5CSYA

Disproportionating enzyme 1 from arabidopsis - acarbose soak
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
517
structure length
506
Chain Sequence
b'SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 180
structure length 506
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5csyA01
2E4TA 1JD9A 3VIHA 3MUAA 2FH8A 2D2OA 5HDRA 1PIGA 4R27A 4D6EA 4AC1X 3RMEA 5BCAA 1FHLA 3CZEA 4NRSA 2W67A 4QAWA 2G41A 3F5LA 3U5UA 5ABEA 4ZFMA 4UFLA 1E4LA 1O6IA 2VCAA 4U5KA 4DM2A 2ZE0A 4AZCA 4QFUA 4WF7A 1X6NA 1W1TA 1NWRA 3OIHA 2XVGA 1HKKA 4KGJA 1XYZA 4OJYA 1W9VA 4U2ZA 1LL6A 1WDPA 3GXIA 1QNOA 5JUVA 1K9EA 2BY3A 1PX3A 5ECUA 5HPOA 3N13A 2IXUA 1A3HA 1HJWA 4WKFA 5EBAA 2VJXA 4W88A 1C8QA 3CMGA 1Q6CA 4GINA 2YOCA 5A6SA 1GQJA 3IAPA 1JD7A 4PRWA 2W66A 1JNEA 1J0ZA 2DDXA 3WF3A 1AMYA 4W8BA 1QI4A 1BGGA 2UY2A 4X0NA 3VGEA 1ZBWA 2BFGA 3N1AA 2WAGA 1GZJA 4LX4A 4OBRA 3CHCA 2IUZA 2XYLA 2F8QA 2O92A 3L2LA 3W4RA 3NYDA 3WF4A 5DEZA 1E43A 1XH0A 1LJYA 3ZR5A 1PIFA 3ZM8A 5DT7A 2VURA 1CBGA 1LL4A 2WVVA 3VX1A 1EQPA 1K9DA 5TD4A 5FL1A 1DWJM 1JZ3A 1W3JA 2XVNA 1FHDA 2FHFA 4CKQA 3PHAA 3WMBA 3WDPP 1W9DM 2EPKX 3SCUA 1E6NA 3G6MA 5BXTA 3M46A 2WWCA 3NCOA 5I77A 1UQYA 3N15A 1V03A 3PBGA 3U5YA 5A6JA 3MS8A 2VRQA 2E8ZA 1KB3A 4B3KA 1W91A 5A6LA 1HJUA 1BF2A 3EDDA 4H8VA 4JFTA 1XGZA 1V0NA 3T09A 1GOIA 1WKYA 3MSDA 3UG3A 1VFOA 3K8KA 1OD8A 1J11A 4IUGA 4CN4A 5E09A 4A3HA 4KWUA 2OYMA 2FGLA 3AIVA 1UH2A 3GH7A 3WQVA 3CBWA 5BRQA 3BLPX 3UCQA 4F66A 3ARRA 4F9JA 2BY2A 1OGSA 3VGHA 1VEMA 1K9FA 3PZMA 1VBRA 1G0CA 4GZEA 3AZRA 4JFUA 5M17A 1XRVA 1H2JA 2DT3A 3PZIA 5E6ZA 1XD1A 4AZ5A 3AHXA 1EH9A 3PZUA 5DF0A 1C91A 3VGDA 3IJ9A 3WFLA 3VM7A 3CPUA 3AS3A 2QMKA 2CEQA 4HA3A 1EHAA 3IANA 5A1AA 1HL9A 2CESA 1SFSA 4ZE5A 2W63A 4BCEA 1B3VA 4MAZA 1NWSA 3BMWA 2XFRA 4UFIA 1EDGA 4DM1A 1GQLA 5GNZA 1CGUA 3WF2A 1US3A 3SUSA 1HJXA 2WMIB 1UA3A 1CENA 1GHSA 3AS2A 4X9YA 5D9PA 3GH5A 4TVUA 1W1PA 1ZS2A 1R87A 1V3JA 2A3CA 4UFMA 2ZX8A 4JL2A 1NM9A 2WLYA 1CXFA 2GJRA 4D1IA 4HMCA 2GK1B 4UQDA 1UWUA 3WL1A 1CYGA 1E4NA 1QBBA 1QVBA 2WKGA 3VD9A 4ML4A 4MADA 3WDHA 4EKJA 1C8YA 2WNWA 4GKLA 4M24A 4AD1A 1JZ5A 4S3JA 1F4HA 4U2YA 2ZUTA 3UETA 4B9ZA 2VCBA 2E3ZA 3WBEA 4ACZA 3A6OA 1V6UA 2V5CA 4TX6A 2WMHA 3DC0A 1JGIA 1HP4A 2WHJA 3WENA 4AD4A 3AZTA 5LA2A 3BSGA 3MMWA 4CD6A 1E3XA 3AMLA 1OINA 1NOUA 2ZXQA 1JZ7A 1E71M 3EDFA 1HXJA 4MNMA 2GK1A 3BAXA 3W82A 1W3KA 3RDKA 4TTUA 1UKOA 3QOMA 4DUXA 2ZIDA 3NSMA 3D3AA 4EAMA 4CCCA 1ECEA 4GZIA 1MQQA 1CLVA 3PZOA 3ARWA 2VI0A 4PMOA 4BA0A 4TOQA 5JIPA 3VVGA 4W7UA 3W25A 4GXPA 1JZ4A 3N11A 4BQ5A 5A8PA 2J7HA 2PWEA 3ARXA 3IJ7A 1H5VA 3AIWA 3L4YA 1E55A 2G3IA 1BAGA 3VU2A 3ZQ9A 5I5RA 2D0FA 4WJXA 3RM4A 3CZGA 1V6WA 3HJEA 4Y7EA 2Y5EA 4AD0A 2ZWZA 2VCCA 4JKKA 2XJ7A 1UKTA 1HX0A 2ZUMA 1H3GA 2CBIA 5E0FA 4NF7A 4QLJA 3CUJA 3ZSSA 1TUXA 4JFVA 5I6SA 2CCRA 2F61A 2VZTA 1VJSA 2CNCA 4H41A 4PSPA 1W1YA 1ESWA 1C7TA 1DTUA 1UR1A 3FN9A 5D8ZA 1V6XA 2YBTA 1TVPA 5C71A 3ZO9A 3SCQA 4AW7A 3GH4A 3BC9A 5GNXA 7A3HA 4M80A 3EMZA 3B9EA 2J25A 2EBNA 5I2UA 1KWKA 3KL5A 1M03A 3J7HA 3MUY1 2ZUNA 5A94A 4AD5A 3T0AA 4W5UA 2CXGA 1VFFA 2V3GA 3QHOA 2V3DA 3GNOA 4H04A 5FL0A 2VR4A 5A8MA 4YPJA 3ZOAA 1TR1A 3MANA 1MW1A 1Z32X 2JALA 4GQRA 5ABGA 3LPGA 3VGGA 2AOSA 3GXMA 4HMEA 1ZU8A 1I1WA 4BQ3A 3TTYA 2ESCA 1E0XA 1BVNP 1RP9A 1UWIA 5D8WA 4AZIA 2DT2A 2DSZA 4UZSA 4D6IA 4J3SA 3ZSTA 1N82A 1XH1A 3OZOA 4MB1A 4GO8A 1WAWA 1L0PA 3KL0A 3BAJA 2ZX9A 1NP2A 2E8YA 5HNNA 1VEOA 1G01A 2E9MA 3O2LA 4F79A 5JBFA 3OGVA 2WZEA 3PZTA 4FF5A 3WF0A 2W62A 1FOBA 4ATDA 2Q8XA 1XHGA 3TOPA 1WDQA 2QPUA 5I78A 3WUEA 3AHZA 1C8XA 4LGXA 1JDCA 3BAWA 1MXGA 4AY1A 4L4PA 1LQ0A 1WE5A 3AIBA 2WBGA 1JDAA 4PMYA 4W5ZA 2UY4A 1IT0A 4P7RA 2J7EA 4DUVA 3SCWA 2VZVA 3VIKA 3SURA 3WFZA 1E15A 4BQ4A 4AZ6A 2W91A 4J3XA 3VGFA 3VDCA 4H8HA 2WC7A 4DWSC 2ZUUA 1RP8A 1DEDA 4HMDA 1WZAA 4PMUA 3UG4A 2V3FA 1W32A 1ODZA 3VIGA 1VFUA 2A3AA 3ALGA 4DWSA 1JFXA 4HPGA 5CPTA 1NWUA 2D23A 2DH2A 3NUKA 3WUFA 4C7DA 4CN1A 4UFJA 3TTQA 3SCTA 1UD2A 5D9MA 2ZXBA 3AMGA 1UH3A 3SCSA 2BXZA 1L8NA 3WEZA 1V3HA 5A6MA 2ZICA 3WUGA 5I3DA 1KBBA 2WB5A 2VX6A 2XSBA 8A3HA 3BMVA 2ZUSA 1E4MM 1GOMA 2AAAA 4TVCA 5EFDA 2C7FA 1R86A 1UR2A 1AQMA 1ZBVA 4MB5A 5I79A 2GDUA 1KCLA 3WNKA 4MJ4A 4TX8A 4BF7A 4CD8A 3SEPA 4UOZA 5CQ1A 2YLAA 2NT1A 2DSUA 1B1YA 3PZQA 4YHGA 3RCNA 2DSWA 4RE2A 1DWFM 2J79A 4AEFA 1B3YA 2BY1A 4RL3A 4WKAA 3VNZA 2YKKA 3VIFA 1VIWA 4FLOA 4AZCB 1KXQA 4MNLA 2OSYA 3WSUA 3VDHA 3WKZA 4M56A 3VINA 1UD6A 4A4AA 1QNQA 4FK9A 3HN3A 1E6SM 4HP5A 3ARSA 2VX4A 4HOWA 2UWFA 1V0MA 4ATLA 2YL9A 3WIJA 1MQRA 4P7NA 1XCWA 4NSBA 3W26A 5C70A 1JXJA 3II1A 3T08A 3ZT7A 2Y2WA 5EB8A 2WCAA 1KR1A 1M01A 1OCQA 2E9BA 2Z1SA 4CCDA 1HKMA 2BVDA 2ZOXA 2WPGA 4TUFA 1BGAA 4PUDA 1PX8A 2DT1A 2PBOA 1EIBA 3TTOA 2QLYA 2W92A 4J3TA 4PMDA 4H7VA 1WCGA 4E4PA 2CBJA 2BS9A 5M3WA 4Z2GA 1Q6DA 3GNPA 1DWIM 4HZ7A 1M7XA 1DP0A 2E9LA 4V28A 2EEXA 3S6TA 4P7QA 3RPMA 5CPQA 3M07A 4AD2A 1PZ2A 4AMCA 4D71A 3FXYA 1E6ZA 2VOTA 1W9PA 3WD3A 5DFAA 2WM0A 4FMVA 3WNPA 1BQCA 2WVVB 3A4XA 4W8AA 4Q7NA 1IZJA 1UR4A 4AIOA 2WBKA 3FAWA 4JKMA 4J3WA 3T2OA 4E2OA 3DYOA 3DYPA 3GXFA 4PMXA 4FLSA 