5CTRC

Crystal structure of human sart3 hat-c domain-human usp4 dusp-ubl domain complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
206
structure length
206
Chain Sequence
b'RPDAETQKSELGPLMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRKVVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Squamous cell carcinoma antigen recognized by T-cells 3
molecule tags Immune system, nuclear protein, rna binding protein, hydrola
source organism Homo sapiens
publication title Structural basis for recruiting and shuttling of the spliceosomal deubiquitinase USP4 by SART3
pubmed doi rcsb
total genus 32
structure length 206
sequence length 206
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06337 DUSP DUSP domain
C PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5ctrC02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 5ctrC01
1AARA 5JHAA 4OVVA 2IZVB 2JRHA 1L7YA 3LDZE 3GOEA 5DPRA 5AZHA 2MBQA 4G11A 3QAQA 4KSKC 2M0XA 4A20A 1J19A 3APCA 4BBNF 4ANVA 4KIKA 4TQ1A 2O6VD 3V6EB 5C1ZA 4FHJA 2WX1A 3JSVB 3UIOB 3QWZB 1MG8A 2DENB 2FCQA 2KWUB 2R2QA 4NNJB 3V62A 1P98A 3TJPA 3L17A 2D11A 2D07B 1E90A 2RD0A 2M8SA 2O6VB 2D10A 1LFDA 4GOCA 5L83A 1RAXA 2HJ8A 4KDLB 2BF8B 2MBOA 3V60A 1P0RA 3S2AA 3N3KB 3VUWA 3QIJA 4B9KA 4FJYA 2K8BA 4XX5A 2Y5BB 3VUYA 2OJRA 1WYWB 2KOXA 2G4SA 1SIFA 2EKEC 4BKTA 1WE6A 1WXMA 2N9EB 1PQSA 4IC7B 4JQWC 5CTRC 4DHJB 4MELA 4E74A 3VH3B 2AEHA 4II2B 1E8WA 4EKUA 3WAMA 1NI2A 4FLHA 4B6WA 3PZDA 2K6QA 3WAPA 1NBFC 3QCAA 5LXHA 3AU5A 1M94A 4NY0A 2LXAA 3ZDTA 4GXBA 2KX0A 1HE8A 5D94A 3CSTA 4ZRIA 2BGFA 1FXTB 1U4AA 2MBHA 2WWZA 4HWIB 4W9LA 2NPTB 4ANUA 2ZJDA 2MW5A 5TR5A 2N1WA 2MRPA 5C23A 1I42A 2HD5B 4FN2A 3JVZX 4GSWA 1V81A 3WAOA 4FHKA 4G50A 2KLCA 3PRZA 3UGBB 2D3GA 1YD8U 3CMMB 4RM8A 2WYQA 2C7HA 4HCNB 5L95C 4HDQA 4WJOA 4AUQC 5CHFA 4RMAA 1WX8A 1E5WA 3IFWB 3DVNV 2FCSA 3HK0A 2EMTA 4II3B 1V2YA 2CHWA 3UQAA 1GC7A 1EF5A 2KQSA 2NR2A 3DOWA 4PS3A 5DPSA 3K9OB 3ML9A 2PEAA 1Z5SB 3ZDMC 3A9JB 2BWFA 3SDLC 2L00B 2Z0EB 3DCGA 1K8RB 2KJ6A 4WJPA 3PLUA 1XT9B 3KH0A 3VVWB 3M3JA 3ZO5B 3KW5B 4W9JA 4I6PA 2MP2A 2NCNA 5CHWA 4M0WB 3PHWB 1T0YA 2YVCA 3BINA 2DYBA 4GDKA 4K7WA 4HXDA 4W9FA 3VHTC 3N30A 3JW0X 2D2QA 3VQIA 3IVFA 2YLMA 4F1SA 3DVGX 2JPHA 4K7SA 4W9IA 3A1QA 2JY6A 4NQKE 3TBLD 4EZLA 1LQBA 1E8XA 1TZ1A 4WWNA 1WX7A 1RRBA 2I1JA 4K7UA 3JYUA 2B3AA 2DZKA 3DDCB 2AWTA 2QHOA 3AU4A 4ICUA 2WDTB 4IWOA 4CHKA 2L3ZA 1UBQA 3QX1A 4KDIC 2KC1A 3PRPB 4LDTB 3ZKJC 4EUTA 3B08A 3VXWA 2O2VB 3MJWA 3OLMD 2MCNB 4EZKA 3KUDB 4EFOA 5GMVA 4I6LB 1ZGUB 1WXVA 3KYDD 2KO3A 3VTUA 1OEYJ 2LXCA 1IPGA 2KMAA 2KHWB 3SHQA 2NBWB 3DBHI 2V1YA 1CMXB 2KD0A 1Y8RC 1OGWA 4I6NB 3ZVVA 3A4SC 2CKHB 1OQYA 3BY4B 5BO4B 4K81A 2IO2B 2JZZA 2KNBA 1E7UA 3PHXB 3TL5A 3LMNA 3NS8A 3ECIA 4MJSA 1WX9A 3O65B 4BFRA 1V86A 3H7PA 4RM9A 2LI5A 5FR6A 3L08A 3M62B 5G55A 5LLIA 4MEMA 1WI0A 3W1SA 1WGHA 1WGRA 2CHZA 1YJ1A 3HIZA 2OOBB 4CYEA 4M8MA 1GUAB 3QARA 5DCNA 1WXSA 2L0TA 1OTRB 2KFKB 4GDLB 4BOSC 3A9JA 4KZCA 3ONSA 3L16A 1Q0WB 2LASA 4WAAA 1EF1A 5E6PA 2LUEA 5HKHA 3ZTCA 2ZPYA 2FCNA 2LVQA 2J0KA 2FCMA 2KFJA 2KTRB 2RSUA 3IG3A 3PPAA 4JL9A 3HM6X 5CHVC 2ZCCA 1KOTA 5AEKB 2CHXA 2LVOA 1WJNA 3NHEB 4MDKE 4PS7A 4W9KA 2BKRB 2ZNVC 4HK2A 4KV2A 4IUMB 2XBBC 1F9JA 1J8CA 3CSFA 2EMSA 4GMVA 3WANA 1KJTA 2KDIA 3ENEA 2GBNA 3NY5A 