KOWA 1IXPA 4K1GA 4IQEA 3RNDA 1YMYA 4ADTA 1GKRA 1A5SA 5GNXA 3WQWA 4JTTA 4LSBA 2BGQA 2FZNA 2V2HA 2J7HA 4NJKA 2ZVRA 2WHMA 2OOFA 5RUBA 5A8NA 2OKTA 2QCLA 4R7WA 4IG2B 4CQ8A 3NYDA 1EQCA 3S4TA 2FDSA 4AF0B 1WBHA 3G1HA 4ATDA 1E9LA 3NYZA 3CK5A 2EAWA 3RPDA 3IIVA 1KW1A 2WLYA 3TSDA 3KS6A 5IBXC 2HK0A 4A6GA 3MUAA 1BSLA 1F4HA 3WK3A 2OSYA 4UFLA 4B92A 2JE8A 5CPSA 4M19A 1EL3A 5D9NA 3UW6A 4FS9A 2Y89A 3WLHA 2V2DA 3CH0A 4KMQA 2DVXA 3LHVA 3C8NA 3CMJA 1OX6A 2AQWA 2VRJA 1KM5A 2Z2BA 1Q6EA 5FD0A 3VNKA 1TR9A 7REQB 3P5YA 2ZUWA 3MY9A 4UQEA 3W1TA 3IGUA 2PZNA 2Y88A 1M53A 3W53A 3NIYA 3LHYA 4CQDA 1E6PA 1NDYA 5CG7A 2VZSA 4HK5A 1ISYA 2VO5A 4J3VA 1W5PA 2WHJA 3MO7A 4DUWA 2ZZ1A 2EKGA 1FP8A 3NM3A 4HJFA 4O0ZA 2ZRXA 4REQA 4EOUA 4RDVA 1QBAA 3O6YX 3DC8A 4J5NA 3GO2A 2POZA 2TMDA 2YIHA 3N6JA 3WMLA 4HA0A 2IKIA 5DX7A 3EXSA 3EA2A 2C1IA 3WDJA 4PZVA 4ZOBA 4DJDA 4LVBA 1O5QA 1NOWA 2Y5JA 1FWCC 2OEKA 3R43A 2VTFA 3FX4A 4UMBA 2D0HA 3VVGA 1DVJA 1FHUA 2F9RA 2FB2A 1KQYA 2DZPA 2OSXA 3I6EA 4C1NB 3UBPC 4IJCA 2NUWA 1C9DA 1RVGA 2C13A 5CSSA 2QXWA 2DVTA 4AZCA 4JNMA 4JFVA 2FTYA 1QOQA 3KX6A 4PC8A 3R0UA 4DM1A 3ARWA 1OFBA 5LNSA 3IJQA 4N9CA 3UY8A 2ANUA 2FHCA 4GVFA 2I1OA 4JTJA 3WUGA 1UHVA 1E0UA 1GOIA 5HJXA 4CD8A 4MWAE 5G1MA 4MPQA 4NAEB 5I78A 1LWJA 1R3QA 2WAGA 3NO5A 4A3HA 4Z2HA 4Q8UA 4C7FA 3EB3A 1UZHA 1OFEA 1JXKA 4JIEA 1S1PA 1IGWA 1SFSA 3ZMRA 3CHVA 5CSUA 1KFLA 4AZ5A 4QNWA 4JN6A 3M0HA 1S5VA 3II1A 2QKFA 3N11A 2OZ0A 1FFQA 1BQCA 1HKVA 1V6XA 2Z29A 1X96A 1EWDA 2QCHA 3N2MA 2YJQA 1X1OA 3CHDA 4KBXA 4L1WA 3CZEA 4ZR8A 5T9BG 4A05A 4ZSUA 3M16A 1BGAA 1OD0A 3HM7A 3A22A 1KCZA 3ARVA 3B8IA 3CGTA 3BG9A 2QIIA 4M6PA 5E5CA 3WSUA 1XWYA 2A4AA 4S3DA 3TTOA 2PDWA 2VCCA 1G4TA 4C60A 2WPBA 2CETA 3S2MA 4E8GA 2AL1A 1SJDA 4BEUA 4E8DA 1GW1A 2NQHA 2Z1KA 2WBKA 5FF3A 1XLJA 3N19B 3PF3A 4XTIA 2R14A 2WHLA 3KVJA 1I8JA 2PZ0A 3PHAA 1UP2A 1LRQA 4HZ8A 1ZAJA 2WQDA 4TX9A 2JF6A 