5CT1A

The structure of the nk1 fragment of hgf/sf complexed with ches
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
173
Chain Sequence
b'TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 38
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 5ct1A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 5ct1A01
5CP9A 2K4RA 1W8KA 3SP8A 2Q8AA 3MKPA 4D3CA 3BT1A 5CT1A 1URKA 3SRIA 4A5TS 2KJ4A 3HMTA 1Z40A 1TPKA 4APLA 5EODA 1NL2A 2K13X 2J8LA 1YXEA 1GP9A 2YILA 1JFNA 4R1CA 1W81A 3SRJA 4HZHA 3U73A 5CS9A 4Z0FA 3BT2A 1GMOA 2Z8WA 1NK1A 4Z09A 2F83A 5HPGA 2FD6A 1PK2A 1HKYA 4BVDA 1B2IA 1I8NA 3ZWZA 2QJ2A 4NZQA 1HPJA 1CEBA 5CS3A 4IUAA 2FEBA 4R19A 4O03A 2K51A 4R1AA 5CS1A 4UAOA 1GMNA 1A0HA 2PF2A 2YIOA 2SPTA 5I25A 3E6PL 2YIPA 4BVWA 2HGFA 1KI0A 1PKRA 2DOIA 2PK4A 4DURA 1CEAA 1KDUA 2DOHX 1BHTA 4Z0DA 2I9BA 5CSQA 4Z0EA 2Z8VA 1KRNA 1PK4A 3KIVA 4BV5A 1NL1A 1HPKA 2Q8BA 4R1BA 1PMKA 5CT2A 2I9AA 2QJ4A 2L0SA 4KIVA 5CT3A 1I71A 1KIVA 3NXPA 3LAQA 2Y8RA 4CIKA 2LL3A 4BV7A 4APMA 3HMRA 3HMSA 5COEA 5CS5A 2J8JA 1PMLA 3ZLEA 3K65A 1I5KA 4UV6A 2HPQP 2X2ZA 5EOKA 2KNFA 2PF1A 2LL4M 3HN4A 2HPPP 4BVVA 4BVCA
chains in the Genus database with same CATH superfamily
5CP9A 2K4RA 1W8KA 3SP8A 2Q8AA 3MKPA 4D3CA 3BT1A 5CT1A 1URKA 3SRIA 4A5TS 4YIZA 2KJ4A 4YIVA 3HMTA 1Z40A 1TPKA 4APLA 5EODA 1NL2A 2K13X 2J8LA 1YXEA 1GP9A 2YILA 1JFNA 4R1CA 1W81A 3SRJA 4HZHA 3U73A 5CS9A 4Z0FA 3BT2A 1GMOA 2Z8WA 1NK1A 4Z09A 2F83A 5HPGA 2FD6A 1PK2A 1HKYA 4BVDA 1B2IA 1I8NA 3ZWZA 2QJ2A 4NZQA 1HPJA 1CEBA 5CS3A 4IUAA 2FEBA 4R19A 4O03A 2K51A 4R1AA 5CS1A 4UAOA 1GMNA 1A0HA 2PF2A 2YIOA 2SPTA 5I25A 3E6PL 2YIPA 4BVWA 2HGFA 1KI0A 1PKRA 2DOIA 2PK4A 4DURA 1CEAA 1KDUA 2DOHX 1BHTA 2KL5A 4Z0DA 2I9BA 5CSQA 4Z0EA 2Z8VA 1KRNA 1PK4A 3KIVA 4BV5A 1NL1A 1HPKA 2Q8BA 4R1BA 1PMKA 5CT2A 2I9AA 2QJ4A 2L0SA 4KIVA 5CT3A 1I71A 1KIVA 3NXPA 3LAQA 2Y8RA 4CIKA 2LL3A 4BV7A 4APMA 3HMRA 3HMSA 5COEA 5CS5A 2J8JA 1PMLA 3ZLEA 3K65A 1I5KA 4UV6A 2HPQP 2X2ZA 5EOKA 2KNFA 2PF1A 2LL4M 3HN4A 2HPPP 4BVVA 4BVCA
chains in the Genus database with same CATH topology