1WJUA 2BYFA 3B0AA 5E6OA 2KJRA 1WMHA 4JIOU 3KUZA 3EECA 3D32A 2DAJA 2GOWA 1KM7A 3UINB 4HCPB 1IYFA 5DPWA 2KQ7A 1E8YA 4MH0E 2AYOB 4WWOA 4WQOB 2RR9A 4P7IA 2KWVB 4HPMB 3C0RB 4KVGB 4IG7B 2IY0B 1ZKHA 1BT0A 2JXXA 2KMCA 3TIXA 1C1YB 2LGXA 3T8MA 3DQVA 1UGMA 3H9DA 4IW0A 4DDGD 3APDA 1L2NA 4LJPB 2K8CA 1GG3A 2C7MB 4YL8A 5D2MB 4TV3A 1OEYA 1EO6A 4WJNA 3RZWC 3RZFA 4GGQA 2JUOA 3Q3FA 2MLBA 4F8CB 2NBUA 4W9DA 3WA0A 2PE6B 2LZ6A 1S3SG 2ASQA 2K25A 1WGDA 1WM3A 2GBJA 3ALBA 3H7SA 3ZNZB 4XZ4A 4MGZE 3AXCA 2MP2B 1WR6E 3KYCD 3A9KB 3PVLA 5EDSA 1QZEA 2MX2A 1E8ZA 2PPHA 3APFA 4JLCA 2DYOA 1VD2A 4AWJA 3PRMB 2FIDA 3R7RA 4OVUA 2CU1A 2K6DB 3A33B 4WWPA 5JH5C 3A9KA 3A1QB 3UF8A 2DZIA 4BKSD 4E71A 1V6EA 5AZGA 4URKA 2ZVOA 4JGHB 2FNJB 3ZRCA 4KIKB 3PGEA 2IYDB 3ZLZA 2G4DB 2N4FA 1UD7A 2JRIB 2L76A 3JSVA 4ZDVA 2LJ5A 4KSLC 3B1LX 3L10B 3RT3B 1WFYA 3QK0A 4FJVB 2MBBB 2O2VA 1WIAA 3L13A 4ASWC 2LD9A 3MHSD 4HJKA 3ZRFA 2C7NB 4W9EA 5G2NA 3DVNU 2V3SA 2DX5B 2BYEA 2XK5A 3TMPB 4EOYA 1WY8A 2FUHB 1H4RA 4NJ7A 2JWZA 1WMHB 3DBSA 4AJYB 5LXIB 2VRRB 5IA7A 2KJHB 4IWQA 3M63B 1RLFA 1Z2MA 2XK5B 3M95A 2ZNVB 2Z0DB 4N9F4 3RYTA 1WJ6A 3NOBA 3W1SC 1ISNA 4DBGA 2GBMA 4DHJD 4E3CA 3PSEB 3AI5A 3QHTA 1ZW7A 3OJ3A 4LJOB 5D7GA 1GJZA 5CX3A 2LVPA 3EHVA 3PT2B 2KXJA 4IM3A 4TUUA 3RULA 4NAWB 4PYZA 4B95A 3PREA 3VH4B 3GZNI 1W6VA 1WRDB 2R2OA 4W9CA 3V6CB 3SD5A 2JVCA 4MSQB 4F7ZA 1R4MI 2G3QB 4CO7A 4DHZE 2NPTA 4FA6A 3RD2A 2M17A 1WH3A 2L8JA 1V9JA 2KTRA 1G6JA 3EC8A 3ZNGC 3ZW3A 2I1KA 2IO0B 2N9PC 1UH6A 1YX6B 5JHBA 4BKSA 3HM3A 4X57B 1WF9A 3SU8X 1V5OA 4KZ0A 2KLGA 4ANXA 3VUXA 2HTHA 4PS8A 5KHQA 1WE7A 2RGFA 4HVBA 2XEWA 3PV1A 1WJ4A 4BKGA 1WXAA 1YQBA 4K1RB 5IAAC 4FBJB 2AL6A 2JF5A 3ZIMA 1C3TA 2AL3A 3A4RA 1XD3B 3R3MA 4DK5A 2KZRA 4FJZA 2LGYA 2KDBA 3EFUA 2CS4A 3LJ3A 2UYZB 4W9HA 1GC6A 2KVRA 1TGZB 1V49A 2J0JA 2KWCA 2MSED 3TCAA 3VFKA 3VTWA 4ZRKA 1YIWA 2Z59B 2JZ3B 1I35A 4IM0A 3DBRI 2J7QB 1YX5B 4LCDE 1SE9A 2DHZA 2V4LA 3DBLI 4LDTD 3W1YA 2IO1B 4PYUA 2ZEQA 4BBNC 5E6NA 2REXA 2KDFB 3QQ8B 3H1UA 4DXAB 3U7DA 3H6NA 3VAWA 2KX3A 4MGIE 2KTFA 1P9DU 3X23A 1SGHA 3U8ZA 1P3QU 3PS6A 1TTNA 4EEWA 1RFAA 3P2BA 2MBEA 2KDEB 4MM3A 2KC2A 2WX0A 2KN5A 3RCZA 1XQQA 2N7DA 2DZMA 1VCBA 2L7RA 3DPDA 3ZUNA 3PLVA 2HE7A 2A5UA 2L0FA 4W9GA 3V61A 3CF6E 2LRWA 2NVUI 1WR1A 2IY1B 3L0WB 4M8NA 1V5TA 1S1QB 2FIFA 2M4NA 3NZUA 2KFKA 1WZ0A 2PJHA 3KVFB 4GDLA 2DZJA 1GNUA 4A3OA 3QC8B 4MSMB 3T9LA 1LM8B 2A4ZA 3L54A 4BVUC 1H8CA 4J6IA 2N1VA 3IBEA 3UIPB 1P1AA 2N9XA 4MJSB 4MGYE 4G3XB 4NQLB 3R7QA 3U30A 3ZTDA 1D3ZA 3H7PB 2KKCA 2KK8A 2ZVNA 3ZNID 4DHZB 2MA9B 2RPQA 3QJZA 4BOZB 2K8HA 1Q5WB 1EUVB 2G45B 1E7VA 3Q3JA 3OJ4B 4NPNA 4HLEA 1JRUA 1A5RA 4XC2A 2C5LC 5D6JB 3WIMA 3OAWA 2N7EA 1IP9A 2BPSA 2DYMA 2O6VA 4GIVA 2GBKA 2PE9A 2BKFA 1WGGA 2M1MA 1Q1OA 4DDID 3VTVA 5KHOA 4IM2A 2K39A 4NJ6A 3AULA 2GBRA 1X1MA 4GN1A 2ZPNA 5AZFA 3UQBA 5J2RA 4FULA 2J0MA 1TBEA 2NBVB 4IWPA 3HHMA 4AJWA 1WZ3A 3N32A 2LRUA 3PTFC 1UELA 4ZYNA 3R66C 4ICVA 4NAWA 3ZNHB 5DPTA 4GU2A 2BYVE 2BWES 2K1FA 1V80A 2LGDA 3NZSA 1NDDA 2GMIC 1UZXB 3WALA 2C60A 4A3PA 2DAFA 4EZJA 1WM2A 1LXDA 2MQJA 4GDKB 1J0GA 5J17A 1R4NI 4GB9A 3KUCB 2LWPA 4MGKE 4TKNA 1UBIA 1WGYA 4G0NB 5JZEB 2ZZPB 2IBIB 2UWQA 3MTNB 4HPLB 2MWSB 2IO3B 4ANWA 3RUIB 2FAZA 2L05A 2CR5A 2KANA 3ML8A 2C9WB 2ZCBA 3DVGY 2NS5A 3I3TB 4WJQA 3X0WA 5J18A 4ZRJA 3K9PB 4HDOA 3QA8A 3VDZA 1KLVA 4AP4C 4TQ0A 2W9NA 4FADA 4DWFA 2JT4B 3IHPC 4AOFA