4F0SA 3A3XA 1V3HA 2JIWA 2VEGA 4D8ZA 4IX0A 3VINA 1P7TB 4FAMA 1B30A 3DECA 3VOIA 2B7QA 1L0PA 3TJIA 2JF7A 2YDAA 3HPFA 4E2VA 3HV8A 2NUYA 4LBSA 4IPJA 1RJPA 1IZJA 4FX7A 3EXTA 4GIRA 4D2JA 5LKYA 1DQWA 3PG9A 5H91A 2GPTA 2DZTA 5H1WA 4E3VA 1YNPA 3MU7A 3A4WA 2VM8A 1SZFA 3H2EA 1NOFA 2A6NA 3GDBA 2BGSA 2O4QA 3RX3A 3WUFA 4IXHA 3FSTA 3UWEA 2GGGA 4A4AA 4NG3A 1CBGA 3PY2A 2A7NA 2CLOA 4MFEA 3PNZA 4NUWA 1R3WA 4UR8A 1A5UA 4MLRA 1BYAA 2G50A 2PBGA 1KXTA 1UWTA 5FEZA 3ZYZA 1YDVA 3THCA 3DBPA 2PTZA 4ACZA 3GVQA 4AD2A 1QW9A 3AYVA 1IR2A 2NT1A 1PKYA 1TO3A 4K7YA 1V7AA 4UTTC 4DNHA 1EZWA 3LM7A 3SFWA 3A4XA 3EWBX 5CPQA 2GK1B 2PI6A 1B3YA 3TMQA 3NQAA 3TW9A 1DJXA 3NQGA 1QWKA 1TJRA 1FWSA 1EYEA 5FJRA 5EFFA 3S1VA 2GDUA 3ISIX 3ZOAA 3WKZA 3HG3A 3P5ZA 1TX2A 3WQFA 4G9PA 1ME9A 1E3ZA 2VVNA 3HQOA 4JTUA 4MB3A 2QR6A 2YR1A 3BMWA 4QLKA 5I24A 5A6TC 2C79A 4GFIA 3LDVA 1RPXA 1VEOA 1US2A 3PR2A 5A5WA 3B8WA 2Y7DA 5KMYA 1U22A 3S9YA 3M0KA 4AVFA 1V3LA 2YLLA 3TTYA 1YTKA 2W27A 3RMJA 1XCWA 4RE3A 2HDJA 1MWOA 2XM2A 4BCEA 3V5CA 3EMCA 3IARA 3OEXA 3N2CA 3C3UA 2XHYA 1ZTVA 5G4WA 4S38A 3UR5A 1VYSX 3KRSA 2DPEA 5EMMA 3WBXA 4NRRA 3WUEA 4N6EA 4BZYA 1QR7A 3O0FA 3T7VA 4IIBA 2CZ5A 4FHAA 5FJPA 4YL2A 4C91A 2I17A 4CNUA 1ISVA 1T5AA 2J13A 3L67A 4HPJA 1Z8AA 1VP5A 1EP1A 2V81A 3EOUA 3BJTA 5FF7A 3KOZA 5F4SA 3OHIA 2TRSA 3IANA 3CNYA 3V0TA 3GH4A 2RAGA 1FBAA 1XW8A 1HKJA 2JBMA 4MNKA 2OEJA 2QLYA 4H01A 3UXAA 4Q7BA 3W7KA 4ZGYA 2PDMA 3FV9A 4NP7A 1A50A 2VMFA 4ROPA 1H63A 3B9OA 1MRQA 1DJYA 3WLIA 3G22A 3NZ1A 4DF0A 3FA3A 3H2FA 4WKAA 3H7VA 1QMLA 1VPQA 2PDGA 1K3UA 3BLPX 1Y5VA 1NAL1 5KZDA 1A53A 1ME8A 1Q6DA 2Z6JA 1CGYA 3B8SA 3BMXA 3UVAA 3NM1A 4W84A 4Y8EA 6REQA 3K4WA 2ZFAA 3VYLA 3W7PA 5H2ZA 3GNOA 2Q3OA 3QSTA 3R7MA 1OK6A 3HIJA 2B81A 4DX3A 4EXBA 4JX4A 5FI8A 2VWTA 2F2HA 1KFJA 3VFCA 1LOQA 3SW6A 2PP3A 3WJWA 4LUIA 1AK5A 2PDQA 4K8HA 4A8LA 1V79A 2JEQA 3UCDA 1GNXA 4ECLA 1WKYA 2ZRVA 