5CP9A 2K4RA 1W8KA 3SP8A 2Q8AA 3MKPA 4D3CA 3BT1A 5CT1A 1URKA 3SRIA 4A5TS 4YIZA 2KJ4A 4YIVA 3HMTA 1Z40A 1TPKA 4APLA 5EODA 1NL2A 2K13X 2J8LA 1YXEA 1GP9A 2YILA 1JFNA 4R1CA 1W81A 3SRJA 4HZHA 3U73A 5CS9A 4Z0FA 3BT2A 1GMOA 2Z8WA 1NK1A 4Z09A 2F83A 5HPGA 2FD6A 1PK2A 1HKYA 4BVDA 1B2IA 1I8NA 3ZWZA 2QJ2A 4NZQA 1HPJA 1CEBA 5CS3A 4IUAA 2FEBA 4R19A 4O03A 2K51A 4R1AA 5CS1A 4UAOA 1GMNA 1A0HA 2PF2A 2YIOA 2SPTA 5I25A 3E6PL 2YIPA 4BVWA 2HGFA 1KI0A 1PKRA 2DOIA 2PK4A 4DURA 1CEAA 1KDUA 2DOHX 1BHTA 2KL5A 4Z0DA 2I9BA 5CSQA 4Z0EA 2Z8VA 1KRNA 1PK4A 3KIVA 4BV5A 1NL1A 1HPKA 2Q8BA 4R1BA 1PMKA 5CT2A 2I9AA 2QJ4A 2L0SA 4KIVA 5CT3A 1I71A 1KIVA 3NXPA 3LAQA 2Y8RA 4CIKA 2LL3A 4BV7A 4APMA 3HMRA 3HMSA 5COEA 5CS5A 2J8JA 1PMLA 3ZLEA 3K65A 1I5KA 4UV6A 2HPQP 2X2ZA 5EOKA 2KNFA 2PF1A 2LL4M 3HN4A 2HPPP 4BVVA 4BVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP9 A;  2K4R A;  1W8K A;  3SP8 A;  2Q8A A;  3MKP A;  4D3C A;  3BT1 A;  5CT1 A;  1URK A;  3SRI A;  4A5T S;  2KJ4 A;  3HMT A;  1Z40 A;  1TPK A;  4APL A;  5EOD A;  1NL2 A;  2K13 X;  2J8L A;  1YXE A;  1GP9 A;  2YIL A;  1JFN A;  4R1C A;  1W81 A;  3SRJ A;  4HZH A;  3U73 A;  5CS9 A;  4Z0F A;  3BT2 A;  1GMO A;  2Z8W A;  1NK1 A;  4Z09 A;  2F83 A;  5HPG A;  2FD6 A;  1PK2 A;  1HKY A;  4BVD A;  1B2I A;  1I8N A;  3ZWZ A;  2QJ2 A;  4NZQ A;  1HPJ A;  1CEB A;  5CS3 A;  4IUA A;  2FEB A;  4R19 A;  4O03 A;  2K51 A;  4R1A A;  5CS1 A;  4UAO A;  1GMN A;  1A0H A;  2PF2 A;  2YIO A;  2SPT A;  5I25 A;  3E6P L;  2YIP A;  4BVW A;  2HGF A;  1KI0 A;  1PKR A;  2DOI A;  2PK4 A;  4DUR A;  1CEA A;  1KDU A;  2DOH X;  1BHT A;  4Z0D A;  2I9B A;  5CSQ A;  4Z0E A;  2Z8V A;  1KRN A;  1PK4 A;  3KIV A;  4BV5 A;  1NL1 A;  1HPK A;  2Q8B A;  4R1B A;  1PMK A;  5CT2 A;  2I9A A;  2QJ4 A;  2L0S A;  4KIV A;  5CT3 A;  1I71 A;  1KIV A;  3NXP A;  3LAQ A;  2Y8R A;  4CIK A;  2LL3 A;  4BV7 A;  4APM A;  3HMR A;  3HMS A;  5COE A;  5CS5 A;  2J8J A;  1PML A;  3ZLE A;  3K65 A;  1I5K A;  4UV6 A;  2HPQ P;  2X2Z A;  5EOK A;  2KNF A;  2PF1 A;  2LL4 M;  3HN4 A;  2HPP P;  4BVV A;  4BVC A; 
#chains in the Genus database with same CATH topology