chains in the Genus database with same CATH superfamily
1AARA 1HZ5A 5JHAA 2LGSA 5DPRA 3LDZE 2WXRA 5AZHA 3QAQA 4BBNF 4ANVA 1UWXA 1JCKB 2J53A 2WX1A 4ACFA 3QWZB 4B0EA 3L17A 5H8YE 3FILA 2M8SA 1LFDA 4RGOS 1EWYC 2WNMA 3GB1A 1SJHD 4KDLB 3W2DA 3V60A 2L83A 4B9KA 1K53A 2K8BA 3VUYA 2JWUA 3ZJUA 3Q3MC 1WE6A 1WXMA 2N9EB 1ENFA 2SAKA 2KVZA 4E74A 1YN4A 3WAPA 3AE3B 3QCAA 5LXHA 2ON8A 2FUG1 3ZDTA 2BGFA 1FXTB 4HWIB 1C78A 2BS3B 2NPTB 1ESFA 2MRPA 5C23A 3WAOA 4FHKA 3LB8C 2D3GA 3CMMB 4WJOA 4A55A 1QLBB 5BYRA 1E5WA 1NYQA 3IFWB 2FCSA 2EMTA 1V2YA 5HI1A 3AM9A 2Y5PA 3OWEB 2NR2A 3DOWA 4PS3A 1YN3A 3K9OB 4PK1A 1NVID 3MJ5A 3A9JB 3AEDB 1TS4A 1QOGA 1SB3C 2EKIA 3DCGA 1SBBB 1KLUD 3PLUA 3ZO5B 1C77A 4I6PA 2MP2A 4M0WB 4W9FA 3PHWB 3BINA 2DYBA 4GDKA 4K7WA 3N30A 4O1NA 1LO5D 1T0RC 3NG0A 4F1SA 2JPHA 4EZLA 1E8XA 3B9JA 4YT0B 1WX7A 3MP9A 1GAQB 3CWIA 4MACA 4IWOA 1FNVA 3QX1A 2KWDA 2N7JA 1C4PA 2O2VB 4R3DA 1VZ8A 3KUDB 1KFYB 1OFFA 2KO3A 3RI7C 1IPGA 1ACCA 2NBWB 4YTNB 4H2AA 3A4SC 2CKHB 4M02A 1VZ7A 2WQYB 1WX9A 4BFRA 4D2KA 1V86A 1YNTE 2KDMA 4RM9A 2LI5A 4PT5A 1WI0A 3LYYA 2CHZA 3MC8A 5FK9C 1DOIA 3QARA 4BOSC 3I63C 1E10A 4RNAA 3R2TA 1HTOA 2LVQA 5BMGA 4HROA 2KFJA 3RPFC 2LVOA 3NHEB 4MDKE 3DBLB 2JX5A 3ZXVA 4C7YA 5FKAC 3CSFA 3WANA 2QJLA 1JRPA 3N1YC 2BYFA 3EECA 2GOWA 1D6EC 1KM7A 4HCPB 2KQ7A 3NRZA 4MH0E 2RR9A 3AE9B 1JQ4A 1IUEA 2BW2A 3C0RB 3P63A 1L4DB 1GG3A 2C7MB 3Q8CA 1QOBA 2LGIA 2H89B 4WJNA 4GGQA 2JUOA 4F8CB 4W9DA 2CJOA 2PE6B 3WA0A 1XF5L 3H7SA 3VR9B 4LNOA 1D5XC 4XZ4A 1C9FA 1WR6E 3PVLA 2INNE 2QCZA 5EDSA 1QZEA 5BYSA 2MX2A 1E8ZA 2PPHA 2K9XA 3MFGA 1XLNA 2K6DB 5JH5C 3A9KA 4BKSD 4E71A 2IGHA 1VZ6A 3OG5A 4XGAB 3ZRCA 3PGEA 3RFZB 3ZLZA 3BVMA 1UD7A 4ZDVA 1MVKA 3HRDD 3L10B 3RT3B 1EM7A 1WIAA 3L13A 4W9EA 2ZW0A 5JXVA 2BYEA 1PYWD 2FUHB 2JWZA 1WMHB 3DBSA 3TEZA 2J4XA 4XDCA 3E9SA 3BZDB 1QF6A 4N9F4 3NOBA 4DHJD 1JROA 2GBMA 1V1OA 1ZW7A 3OJ3A 4LJOB 5CX3A 4RF0A 1E6EB 2KXJA 4TUUA 4PYZA 4B95A 1IBXB 4JPSA 3GZNI 1WRDB 4MSQB 4LNIA 2WP9B 1R4MB 1WH3A 3EC8A 2D3CA 1UH6A 5LNK1 1HTQA 3SU8X 3W9CB 5D3IB 2HTHA 4PS8A 5KHQA 1D5ZC 1UWMA 1C3TA 2AL6A 3ZIMA 2Y5CA 4DK5A 2KZRA 4FJZA 2LGYA 2CS4A 2UYZB 4W9HA 1NYRA 1KTKA 3VTWA 3AEEB 4XYCA 1YIWA 2Z59B 2K3UA 4C56C 1K51A 4KKJA 4XWTA 1B1ZA 2J7QB 1SE9A 2DHZA 3W1YA 5E6NA 3H1UA 3U7DA 3H6NA 4MGIE 3X23A 1SGHA 1TTNA 2RMMA 4EEWA 1MG4A 2W3RA 2MEKA 3ZUNA 3ZGZA 2L0FA 1Q10A 2IY1B 4M8NA 2FIFA 4A3OA 2PJHA 1WZ0A 1SSNA 3AE7B 4MSMB 1LM8B 3L54A 3UIPB 1P1AA 2N9XA 1D3ZA 1FXAA 3U30A 1NEKB 3PZ7A 3R2IA 1KRHA 3P1MA 3Q3JA 1VDVA 3FILB 3WIMA 1YMHE 2N7EA 2PE9A 2HDEA 2M1MA 3VTVA 1TKYA 2BQQA 4IM2A 5EE0A 2GBRA 4P1CC 4C7ZA 2J0MA 1TBEA 2NBVB 4IWPA 4AJWA 1WZ3A 2WS3B 3PTFC 1PFDA 1TJEA 4NAWA 1F1HA 2ICIA 5DPTA 2BYVE 1V80A 3AV8A 1WM2A 1LXDA 2Q5WD 3EFCA 4GDKB 4HRSA 1J0GA 1BUIC 5J17A 3U7ZA 1YN5A 3Q8EA 3O13A 1RFKA 4OVZA 1L4ZB 2DNFA 4HPLB 3RUIB 3ML8A 1SE3A 3DVGY 3X0WA 3K9PB 4RH6A 4OHJA 3EUB2 1KLVA 3B2GA 4AOFA 4OVVA 2JRHA 5IOIA 3DHIC 4B0MA 2M0XA 4OZBA 5MPOA 3ZYYX 4HKZE 1GB1A 4KIKA 1K52A 3V6EB 4FHJA 3JSVB 1EU4A 1K50A 2DENB 2FCQA 2KWUB 2R2QA 3TJPA 2D11A 2D07B 2RD0A 2LHDA 1TY2A 4RF1A 4C4VB 1L6UA 1P0RA 1ZUD2 3VUWA 3QIJA 4FJYA 4XX5A 1ZDXA 1WYWB 4JQWC 1PQSA 2QEJC 4C00A 1L0YB 3Q3NC 2AEHA 3RNCC 3DWMA 2RDBC 2LXAA 4GXBA 3PO0A 4AQ7A 2MBHA 2ZJDA 