3RM8A 4D6CA 6TAAA 2E0PA 4IPLA 2WMGA 1HKIA 1XH2A 3WELA 3UR7A 3QHMA 1MQPA 1UYQA 2TAAA 5HXMA 3BSHA 4AZHA 1HJVA 1OM0A 4HU8A 3L4VA 4GO9A 3AHTA 3CMJA 1J0HA 1NWTA 1E6QM 3N9KA 2MANA 3OLGA 2GJXA 3N17A 1V3MA 4HU0A 3FNDA 1W9UA 3WNOA 2D20A 4QLLA 3AHYA 4PN2A 4AIUA 4MAVA 3WD0A 1TZ7A 5IFPA 1R7OA 2GFTA 4XB3A 3POHA 4PTWA 1KFWA 2VRKA 1D3CA 3CGTA 3UESA 5CPSA 2XWEA 2J75A 2CHOA 1CXKA 2DQXA 5E0CA 3AXIA 3WQWA 2G8ZA 4ZENA 2JE8A 1OWQA 3N18A 2W5FA 4HTYA 4LYRA 1ISWA 4W85A 1PX4A 1QHZA 4JFSA 3MV01 3ZMRA 5A95A 2XUCA 3RIKA 2F2HA 1GJUA 3W29A 1QBAA 1EO5A 1HP5A 4EE9A 1W9BM 2JIEA 1TG7A 1CGYA 2CKRA 4Z2IA 3A4AA 3D5HA 4F8XA 3FHAA 4D6FA 2JIWA 4C7FA 5A6BD 4LYQA 2OYKA 3UR8A 1VF8A 5IFTA 1JIBA 5ABHA 1JYWA 1Y7VA 1PEZA 1YHTA 1B90A 4E8DA 1I75A 2GVYA 5CLWA 1Q6GA 2Y8KA 3B9DA 1J18A 5DO8A 1CXEA 2O9TA 1FP9A 1HNYA 2PWDA 1M53A 1EXPA 1E6PA 2FHBA 2X0YA 4AZGA 2QMJA 2D0HA 2XGBA 2RGLA 2DGAA 1SMDA 9CGTA 4ACZB 1UWQA 3I3EA 1VB9A 1OGBA 3KZSA 1JAEA 3MMUA 1BYDA 3W28A 4D1JA 1CXIA 1UR0A 1ISXA 1H11A 2BY0A 2WZIA 1BLIA 1CECA 1RH9A 1G5AA 2VVSA 1Q6FA 2WCSA 3VDBA 3W81A 4JAWA 4ACYA 1QPKA 1UWRA 3HMCA 4Z2KA 3T0BA 5M5DA 4M81A 2G3MA 4WK9A 3OA5A 3VMOA 4J7RA 3CIVA 1CPUA 5BRPA 2J4GA 2OLHA 2PWHA 1CGWA 3GBDA 5KEZA 1BTCA 2CBUA 1XV8A 2D1ZA 2QPSA 4AIEA 4C7GA 3I3DA 1EDQA 1G1YA 1E1FA 3DHUA 3ZT6A 1UKPA 1E5JA 5JBEA 1FFQA 4HZ8A 4UQCA 1ITCA 2W4XA 4W7WA 2EQDA 2VT0A 3CUHA 4QDMA 2YA1A 2XVKA 1EDTA 3U7VA 3AZSA 3KWXA 1AQHA 3SUWA 2CIPA 2DSKA 1JYNA 2XG9A 1V08A 4QCEA 1NQ6A 1KXVA 1OT1A 3POCA 2G3JA 4NI3A 1ZBKA 5LA0A 2J74A 2VQUA 1W9XA 3NDZA 5HOSA 3CH9A 3VIPA 3WY1A 1E73M 3BAYA 4UOQA 2J47A 7CGTA 2GUYA 4EK7A 1C90A 1W2PA 2XTKA 3NSNA 5A3HA 1H0IA 4XUYA 1H49A 2WVTA 1V6YA 3AXHA 1XCXA 1VRXA 1KGWA 4GI8A 4UQAA 4GQQA 4D6HA 1FH8A 4Z2JA 3W27A 2WKLA 2XGIA 2E40A 1US2A 2WHKA 1LL7A 2C8NA 2PWGA 1XC6A 1G9HA 3RO8A 3T0DA 5GPRA 3OGSA 1CXHA 5BWFA 1VJZA 1JZ8A 2VNCA 3SUTA 2V5DA 4UOJA 4IM4A 3EDJA 2NW0A 4W89A 3E1F1 2VZUA 4H2CA 3NDYA 4HA4A 1ZJAA 3WD1A 1E1EA 4KMQA 3K46A 1UD8A 5I24A 1UZ1A 2WSPA 3VD4A 2WK2A 3AOFA 3CHFA 1BFNA 1FP8A 4UR9A 4B3LA 4YHEA 1LG2A 2ZX6A 3HU7A 4ZE4A 2D22A 2J7GA 2VRJA 1UA7A 2OWWA 3CUGA 2EPNA 4CUCA 4IPNB 5HBFA 3K8LA 1V3LA 1QOXA 5BXSA 2VMFA 4PCSA 3WH7A 2GJPA 1PBGA 3L4XA 3VMNA 3FHQA 3AIRA 1BPLB 1JF6A 4JCMA 1WZLA 4Z2HA 1A47A 1UHVA 2QF8A 2CITA 4MDOA 4R5EA 3NJ3A 1J0IA 2ZUVA 1TA3A 3OLEA 5AC4A 4LQ1A 1UQZA 3W6LA 5A2BA 1R7AA 1V0KA 2PC8A 4AZ7A 4CVWA 3L4UA 3AXXA 1KGXA 2YIHA 4B15A 1UG6A 1UR9A 4ZXLA 3T2QA 2UY3A 4U3AA 3SCPA 3CHEA 1UOKA 3AICA 3CUIA 2WMKA 1LF1A 1GJWA 1AVAA 4PTVA 3SCNA 2FHCA 1IV8A 2CBVA 3VIOA 4LPCA 3B9AA 3F4VA 4EANA 1KGUA 3I3BA 3VO0A 4AZBA 1CTNA 4B16A 1CGTA 4DWSB 5CXPA 1C92A 4TVDA 1QI0A 4AWEA 2DPEA 3WQ6A 5M03A 2QHAA 1UD3A 2VVNA 3CUFA 2X1IA 4JCLA 1GORA 1DWAM 2CPUA 1E6RA 3ARVA 3MO4A 3WD2A 3WEMA 4UNIA 1EHNA 4PCTA 1VENA 2FH6A 2Y8VA 1J9YA 3PTQA 2OYLA 2CYGA 1GUVA 2ZXAA 3PZ9A 3WDQA 4QP0A 5A8OA 1VBUA 2BNJA 4D6GA 1HN1A 2CERA 2WVSA 3GXDA 4HA1A 1GQKA 4GI9A 1JL8A 3JUGA 1V3IA 4JIEA 1TVNA 4OUEA 5FCZA 1JZ6A 3IAQA 1BSIA 2XFFA 1JXKA 4DUWA 1GPFA 2ZWYA 1EOKA 3CZJA 1W2VA 1J0JA 2BXYA 5EFFA 3WNMA 3DYMA 4RE4A 3WEOA 1WB0A 1JYXA 1TMQA 4WLCA 2ZX7A 1JG9A 3KE0A 4TTGA 5CGTA 4UFHA 2BHZA 1H09A 2W61A 3VIIA 5ABFB 3VIJA 1V02E 3WH8A 4N42A 2VL4A 2PF0A 2PWFA 4N0RA 4PEEA 2WSKA 2XHYA 4PMRA 3EMQA 4CD4A 3TA9A 4CGTA 1J0KA 2J7DA 3LPOA 2XVLA 3ALFA 4JFWA 2XM2A 1G94A 3WH6A 2A3BA 1ZL1A 3AJ7A 3UG5A 3VD7A 3WUBA 2WXDM 4PTXA 1F4AA 3W38A 4W84A 3ZR6A 1CLXA 1W3LA 1GHRA 4OKDA 3AMDA 2JEPA 4FLRA 4MDPA 1JAKA 3VGBA 1JI1A 4UTFA 2PB1A 3VNYA 5ABFA 1B3ZA 3GTNA 1BYAA 3RJXA 4ATWA 3BLKA 1EOMA 5GNYA 5A2AA 5FIPA 1WDRA 2VQTA 2WC4A 4MTVA 3L2MA 1CIUA 5CSYA 3OLIA 1E6XM 3AYRA 6A3HA 4PMQA 5A8QA 1JFHA 1HVQA 3AIUA 4UQEA 4OZOA 3OG2A 1C93A 3VTRA 4GI6A 2J7CA 5D4YA 4UQBA 1H1NA 1X1NA 4PMVA 4JL1A 4H8UA 1LWHA 4CVUA 3QHNA 1CDGA 1BVZA 1LLOA 3MV11 4HPHA 2YBUA 1AQ0A 4KRTA 2X2YA 3ARUA 2WHMA 2EPMX 5IHRA 1UWSA 1Q4NX 3BXWA 4XZBA 2J8GA 2DH3A 4MB3A 2J78A 1C7SA 2J62A 2PI6A 4V27A 2XWDA 4AD3A 1WNOA 1UR8A 5AYBA 3G6LA 1K9TA 1NP0A 2RGMA 3GBEA 2WWDA 2WHLA 2VO5A 3ZT5A 1QNPA 3AISA 4JHZA 2WLZA 1ZB5A 4RE3A 1OT2A 5CLTA 3VIMA 1ISVA 2GJXB 3CLWA 5FD0A 4LYPA 3EMCA 3MKKA 1BG4A 4HOZA 3BCDA 4MJ2A 2NT0A 1XSIA 1B30A 2ZXDA 1FA2A 4CD5A 1HIZA 5I23A 1DWHM 2VX5A 1DHKA 4OOZA 2J8FA 4AXNA 4PUEA 4CN6A 4CU7A 1KWGA 1VFMA 1WDSA 3AHVA 4UZUA 3SCVA 3ZJ7A 3K4AA 3WDIA 1U2YA 1FFRA 3WQ8A 4WSJA 3WL0A 3W0KA 2VC9A 2X05A 3EYPA 5A6BA 3UERA 4ZEPA 1KBKA 1CNVA 4K68A 1C3FA 1B3XA 3BCFA 4P7LA 5E6YA 3MUIA 3VUPA 1GVIA 1K6AA 3PZVA 2YL5A 4CU8A 4NRRA 3VMPA 1J0YA 1H41A 4M29A 1KXTA 1MXDA 4M1RA 3SIMA 4UFKA 4PMNA 3ARPA 4V2XA 4F9DA 1GW1A 1XSJA 5A2CA 1MFVA 1HJSA 3K4DA 1OSEA 2VUYA 1E0VA 3FY1A 2GSJA 4P8UA 1ZBCA 4MNJA 1UKQA 1GQIA 5D9NA 5GQBA 2AMGA 1BYBA 3MSGA 4P8XA 3S2CA 2XIBA 3N04A 3M6DA 7TAAA 5BXRA 1M04A 1SYTA 2YA0A 2WC3A 5A6KA 1QNSA 1E5NA 1EO7A 1JNDA 4BQ2A 4CCEA 4CD7A 3CO4A 1E72M 4JHOA 3LMYA 2ZUWA 4TXEA 2XM1A 1D7FA 3ZJ6A 1UD5A 3AROA 1CGXA 4HOXA 1NH6A 2X0HA 1UZ4A 4MPKA 3OZPA 5JIWA 4AEEA 4BS0A 3NIYA 1VEPA 1RD6A 4WIWA 3ZJ8A 2OWCA 4W86A 2O9RA 1H4PA 1V0LA 2XFYA 