5CT1A

The structure of the nk1 fragment of hgf/sf complexed with ches
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
173
Chain Sequence
TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Exploring the chemical space of the lysine-binding pocket of the first kringle domain of hepatocyte growth factor/scatter factor (HGF/SF) yields a new class of inhibitors of HGF/SF-MET binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 38
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 5ct1A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 5ct1A01
5EOKA 4R1CA 1HPKA 4BV5A 3HMSA 2YIPA 4HZHA 1A0HA 1I71A 4UV6A 3SRIA 5HPGA 2Q8BA 2LL4M 1NL1A 1GMOA 2YILA 2KJ4A 2DOHX 2I9AA 2QJ2A 4DURA 3ZWZA 5CT3A 2Z8WA 5CS5A 5CT1A 3U73A 4R1AA 1KI0A 2K4RA 5CS9A 1PK2A 4APMA 3SP8A 1I5KA 1HPJA 3LAQA 5CP9A 3HN4A 3HMRA 3KIVA 4APLA 5CSQA 2F83A 3ZLEA 5CS1A 1KIVA 2K13X 4BV7A 2Q8AA 2J8LA 4KIVA 2Y8RA 4Z09A 4R19A 2HPQP 2PF1A 5CT2A 2Z8VA 1GMNA 1KRNA 2DOIA 4A5TS 1PMLA 1CEAA 2YIOA 3HMTA 1URKA 2KNFA 1GP9A 1YXEA 4Z0EA 1I8NA 1KDUA 2PK4A 3K65A 3BT2A 2SPTA 4CIKA 1TPKA 1NL2A 2J8JA 1NK1A 3E6PL 2HPPP 5EODA 1CEBA 2I9BA 2LL3A 4Z0FA 4Z0DA 3MKPA 4BVCA 2FD6A 2X2ZA 3NXPA 4BVVA 1PK4A 3SRJA 1BHTA 2L0SA 4D3CA 2FEBA 2QJ4A 1Z40A 4NZQA 4R1BA 5CS3A 1W8KA 2HGFA 1PMKA 4BVWA 4IUAA 1JFNA 4BVDA 1HKYA 1W81A 4UAOA 4O03A 2K51A 5COEA 3BT1A 2PF2A 1PKRA 5I25A 1B2IA
chains in the Genus database with same CATH superfamily
5EOKA 4R1CA 1HPKA 4BV5A 3HMSA 2YIPA 4HZHA 1A0HA 1I71A 4UV6A 3SRIA 5HPGA 2Q8BA 2LL4M 1NL1A 1GMOA 2YILA 2KJ4A 2DOHX 2I9AA 2QJ2A 4DURA 3ZWZA 5CT3A 2Z8WA 5CS5A 5CT1A 3U73A 4R1AA 1KI0A 2K4RA 5CS9A 1PK2A 4APMA 3SP8A 1I5KA 1HPJA 3LAQA 5CP9A 3HN4A 3HMRA 3KIVA 4APLA 5CSQA 2F83A 3ZLEA 5CS1A 1KIVA 2K13X 4BV7A 2Q8AA 2J8LA 4KIVA 2Y8RA 4Z09A 4R19A 2HPQP 2PF1A 5CT2A 2Z8VA 1GMNA 1KRNA 2DOIA 4A5TS 1PMLA 1CEAA 2YIOA 3HMTA 1URKA 2KNFA 1GP9A 1YXEA 4Z0EA 1I8NA 4YIVA 1KDUA 2PK4A 3K65A 3BT2A 2SPTA 4CIKA 1TPKA 1NL2A 2J8JA 1NK1A 3E6PL 2HPPP 5EODA 1CEBA 2I9BA 2LL3A 4Z0FA 4Z0DA 3MKPA 4BVCA 2FD6A 2X2ZA 3NXPA 4BVVA 1PK4A 3SRJA 1BHTA 2L0SA 4D3CA 2FEBA 2QJ4A 1Z40A 4NZQA 2KL5A 4R1BA 5CS3A 1W8KA 2HGFA 4YIZA 1PMKA 4BVWA 4IUAA 1JFNA 4BVDA 1HKYA 1W81A 4UAOA 4O03A 2K51A 5COEA 3BT1A 2PF2A 1PKRA 5I25A 1B2IA
chains in the Genus database with same CATH topology