4RGMA 5TR5A 1FCLA 1XXGA 2QDFA 1V81A 4US9A 1QOFA 1FCCC 4G50A 4USAA 3PRZA 1YD8U 3DWGC 2WYQA 3N9YC 4HDQA 4AUQC 4RMAA 3DVNV 3HK0A 2G9HD 4II3B 1ZDVA 2V9HA 3AEAB 1WSPA 2JXTA 2PEAA 1Z5SB 3ZDMC 5BMHA 1STEA 1BXTA 1K8RB 5EE3A 3M3JA 2BBCA 3KW5B 1JALA 5HHDG 1B9RA 5CHWA 3VHTC 2GLSA 3HVDA 2KQ4X 2D2QA 3VQIA 2YLMA 4DXFA 3IT4B 4NQKE 1RRBA 2I1JA 3JYUA 2QIEB 3AU4A 4ICUA 2WDTB 1UBQA 4KDIC 3BIID 3ZKJC 1PGBA 3MJWA 4EFOA 5GMVA 2BYTA 2KHWB 3SHQA 3DBHI 2XN9C 1CMXB 1OGWA 5G5HA 3BY4B 5BO4B 3NS1A 2IO2B 2GI9A 3TL5A 3LMNA 3HVZA 4MJSA 3TEYA 3GE8C 3H7PA 3IXSA 2IPKD 5FR6A 3L08A 4YSXB 5LLIA 2OEDA 1WGHA 1WGRA 2I38A 1YJ1A 5AUIA 2OOBB 4CYEA 3DBRB 5DCNA 1VLBA 1OTRB 4GDLB 3ONSA 2INCC 2JZPA 4WAAA 4IDIA 1EF1A 2V3NA 5HKHA 2WU5B 2J0KA 4LLGM 3IG3A 4JL9A 5CHVC 2ZCCA 2CHXA 4OZAA 1WJNA 4PS7A 4W9KA 3L4PA 4KV2A 1F9JA 3RMKC 4GMVA 2KACA 5E6OA 1WMHA 5I4DA 2WLBA 1MHXA 4P7IA 2KWVB 4KVGB 1BT0A 2KMCA 1CK1A 1UGMA 4DDGD 3U4EG 5GXGB 2WXKA 4TV3A 1OEYA 3N1XC 3AE2B 2QSDA 3Q14C 4WWMA 2LFIA 1T5XD 3Q3FA 1YQ4B 1S3SG 2CJNA 1WGDA 2GBJA 3ALBA 3ZNZB 2N9LA 1QILA 1MJDA 3KYCD 4A6QA 3A9KB 3APFA 1GPXA 4LNFA 4AWJA 1EU3A 1BMLC 4RFBA 3TSSA 3AEFB 4HEA1 4ZHPA 3A1QB 3UF8A 4URKA 4JGHB 2FNJB 2G4DB 2N4FA 2JRIB 2L76A 2LJ5A 4ASWC 4YWGG 3VRBB 4HJKA 3DVNU 1RWSA 1WY8A 1L0XB 1H4RA 2VRRB 5IA7A 2KJHB 2MJEA 1RLFA 1Z2MA 2XK5B 3ZJVA 1TT5B 4XE0A 3RYTA 1T0SC 1TIFA 3NVVA 3W1SC 4DBGA 3QHTA 3AI5A 5D7GA 1GJZA 1TKEA 3RULA 4NAWB 1HZ6A 2BTEA 2R2OA 4W9CA 3TUOA 1ZXHA 1R4MI 4CO7A 3Q8AA 4DXGA 3RD2A 4ZYSA 2JYEA 1V9JA 3ZNGC 1E0ZA 1YX6B 5JHBA 1ZXIA 4X57B 2KLGA 4ANXA 3VUXA 3P4SB 2D3AA 1FM0D 2RGFA 4L1BA 3PV1A 4M0WA 4BKGA 1YQBA 5C2TB 3ZQ4A 2JF5A 3E56A 5HFYA 2AL3A 3A4RA 3R3MA 2Z8LA 2KDBA 1ZE3D 3EFUA 1CQVA 3LJ3A 2KVRA 1TGZB 3TCAA 3VFKA 5BYQA 1I4HA 3Q8BA 2D5GA 4MH8A 1YX5B 2MJ3A 2IO1B 4PYUA 2GB1A 4BBNC 1I4RA 3QQ8B 3GP7A 4DXAB 3WCQA 1P9DU 3PS6A 1XEEA 2PMVA 1N63A 2KDEB 3J9CA 4MM3A 5D3DA 2L52A 2N7DA 3DPDA 1VCBA 2VH2A 2IDYA 4ZOHC 3PLVA 2HE7A 5T8IA 4W9GA 3CF6E 2LRWA 1WR1A 1AYFA 3T3NA 1JWSD 2QMTA 3R8BA 4J6IA 3IBEA 3GE3C 5IN7A 4G3XB 2WDQB 3R7QA 1V1PA 2ZVNA 1XCQL 3ABVB 2RPQA 3KWVA 3QJZA 1Q5WB 1JRUA 2C5LC 4NZLB 2DYMA 4GIVA 2BKFA 4DDID 4REZA 1Q1OA 3Q6BA 4C4VA 2WU2B 2K39A 4RGTA 3AULA 1WGKA 1X1MA 4EE2A 4YTMB 3HHMA 1QT9A 4YXDB 4ZYNA 3SFDB 4GU2A 2C60A 4A3PA 4EZJA 4JWSC 2MQJA 2WXJA 4GB9A 4WAFA 2WXOA 4TKNA 2PVGC 1D5MC 4KGSA 1UBIA 2VZKB 4IOIE 1ROEA 2ZZPB 2IBIB 2UWQA 4ANWA 1DOYA 1HA5A 2FAZA 2CR5A 3URYA 2C9WB 4WJQA 2D3BA 1I7HA 3QA8A 1JWMD 4TQ0A 4KX6B 3Q2AC 1MHHE 4FADA 2QC8A 1P7EA 1HXYD 2QILA 5AUKA 2IZVB 2MBQA 4G11A 1J19A 3APCA 4TQ1A 3RNAC 1TKGA 4WIPA 4NNJB 2AX5A 1JMLA 3GZNB 1UF0A 4GOCA 1RAXA 2KN4A 3S2AA 3N3KB 2V3PA 1C4CA 1SXTA 2Y5BB 2OJRA 2KOXA 2G4SA 4IC7B 5CTRC 4MELA 1FO4A 1LGRA 3VH3B 2YEPF 4II2B 2KT7A 3AMZA 3WAMA 2K5PA 1SJED 2WXHA 1M94A 1AW7A 4NY0A 4ZHOA 1WXQA 5D94A 4ZRIA 1FPYA 4W9LA 4P1BC 4XWWA 2MHJA 3PZ8A 2N1WA 3H8HA 3EA6A 2HD5B 2M19A 4GSWA 1TS2A 4HCNB 3C8YA 3DHGC 5CHFA 1WX8A 1T0QC 1GC7A 5DPSA 2N9KA 3ML9A 1V97A 2Z0EB 4ITKA 1XT9B 3KH0A 4P6VF 4W9JA 1VJKA 4L2YA 3NVWA 1FFVA 4RCOA 4HXDA 1FNUA 3IVFA 4LNKA 4K7SA 3A1QA 1GB4A 4BZAA 2B3AA 2DZKA 3DDCB 2L3ZA 3Q69A 1I4GA 4LDTB 4EUTA 4LTUA 2MCNB 4EZKA 1ZGUB 3P4QB 5G5GA 1WXVA 3KYDD 2LXCA 2KMAA 1ET6A 1YJIA 2KD0A 1Y8RC 4FXCA 1OQYA 4K81A 2JZZA 1E7UA 3V3XA 3NS8A 1F2RI 4K3CA 