1MW3A 1B3WA 2Y4SA 1E40A 5HPCA 1HKJA 4J27A 2JEQA 3RILA 3AMKA 2YDRA 2OSXA 1KQYA 3K8MA 2A3EA 1UKSA 1ODUA 4LXFA 3SUVA 5BYWA 1I1XA 1PJ9A 1OGGA 3GDBA 4AISA 1JYVA 2FGZA 1HF6A 2YA2A 3VKKA 3WNLA 3EDKA 3SCOA 4KH2A 1GOOA 1J10A 4JZ5A 1MFUA 3W53A 2QV4A 1E4IA 4MNKA 4W87A 4P8WA 5DT5A 2VZOA 3T2PA 3ARTA 1J01A 3WBAA 4BZYA 5I0DA 3L4WA 3U57A 2EO7A 1KCKA 3WQ5A 1CGVA 4D72A 3WDRA 2D3NA 1JI2A 1MVYA 2B31A 5D9OA 1E56A 1OD0A 3OB8A 4MB4A 1NARA 1B2YA 5CSUA 1OBAA 4HZ6A 5IXEA 3VOCA 3A4WA 3VM5A 4L4OA 2EPOA 3KEHA 1UWTA 3ECQA 1R85A 1FH7A 4X0VA 4XV0A 5JBDA 5AC5A 3UEQA 1SMAA 1JDDA 4URIA 1GOWA 3WQ4A 2A3HA 3WH9A 2BHYA 2GDVA 2WMIA 3THDA 1VAHA 1QNRA 5AY7A 2BVTA 2IXVA 4U5IA 1WP6A 5A8NA 3TTSA 3SCRA 2VTFA 1LWJA 4E8CA 5F7UA 2O9OA 3EBVA 1B0IA 3AS1A 1S46A 3EDEA 4PBGA 1HT6A 2EXOA 2ZX5A 2X8RA 3ARZA 4GPNA 2NSXA 2HISA 1ISYA 3WD4A 1O7AA 1QHOA 1E3ZA 2CHNA 1CZ1A 4Z2LA 5LYRA 1V02A 5E70A 4XZWA 2YDSA 1QI3A 2BVYA 1ISZA 2UY5A 5LA1A 5C8BB 3CHDA 2DIJA 2JF7A 1HVXA 5FKYA 1GONA 3PTMA 2O9PA 1OIFA 1WZKA 1FH9A 3BAIA 3BAKA 1XD0A 1QW9A 1JF5A 5A6AA 4QCFA 5EMYA 2DSVA 2Z1KA 3OBAA 1QI5A 2Y24A 4GIAA 3AFBA 2XPKA 3ZIZA 3AMCA 3GYCA 1MYRA 3O9NA 1TA3B 1WZMA 4W93A 3FW6A 1X6LA 1TCMA 3TONA 2CKSA 1BYCA 1UUQA 1QW8A 3SUUA 1KXHA 1MW2A 4AYSA 3CZLA 3PZGA 3OLDA 5CG0A 1PPIA 3A47A 1GCYA 2VR5A 1DWGM 4M82A 1XSKA 4CU6A 3WMCA 1RPKA 2BV9A 5DMYA 3B8SA 2WYSA 1QI2A 3CZKA 1TFVA 4KGLA 3TP4A 3PZNA 2YLLA 3GNRA 4QLKA 2DIEA 1E70M 3WN6A 1GOKA 4ZXOA 2OSWA 4OBSA 3ZJKA 1U33A 2YL8A 3QGVA 5AYIA 3W6MA 2D0GA 3VD5A 3WH5A 3WMSA 3L4ZA 3ARYA 5BXPA 4U31A 2HVMA 1WO2A 3WDJA 2D24A 1V6VA 4PYSA 1E9LA 3AI0A 5CZKA 4GZJA 1OIMA 1KQZA 2JF6A 3BH4A 3DHPA 3GM8A 4U3CA 1V3KA 3F5KA 2CETA 1BHGA 1HL8A 4J3UA 3CTTA 4KRUA 3PN8A 1D2KA 4PMZA 1YQ2A 2WMJA 4JKLA 1TE1A 2YJQA 1P6WA 1JZ2A 1PAMA 2WW5A 1B31A 2WZHA 6CGTA 2EJ1A 4PTMA 3MUZ1 3LPFA 1BG9A 1HJQA 1U30A 2XVPA 1XYFA 5E9AA 4UQ9A 3W24A 1GOQA 2XIIA 3VILA 4NZCA 3IJ8A 4PSRA 2DT0A 3N12A 1MW0A 4D6DA 4A3YA 1EGZA 1R8LA 3GZAA 1J12A 4U33A 3VD3A 3APGA 2D3LA 4J3VA 4YN5A 1CXLA 2YDQA 2DEPA 3VPLA 2YL6A 3RM9A 2VX7A 8CGTA 3FAXA 5A69A 4B9YA 1GVYA 3W37A 2PBGA 2C0HA 4OOUA 4P8VA 3A3HA 2EPLX 2G3NA 3AYSA 3VX0A 1QHPA 5FOOA 1W1VA 2G4FA 2X09A 2BHUA 1ITXA 1Q6EA 1MWOA 4XX6A 2VZSA 4J28A 2WCGA 5IHSA 1E0WA 1B9ZA 1IZKA 4IISA 1GNXA 2V38A 1CEOA 3O6AA 3VDAA 4WSKA 3U7BA 1WPCA 2JFEX 4W8LA 3OGRA 4FLQA 3MU7A 3BGAA 1NOFA 1H0GA 2WANA 3QOKA 4W7VA 4WKHA 3ARQA 4P7OA 2V3EA 2XSAA 3L4TA 1ZJBA 1NOWA 2J77A 2FDMA 5IDIA 3RJYA 3M7SA 4UCFA 5KZ6A 3IK2A 3DECA 4Q22A 3WNNA 3PTKA 3AIQA 3CZ8A 5CJ5A 3NSXA 5CGMA 4S3KA 2J7BA 2WVUA 1UH4A 3KL3A 3MMDA 1PZ3A 1EA9C 1KR0A 3F5JA 3AQUA 2J7FA 3AS0A 1W3HA 4OIFA 4M8UA 3K1DA 1CWYA 3LPPA 3WF1A 4D6JA 3QR3A 4DWSD 5BROA 1OB0A 2OWXA 1SR0A 1UD4A 3AIEA 3THCA 2WMFA 1EQCA 1LG1A
chains in the Genus database with same CATH superfamily
4E4FA 3GD6A 1JD9A 3FV9A 3MUAA 3WBWA 3E2SA 3GTHA 1A5LC 4MOZA 3URAA 3EWCA 5BW6A 1PIGA 3H53A 4AC1X 3V35A 1FDJA 2ZYFA 1FHLA 5HWJA 1Q85A 1R2SA 4D2JA 5ABEA 3U5UA 4UFLA 1E4LA 3PPFA 3TJ4A 4U5KA 4DBEA 1X8CA 4H6KA 5G1MA 1GK8A 5LXEA 1B3OA 4KEZA 2XVGA 4KGJA 2X1UA 1YE6A 1WDPA 4ZA0A 3PS7A 4IG2A 3DIPA 3IPWA 1OFBA 4N6FA 1QNOA 5JUVA 1US0A 2RDTA 3OBKA 2V82A 5I03A 5F4WA 2IMRA 1IE7C 2VJXA 4W88A 3QC3A 2A7PA 4GINA 5A6SA 3CWNA 1SJDA 4DJEC 1JNEA 3WQOA 1J0ZA 3VE7A 3LLDA 2ZZ2A 1FX6A 4X0NA 1ZBWA 4IZGA 3KLLA 3DEQA 3HPAA 1A5UA 1FWCC 3W3OA 5HMFA 1A5MC 1R6WA 2O92A 3WF4A 5DEZA 4DBWA 1E43A 5E5CA 3RPDA 1PIFA 5H8UA 3TFCA 3ZM8A 5DT7A 3ZLGA 1JEZA 1LL4A 2FZ9A 2WVVA 5TD4A 4LCRA 2ONEA 4ZOCA 3C6CA 1W3JA 5CBIA 2FYMA 4CKQA 3PHAA 3WMBA 3WDPP 5HUPA 1W9DM 4KRZA 2ICSA 1MZHA 3SCUA 1ALDA 4PUJA 9XIAA 6PTDA 5E1QA 5I77A 1VGAA 1TPEA 1RXOB 1V03A 1BWKA 5A6JA 4B3KA 5DRIA 3W87A 2Z0IA 3UNTA 1HJUA 2ZA3A 5LSMA 5AYZA 1OC7A 3W7HA 1V0NA 3UG3A 1N2VA 4K6AA 1YTEA 3WK3A 3K8KA 4R9OA 2V2CA 3MDUA 4M7SA 4LT9A 1EPXA 3FLUA 4AY7A 4A3HA 4KWUA 1Q3NA 1IIGA 1QO2A 3CBWA 1A50A 3TW6A 3BLPX 5E93A 4F66A 4F9JA 3ZWTA 2VEMA 1PTGA 1K9FA 1Q7QA 3PZMA 1VBRA 5T9BG 4GZEA 1Y65A 1EJXC 2TRSA 1M5WA 3N6HA 4PTDA 3I4KA 2A4AA 3PZIA 4AZ5A 3G0UA 2HS6A 5DF0A 2OEMA 3WFLA 3M5XA 3CPUA 3AS3A 2QMKA 3M0JA 3QZAA 2CEQA 1EHAA 3IANA 2CESA 3EWDA 1SFSA 5C6MA 5F2GA 4MAZA 3LHUA 3BVJA 1NWSA 4BKNA 4N6EA 3VAVA 4G8TA 1GQLA 3M64A 1CGUA 2P0IA 3A9BA 4H83A 2PE4A 4TVUA 1ZS2A 2A3CA 3B8VA 1XLKA 1JVNA 1Q7MA 4WY0B 3GC4A 2NVCA 1QPRA 1NM9A 4A29A 2WLYA 4B5SA 3VDGA 3TU9A 2RAGA 4AHOA 1TTQA 1UWUA 3BQ6A 1QBBA 5J5DA 1QVBA 3VD9A 4ML4A 1KRBC 4MADA 4RNJA 1JZ5A 4ZSTA 2H90A 2ZUTA 1AJ2A 2E3ZA 3A6OA 3RG6A 3W1QA 1V6UA 3HB9A 3E5BA 4XAFA 3DC0A 1JGIA 3OZMA 3DFNA 4HNVA 1HP4A 1BRLB 1JQVA 2QXWA 1S38A 1P5BA 3CM4A 5LA2A 4H01A 1E3XA 3AMLA 3KRBA 3CUZA 4MNMA 2OT0A 5FJTA 3T81A 4UTKA 4TTUA 4JX6A 1M7JA 3LZ3A 1S2UA 1DIOA 4LB4A 5D37A 3NSMA 3MY9A 3QV6A 3D3AA 3DG7A 4TOQA 4F0LA 3NVTA 2Q09A 4S3EA 1JZ4A 1ZTVA 2PWEA 4YYCA 4ZCWA 1E55A 3C5QA 3B06A 3GVGA 3VU2A 3G18A 2D0FA 4WJXA 3CZGA 1V6WA 3HJEA 2E5DA 2ZWZA 1GJPA 3S1WA 2ZUMA 5E0FA 3NVDA 4MWAE 2FVLA 3THAA 1XWYA 3WJZA 4DBUA 4F2UA 1DTUA 1HO4A 1UR1A 5D8ZA 5HA7A 1RBOB 1AL7A 2QDDA 4TIMA 3IJ6A 3SCQA 5K3VA 1EEPA 