5EOKA 4R1CA 1HPKA 4BV5A 3HMSA 2YIPA 4HZHA 1A0HA 1I71A 4UV6A 3SRIA 5HPGA 2Q8BA 2LL4M 1NL1A 1GMOA 2YILA 2KJ4A 2DOHX 2I9AA 2QJ2A 4DURA 3ZWZA 5CT3A 2Z8WA 5CS5A 5CT1A 3U73A 4R1AA 1KI0A 2K4RA 5CS9A 1PK2A 4APMA 3SP8A 1I5KA 1HPJA 3LAQA 5CP9A 3HN4A 3HMRA 3KIVA 4APLA 5CSQA 2F83A 3ZLEA 5CS1A 1KIVA 2K13X 4BV7A 2Q8AA 2J8LA 4KIVA 2Y8RA 4Z09A 4R19A 2HPQP 2PF1A 5CT2A 2Z8VA 1GMNA 1KRNA 2DOIA 4A5TS 1PMLA 1CEAA 2YIOA 3HMTA 1URKA 2KNFA 1GP9A 1YXEA 4Z0EA 1I8NA 4YIVA 1KDUA 2PK4A 3K65A 3BT2A 2SPTA 4CIKA 1TPKA 1NL2A 2J8JA 1NK1A 3E6PL 2HPPP 5EODA 1CEBA 2I9BA 2LL3A 4Z0FA 4Z0DA 3MKPA 4BVCA 2FD6A 2X2ZA 3NXPA 4BVVA 1PK4A 3SRJA 1BHTA 2L0SA 4D3CA 2FEBA 2QJ4A 1Z40A 4NZQA 2KL5A 4R1BA 5CS3A 1W8KA 2HGFA 4YIZA 1PMKA 4BVWA 4IUAA 1JFNA 4BVDA 1HKYA 1W81A 4UAOA 4O03A 2K51A 5COEA 3BT1A 2PF2A 1PKRA 5I25A 1B2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EOK A;  4R1C A;  1HPK A;  4BV5 A;  3HMS A;  2YIP A;  4HZH A;  1A0H A;  1I71 A;  4UV6 A;  3SRI A;  5HPG A;  2Q8B A;  2LL4 M;  1NL1 A;  1GMO A;  2YIL A;  2KJ4 A;  2DOH X;  2I9A A;  2QJ2 A;  4DUR A;  3ZWZ A;  5CT3 A;  2Z8W A;  5CS5 A;  5CT1 A;  3U73 A;  4R1A A;  1KI0 A;  2K4R A;  5CS9 A;  1PK2 A;  4APM A;  3SP8 A;  1I5K A;  1HPJ A;  3LAQ A;  5CP9 A;  3HN4 A;  3HMR A;  3KIV A;  4APL A;  5CSQ A;  2F83 A;  3ZLE A;  5CS1 A;  1KIV A;  2K13 X;  4BV7 A;  2Q8A A;  2J8L A;  4KIV A;  2Y8R A;  4Z09 A;  4R19 A;  2HPQ P;  2PF1 A;  5CT2 A;  2Z8V A;  1GMN A;  1KRN A;  2DOI A;  4A5T S;  1PML A;  1CEA A;  2YIO A;  3HMT A;  1URK A;  2KNF A;  1GP9 A;  1YXE A;  4Z0E A;  1I8N A;  1KDU A;  2PK4 A;  3K65 A;  3BT2 A;  2SPT A;  4CIK A;  1TPK A;  1NL2 A;  2J8J A;  1NK1 A;  3E6P L;  2HPP P;  5EOD A;  1CEB A;  2I9B A;  2LL3 A;  4Z0F A;  4Z0D A;  3MKP A;  4BVC A;  2FD6 A;  2X2Z A;  3NXP A;  4BVV A;  1PK4 A;  3SRJ A;  1BHT A;  2L0S A;  4D3C A;  2FEB A;  2QJ4 A;  1Z40 A;  4NZQ A;  4R1B A;  5CS3 A;  1W8K A;  2HGF A;  1PMK A;  4BVW A;  4IUA A;  1JFN A;  4BVD A;  1HKY A;  1W81 A;  4UAO A;  4O03 A;  2K51 A;  5COE A;  3BT1 A;  2PF2 A;  1PKR A;  5I25 A;  1B2I A; 
#chains in the Genus database with same CATH topology