3NUHB 3O65B 2IGGA 2PW9A 2WXPA 4MEMA 2M56B 3W1SA 3U52E 4ZRPA 4M8MA 1ZP0B 2L0TA 2KFKB 1I4XA 1Q0WB 1C4AA 2LUMA 2ACZB 2LUEA 1F2RC 2W54A 1WYGA 2FBWB 3ZTCA 2LJIA 2ZPYA 1JWUD 2FCNA 2FCMA 2RSUA 3HM6X 2BKRB 1DGJA 1N61A 2XBBC 1J8CA 2EMSA 1KJTA 1WJUA 3TEWA 3B0AA 4JIOU 3KUZA 2WDVB 3D32A 2DAJA 1IYFA 4JWUC 5DPWA 1E8YA 4WWOA 3RNBC 2E6XA 4CQNA 4IG7B 3TIXA 1C1YB 2LGXA 3T8MA 4LJPB 2K8CA 5D2MB 2I2YA 1EO6A 3RZFA 2OHFA 2H88B 4OW0A 1I4PA 2LZ6A 2DBYA 1SE2A 1ET9A 2ASQA 2K25A 5H92C 5EE9A 4UDUC 4MGZE 1CJEA 1T3QA 1FNWA 3AXCA 2L32A 1SE4A 2ZW1A 3R7RA 3B2FA 2CU1A 4OVUA 2DZIA 1V6EA 5AZGA 2ZVOA 3AE1B 2IYDB 1L0VB 4KSLC 2CU3A 1QOAA 2X8XX 1V1PB 4K3BA 3P4PB 3N20C 3BK2A 2W3SA 3MHSD 2C7NB 5G2NA 5BMIA 2V3SA 2XK5A 3TMPB 4EOYA 3BWUD 3ZXRA 1XLPA 4NJ7A 4AJYB 5LXIB 1FEHA 3M95A 2Z0DB 1ISNA 3RNFC 3PSEB 1M4VA 2LVPA 3EHVA 3PT2B 1KF6B 4IM3A 2WXMA 2LEKA 3VH4B 3SD5A 4FA6A 2G3QB 2WXGA 2NPTA 2FE8A 2BB5A 3KQ4A 3AE6B 2KTRA 1G6JA 1PDXA 1R7SA 1KLGD 2I1KA 2LHEA 4N58A 3FC4A 3KWLA 4BKSA 1UGJA 1R4NB 4HVBA 2XEWA 4WH4A 1WXAA 4K1RB 4WQMA 4US8A 1EWCA 1FIQA 3RN9C 1V49A 3AE8B 4ZRKA 2KAJA 3RNEC 3SEBA 4LCDE 3DBLI 1CZPA 2OJWA 2HJ1A 5FR3A 2MJDA 1FRRA 3U8ZA 1P3QU 1RFAA 4HPPA 2MBEA 1XCTL 3HUIA 3AE5B 2WX0A 1XQQA 2DZMA 2L7RA 2E3TA 1XLQA 3V61A 2NVUI 3MHZA 1S1QB 3NZUA 4GDLA 1JWAD 1MFWA 2NMQA 2A4ZA 2J42A 1H8CA 2N1VA 1N60A 3SFEB 3ZTDA 3Q3OC 2L1AA 4DHZB 4BOZB 1WWTA 2K8HA 2WXIA 2G45B 1AN8A 1E7VA 3IT6B 4NPNA 4HLEA 1A5RA 3IAM1 5D6JB 2INPE 2BPSA 1WGGA 2WXLA 4A9AA 3NZ3A 2JU6X 2K22A 2ZPNA 5AZFA 3UQBA 4FULA 3ZJTA 1UELA 3R66C 3ZNHB 1N5XA 4QAYA 2BWES 2K1FA 3NZSA 1NDDA 2GMIC 2GRIA 1UZXB 2DAFA 4XDDA 3KUCB 2LWPA 4MGKE 1IGDA 1WGYA 4G0NB 1RYJA 2IO3B 1VRAB 2L05A 4KKIA 4GLSC 4MT5A 3CIRB 4L23A 4M01A 2NS5A 3I3TB 5J18A 1FFUA 4ZRJA 3SR6A 4A90A 1I4QA 1QKZA 4DWFA 1UNSA 1L7YA 3GOEA 4KSKC 4A20A 2VH1A 2O6VD 5C1ZA 3UIOB 1MG8A 4NJCA 3N1ZC 3V62A 3AECB 1P98A 1F52A 1E90A 1NI3A 2O6VB 2D10A 2RDGA 5L83A 1PUTA 2NTTA 2HJ8A 2BF8B 2MBOA 2RDHA 2AQ3B 2X38A 1XO3A 1SIFA 2EKEC 4BKTA 4DHJB 1FD6A 1E8WA 4EKUA 1NI2A 4FLHA 4B6WA 3PZDA 2K6QA 4JX1C 1NBFC 3FAHA 3I9V1 3AU5A 1F77A 2INDC 2KX0A 1HE8A 3CSTA 1U4AA 2WWZA 2Y3AA 4ANUA 1SIJA 1XLOA 2MW5A 4OZCA 3AEBB 1I42A 1D4BA 1J7BA 1RM6C 3JVZX 4FN2A 1TYGB 3MC0B 4Q2JA 2KLCA 3U2SC 3UGBB 4RM8A 2C7HA 5L95C 5IO9A 1N5WA 4ZRQA 3P4RB 4M00A 2CHWA 3V05A 3UQAA 1EF5A 2KQSA 2N0SB 1OQQA 2BWFA 2M0AA 2ONQA 3SDLC 2L00B 2KJ6A 4WJPA 3VVWB 1A70A 2K0PA 2V0GA 1YJJA 2NCNA 1T0YA 2YVCA 2TSSA 2B76B 1PGAA 1Y56A 3JW0X 2W55A 1TZOA 5TSSA 3DVGX 4W9IA 2JY6A 3TBLD 1LQBA 1TZ1A 4WWNA 2UU7A 4K7UA 2YEPB 2AWTA 2IJ0A 2QHOA 4CHKA 4IKGA 3P42A 4MM3B 2KC1A 3PRPB 3W5VB 3B08A 3VXWA 2WXNA 3OLMD 2G1EA 4I6LB 2WHIA 2BB6A 3VTUA 1OEYJ 2V1YA 4NAMA 4I6NB 3ZVVA 2BS2B 1N62A 2KNBA 3PHXB 2JYTA 4S0RA 3ECIA 1FMAD 2MH7A 3M62B 5G55A 3HIZA 3UI3A 2KMMA 1GUAB 1WXSA 2SEBD 3A9JA 4KZCA 1HEZE 3L16A 2LASA 3W5UB 3AEGB 5E6PA 4N6EB 2KTRB 3PPAA 1N6ZA 2HTME 4JE3B 3Q8FA 1KOTA 5AEKB 3C19A 2LMCA 1E7PB 2ZNVC 4HK2A 4IUMB 1T6BX 2KDIA 3ENEA 2GBNA 3NY5A 2KJRA 3UINB 2JQRB 2AYOB 2W82A 4WQOB 2WXFA 2PVOD 3AE4B 4HPMB 2IY0B 1ZKHA 2JXXA 3DQVA 3H9DA 4IW0A 3APDA 2DWQA 1L2NA 3KLSX 3RNGC 4YL8A 3RZWC 3NVZA 4LNNA 4N59A 2VZKD 2AQ2B 2MLBA 2NBUA 3BYTB 1DOXA 4KGTA 3I57A 1WM3A 1JWBD 1QQRA 1AWDA 2MP2B 1SF0A 4JLCA 1JW9D 2BT6A 1L5PA 2DYOA 1VD2A 3PRMB 2FIDA 4LK0M 3A33B 