5GNXA 1FWBC 2ACSA 2F6XA 2J9YA 5I2UA 5JMUA 2XN1A 2VC6A 3GVQA 3MUY1 3VCRA 2DZAA 2ZVRA 4XZLX 4IJBA 3QY6A 4PA8A 1VFFA 1OFDA 2VDHA 3QHOA 4O1FA 3ZOAA 2FZBA 5DBTA 3MANA 1MW1A 3KLKA 2WNNA 2JALA 3K5XA 2OR2A 2GGIA 4XD4A 2O55A 5ABGA 3T0CA 5FJJA 1ZU8A 4MIMA 4DVOA 3CV2A 4Z1CA 2E77A 1RP9A 5H1WA 2PDLA 4AZIA 3VKBA 3OQ8A 3TJIA 3OZOA 4HGXA 4GO8A 2I9EA 1Q6QA 3BAJA 2ZX9A 5DY3A 4L9XA 5BMWA 3GNXA 1QWGA 2C15A 1VFTA 3W1NA 1RCXB 1DJWA 5DN1A 3QQ0A 4HU4A 1WDQA 3HTWA 5I78A 3WUEA 3BJSA 1C8XA 3W70A 1JDCA 2WJFA 3FEMA 1RBAA 2BSLA 4P7RA 1H50A 5EPDA 2VZVA 1DE5A 3VIKA 3WCZA 5K9CA 3WFZA 5C2CA 1E15A 3S1XA 1VLWA 3C2EA 2R1LA 3VGFA 2WC7A 2X7VA 4QTGA 3K30A 2ZUUA 1TCDA 3W76A 1DEDA 1WZAA 1VLIA 4PMUA 2V3FA 2I57A 4G6CA 4O28A 3NR0A 3OHIA 3ALGA 3KOFA 4XBJA 2DH2A 1UD2A 1IYXA 1XS2A 3SCSA 1L8NA 4BK9A 1R9YA 4DY1A 4ROPA 1KBBA 1GYLA 2WB5A 1O60A 1UP3A 4G7FA 4XQ6A 5I3HA 1E4MM 3V0TA 2BX7A 4TVCA 4O4VA 5EFDA 4YIWA 1UR2A 4ASTA 3NQEA 3HQNA 3A12A 4MB5A 4ZQRA 5I79A 2GDUA 2QVHA 4P61A 1KLZA 1UCWA 3H2EA 4XWUA 1W3TA 2R8WA 2OXNA 2DSWA 4RE2A 1B3YA 3DU0A 3VNZA 4ECLA 3VIFA 2FFCA 2OSYA 3WSUA 1GKQA 3VINA 2DZWA 4XBSA 3HN3A 2NV2A 1E6SM 4HP5A 3ARSA 2VX4A 4F2TA 3SDOA 1KO0A 1LZOA 3OP2A 1UP0A 1WXYA 4GG9A 4WOQA 3WIJA 4NSBA 1MUWA 1AD4A 3TAKA 2A5HA 5CGQA 3CK5A 1IR2A 4C6OA 4CCDA 5H6HA 3CQIA 1PSCA 4IMDA 2DUXA 2ODOA 5EBUA 3WJWA 1RJRA 3KS5A 5BMXA 1A5NC 4J3TA 5I02A 4PMDA 1WCGA 4DXVA 4Z2GA 3GNPA 1AJZA 1M7XA 1XIMA 1JR1A 2X30A 1ZNNA 1XDJA 2X41A 3MZ2A 3LSBA 5CPQA 1C29A 1PZ2A 2PFHA 3RXZA 2QCFA 2VELA 2VOTA 1W9PA 4ORMA 1O94A 2NQ5A 3UJRA 4IIGA 3AXMA 3WNPA 3AYTA 1DXFA 4W8AA 1OG0A 1H63A 4IGSA 4KF1A 5REQB 2JGYA 3LZ5A 4E2OA 3DYOA 4ES4A 3B0XA 3GXFA 4PMXA 2QCDA 3BICA 5E9XA 3UJFA 4QRNA 6TAAA 2PRHA 2E0PA 2R91A 1I2PA 4CLMA 1UYQA 3QW3A 3PANA 4FOKA 4ZQNA 1GTEA 3AHTA 1IHIA 5HAOA 1FWWA 2WNZA 1NWTA 4B4HA 3OLGA 3U48A 1V3MA 2VEPA 3H2OA 3WNOA 4QLLA 3QFWA 4KEVA 1S1RA 3AHYA 3B3DA 4MAVA 3WD0A 1ZLPA 1J93A 4PUNA 3EB4A 1D3CA 3MHUA 1PZ0A 5CPSA 4MWAC 2J75A 1VPYA 1AW2A 3GNNA 4L65A 4XTIA 5E0CA 3AO0A 4ZENA 5HQEA 2ZBTA 4LYRA 5BU9A 1EA0A 3RU6A 1PX4A 3EWWA 5FF2A 1T99A 1HZYA 3ZMRA 5A95A 3RIKA 3LX9A 4PGLA 2CU0A 1UBPC 1QBAA 2OX1A 1W9BM 4QR6A 2WSYA 4LFYA 2B7NA 3K1GA 4IUOA 4Z2IA 2Q8ZA 1J8VA 4YJ5A 1DOSA 4F8XA 4IWWA 1KTBA 2A3LA 5MKGA 3MQTA 2OYKA 3UR8A 3ONBA 5IFTA 1P1MA 1ZZMA 7REQB 1QNVA 2W6RA 2AQVA 2G97A 5HQMA 1Y7VA 5I06A 3VNKA 2ZRWA 4XKYA 3QEZA 3HO8A 3WLTA 2GGJA 3CMFA 4GACA 4BWLA 5DO8A 3PFMA 3TSMA 3VA8A 1A5BA 3V16A 4QIUA 3UWZA 3V18A 2BB0A 1M53A 3ZZ1A 4M1BA 4QITA 2VGBA 2D0HA 3GRIA 2DGAA 3C0QA 9CGTA 1UROA 3MDWA 1UWQA 4AWSA 2BGQA 1VB9A 1OGBA 2A85A 3KZSA 1JAEA 5PTDA 2E6DA 2QNEA 3UD6A 2EKGA 4OFCA 3W28A 5IBXA 1VPQA 3F2CA 1CECA 4GC3A 3BMXA 1G5AA 3V5CA 1ZGDA 3VDBA 4ACYA 5M5DA 5HJXA 4ORIA 4ZB0A 3CIVA 5BRPA 4ZSUA 2HXTA 3CV7A 1YRRA 3TCEA 1BTCA 3JU2A 4FALA 3S6OA 2PDXA 2TSYA 1E5JA 3UZXA 2EQDA 4B2DA 3CUHA 2UZ9A 3M0LA 3KWXA 1AQHA 3SUWA 1JYNA 1FXQA 1YIXA 2J27A 3GAYA 1OT1A 3TN4A 1ZBKA 5LA0A 3HV9A 1TELA 1W9XA 3LCLA 4NILA 5CSSA 4A35A 3TYBA 3QPZA 4GBDA 4I7VA 3T42A 1KRAC 3VNDA 3SQMA 2GUYA 2CLEA 3V5OA 1H49A 1F6YA 5D32A 4GI8A 3UP8A 4GVFA 2DZBA 1FH8A 4RXFA 3ZFHA 2XGIA 2E40A 1LL7A 3EPNA 4N9BA 1LBFA 3DN5A 3O6DA 1G9HA 3W7NA 2QUTA 3OGSA 1SO6A 1Q13A 1CXHA 5BWFA 1MRQA 1VJZA 1JZ8A 2VNCA 3COTA 3F2DA 3O6YX 4PUUA 5AVHA 4IM4A 4F3HA 4W89A 3TROA 2VZUA 4E2DA 1XICA 1FWSA 1AD1A 1UP2A 4HA4A 3WD1A 1OFQA 3C0SA 3VCNA 2OEKA 3VD4A 3AOFA 3CHFA 2QVNA 4UR9A 4YHEA 2PP0A 3S4TA 2J7GA 2OJPA 4UR7A 3GDTA 4CUCA 5J04A 3VFLA 3DFQA 5HBFA 2QEZA 2XIOA 1R2TA 1FKXA 5BXSA 3WH7A 1G7UA 3HPXA 3QGAC 4JPGA 1A47A 4NZ3A 4MDOA 1UJQA 4R5EA 4JTAA 2V63A 1JGMA 1TREA 3H2MA 2ZUVA 1UQZA 2CFFA 3WQPA 3W6LA 1R7AA 4J2MA 2ZFAA 3RFAA 1SM9A 4DJDC 3L4UA 3S1VA 2PU0A 1KGXA 3T2QA 2UY3A 4U3AA 3AICA 1LF1A 1GJWA 4QG8A 1AVAA 4MY1A 1QATA 1IEVA 4PTVA 2G5WA 4CQCA 1U1HA 1IV8A 1K03A 3UPMA 4NNAA 4O1DA 4CNNA 3KOZA 2X1SA 4L64A 1PKYA 4AIBA 1PKLA 4S2CA 4PODA 2IQTA 1WUEA 2VFDA 4B16A 1CGTA 1KM1A 4DWSB 4DJFC 2QYGA 1MUCA 2P8BA 5M03A 3JZEA 1UD3A 3UQNA 3RRAA 1FWTA 3PUDA 5J5RA 2YZ5A 2OYLA 2X1TA 3IARA 3U2EA 4OQVA 5H2ZA 1XF0A 1GUVA 1TPUA 3PZ9A 3KXQA 4QP0A 4HA1A 2CERA 3UJSA 1GZ1A 3W9ZA 1V3IA 3DESA 1JZ6A 3N2BA 1BSIA 2XFFA 3W7OA 1JXKA 4DUWA 2ZE3A 5LGZA 4PEKA 2H3DA 4JYFA 3QW4B 2Q3OA 3KOXA 3QY8A 2ZX7A 1JG9A 4TTGA 3CAQA 2W61A 5ABFB 1ADSA 1JRBA 3ITOA 2WOQA 3RUBL 1HG3A 1V02E 3WG6A 4N42A 2PWFA 4N0RA 4DZAA 2WSKA 4PMRA 3AALA 3ITCA 4XZIA 3SQSA 1Z3NA 3MYOA 3LPOA 4NIRA 2OQHA 2XM2A 3EX1A 3LCHA 4C6PA 3WUBA 3UG5A 2WXDM 1PDYA 4O15A 3GUGA 4QXIA 4B92A 3H22A 1GHRA 3O07A 3AMDA 4MDPA 1JI1A 4UTFA 3VNYA 5ABFA 3GTNA 1BYAA 3RJXA 4O52A 3N9SA 5EU9A 3GB6A 2PURA 1UIPA 1WDRA 5D38A 2L5HA 3UZJA 5CC7A 8TIMA 4ADUA 2VEFA 4GC4A 4GGBA 1SW3A 3V3WA 2Z00A 3STFA 2Y61A 4WSHA 4H7ZA 1P0NA 1JDEA 2PLMA 2WQPA 2QJHA 2CLHA 5D4YA 2NV1A 4PMVA 4JL1A 4H8UA 3DDMA 2Y5JA 3QHNA 1ICQA 3OOQA 3MV11 3BQ5A 2OGYA 1A5CA 3GE7A 5G4EA 5IHRA 4IP5A 1UWSA 1Q4NX 3P6LA 4IMAA 2DH3A 1TX2A 2Z25A 1EJRC 1EP1A 4GVGA 4XK2A 1C7SA 3P62A 1EP3A 3FA3A 4H9YA 3L5LA 2XWDA 1J2BA 4PL1A 3URQA 2V5JA 2ABAA 5AYBA 1DJHA 2WWDA 2EF9A 