 5EOK A;  4R1C A;  1HPK A;  4BV5 A;  3HMS A;  2YIP A;  4HZH A;  1A0H A;  1I71 A;  4UV6 A;  3SRI A;  5HPG A;  2Q8B A;  2LL4 M;  1NL1 A;  1GMO A;  2YIL A;  2KJ4 A;  2DOH X;  2I9A A;  2QJ2 A;  4DUR A;  3ZWZ A;  5CT3 A;  2Z8W A;  5CS5 A;  5CT1 A;  3U73 A;  4R1A A;  1KI0 A;  2K4R A;  5CS9 A;  1PK2 A;  4APM A;  3SP8 A;  1I5K A;  1HPJ A;  3LAQ A;  5CP9 A;  3HN4 A;  3HMR A;  3KIV A;  4APL A;  5CSQ A;  2F83 A;  3ZLE A;  5CS1 A;  1KIV A;  2K13 X;  4BV7 A;  2Q8A A;  2J8L A;  4KIV A;  2Y8R A;  4Z09 A;  4R19 A;  2HPQ P;  2PF1 A;  5CT2 A;  2Z8V A;  1GMN A;  1KRN A;  2DOI A;  4A5T S;  1PML A;  1CEA A;  2YIO A;  3HMT A;  1URK A;  2KNF A;  1GP9 A;  1YXE A;  4Z0E A;  1I8N A;  4YIV A;  1KDU A;  2PK4 A;  3K65 A;  3BT2 A;  2SPT A;  4CIK A;  1TPK A;  1NL2 A;  2J8J A;  1NK1 A;  3E6P L;  2HPP P;  5EOD A;  1CEB A;  2I9B A;  2LL3 A;  4Z0F A;  4Z0D A;  3MKP A;  4BVC A;  2FD6 A;  2X2Z A;  3NXP A;  4BVV A;  1PK4 A;  3SRJ A;  1BHT A;  2L0S A;  4D3C A;  2FEB A;  2QJ4 A;  1Z40 A;  4NZQ A;  2KL5 A;  4R1B A;  5CS3 A;  1W8K A;  2HGF A;  4YIZ A;  1PMK A;  4BVW A;  4IUA A;  1JFN A;  4BVD A;  1HKY A;  1W81 A;  4UAO A;  4O03 A;  2K51 A;  5COE A;  3BT1 A;  2PF2 A;  1PKR A;  5I25 A;  1B2I A; 
#chains in the Genus database with same CATH homology
 5EOK A;  4R1C A;  1HPK A;  4BV5 A;  3HMS A;  2YIP A;  4HZH A;  1A0H A;  1I71 A;  4UV6 A;  3SRI A;  5HPG A;  2Q8B A;  2LL4 M;  1NL1 A;  1GMO A;  2YIL A;  2KJ4 A;  2DOH X;  2I9A A;  2QJ2 A;  4DUR A;  3ZWZ A;  5CT3 A;  2Z8W A;  5CS5 A;  5CT1 A;  3U73 A;  4R1A A;  1KI0 A;  2K4R A;  5CS9 A;  1PK2 A;  4APM A;  3SP8 A;  1I5K A;  1HPJ A;  3LAQ A;  5CP9 A;  3HN4 A;  3HMR A;  3KIV A;  4APL A;  5CSQ A;  2F83 A;  3ZLE A;  5CS1 A;  1KIV A;  2K13 X;  4BV7 A;  2Q8A A;  2J8L A;  4KIV A;  2Y8R A;  4Z09 A;  4R19 A;  2HPQ P;  2PF1 A;  5CT2 A;  2Z8V A;  1GMN A;  1KRN A;  2DOI A;  4A5T S;  1PML A;  1CEA A;  2YIO A;  3HMT A;  1URK A;  2KNF A;  1GP9 A;  1YXE A;  4Z0E A;  1I8N A;  4YIV A;  1KDU A;  2PK4 A;  3K65 A;  3BT2 A;  2SPT A;  4CIK A;  1TPK A;  1NL2 A;  2J8J A;  1NK1 A;  3E6P L;  2HPP P;  5EOD A;  1CEB A;  2I9B A;  2LL3 A;  4Z0F A;  4Z0D A;  3MKP A;  4BVC A;  2FD6 A;  2X2Z A;  3NXP A;  4BVV A;  1PK4 A;  3SRJ A;  1BHT A;  2L0S A;  4D3C A;  2FEB A;  2QJ4 A;  1Z40 A;  4NZQ A;  2KL5 A;  4R1B A;  5CS3 A;  1W8K A;  2HGF A;  4YIZ A;  1PMK A;  4BVW A;  4IUA A;  1JFN A;  4BVD A;  1HKY A;  1W81 A;  4UAO A;  4O03 A;  2K51 A;  5COE A;  3BT1 A;  2PF2 A;  1PKR A;  5I25 A;  1B2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...