2J52A 4WWPA 2EELA 2WGSA 4KIKB 3JSVA 4ARCA 3B1LX 1WFYA 1ZOYB 3AB5A 4FJVB 2MBBB 3QK0A 2O2VA 1TY0A 1YOVB 2V4IB 2LD9A 4WURA 3ZRFA 3VR8B 1PGXA 4C80A 4TMAB 2DX5B 1L6VA 1FXIA 4IWQA 3M63B 4YSZB 1GOZA 2ZNVB 1WJ6A 4HKQA 2BS4B 5E6JA 4E3CA 2XNAC 5IP4D 4ARIA 2BVCA 3MC9A 1WRIA 1HQRD 3PREA 5HG2A 1W6VA 1MPEA 1P7FA 3V6CB 2JVCA 3BVGA 4F7ZA 4DHZE 2WDRB 3DBHB 3AH7A 1IGCA 2KYWA 2M17A 2L8JA 3ZW3A 2IO0B 2N9PC 3BK1A 3ETRA 3HM3A 1WF9A 1V5OA 4KZ0A 3EGRA 1WE7A 2AQ1B 1WJ4A 5IAAC 2IGDA 1TS5A 2RPVA 4FBJB 1XD3B 2PKOA 3BYYB 1GC6A 2J0JA 2KWCA 1ZPSA 2MSED 3BVZA 2JZ3B 1I35A 4IM0A 3DBRI 1C79A 5IKCM 2V4LA 4LDTD 1J7AA 1UUPA 2R61A 3NVYA 2ZEQA 2JSVX 1J7CA 5EE1A 2REXA 2KDFB 2PIAA 3GS2A 4DQOC 1YQ3B 1TS3A 3VAWA 2KX3A 2KTFA 1E9MA 1DYQA 2WXQA 2PLPA 3P2BA 2KC2A 2KN5A 4TSSA 3RCZA 3FKYA 4HJGE 4A8XC 2A5UA 4S17A 3AN1A 3L0WB 4NQLB 1V5TA 2M4NA 3KVFB 2KFKA 2DZJA 1GNUA 3QC8B 3T9LA 4BVUC 3DHHC 1NENB 4MGYE 4MJSB 3H7PB 2KKCA 2KK8A 3ZNID 4RGNA 2MA9B 4YTPB 1EUVB 3OJ4B 4XC2A 3OAWA 1IP9A 3NJTA 2O6VA 2GBKA 4YSYB 5KHOA 4NJ6A 4GN1A 5J2RA 4J3OD 1MI0A 3N32A 2LRUA 2PTLA 4ICVA 1IBXA 2LGDA 3WALA 4AS1A 3VRAB 3TEXA 2DLBA 4P16A 1R4NI 3IAS1 1V8CA 3LXFA 1OQRA 4KGRA 5JZEB 1SEBD 3T3OA 1FRDA 3MTNB 2MWSB 2KANA 3I5JC 2ZCBA 5C3JB 1KH0A 4HDOA 1F0ZA 3VDZA 2NTSA 1VR9A 4AP4C 2W9NA 4BAXA 1C76A 2JT4B 3IHPC
chains in the Genus database with same CATH topology
1AARA 5JHAA 4OVVA 2IZVB 2JRHA 1L7YA 3LDZE 3GOEA 5DPRA 5AZHA 2MBQA 4G11A 3QAQA 4KSKC 2M0XA 4A20A 1J19A 3APCA 4BBNF 4ANVA 4KIKA 4TQ1A 2O6VD 3V6EB 5C1ZA 4FHJA 2WX1A 3JSVB 3UIOB 3QWZB 1MG8A 2DENB 2FCQA 2KWUB 2R2QA 4NNJB 3V62A 1P98A 3TJPA 3L17A 2D11A 2D07B 1E90A 2RD0A 2M8SA 2O6VB 2D10A 1LFDA 4GOCA 5L83A 1RAXA 2HJ8A 4KDLB 2BF8B 2MBOA 3V60A 1P0RA 3S2AA 3N3KB 3VUWA 3QIJA 4B9KA 4FJYA 2K8BA 4XX5A 2Y5BB 3VUYA 2OJRA 1WYWB 2KOXA 2G4SA 1SIFA 2EKEC 4BKTA 1WE6A 1WXMA 2N9EB 1PQSA 4IC7B 4JQWC 5CTRC 4DHJB 4MELA 4E74A 3VH3B 2AEHA 4II2B 1E8WA 4EKUA 3WAMA 1NI2A 4FLHA 4B6WA 3PZDA 2K6QA 3WAPA 1NBFC 3QCAA 5LXHA 3AU5A 1M94A 4NY0A 2LXAA 3ZDTA 4GXBA 2KX0A 1HE8A 5D94A 3CSTA 4ZRIA 2BGFA 1FXTB 1U4AA 2MBHA 2WWZA 4HWIB 4W9LA 2NPTB 4ANUA 2ZJDA 2MW5A 5TR5A 2N1WA 2MRPA 5C23A 1I42A 2HD5B 4FN2A 3JVZX 4GSWA 1V81A 3WAOA 4FHKA 4G50A 2KLCA 3PRZA 3UGBB 2D3GA 1YD8U 3CMMB 4RM8A 2WYQA 2C7HA 4HCNB 5L95C 4HDQA 4WJOA 4AUQC 5CHFA 4RMAA 1WX8A 1E5WA 3IFWB 3DVNV 2FCSA 3HK0A 2EMTA 4II3B 1V2YA 2CHWA 3UQAA 1GC7A 1EF5A 2KQSA 2NR2A 3DOWA 4PS3A 5DPSA 3K9OB 3ML9A 2PEAA 1Z5SB 3ZDMC 3A9JB 2BWFA 3SDLC 2L00B 2Z0EB 3DCGA 1K8RB 2KJ6A 4WJPA 3PLUA 1XT9B 3KH0A 3VVWB 3M3JA 3ZO5B 3KW5B 4W9JA 4I6PA 2MP2A 2NCNA 5CHWA 4M0WB 3PHWB 1T0YA 2YVCA 3BINA 2DYBA 4GDKA 4K7WA 4HXDA 4W9FA 3VHTC 3N30A 3JW0X 2D2QA 3VQIA 3IVFA 2YLMA 4F1SA 3DVGX 2JPHA 4K7SA 4W9IA 3A1QA 2JY6A 4NQKE 3TBLD 4EZLA 1LQBA 1E8XA 1TZ1A 4WWNA 1WX7A 1RRBA 2I1JA 4K7UA 3JYUA 2B3AA 2DZKA 3DDCB 2AWTA 2QHOA 3AU4A 4ICUA 2WDTB 4IWOA 4CHKA 2L3ZA 1UBQA 3QX1A 4KDIC 2KC1A 3PRPB 4LDTB 3ZKJC 4EUTA 3B08A 3VXWA 2O2VB 3MJWA 3OLMD 2MCNB 4EZKA 3KUDB 4EFOA 5GMVA 4I6LB 1ZGUB 1WXVA 3KYDD 2KO3A 3VTUA 1OEYJ 2LXCA 1IPGA 2KMAA 2KHWB 3SHQA 2NBWB 3DBHI 2V1YA 1CMXB 2KD0A 1Y8RC 1OGWA 4I6NB 3ZVVA 3A4SC 2CKHB 1OQYA 3BY4B 5BO4B 4K81A 2IO2B 2JZZA 2KNBA 1E7UA 3PHXB 3TL5A 3LMNA 3NS8A 3ECIA 4MJSA 1WX9A 3O65B 4BFRA 1V86A 3H7PA 4RM9A 2LI5A 5FR6A 3L08A 3M62B 