3L9CA 2O92A 2X1TA 5EMYA 2ZUMA 3B4YA 1QWGA 1KKOA 2A7RA 1EX1A 5GJNA 1BYDA 1JRCA 4XZNX 4JCMA 5AY7A 4F0HA 2HNHA 1YW1A 1BWVA 1TPWA 5TAOA 3OG2A 2VEMA 4TOQA 2VX7A 2QJMA 2HSAA 3U0HA 3WX7A 3CHEA 4FX6M 3M0YA 1SSGA 1Y65A 5BZAA 7A3HA 1B3WA 4WY0F 2CLKA 1UZ1A 3GTNA 4TO8A 1ESWA 2PP0A 4F0MA 2R1MA 2DT1A 3SUSA 4A3QA 4Y90A 2GGEA 4QDWA 3YPIA 3EYPA 3V36A 1Q8AA 4V1YA 4H41A 1UJPA 4JAWA 3VDAA 4YHGA 3HF3A 3HURA 2ZX8A 2O55A 3LSBA 1XYCA 1JDFA 1CLVA 4H6EA 5GPRA 3LN3A 1K70A 3QFWA 3G1YA 3BSGA 3UYCA 4KWWA 1DWAM 3CEUA 4LF2A 3E2VA 1XGZA 3PPCA 1AVAA 1DJNA 3N2TA 4YVPA 2ZE0A 3FS2A 5H6HA 2QMKA 3ID7A 4Q4OA 1O60A 4P7QA 4QSHA 2FPYA 4LNYA 2EPNA 2PUZA 3SAZA 2ZUUA 2NX1A 3GH7A 3SIMA 5EA9A 4AFYA 3CUZA 1SW0A 4CCDA 1H11A 2CPUA 2OLHA 1JCXA 1S2VA 1LOSA 2PBOA 5A8OA 4US5A 3OGSA 2O9PA 1Q6RA 2R8WA 4M51A 3GFZA 4X9SA 5HATA 3R13A 3EX1A 7TAAA 3DFSA 1EX5A 3ABXA 1PX8A 4OUIA 3ITCA 4MVAA 1DQUA 2ZXBA 1QCWA 4KWSA 3V5FA 3R11A 2XIJA 2CBIA 2XINA 3KWSA 1EZ2A 3QHMA 3CZGA 1RK6A 3UR7A 1VQTA 4FXRA 3WFAA 4PMRA 1VGAA 4M0XA 2GJPA 3OLIA 2NLYA 3THDA 1FHDA 3RU6A 1H0GA 4H8UA 1K1DA 3M0MA 1MXSA 4JDYA 4QSFA 3NQVA 3AMCA 1E0XA 1BYBA 1BPLB 1OHLA 1WPCA 3B3DA 4C6JA 4PMNA 2CBVA 4HOWA 1T40A 3GHRA 3TJLA 2CXEA 4KPLA 3HOJA 1P0BA 1RCOB 3T40A 4GJ1A 5TIMA 3LPPA 4HA4A 4IJRA 5C70A 4PEKA 1U33A 4DWSB 1F07A 1XCXA 4L65A 3WH5A 1VB9A 2YFNA 2Q02A 4W89A 4WGXA 1CYGA 1S46A 3DZ1A 4GNJA 3RJYA 4A8IA 3C52A 4MUPA 2BY3A 3PBWA 3QEZA 4AIEA 3XIMA 3UG4A 3NL6A 4F2UA 2DU2A 3KBWA 2Z6IA 3PZ9A 1NQKA 2UBPC 2PDKA 3M4HA 1ZCOA 5HAOA 5BCAA 1VFSA 1O5KA 1IIGA 2ZDRA 1VBHA 2BSLA 4NY2A 1V6UA 1MW3A 1XLAA 3LMZA 4GUHA 2YCEA 4LUTA 1G6CA 3OGRA 1C8VA 1SR9A 4MZ8A 2QV5A 2D0GA 3F4DA 2WVUA 4GZJA 1XYAA 1A0DA 5IXEA 4XZWA 4G1NA 3PK7A 3OB8A 1ONRA 1Z32X 3MTWA 4BF7A 1PDZA 4UFKA 4MJMA 2EO7A 1VLIA 4UQDA 1XF0A 4BQ3A 2H3BA 7ENLA 3GU9A 1X97A 2IUZA 2EPMX 1JPKA 4N02A 3G2GA 1ADSA 4H7VA 4DJDD 4JDBA 2VC7A 2Z25A 