 5CP9 A;  2K4R A;  1W8K A;  3SP8 A;  2Q8A A;  3MKP A;  4D3C A;  3BT1 A;  5CT1 A;  1URK A;  3SRI A;  4A5T S;  4YIZ A;  2KJ4 A;  4YIV A;  3HMT A;  1Z40 A;  1TPK A;  4APL A;  5EOD A;  1NL2 A;  2K13 X;  2J8L A;  1YXE A;  1GP9 A;  2YIL A;  1JFN A;  4R1C A;  1W81 A;  3SRJ A;  4HZH A;  3U73 A;  5CS9 A;  4Z0F A;  3BT2 A;  1GMO A;  2Z8W A;  1NK1 A;  4Z09 A;  2F83 A;  5HPG A;  2FD6 A;  1PK2 A;  1HKY A;  4BVD A;  1B2I A;  1I8N A;  3ZWZ A;  2QJ2 A;  4NZQ A;  1HPJ A;  1CEB A;  5CS3 A;  4IUA A;  2FEB A;  4R19 A;  4O03 A;  2K51 A;  4R1A A;  5CS1 A;  4UAO A;  1GMN A;  1A0H A;  2PF2 A;  2YIO A;  2SPT A;  5I25 A;  3E6P L;  2YIP A;  4BVW A;  2HGF A;  1KI0 A;  1PKR A;  2DOI A;  2PK4 A;  4DUR A;  1CEA A;  1KDU A;  2DOH X;  1BHT A;  2KL5 A;  4Z0D A;  2I9B A;  5CSQ A;  4Z0E A;  2Z8V A;  1KRN A;  1PK4 A;  3KIV A;  4BV5 A;  1NL1 A;  1HPK A;  2Q8B A;  4R1B A;  1PMK A;  5CT2 A;  2I9A A;  2QJ4 A;  2L0S A;  4KIV A;  5CT3 A;  1I71 A;  1KIV A;  3NXP A;  3LAQ A;  2Y8R A;  4CIK A;  2LL3 A;  4BV7 A;  4APM A;  3HMR A;  3HMS A;  5COE A;  5CS5 A;  2J8J A;  1PML A;  3ZLE A;  3K65 A;  1I5K A;  4UV6 A;  2HPQ P;  2X2Z A;  5EOK A;  2KNF A;  2PF1 A;  2LL4 M;  3HN4 A;  2HPP P;  4BVV A;  4BVC A; 
#chains in the Genus database with same CATH homology
 5CP9 A;  2K4R A;  1W8K A;  3SP8 A;  2Q8A A;  3MKP A;  4D3C A;  3BT1 A;  5CT1 A;  1URK A;  3SRI A;  4A5T S;  4YIZ A;  2KJ4 A;  4YIV A;  3HMT A;  1Z40 A;  1TPK A;  4APL A;  5EOD A;  1NL2 A;  2K13 X;  2J8L A;  1YXE A;  1GP9 A;  2YIL A;  1JFN A;  4R1C A;  1W81 A;  3SRJ A;  4HZH A;  3U73 A;  5CS9 A;  4Z0F A;  3BT2 A;  1GMO A;  2Z8W A;  1NK1 A;  4Z09 A;  2F83 A;  5HPG A;  2FD6 A;  1PK2 A;  1HKY A;  4BVD A;  1B2I A;  1I8N A;  3ZWZ A;  2QJ2 A;  4NZQ A;  1HPJ A;  1CEB A;  5CS3 A;  4IUA A;  2FEB A;  4R19 A;  4O03 A;  2K51 A;  4R1A A;  5CS1 A;  4UAO A;  1GMN A;  1A0H A;  2PF2 A;  2YIO A;  2SPT A;  5I25 A;  3E6P L;  2YIP A;  4BVW A;  2HGF A;  1KI0 A;  1PKR A;  2DOI A;  2PK4 A;  4DUR A;  1CEA A;  1KDU A;  2DOH X;  1BHT A;  2KL5 A;  4Z0D A;  2I9B A;  5CSQ A;  4Z0E A;  2Z8V A;  1KRN A;  1PK4 A;  3KIV A;  4BV5 A;  1NL1 A;  1HPK A;  2Q8B A;  4R1B A;  1PMK A;  5CT2 A;  2I9A A;  2QJ4 A;  2L0S A;  4KIV A;  5CT3 A;  1I71 A;  1KIV A;  3NXP A;  3LAQ A;  2Y8R A;  4CIK A;  2LL3 A;  4BV7 A;  4APM A;  3HMR A;  3HMS A;  5COE A;  5CS5 A;  2J8J A;  1PML A;  3ZLE A;  3K65 A;  1I5K A;  4UV6 A;  2HPQ P;  2X2Z A;  5EOK A;  2KNF A;  2PF1 A;  2LL4 M;  3HN4 A;  2HPP P;  4BVV A;  4BVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...