5G55A 5LLIA 4MEMA 1WI0A 3W1SA 1WGHA 1WGRA 2CHZA 1YJ1A 3HIZA 2OOBB 4CYEA 4M8MA 1GUAB 3QARA 5DCNA 1WXSA 2L0TA 1OTRB 2KFKB 4GDLB 4BOSC 3A9JA 4KZCA 3ONSA 3L16A 1Q0WB 2LASA 4WAAA 1EF1A 5E6PA 2LUEA 5HKHA 3ZTCA 2ZPYA 2FCNA 2LVQA 2J0KA 2FCMA 2KFJA 2KTRB 2RSUA 3IG3A 3PPAA 4JL9A 3HM6X 5CHVC 2ZCCA 1KOTA 5AEKB 2CHXA 2LVOA 1WJNA 3NHEB 4MDKE 4PS7A 4W9KA 2BKRB 2ZNVC 4HK2A 4KV2A 4IUMB 2XBBC 1F9JA 1J8CA 3CSFA 2EMSA 4GMVA 3WANA 1KJTA 2KDIA 3ENEA 2GBNA 3NY5A 1WJUA 2BYFA 3B0AA 5E6OA 2KJRA 1WMHA 4JIOU 3KUZA 3EECA 3D32A 2DAJA 2GOWA 1KM7A 3UINB 4HCPB 1IYFA 5DPWA 2KQ7A 1E8YA 4MH0E 2AYOB 4WWOA 4WQOB 2RR9A 4P7IA 2KWVB 4HPMB 3C0RB 4KVGB 4IG7B 2IY0B 1ZKHA 1BT0A 2JXXA 2KMCA 3TIXA 1C1YB 2LGXA 3T8MA 3DQVA 1UGMA 3H9DA 4IW0A 4DDGD 3APDA 1L2NA 4LJPB 2K8CA 1GG3A 2C7MB 4YL8A 5D2MB 4TV3A 1OEYA 1EO6A 4WJNA 3RZWC 3RZFA 4GGQA 2JUOA 3Q3FA 2MLBA 4F8CB 2NBUA 4W9DA 3WA0A 2PE6B 2LZ6A 1S3SG 2ASQA 2K25A 1WGDA 1WM3A 2GBJA 3ALBA 3H7SA 3ZNZB 4XZ4A 4MGZE 3AXCA 2MP2B 1WR6E 3KYCD 3A9KB 3PVLA 5EDSA 1QZEA 2MX2A 1E8ZA 2PPHA 3APFA 4JLCA 2DYOA 1VD2A 4AWJA 3PRMB 2FIDA 3R7RA 4OVUA 2CU1A 2K6DB 3A33B 4WWPA 5JH5C 3A9KA 3A1QB 3UF8A 2DZIA 4BKSD 4E71A 1V6EA 5AZGA 4URKA 2ZVOA 4JGHB 2FNJB 3ZRCA 4KIKB 3PGEA 2IYDB 3ZLZA 2G4DB 2N4FA 1UD7A 2JRIB 2L76A 3JSVA 4ZDVA 2LJ5A 4KSLC 3B1LX 3L10B 3RT3B 1WFYA 3QK0A 4FJVB 2MBBB 2O2VA 1WIAA 3L13A 4ASWC 2LD9A 3MHSD 4HJKA 3ZRFA 2C7NB 4W9EA 5G2NA 3DVNU 2V3SA 2DX5B 2BYEA 2XK5A 3TMPB 4EOYA 1WY8A 2FUHB 1H4RA 4NJ7A 2JWZA 1WMHB 3DBSA 4AJYB 5LXIB 2VRRB 5IA7A 2KJHB 4IWQA 3M63B 1RLFA 1Z2MA 2XK5B 3M95A 2ZNVB 2Z0DB 4N9F4 3RYTA 1WJ6A 3NOBA 3W1SC 1ISNA 4DBGA 2GBMA 4DHJD 4E3CA 3PSEB 3AI5A 3QHTA 1ZW7A 3OJ3A 4LJOB 5D7GA 1GJZA 5CX3A 2LVPA 3EHVA 3PT2B 2KXJA 4IM3A 4TUUA 3RULA 4NAWB 4PYZA 4B95A 3PREA 3VH4B 3GZNI 1W6VA 1WRDB 2R2OA 4W9CA 3V6CB 3SD5A 2JVCA 4MSQB 4F7ZA 1R4MI 2G3QB 4CO7A 4DHZE 2NPTA 4FA6A 3RD2A 2M17A 1WH3A 2L8JA 1V9JA 2KTRA 1G6JA 3EC8A 3ZNGC 3ZW3A 2I1KA 2IO0B 2N9PC 1UH6A 1YX6B 5JHBA 4BKSA 3HM3A 4X57B 1WF9A 3SU8X 1V5OA 4KZ0A 2KLGA 4ANXA 3VUXA 2HTHA 4PS8A 5KHQA 1WE7A 2RGFA 4HVBA 2XEWA 3PV1A 1WJ4A 4BKGA 1WXAA 1YQBA 4K1RB 5IAAC 4FBJB 2AL6A 2JF5A 3ZIMA 1C3TA 2AL3A 3A4RA 1XD3B 3R3MA 4DK5A 2KZRA 4FJZA 2LGYA 2KDBA 3EFUA 2CS4A 3LJ3A 2UYZB 4W9HA 1GC6A 2KVRA 1TGZB 1V49A 2J0JA 2KWCA 2MSED 3TCAA 3VFKA 3VTWA 4ZRKA 1YIWA 2Z59B 2JZ3B 1I35A 4IM0A 3DBRI 2J7QB 1YX5B 4LCDE 1SE9A 2DHZA 2V4LA 3DBLI 4LDTD 3W1YA 2IO1B 4PYUA 2ZEQA 4BBNC 5E6NA 2REXA 2KDFB 3QQ8B 3H1UA 4DXAB 3U7DA 3H6NA 3VAWA 2KX3A 4MGIE 2KTFA 1P9DU 3X23A 1SGHA 3U8ZA 1P3QU 3PS6A 1TTNA 4EEWA 1RFAA 3P2BA 2MBEA 2KDEB 4MM3A 2KC2A 2WX0A 2KN5A 3RCZA 1XQQA 2N7DA 2DZMA 1VCBA 2L7RA 3DPDA 3ZUNA 3PLVA 2HE7A 2A5UA 2L0FA 4W9GA 3V61A 3CF6E 2LRWA 2NVUI 1WR1A 2IY1B 3L0WB 4M8NA 1V5TA 1S1QB 2FIFA 2M4NA 3NZUA 2KFKA 1WZ0A 2PJHA 3KVFB 4GDLA 2DZJA 1GNUA 4A3OA 3QC8B 4MSMB 3T9LA 1LM8B 2A4ZA 3L54A 4BVUC 1H8CA 4J6IA 2N1VA 3IBEA 3UIPB 1P1AA 2N9XA 4MJSB 4MGYE 4G3XB 4NQLB 3R7QA 3U30A 3ZTDA 1D3ZA 3H7PB 2KKCA 2KK8A 2ZVNA 3ZNID 4DHZB 2MA9B 2RPQA 3QJZA 4BOZB 2K8HA 1Q5WB 1EUVB 2G45B 1E7VA 3Q3JA 3OJ4B 4NPNA 4HLEA 1JRUA 1A5RA 4XC2A 2C5LC 5D6JB 3WIMA 3OAWA 2N7EA 1IP9A 2BPSA 2DYMA 2O6VA 4GIVA 2GBKA 2PE9A 2BKFA 1WGGA 2M1MA 1Q1OA 4DDID 3VTVA 5KHOA 4IM2A 2K39A 4NJ6A 3AULA 2GBRA 1X1MA 4GN1A 2ZPNA 5AZFA 3UQBA 5J2RA 4FULA 2J0MA 