2FLIA 1RQHA 3A6OA 4WSKA 3VDCA 5DN1A 4PMZA 1GPWA 3THUA 4BQ4A 3AXHA 1B3VA 5FJUA 5K7JA 1IGSA 1VRDA 3MZNA 1SW7A 1GG0A 3QRHA 4RZ6A 3ITTA 1WZAA 3KOYA 3NO1A 1BFNA 4FPSA 4ZQRA 3LRLA 3T0AA 3DDMA 3MO4A 3VNDA 1G01A 4HPNA 3H22A 3WK2A 1XPGA 2TAAA 1XIBA 1E6NA 3SGGA 1TZ9A 2DT2A 1EF3A 2VENA 2XWEA 4DIAA 3EDEA 2ZTKA 1JAKA 3B9DA 1Q6LA 5J5RA 3SCTA 1UUQA 3WBYA 4EKJA 3AUOA 4MJ4A 3L5AA 2FKPA 3BQ5A 3CTTA 1FCBA 2XVLA 2QJIA 2R1KA 2V8ZA 2CNCA 5G1TA 5IHSA 2BXYA 4CN6A 5M3WA 2VVSA 4UFHA 4AMAA 3O15A 3UZ5A 3MKKA 4OKDA 4FNTA 3WLQA 3W25A 2EBNA 5AYXA 5CLWA 1B5TA 2ACSA 1HW6A 1UPPA 3GTIA 5J04A 2BTMA 3O6AA 5AC7A 2VURA 1NM9A 1KM4A 1XLBA 4NI3A 4BA0A 2AAMA 1W5MA 2PF8A 1VFUA 1REQA 1HJSA 4KWOA 3UZJA 1GONA 3G1XA 4B5NA 2WVVA 5FEWA 3S9IA 4XSLA 4O4WA 5FACA 1GJWA 5I00A 5KETA 4GZ7A 1KD0A 1V3IA 1JEZA 5ENLA 1B54A 1P0NA 2WSKA 1OFQA 1EBHA 4C6QA 4EPBC 4WDWA 4H9VA 4TX8A 4ERIA 4LU0A 3U2EA 4PTVA 2D69A 3EOLA 4XZBA 4GYKA 4BEQA 2CCRA 1GVFA 3WDHA 5I0DA 2W6RA 2FGZA 1NF0A 4H9XA 1GYNA 1VH7A 3DERA 2G0WA 1AUSL 3HPAA 3P0XA 1MUCA 3LPOA 1YIXA 3T55A 5FL0A 1VKFA 3QY8A 4JN8A 4QG6A 1OG0A 3F2CA 1QI2A 2DZAA 5JBDA 1CEOA 2E6YA 1E15A 4K8GA 3CUGA 1ICPA 1EHAA 3UERA 3EZ4A 4MG4A 3G6LA 1HVXA 1FX6A 5HPOA 2XZ7A 1O1ZA 1R7OA 1R3SA 1MI3A 2DSKA 2OFJA 1A4LA 4UTWA 3MANA 1EBGA 1RA0A 1W9XA 4I6KA 3URNA 1AJ2A 4ILSA 4R53A 2Z27A 3TROA 5EFDA 3T0BA 3FAXA 3AI0A 3NL2A 3F2DA 3NQEA 1EB3A 3A64A 2XGBA 2O9RA 3TR2A 4BHYA 5C6MA 4XB3A 1TCMA 3ZJ8A 2C6QA 2C0AA 1SO3A 3M6DA 4MWAA 2PS2A 4IPLA 1MO0A 4CU6A 3PJTA 4QJ4B 2PDXA 2QVNA 1PEZA 3KP0A 5EPDA 4JTQA 1DTNA 1HGYA 4Q6JA 3K13A 1V6VA 3WNLA 1J5SA 1N55A 2NX9A 2WK2A 2WNZA 3MZ2A 1I2RA 1V0MA 3L4TA 4ZB2A 2VQTA 4N9DA 2E8ZA 3M5VA 1AW2A 2OYMA 6PTDA 3EA3A 2EHHA 2ON3A 3F4VA 3F4CA 2X0HA 3TAOA 4XVEA 3DUGA 5I07A 1WUFA 1WZMA 3HGOA 3FYPA 2GZXA 2D3LA 3SCWA 4JGDA 4INFA 3GFYA 2B0MA 5FSDC 1JDEA 3L12A 3DHDA 4E2DA 2PLJA 2CZEA 5IFTA 4GA8A 3CAWA 