1OFEA 4PL2A 2GDQA 3AISA 1OT2A 4EACA 4MZ8A 3JS3A 3MKKA 1GPWA 3BCDA 4MJ2A 4US5D 2AKMA 1OQFA 5CAHA 1K8XA 4CD5A 2VFIA 1GTHA 4B5XA 1D3HA 3QXBA 4OOZA 1KWGA 1TSIA 1WOBA 4FNPA 4HNOA 3S5NA 4UZUA 3ZJ7A 3K4AA 1EPVA 4DB7A 1Q65A 3WDIA 4GX9A 1U2YA 2AMXA 3VXGA 2VC9A 1H5YA 3EYPA 4ALDA 4H9UA 4M19A 1RJQA 1CNVA 3PPGA 2FZMA 4YCPA 4M6UA 5AC6A 4MF4A 4DRSA 2YL5A 3N2TA 3BWWA 2AKZA 2Z24A 2IKJA 3VMPA 1QOQA 4M29A 2VGIA 3SRHA 2PRMA 3E0WA 5TAOA 4JR5A 3QMTA 3ARPA 4GRSA 4RNIA 1HKVA 1NEYA 1VP5A 1AL8A 1ZQ5A 4AMAA 5A2CA 1MFVA 1HJSA 1E0VA 5HJLA 3WJXA 3LGEA 4KCWA 4KCVA 4DN1A 5D9NA 1EL3A 3MSGA 3S2CA 1X1ZA 7TAAA 3BSMA 4GMEA 1O5RA 1JNDA 4QROA 3DG6A 4BQ2A 1Z41A 5I3JA 1M6JA 2ZKMX 1E72M 3KBNA 3W1XA 4JHOA 3CV6A 4TXEA 1Q6OA 2TPSA 1D7FA 4GY7A 4RZBA 5K9DA 1UZ4A 5B80A 4BS0A 3ATYA 1VEPA 4DAFA 1YEYA 2I16A 4Z1YA 4W86A 1H4PA 4WX2A 1V0LA 2YCEA 1LWIA 2Y4SA 4GUFA 4GX8A 4TMCA 2IKIA 1HKJA 4OUIA 1OY0A 2ISWA 2ZC1A 2YDRA 4QM1A 2OSXA 2ZDRA 1KQYA 3SSZA 2FB3A 2A3EA 2P8CA 1G67A 1ODUA 5BYWA 3WQCA 3W2LA 2NXIA 1PJ9A 1OGGA 3NZQA 4LS2A 1KFBA 1UOZA 1IXQA 2FGZA 1HF6A 3LCXA 5KITA 4KH2A 3E5PA 2QV4A 1ZSXA 3DENA 5DT5A 1KTCA 2DZVA 4UTLA 2PMQA 3ARTA 1J01A 5I0DA 1DV7A 3WQ5A 4K7YA 2JGQA 1O5XA 1YPFA 3G1VA 1UUMA 3HOJA 2D3NA 3SN1A 3OB8A 1A3WA 5CSUA 5U4NA 1OBAA 1V93A 3GY1A 3A21A 3KEHA 3W86A 3AAMA 4X0VA 4MYXA 5AC5A 1KV5A 1TWWA 3IS4A 3P81A 3Q58A 2A3HA 4LF2A 2CZEA 1N8WA 1QPOA 2E1WA 4H9TA 1LOSA 4ADTA 3NQ6A 2BVTA 1FWEC 1XBZA 2QIWA 3S5ZA 2CLOA 4RE0A 3T6CA 2TMDA 3SCRA 3EBVA 3AS1A 1S46A 3M0MA 3B0YA 2X8RA 4GLEA 3ARZA 5ABTA 4QG6A 5D2WA 1ISYA 1J4EA 3ENLA 2FTYA 5C9UA 3C8NA 1CZ1A 4XZWA 3P0WA 2OT1A 2BVYA 4RW5A 3EX4A 5C8BB 1E0TA 1XBXA 3CHDA 1Q8AA 2IPJA 4OWGA 2O9PA 1WZKA 2O4MA 1FH9A 1SW7A 5EY5A 5EMYA 3M0YA 2DSVA 1QT1A 3AFBA 3V4BA 2XPKA 4Z08A 5AZ1A 1BTMA 3ZIZA 4REQA 3BOXA 1NTHA 4ZB2A 2PDKA 4IF2A 3B8UA 1X6LA 1AZ2A 4S23A 4DWDA 1R3SA 3PZGA 2PLCA 3APTA 2CZFA 2PDJA 2V0TA 1D9EA 3ORWA 4M82A 3STEA 1NF7A 4FX8A 3B8SA 4M6VA 4ZTXA 3TP4A 1TJPA 1GEHA 2DIEA 3GU9A 4IQLA 2Y7EA 3R7MA 4ZXOA 3CAKA 3MCOA 2OSWA 4OBSA 3HG5A 3WLRA 2D0GA 3WH5A 2PDNA 3WMSA 3NM3A 4ILSA 2QJIA 3GIPA 2VHLA 4U31A 2C1IA 3F4WA 4B5TA 1N8IA 3WDJA 4H6QA 4WR3A 2W3ZA 5FJPA 3VNMA 4J40A 2NWRA 4H9VA 1ZFJA 3DHPA 2JF6A 3GU1A 3F5KA 1HL8A 3WLHA 2I1OA 5LNVA 4J3UA 4GY1A 3PN8A 4C6MA 4BY3A 2CLLA 1YQ2A 4Q8OA 2OVLA 4NJGA 3SRKA 3A23A 1TE1A 1JZ2A 1UMLA 2WW5A 1B31A 2WZHA 3RYSA 3LNMA 1U30A 4JOMA 3UY8A 4UQ9A 1GOQA 5CZSA 2DT0A 2E6FA 3N12A 2ISSA 2V67A 3S8HA 3GZAA 1XR2A 5EMJA 1YADA 1A80A 2D3LA 3UCDA 4J3VA 3DFSA 1O1ZA 2HDJA 3VPLA 2YL6A 3G22A 3RM9A 2RHGA 4WGHA 3EGJA 4B9YA 3W37A 3G0SA 4Y9AA 5LIXX 4QJ5B 4Q8UA 2PDWA 2PBGA 1EBHA 2EPLX 3O6CA 3VX0A 1W1VA 5EMKA 2BHUA 1GVOA 1PWLA 3T1GA 4I5RA 1XIIA 3ISIX 5IHSA 1LRQA 4F0SA 1XXXA 1TV2A 3CWHA 1GNXA 3VDAA 1XYMA 3U7BA 4FLQA 1H0GA 6XIAA 3KX6A 5FEWA 4MZYA 4LTSA 4P7OA 3BO9A 1ZJBA 1NOWA 3QYQA 3VZXA 3WQDA 3EOEA 5KZ6A 4Q22A 3WNNA 3G3MA 3UXIA 3GXNA 3C2YA 5CGMA 3OEXA 5A8GA 3FGCA 4IPPA 3NL3A 4AVOA 1N8FA 4PMJA 2F6KA 1RR2A 1NQKA 4UTWA 2YDAA 1XRFA 3AQUA 4EXAA 1P48A 4DYEA 5CZTA 4WDXA 3SJ3A 3UGVA 4P2VA 1XJBA 2V6AA 3K1DA 4UTTA 1XRSA 4UC5A 3WF1A 4Q8MA 4US5A 2BMBA 4HMNA 4OU1A 1SR0A 3PPCA 2Y89A 2Y62A 3PBUA 1W54A 3VIHA 4CNTA 4IX2A 4R27A 1TV3A 1FHUA 4D6EA 3I7SA 1NDVA 1F2JA 5G2WA 3CZEA 2W67A 3P8JA 2QV5A 3NQGA 2VEKA 1A4MA 3UZYA 4E4UA 1EUNA 1O6IA 2VCAA 4DM2A 4Q8TA 3MZNA 3OO2A 4AZCA 4JBRA 3E0LA 4V1YA 1G4PA 3UPBA 3QPEA 3OU8A 1HKKA 1XYZA 2PDFA 3FSTA 1DXEA 4MY9A 2CWNA 4C91A 3N3MA 1K9EA 3IIPA 3LOTA 2PDGA 5ECUA 4JEJA 2W0UA 5HPOA 2YCLB 2F38A 3EZ4A 1V8EA 2PDCA 2IXUA 5LXXA 1A3HA 3NPXA 1HFBA 3NQBA 3WJYA 5G5IA 2P3ZA 3CMGA 1Q6CA 1I0BA 2V81A 3A13A 3CPGA 2W66A 1XQLA 1SQ7A 4ZQOA 2DDXA 4DELA 2XZ9A 4G2DA 4W8BA 1BGGA 3BW2A 2H6RA 1WAUA 4IL0A 1CW2A 1XKJA 1GZJA 4LX4A 3WYZA 5LNRA 3B03A 3DAQA 3C0JA 3LN3A 4YMZA 3L2LA 1Q5MA 3W4RA 3NYDA 4WVXA 1XH0A 2CLFA 2HPMA 2Z26A 4LVBA 4ZL1A 1KCZA 2VURA 1L8PA 1CBGA 1JQXA 4J1OA 4GJJA 3VX1A 1K9DA 1REQA 1F7BA 1DWJM 1DJIA 4H00A 4O0ZA 3I6RA 4LY8A 3CYJA 1MDLA 3RITA 3AU2A 3MHFA 1R46A 3SZ8A 2EPKX 1E6NA 5BXTA 4NAEA 4DI9A 2BOEX 3GDMA 3U4AA 1S2VA 1ONRA 1XDLA 1IQ8A 3UF9A 1JUKA 2V8ZA 1SZNA 2OX4A 2J9XA 1PL9A 3EDDA 3L23A 1UASA 4DZ5A 3QPYA 4V1XA 4MKVA 3UU0A 1Z8AA 4DJED 4JFTA 3M5VA 2OPJA 4LU0A 5C54A 1WKYA 2FZDA 3QMRA 4FF7A 1H51A 1OD8A 1MUMA 3GX9A 4IUGA 3PWIA 3O0KA 3STPA 4CN4A 1JPIA 1IGSA 2OYMA 4DHGA 2FGLA 2GVEA 3CNYA 3AIVA 4FNTA 2WZTA 3WQVA 1YPXA 5BRQA 4GYPA 4OECA 4P5UA 3W1AA 4ZOEA 3EX2A 3CASA 4JTGA 2REQB 4WGXA 3USZA 1U22A 4Y96A 1H7RA 2BY2A 4Z1AA 1VEMA 2FB2A 2MNRA 3KP1A 1DVJA 1OX4A 5AC8A 1H2JA 1RVKA 2DT3A 1BWVA 3W1UA 4FX7A 3AHXA 1EH9A 4A8RA 3KCOA 3QMSA 3PBWA 3IJ9A 3W84A 3VNJA 4QEEA 2PSNA 2HXUA 5A1AA 1HL9A 1D7KA 4MUZA 4ZE5A 2BDQA 5ENLA 4Q8WA 4FNQA 3BMWA 5H8PA 1THFD 4G1NA 1EDGA 3MJYA 3TYCA 2REQA 4UMAA 1O12A 3H7UA 4GKTA 1CENA 1FHVA 2P1FA 2GSEA 1QUMA 1R9ZA 3VKJA 3Q65A 1IR1A 4JL2A 1J5SA 1CXFA 3DHDA 4PUMA 2AQOA 3TJXA 4UQDA 4IOTA 1J6PA 2A6LA 3G0XA 3WDHA 1HW6A 2Q02A 4M24A 4U2YA 4ZMGA 4HNNA 3UETA 4RW3A 4KCTA 3MW7A 3EAUA 3ITXA 5CPNA 2V5CA 1XG3A 2WMHA 3LHZA 3V0UA 3ANVA 2IW0A 2WHJA 3DFTA 3L66A 3WENA 4B5UA 2XISA 3G2GA 3DX5A 1SZGA 1OINA 2CLMA 4XVEA 1KBLA 3H12A 3EDFA 2PTYA 4JX5A 1TMHA 1UPPA 3N2OA 3QOMA 4L6DA 5B7ZA 2ZIDA 1NF0A 1PZ1A 2HBVA 4N7QA 1ECEA 4LCQA 1MQQA 3PZOA 4PMOA 5K4XA 1BSLA 5FSDC 5T26A 4BQ5A 4RKAA 1H5VA 3OYZA 3TC3A 2Z4GA 1S2CA 3ZQ9A 3ABSA 1LT7A 1KV8A 1YMYA 2ZZ7A 2CBIA 1FVPA 3CUJA 1DIDA 5XIMA 1G6CA 2NX1A 5TIMA 4JNYA 5I6SA 3FKRA 2F61A 4LC8A 4DNMA 2QCEA 2DIKA 2UV8G 3EA2A 4PSPA 3UW6A 1W1YA 1C7TA 3BL3A 3NEHA 3PULA 1K3UA 2YBTA 5AYXA 4AW7A 3GH4A 1W5MA 2ZZ1A 5FF4A 3KL5A 3J7HA 2ZUNA 2O7QA 2EG8A 4AD5A 3NO5A 3OYXA 4W5UA 2CXGA 4ZR8A 1VHCA 3NQMA 2CXEA 3CL6A 2V3DA 2V3GA 5FL0A 1WBHA 4C1LA 3S42A 2VR4A 3BLFA 3S2JA 3HA1A 1Z32X 5FF7A 3I68A 1KC7A 3ITYA 3LPGA 3VGGA 5I3KA 3EWZA 3LXCA 3ID7A 5BWAA 3TTYA 1BVNP 1UWIA 3R0DA 4R7WA 2V5KA 3CV1A 1LROA 1E9ZB 3NXLA 4D6IA 4NASA 1N82A 1JPDX 4EX4A 1SVDA 1WAWA 3KL0A 3IWPA 4R53A 1NP2A 2DZUA 4LS1A 4Z0SA 5HNNA 3LXBA 1P4CA 1YNQA 1YBQA 4Z17A 2WZEA 1PCWA 3W1MA 4LRTA 2XIQA 2NUWA 1FOBA 4B4FA 2VXNA 4GCAA 4UIOA 3C2FA 3EOOA 4LGXA 3BAWA 2Y85A 5F2LA 4B90A 1SZFA 1FUYA 2WBGA 5AVNA 3GC5A 3SCWA 2ZZ5A 1JCMP 2ACUA 4S38A 4RPPA 3MA8A 4JGDA 5AHLA 1HKWA 1AQFA 1V77A 3N73A 4J3XA 4WJEA 3W7QA 5AZ0A 2R6OA 1OF8A 2CLPA 4UBPC 1RP8A 3Q37A 1TJ1A 3UG4A 1W32A 1ODZA 3GVRA 3ZVHA 4E3TA 2A3AA 3CAVA 3TVAA 2ABBA 4HPGA 4EPKA 4XO7A 2INEA 4QGCA 2VP8A 4CN1A 3MT1A 3SCTA 3NPWA 2ZXBA 3AMGA 1I6NA 3AWOA 1R5YA 4O0QA 5A6MA 3WUGA 2XSBA 4G9PA 3BMVA 8A3HA 1RA5A 4IT1A 2ZUSA 1VS1A 2AAAA 1XX1A 3MVIA 3M0HA 1H62A 1DQUA 1LUCB 4LUTB 3EX3A 1A5OC 1ZBVA 1MO0A 1KCLA 1XLAA 3O8AA 4TX8A 2GJNA 3BOFA 4U10A 3TLLA 5T91A 3SEPA 4UOZA 5LNUA 1WUFA 4FXFA 3QV9A 1E1CA 3P67A 3TKFA 1B1YA 5G2HA 4ONVA 3PJXA 4AEFA 3RLHA 1A5SA 4WKAA 1BKHA 5EMMA 1VIWA 3PR2A 1D3GA 4IMEA 4NAFB 3W7CA 4L4LA 4S3FA 4HCHA 3MP5A 2FKPA 3VDHA 3WKZA 4EIVA 3OA3A 3C8FA 1TTJA 2QQ6A 4GUJA 3REQB 4HOWA 1KA9F 2UWFA 2C16A 1MQRA 2PF8A 4GQGA 1XLFA 3E0VA 1JXJA 3II1A 2Y2WA 2WCAA 1M01A 4Q4SA 1GVQA 1S5MA 3H6OA 3GHRA 3B05A 3VCCA 4JY8A 2BVDA 4C5YA 2G0WA 4PUDA 1PX8A 4IGHA 4NAFA 3TTOA 4H7VA 1YTKA 1YE4A 3UR2A 1DP0A 4QJ4B 2X40A 1IWBA 2E9LA 3SBFA 4QDWA 2F7FA 5I00A 3S5SA 1R2RA 1JCTA 3RPMA 1TZ9A 2VENA 4AD2A 2J8TA 4KESA 2V68A 1P1XA 4ZO6A 3C4UA 2PLKA 4C60A 1BQCA 3GO2A 2ISVA 4Q7NA 4CNOA 3ITGA 4AIOA 4X2RA 3WLQA 4LAZA 3PSWA 4JKMA 4J3WA 2QCCA 8XIAA 1O66A 1W1B1 3DYPA 3S9IA 3IJQA 1YXYA 4D6CA 4IPLA 2E5CA 1LOQA 3PUOA 3QHMA 3L9CA 4JTLA 3ABQA 3C0LA 5LHEA 2C18A 3BSHA 4AZHA 4HU8A 3LRLA 2GQ3A 2QR6A 3KAOA 5AHFA 2Z2UA 1B54A 1J0HA 1X7IA 3RO6A 1NDZA 2MANA 3N2MA 3FNDA 1W9UA 8XIMA 4IFRA 4NU7A 3MBFA 5FAJA 3M5ZA 4XB3A 3LRMA 4PTWA 3EX6A 4WDTA 1A0EA 1LYXA 3RAOA 5SWUA 1CXKA 4WZHA 3N9RA 1WDDA 2DQXA 3IJIA 3PBMA 3UZZA 2XU2A 5KSWA 3NQVA 1ZAIA 2EJAA 2VD8A 3NXFA 4JFSA 4XTDA 1ITQA 1GJUA 5HULA 2BTMA 2QCLA 4JTCA 4FA3A 1HP5A 3G1RA 3TZFA 1TG7A 2Y7GA 3U9IA 5GVJA 5HATA 4C6FA 3M0ZA 4LBUA 3WQGA 1EC9A 4FOJA 2JIWA 4C7FA 3V7PA 1VBGA 3ZYZA 4C1NB 4BJHA 4BWLC 5ABHA 1YDOA 1YHTA 1PKNA 5D30A 3QBUA 5GJMA 5CCZA 2YFNA 1YPIA 2GVYA 1EJ7L 1CXEA 4AFYA 1FP9A 3GIQA 5FJRA 5LGXA 1D8WA 2FHBA 4AZGA 1TX0A 3H8AA 3ITLA 1KFCA 2QMJA 3NQFA 3EOUA 3WFAA 4ACZB 4EWND 3DGRA 3IIVA 1L2UA 5IBXC 3MMUA 4MLRA 2PAJA 3SY1A 5HWNA 1ISXA 4F0MA 2WZIA 2DZPA 4WUIA 3H70A 1OX6A 2WCSA 4H6RA 4Z2KA 3LLXA 4HYRA 4JNZA 1HO1A 3BV7A 4M81A 2G3MA 3OA5A 4OTKA 3VMOA 1EGVA 2FMNA 2J4GA 2OLHA 3RCMA 5C2XA 1FDYA 3IVUA 2QPSA 2D1ZA 2Z27A 5AFDA 2PTWA 3DHUA 1OK6A 2YCIX 1ITCA 2W4XA 4W7WA 4QAIA 2VT0A 3NM1A 4LEFA 2XVKA 3U7VA 3M0XA 4LEQA 2DP3A 3E6EA 5I3FA 1M68A 2WJEA 1NQ6A 3POCA 3K4WA 1JPHA 2GPTA 5J8LA 3MI6A 5HOSA 4NJIA 2HS8A 5M2FX 2R1PA 7CGTA 2Z1WA 4IMCA 1OFOA 1C90A 4PUWA 1H0IA 1V6YA 3AXHA 3K2GA 1ZAJA 4UQAA 4IQEA 1KKOA 4D6HA 4WCJA 3W27A 3RLUA 2WHKA 2NV9A 1OX5A 2C13A 3T0DA 5GPRA 4FP1A 2GOUA 5E0KA 1B4KA 3E2RA 3H7RA 3SUTA 2V5DA 3H21A 4N02A 2NW0A 3E1F1 4H2CA 3RHGA 1MEHA 3UYIA 1X97A 1W3IA 2B7OA 3PPHA 3S2MA 5AHMA 4M3PA 4KMQA 1UD8A 1K8CA 4FB7A 1BFNA 1FP8A 1R9XA 2ZRXA 4B3LA 3H55A 1RUSA 2D22A 4H19A 3CUGA 4UNLA 4EVZA 3HM7A 3KW3A 1A5AA 3TK7A 3U6WA 4PCSA 2OG9A 1GWJA 1VD6A 3FHQA 3BZGA 3AIRA 1C8VA 1BPLB 1JF6A 1WZLA 4Z2HA 2PRLA 3P84A 1UHVA 2QF8A 3NJ3A 2J13A 3S1UA 2GUBA 1TA3A 4E5TA 5A2BA 1V0KA 2PC8A 1V4YA 3QGKC 3FYPA 2YIHA 1RZMA 4H9XA 4YVVA 1R3VA 1LBMA 3SGGA 3CHEA 3NFUA 1QWKA 3SY8A 3SCNA 1UZDA 2FHCA 5XINA 4CNSA 4D8ZA 3I3BA 3JVAA 3VO0A 2QPXA 1A0CA 2DPEA 2IPWA 1JCJA 1EX1A 4JQ3A 2ISFA 1DXIA 3CUFA 4JCLA 3KZPA 2WKJA 3R8HA 4AG0A 7XIMA 1ECQA 3WD2A 1RHCA 3LCWA 4PCTA 2HV5A 1VENA 4GYFA 4DUOA 1QK0A 3H4WA 3ME3A 4G7EA 2BNJA 1EUAA 2G95A 5HJYA 2WVSA 1ZENA 1GQKA 4QJ3B 3GYEA 1JL8A 3XIMA 2EHHA 3VC6A 1NELA 1JCLA 3IAQA 3W2JA 3T0TA 1QPQA 1AW5A 2BXYA 5EGRA 3NZ1A 3DYMA 3WNMA 3PWAA 3WEOA 1WB0A 1JYXA 3LCFA 3F2BA 4AX6A 4L4MA 3M44A 3KE0A 5CGTA 4XSLA 2BHZA 4LAMA 4RZ4A 4G5DA 1L6FA 3TW9A 2Q01A 2HE8A 3UJ2A 4C90A 2QS8A 1OCJA 3KBMA 4RPQA 2J7DA 2R1KA 4C6DA 3GQYA 4HPNA 4DJFD 1F3TA 2FLIA 3WX7A 1TV7A 3VD7A 4PTXA 1F4AA 3W38A 3ZR6A 2Z1XA 1CLXA 2Y63A 4Q8QA 1W3LA 3GG7A 1ZRQA 4Z0JA 1EIXA 4A2SA 2PB1A 2NX9A 4MYAA 5DCBA 2JKAA 4AF0B 2O4QA 3TQVA 1PUDA 