4HMCA 1DJHA 1EH9A 4WGHA 5M1TA 3WBWA 4IL0A 3DFNA 2HE8A 5LHFA 3LYEA 3HPXA 4H7CA 4W86A 3GG7A 1D3HA 4HK7A 3FXGA 3S5OA 2JKPA 2XSBA 3MSYA 1DL3A 1E51A 1Y5XA 1W91A 1V0LA 1C92A 1A47A 4LC8A 1XSJA 1P6WA 2FB3A 1B4KA 1C91A 4CEXC 1CXEA 2QUMA 5AHLA 3OQEA 4DBEA 1DWIM 4ORMA 4YN5A 4DF1A 4TQTA 4PUMA 2DORA 3MP5A 1U5HA 4HN4A 1E40A 1T7LA 4F0LA 1XDLA 5AHEA 3AZSA 4XAPA 3ARSA 2YB4A 3Q2DA 3BW4A 5KZMA 4CEUC 3B8UA 3W83A 2CIPA 5A8QA 1PWMA 3WQ6A 4UOQA 4DO5A 1TTIA 5LIXX 4PE8A 3LGEA 3T08A 3LCXA 4E4PA 1R86A 1XD1A 3NZPA 3GE7A 5J5DA 3TYBA 1VF8A 5D2WA 2Z26A 4CVUA 3M0ZA 4Q8QA 3ONCA 2WLZA 4CNNA 1V6YA 5AYBA 1MW2A 3W70A 4ZZ9A 3PUDA 3RM9A 1R47A 4KEMA 3ARPA 3DFTA 3G0SA 1ODZA 4JHMA 4GYPA 1IF2A 2EG7A 3WLMA 1OADA 3QSRA 1T8XA 1OF8A 4IFOA 4Y9MA 3Q37A 2NV9A 4G1KA 4RNJA 4AZHA 3W76A 4H6KA 4LS2A 2QCEA 3TFCA 4MHBA 4O17A 3RCMA 1VS1A 3MT1A 4H9ZA 3GW3A 3HQPA 2ZQ0A 2EXOA 3A5FA 1AODA 1NWRA 3AU2A 3LCLA 3AIUA 3WUBA 3WL1A 4ASTA 3UZYA 3EKZA 1VJZA 3QM3A 4PCFA 3KVLA 2A5HA 5D30A 1T96A 4J7RA 1ZSXA 3NQBA 2J8GA 2QGYA 1XIHA 5ABGA 4XX6A 3KDNA 4D6FA 4AISA 3N4FA 1D9EA 1X1NA 3MBFA 1ISWA 1TPB1 3K2GA 5I3DA 5FSEC 2XIOA 1V08A 1VC4A 5B7YA 3WLOA 3W37A 4PUWA 2NQLA 1F9CA 3BV4A 3U8GA 2UY2A 3ZM8A 2PC4A 1EC9A 1A0CA 1JGIA 5A6JA 1DYSA 3VKDA 4PTDA 1VHNA 4LF1A 1MW1A 4DZIA 5DCBA 3HFTA 5D32A 1C7TA 1KGWA 2XGZA 3VC6A 4MZ1A 3WQ4A 4I7UA 2CZVA 4UTLA 3BTNA 1H1ZA 3CS2A 5JUVA 2KX9A 2X40A 3KVKA 9XIAA 5LA2A 3PZTA 3FYOA 4DWSC 1JI2A 4GQQA 4OFCA 5D03A 2XN1A 1WAWA 1UD3A 3LGGA 3REQB 5FOOA 1UQYA 1Z48A 5LIUX 5HNUA 4RLIA 3EX3A 4MPKA 3P93A 3H24A 2W62A 2CEQA 4NJHA 3O05A 2C15A 3QTGA 2NQJA 1IR1A 1UH4A 3W7JA 4BQ2A 2FZ9A 4CD5A 5KINA 4BI5A 2GGJA 5H8MA 4S23A 3LQLA 4UTIA 4CD7A 4D8AA 3CV1A 3C86A 3TOPA 3R1ZA 4LVAA 4JL2A 5LZLA 3UGVA 3B0XA 3EX4A 5AZ0A 1R6WA 5F1UA 5F4XA 1VR6A 2P76A 3R8HA 3B06A 4PH6A 4BS0A 1UP3A 1QOPA 3CQIA 3G24A 1XJBA 5I6SA 2YW4A 1KCKA 3OP2A 3BW2A 2X05A 2VDIA 4M82A