5GNYA 5FIPA 2PDYA 1POKA 4Y9MA 1DJZA 3L2MA 3W22A 1CIUA 4QBXA 3OLIA 4HHHA 2AL2B 2IS7A 3MWCA 1O4UA 1S5WA 3W7LA 1S2AA 3AIUA 3QR0A 4UTIA 1JCYA 3OG2A 1RLCL 3VTRA 3BCJA 4GI6A 3UWUA 2E1DA 3STGA 1ML1A 3HG3A 4R7JA 3NQAA 1CDGA 1EX5A 1FCUA 1BVZA 2INFA 1LLOA 1TE6A 4UCGA 4AF0A 3RLGA 1GEQA 2DV0A 3ARUA 5BRBA 2NX3A 5EA9A 4WD0A 3SQLA 3BXWA 4XZBA 5HANA 3CT7A 2O0TA 3NYZA 1BWLA 2PI6A 2ZVIA 4V27A 3IUHA 2DU2A 5XIAA 1Q6LA 3TDFA 2HPIA 1UR8A 1W5QA 2QCGA 3MWAA 3SN0A 3VKCA 3LY0A 3G6LA 2YBVA 1K9TA 3WO8A 4HU3A 2WHLA 4AWTA 4JHZA 4IIHA 4HHMA 2WLZA 1ZB5A 1DJQA 3VIMA 1SPQA 1B9BA 3DI1A 3STCA 4NUWA 2GJXB 4NI8A 4LYPA 3G1YA 5AOUA 4HOZA 3KTSA 3NEVA 3GUWA 2ZXDA 1FA2A 4NJKA 1SJBA 1EC8A 1M9HA 5G4HC 4TV5A 1NSJA 2DORA 1DHKA 1XLCA 3RMJA 1PE1A 1OFRA 1VFMA 3D46A 3OVPA 1W31A 3TMLA 4EP8C 4DI8A 4DZHA 1FFRA 3WQ8A 4MWAB 5CJMA 1S1PA 5K9XA 4NG3A 1C3FA 3BCFA 4P7LA 4ICMA 1XLDA 2VFEA 4CU8A 4Y90A 3UXLA 1MNZA 3MYPA 1H7PA 1H41A 3EWBX 3C2VA 1KXTA 4NYUA 3SIMA 4UFKA 3QV8A 5DCEA 4NNCA 3TZNA 1ZCCA 1I2NA 3G1FA 1XUUA 3S6DA 3QSRA 1XSJA 3PJUA 1XC4A 3A9IA 2VUYA 3FY1A 2BWGA 1O68A 5FJIA 2NQJA 3TYAA 4IFKB 3SM0A 4UTHA 4NZ5A 1UKQA 3EPOA 1Q8JA 1BYBA 2W27A 4P8XA 1R3WA 2XIBA 3N04A 3M6DA 3GFXA 1M04A 1SYTA 3ATZA 5HUOA 1QNSA 2WM1A 5BOFA 1EO7A 1MNSA 4CCEA 3FYYA 3LMYA 1TYGA 3W1TA 1F3WA 2XM1A 1LTDA 4H9ZA 3T7VA 2NWSA 3TN3A 3WBXA 1NH6A 5JIWA 4IFKA 4AEEA 2OKTA 4BF9A 3KBSA 3M7WA 4A22A 2FIQA 1MW3A 2GVJA 4PCPA 1FDZA 5HPCA 2PZ0A 2V5LA 1FRBA 3RILA 3L68A 1X1OA 4PFMA 1UJPA 1EEXA 3O1NA 4QNEA 4TQTA 3W00A 5JVLA 4YNGA 3DBNA 4MG4A 1WKEA 4HK5A 3H2NA 1KM0A 1XLBA 4JZ5A 4MNKA 4W87A 3NOEA 1WDWA 4P8WA 3TJLA 1PHQA 3NURA 3U57A 4D72A 2H8ZA 1CGVA 3BLLA 1F61A 2XIMA 5FEXA 1BKSA 2TODA 5EMLA 5D9OA 1T96A 4Q4QA 2DFAA 3F1QA 2D69A 2IQDA 2Q6ZA 1A0DA 3A3WA 4I6KA 4HZ6A 3VOCA 2HBXA 3A4WA 3VM5A 2XSXA 2EPOA 4GNVA 1MZRA 3UWYA 4TMBA 4AEOA 3W7EA 1SMAA 1GOWA 3GKAA 3S9YA 2B7PA 3WH9A 2GGGA 3S3GA 3HG4A 3OJGA 1QNRA 5AY7A 3W73A 2IXVA 4LV9A 3WLSA 4WY0A 4JTSA 3TTSA 1GYNA 1LWJA 5CPLA 4E8CA 5F7UA 2X42A 1TR9A 1B0IA 2AGKA 2ALRA 1WBJA 1FWJC 4GPNA 1SFLA 4KFPA 3TIMA 3R94A 1WA3A 1QHOA 4HHLA 1ISZA 2UY5A 5CH9A 3KVLA 3F4NA 2JF7A 4DYKA 4HSOA 3MI2A 3ONCA 1BRLA 1OIFA 1I9CB 3KVKA 5AYYA 1P0DA 1XD0A 1QW9A 5A6AA 3NGJA 3R13A 4QCFA 4UMCA 4GIAA 4FNSA 3GHSA 3TYDA 1MYRA 4Q7BA 3DHFA 4O18A 4DZIA 3IIZA 4UR8A 1WZMA 4W93A 2I9UA 1TCMA 1FWFC 3TONA 4L6HA 1UUQA 1QW8A 3SUUA 3AXKA 3GDRA 4AYSA 2EPHA 2OKOA 3W1LA 1E51A 3LS9A 5CG0A 1GCYA 4O14A 3M6YA 2PDUA 2WSRA 2HK1A 3CEUA 1L6YA 4HNUA 1NFGA 2YLLA 6ENLA 1K70A 3N14A 2ZZ6A 2OU4A 2Y7FA 4NZFA 3ZJKA 3W6MA 2ZRZA 3E0IA 3CEPA 5DCDA 3HQPA 5BXPA 1E9IA 1D8CA 4KS0A 3LERA 2I7GA 3I7RA 1GVFA 4K8HA 2D24A 3UA4A 1E9LA 5CZKA 1MRAA 4GZJA 2INZA 1OIMA 3LBCA 2NVDA 3CQHA 3BH4A 3G8EA 1V3KA 4JQAA 2CETA 4ZBCA 1X38A 1HUVA 1KTNA 2Y70A 4PMZA 4BR1A 2WMJA 4I5XA 1IXPA 2YJQA 1PAMA 5LIUX 3HGOA 6CGTA 2EJ1A 4PTMA 3MUZ1 2CW6A 3H2FA 1HJQA 2PP3A 2XGZA 3E2VA 4JTTA 5DANA 3VILA 3HPFA 4GFIA 1R8LA 2Y88A 4DYJA 5AHNA 2JQXA 4YN5A 5LNSA 4Z1BA 2DEPA 3LRKA 1X7FA 3LB0A 2VX7A 4XIAA 4P8VA 3MKCA 2PPGA 1XI3A 1RQHA 4K39A 2BOFX 5FOOA 3H7VA 2G4FA 1P6BA 3S0CA 3KVJA 3R4IA 1SGJA 1RPXA 1K1DA 3B8IA 3BDKA 3FCPA 1V51A 2XH2A 2Y6ZA 3M0KA 1ZCOA 2JK2A 4HYVA 1Y5VA 1E0WA 1W3NA 1IZKA 4IISA 2MUCA 3H26A 2V38A 4WSKA 2JFEX 1ZHAA 1ICPA 3LM3A 3MMTA 3PG9A 1EJWC 2GLKA 4WKHA 4E2VA 5LNWA 4X9SA 2XSAA 2I56A 3L4TA 3TFXA 2J77A 2ZA1A 3QVQA 2FDMA 3M7SA 4E3VA 3O15A 3PTKA 4UTWC 2D2GA 3XINA 3CZ8A 5CJ5A 4RNHA 4LVDA 3FXGA 4R9XA 4S3AA 4YU1A 4IJRA 2ANUA 1VCVA 5KZMA 4UTTC 1UH4A 4DNHA 2YXOA 2QUVA 1EA9C 3F5JA 2GVLA 3GW0A 1TV8A 2VM8A 5FEZA 4NHVA 4Q32A 4L1WA 1TJ0A 4M8UA 3LPPA 3QR3A 1QJWA 1T0OA 5BROA 4DWSD 1H7OA 3TC6A 3NPUA 2OWXA 2FMOA 2Z1BA 1I8JA 5C9WA 1EQCA 3NQ7A 1F3EA 4K2SA 1EYEA 2D2OA 5AC7A 5HDRA 4LBSA 3WK0A 1GQNA 2PDQA 4I7UA 3FOKA 3TTEA 2GYIA 2PZNA 4K38A 4QAWA 3ANYA 3F5LA 4ZFMA 1TTPA 3VOHA 3KS6A 1Z69A 2A7RA 3AWNA 3OVGA 4FXJA 4QQUA 4QFUA 4R33A 4WF7A 1UMYA 5G4WA 3OIHA 4HTBA 4OJYA 4J4KA 1W9VA 4U2ZA 1LL6A 3H2AA 3GXIA 2BY3A 3WK2A 1PX3A 4XD3A 5HMDA 2ISDA 3TQKA 2X16A 3N13A 5U7SA 4WKFA 4D8LA 1C8QA 2IQ0A 4AC7C 2YOCA 4NXSA 1JD7A 3TSBA 1QR7A 4EPEC 3GR8A 2HTMA 2A0NA 1HQTA 2GQ9A 3UR5A 3QTGA 2V30A 4YVPA 6TIMA 2UY2A 3T40A 4R3UA 1P7TB 1I2OA 3L5AA 1L6WA 4MLJA 4LCSA 1YKWA 3TR2A 4O1CA 4QE4A 3CHCA 2IUZA 2XYLA 3CQJA 4S3DA 2F8QA 3R79A 1X39A 3HURA 4K1GA 1XBVA 1U5JA 1LJYA 1LQ2A 4QX4A 3I6EA 1W1IE 1FBAA 5FL1A 1TVLA 1JZ3A 2XVNA 1FHDA 4WDUA 3TQ0A 3R5EA 2OB3A 5T9CE 4LUSB 2QGHA 3BOLA 4F2BA 3W83A 5REQA 4ZQMA 1TWIA 2CLKA 4M5PA 4GWEA 1IT8A 3KRSA 4IIDA 1UQYA 3N15A 1XPYA 2ON3A 3VKDA 3UPWA 4JTEA 4IMFA 3U5YA 5FEPA 4AVNA 4L56A 5EKYA 3DERA 1JCNA 2QZRA 2VRQA 3UA3A 4RUBA 1W91A 3LXAA 1UW9A 1BF2A 5FF3A 1DBTA 4Q4MA 1XGZA 2G4JA 1F8IA 3MP4A 3YPIA 5D2TA 1J11A 4GYPC 5JXQA 5DLCA 5E09A 4QISA 4JD4A 3GSMA 1UH2A 3UCQA 4QSHA 4RDVA 1JCXA 1OGSA 4UWMA 1AH3A 1FWGC 4QQ3A 4FO4A 4ZGYA 3AZRA 3P82A 1FWIC 4JFUA 4XUGA 2OGJA 1K6WA 5M17A 1MXSA 3QTPA 5E6ZA 3HJZA 2RDUA 3FDKA 3PZUA 4BI6A 1PIIA 4BI7A 5FACA 2VFFA 4HA3A 1AODA 2GGHA 1OYCA 1B3VA 4EF9A 3FJ4A 2XFRA 3GLCA 4HSNA 3RN6A 4UFIA 4DM1A 3UJEA 4PE8A 4UTUA 1ONXA 3SUSA 1HJXA 2WMIB 1GHSA 3HGJA 1KM4A 4X9YA 5D9PA 3GTIA 3GH5A 1W1PA 1RQBA 1R87A 4UFMA 4O8RA 2J6VA 3I10A 7REQA 2P10A 3G8RA 4O12A 2WO5A 3GR7A 4YCOA 2LLEA 4YTSA 4D1IA 3B97A 4HMCA 3E2QA 3WL1A 1XW8A 1CYGA 1E4NA 4KPLA 3C61A 2WNWA 2ATSA 3LI0A 4S3JA 1F4HA 1W8SA 2YX0A 3RPTA 3WLOA 3IIOA 4AX7A 4NZ4A 4XZMX 4RX0A 3IVTA 4CQ8A 4AHPA 2HZGA 2Z2AA 3PAJA 3TQPA 5I3IA 2QUMA 4AD4A 3ZS4A 3NGFA 3BSGA 1NOUA 1HXJA 3W2KA 3W7IA 2ACRA 4LNYA 3BAXA 4C6CA 5DBUA 3W82A 1DJNA 1W3KA 3RDKA 3N19B 1UKOA 4OVXA 4DUXA 5KTLA 4JTQA 3QFEA 3LM7A 3QH2A 2ZZ3A 3W6YA 3ARWA 2VI0A 5JIPA 3VVGA 4W7UA 4GXPA 4O1EA 1EJSC 1P0EA 2J7HA 3IJ7A 3AIWA 3SR7A 4K1WA 2G3IA 4C6KA 4S1FA 4XSMA 1LQAA 3C52A 5B7YA 4O53A 2HVOA 1ELSA 1OVDA 4GJIA 2Y5EA 2RJGA 1KM5A 2VCCA 4HJFA 2JKPA 1XFCA 4LSBA 3S2LA 1F5ZA 3ZSSA 4YTQA 1TUXA 4JFVA 2CCRA 1H60A 4GGHA 3G77A 2CNCA 1R3RA 3N25A 4BHYA 1ESWA 4CCZA 5BNKA 3DZ1A 3MJMA 3B0PA 4IP7A 4EAYA 1TVPA 3ZLFA 5C71A 5C55A 2BXVA 3NNTA 3EMZA 4GNKB 3B9EA 3KDOA 4FS9A 2J25A 4L6OA 3HGSA 1KWKA 1PTDA 1RAKA 2DJXA 3LHYA 5A94A 4NZ1A 1LBLA 3T0AA 2Q71A 1LOLA 2HNEA 3M0IA 4H04A 5A8MA 3DFOA 1TKKA 1ONWA 5CSRA 2BG5A 5A6TC 3HQOA 4GQRA 3CL8A 4FNUA 1F8MA 3GXMA 2NLIA 3R1ZA 2HNHA 2QCNA 1E0XA 1BD0A 2QF7A 3CHVA 2ZRUA 1SW0A 2DT2A 5F2MA 1OCNA 1XH1A 4GY0A 4MB1A 3KTXA 1KNWA 1L0PA 1YXCA 2E8YA 1PCKA 3GK0A 4E8GA 1EF2A 1VEOA 2E9MA 3OGVA 3PZTA 3T78A 4FF5A 1L6GA 5F4SA 2W62A 4TR9A 2ZTJA 2Y0FA 4LWWA 4FSAA 4ATDA 2Q8XA 1XHGA 3TOPA 4DO5A 2KAUC 2SFPA 4GA8A 4AY1A 1MXGA 1UPMB 1LQ0A 1WE5A 3IK4A 3EKLA 1X96A 1JDAA 4V33A 4KFNA 4W5ZA 1IT0A 3KOWA 2J7EA 3G5EA 3MI3A 3W7MA 3SURA 3NPVA 4PRTA 3G1DA 2W91A 4WJ8A 2FTWA 3ZR4A 1M7OA 4CQDA 2VWTA 2X2GA 1A4LA 4HMDA 3N29A 4NZJA 1XYBA 3B8TA 3VOFA 4DWSA 1JFXA 8RUCA 5CPTA 1NWUA 2D23A 3NUKA 3EEGA 1WYIA 4C7DA 4UFJA 4GH3A 3P5YA 3TTQA 4RDWA 5D9MA 3USBA 4AHQA 4EPDC 1UH3A 1VKFA 3WEZA 3P93A 3WLPA 4JX4A 3IJLA 1GOMA 1LM1A 2C7FA 1YDVA 3GVVA 2VFGA 1AQMA 3WNKA 1AJ0A 4EPBC 4MJ4A 4BF7A 3TWAA 3E96A 5CQ1A 2YLAA 2ZZ4A 2NT1A 2DSUA 2HROA 3B4UA 3WQEA 1XGEA 5MF5A 4YHGA 2J79A 4AU0A 2BY1A 4RL3A 2XH4A 2OQLA 3OVQA 4LVFA 3UVAA 4R7OA 4FLOA 3DG3A 3UBPC 1KXQA 5LIWX 4MNLA 1S2WA 4MUPA 3JRKA 1PYMA 1UD6A 4A4AA 2Z29A 3A4JA 1QNQA 1RQEA 4IG2B 2OOGA 1GKPA 3CS2A 1R3YA 4XBKA 1V0MA 1TPDA 4IFOA 3SB0A 4ATLA 3S9ZA 2YL9A 4P7NA 1XCWA 3FVDA 4HD5A 2V5BA 2JBMA 3T08A 4EF8A 1R3TA 3ES7A 3ZT7A 5EB8A 3TN5A 1OCBA 1KM2A 1XLLA 1KFKA 1TWZA 1OCQA 3GWQA 9XIMA 4FR6A 1EWEA 4JIIX 2OMAA 2ZOXA 1BGAA 3THQA 3N4FA 2PBOA 4DAIA 1EIBA 1FWHC 3EA3A 3NZRA 2W92A 3FIGA 3OG3A 3DFHA 2CBJA 5M3WA 1Q6DA 4HZ7A 4H8NA 4I8DA 5CBJA 2HJPA 2WPBA 4V28A 2C79A 2IPGA 4P7QA 3MP3A 3M07A 3U4FA 3GDKA 4D71A 1TPVA 2I14A 4H1ZA 3JZUA 1KRMA 3D47A 5KETA 1FY6A 1VYSX 1WKFA 3GXTA 2VR2A 3C86A 5DFAA 2WM0A 4FAMA 3LU2A 3ZLHA 3RK8A 2WVVB 2Z7GA 2V2DA 1IZJA 1UR4A 2R9RA 2WBKA 2NXHA 3R8GA 3U2OA 3U0HA 3T2OA 1GVRA 1X6UA 5LZLA 4FIQA 1EJVC 4FLSA 4JS3A 2BBFA 2XIJA 3RM8A 1AW1A 3A22A 4GNJA 5FJOA 2G96A 1RD5A 2WMGA 1BQGA 1XH2A 2TAAA 4QEHA 5HXMA 3R6IA 3IGUA 2C0AA 2DUAA 2AGTA 2PC4A 5F4XA 2A6NA 1HJVA 1OM0A 3B9NA 3L4VA 3TXVA 3GG8A 2FQIA 3BJFA 1LLWA 3KRUA 3TUUA 1SFTA 3RX2A 3N17A 4HU0A 4M6QA 3GXPA 1S3TC 4ZB5A 4PN2A 1ME9A 1KBJA 1R7OA 2GFTA 3BG9A 3POHA 5JH1A 2XWEA 1F9CA 2CHOA 4N4QA 4I3GA 1BXBA 3Q45A 4WQ6A 4ZQPA 3V5FA 3WQWA 4ERIA 2JE8A 1OWQA 1U1UA 3L67A 2C19A 1ISWA 3NO3A 3UXDA 2X0SA 4UMBA 4WRHA 4R88A 1EJUC 3EKZA 4JTDA 4Y6GA 4CEXC 2I5IA 2F2HA 3Q2DA 4GHRA 1DYSA 3UY7A 3PC0A 2VUNA 2FFIA 1EO5A 2OLSA 2Z2BA 3UWWA 4O8AA 3D5HA 3V1HA 4DLMA 3FHAA 3QN3A 4K37A 5IM51 3MCMA 2FJKA 1XIGA 1GG0A 4HSHA 1VF8A 3WMLA 1WKDA 2QKFA 2XINA 5AN7A 1JYWA 3SO7A 3AJXA 4FXRA 3UYCA 1PEZA 3QV7A 1B90A 1RSCA 2Q8LA 5CLWA 4L5ZA 4DLFA 2Y8KA 3B9DA 1HNYA 4HCDA 2GZXA 3SJNA 1EXPA 1E6PA 1R38A 2X0YA 1DHPA 4MSSA 4HK6A 2XGBA 2RGLA 1SSGA 1SMDA 3W01A 2G3FA 5GJNA 3DFPA 3A5FA 3RR4A 2C6QA 1EGMA 1OFPA 3GHUA 1TQXA 1Q4WA 2YSWA 4KIEA 1EWDA 2W79A 3BG5A 4RLIA 5HMSA 1CXIA 1UR0A 3EXTA 3VOGA 2E68A 1RH9A 4ML9A 3O16A 3W81A 1VZWA 4JAWA 1QPKA 3T0BA 4XVDA 4C6EA 3SAZA 4ERGA 1CPUA 3D6NA 2PWHA 1CGWA 3CLMA 2CBUA 1XV8A 5ECVA 1O1HA 4AIEA 4C7GA 1EDQA 1G1YA 5K4ZA 1E1FA 1AK5A 4HIBA 5JBEA 1UKPA 3LG3A 1A3XA 4UQCA 3T8QA 1EDTA 1SFJA 3AZSA 2CIPA 3IACA 2CZVA 2XG9A 1V08A 4QCEA 4LB3A 3E12A 1KXVA 3FA4A 4F4RA 3WZ0E 2DZSA 2EGZA 2VQUA 1P6CA 1TO3A 3BPWA 2NLYA 3PF3A 4IXXA 1SU5A 4WXYA 3VIPA 3WY1A 1OC6A 3IRDA 1TPB1 2OEJA 3CO8A 3BAYA 3QLLA 2J47A 4MKNA 3NSNA 5A3HA 2YR1A 2WVTA 3SGUA 1XCXA 1VRXA 2XDFA 2BGSA 4GQQA 2YW3A 1F3XA 1IXNA 1XIJA 2R14A 4C6JA 3PY2A 2PWGA 1RCOB 1XC6A 2QDGA 5FI8A 1RV8A 5A5WA 4JTJA 1VJIA 1ZPTA 1QTWA 4Q33A 2PDBA 2OLAA 1B4EA 3MSRA 4HNTA 4K7VA 3NDYA 3MHGA 1ZJAA 4B2DD 2E28A 1AG1O 2WSPA 2DVTA 1CB7B 2WK2A 9RUBA 1XG4A 1U5HA 1LG2A 3PUEA 2ZX6A 5CC6A 3FS2A 4A8LA 3IUDA 3SFWA 3IIXA 2VRJA 4NYYA 2NQLA 4LVGA 1KLYA 4IPNB 4Q4RA 1QOXA 4R85A 4F0HA 3DH7A 1RA0A 2B0MA 3TYEA 1AFSA 3GFYA 1CT5A 1Z42A 3PBYA 5CEWA 4JCMA 1U5VA 4WXZA 3CAWA 1RK6A 5FSEC 1K4GA 4HBKA 3O05A 4LAOA 3R11A 3LV6A 2I5GA 2J9ZA 5AC4A 5CZJA 4AZ7A 1JULA 4CVWA 3AXXA 2KX9A 4B15A 4A3RA 4Z42C 1UR9A