1TBEA 2NBVB 4IWPA 3HHMA 4AJWA 1WZ3A 3N32A 2LRUA 3PTFC 1UELA 4ZYNA 3R66C 4ICVA 4NAWA 3ZNHB 5DPTA 4GU2A 2BYVE 2BWES 2K1FA 1V80A 2LGDA 3NZSA 1NDDA 2GMIC 1UZXB 3WALA 2C60A 4A3PA 2DAFA 4EZJA 1WM2A 1LXDA 2MQJA 4GDKB 1J0GA 5J17A 1R4NI 4GB9A 3KUCB 2LWPA 4MGKE 4TKNA 1UBIA 1WGYA 4G0NB 5JZEB 2ZZPB 2IBIB 2UWQA 3MTNB 4HPLB 2MWSB 2IO3B 4ANWA 3RUIB 2FAZA 2L05A 2CR5A 2KANA 3ML8A 2C9WB 2ZCBA 3DVGY 2NS5A 3I3TB 4WJQA 3X0WA 5J18A 4ZRJA 3K9PB 4HDOA 3QA8A 3VDZA 1KLVA 4AP4C 4TQ0A 2W9NA 4FADA 4DWFA 2JT4B 3IHPC 4AOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AAR A;  5JHA A;  4OVV A;  2IZV B;  2JRH A;  1L7Y A;  3LDZ E;  3GOE A;  5DPR A;  5AZH A;  2MBQ A;  4G11 A;  3QAQ A;  4KSK C;  2M0X A;  4A20 A;  1J19 A;  3APC A;  4BBN F;  4ANV A;  4KIK A;  4TQ1 A;  2O6V D;  3V6E B;  5C1Z A;  4FHJ A;  2WX1 A;  3JSV B;  3UIO B;  3QWZ B;  1MG8 A;  2DEN B;  2FCQ A;  2KWU B;  2R2Q A;  4NNJ B;  3V62 A;  1P98 A;  3TJP A;  3L17 A;  2D11 A;  2D07 B;  1E90 A;  2RD0 A;  2M8S A;  2O6V B;  2D10 A;  1LFD A;  4GOC A;  5L83 A;  1RAX A;  2HJ8 A;  4KDL B;  2BF8 B;  2MBO A;  3V60 A;  1P0R A;  3S2A A;  3N3K B;  3VUW A;  3QIJ A;  4B9K A;  4FJY A;  2K8B A;  4XX5 A;  2Y5B B;  3VUY A;  2OJR A;  1WYW B;  2KOX A;  2G4S A;  1SIF A;  2EKE C;  4BKT A;  1WE6 A;  1WXM A;  2N9E B;  1PQS A;  4IC7 B;  4JQW C;  5CTR C;  4DHJ B;  4MEL A;  4E74 A;  3VH3 B;  2AEH A;  4II2 B;  1E8W A;  4EKU A;  3WAM A;  1NI2 A;  4FLH A;  4B6W A;  3PZD A;  2K6Q A;  3WAP A;  1NBF C;  3QCA A;  5LXH A;  3AU5 A;  1M94 A;  4NY0 A;  2LXA A;  3ZDT A;  4GXB A;  2KX0 A;  1HE8 A;  5D94 A;  3CST A;  4ZRI A;  2BGF A;  1FXT B;  1U4A A;  2MBH A;  2WWZ A;  4HWI B;  4W9L A;  2NPT B;  4ANU A;  2ZJD A;  2MW5 A;  5TR5 A;  2N1W A;  2MRP A;  5C23 A;  1I42 A;  2HD5 B;  4FN2 A;  3JVZ X;  4GSW A;  1V81 A;  3WAO A;  4FHK A;  4G50 A;  2KLC A;  3PRZ A;  3UGB B;  2D3G A;  1YD8 U;  3CMM B;  4RM8 A;  2WYQ A;  2C7H A;  4HCN B;  5L95 C;  4HDQ A;  4WJO A;  4AUQ C;  5CHF A;  4RMA A;  1WX8 A;  1E5W A;  3IFW B;  3DVN V;  2FCS A;  3HK0 A;  2EMT A;  4II3 B;  1V2Y A;  2CHW A;  3UQA A;  1GC7 A;  1EF5 A;  2KQS A;  2NR2 A;  3DOW A;  4PS3 A;  5DPS A;  3K9O B;  3ML9 A;  2PEA A;  1Z5S B;  3ZDM C;  3A9J B;  2BWF A;  3SDL C;  2L00 B;  2Z0E B;  3DCG A;  1K8R B;  2KJ6 A;  4WJP A;  3PLU A;  1XT9 B;  3KH0 A;  3VVW B;  3M3J A;  3ZO5 B;  3KW5 B;  4W9J A;  4I6P A;  2MP2 A;  2NCN A;  5CHW A;  4M0W B;  3PHW B;  1T0Y A;  2YVC A;  3BIN A;  2DYB A;  4GDK A;  4K7W A;  4HXD A;  4W9F A;  3VHT C;  3N30 A;  3JW0 X;  2D2Q A;  3VQI A;  3IVF A;  2YLM A;  4F1S A;  3DVG X;  2JPH A;  4K7S A;  4W9I A;  3A1Q A;  2JY6 A;  4NQK E;  3TBL D;  4EZL A;  1LQB A;  1E8X A;  1TZ1 A;  4WWN A;  1WX7 A;  1RRB A;  2I1J A;  4K7U A;  3JYU A;  2B3A A;  2DZK A;  3DDC B;  2AWT A;  2QHO A;  3AU4 A;  4ICU A;  2WDT B;  4IWO A;  4CHK A;  2L3Z A;  1UBQ A;  3QX1 A;  4KDI C;  2KC1 A;  3PRP B;  4LDT B;  3ZKJ C;  4EUT A;  3B08 A;  3VXW A;  2O2V B;  3MJW A;  3OLM D;  2MCN B;  4EZK A;  3KUD B;  4EFO A;  5GMV A;  4I6L B;  1ZGU B;  1WXV A;  3KYD D;  2KO3 A;  3VTU A;  1OEY J;  2LXC A;  1IPG A;  2KMA A;  2KHW B;  3SHQ A;  2NBW B;  3DBH I;  2V1Y A;  1CMX B;  2KD0 A;  1Y8R C;  1OGW A;  4I6N B;  3ZVV A;  3A4S C;  2CKH B;  1OQY A;  3BY4 B;  5BO4 B;  4K81 A;  2IO2 B;  2JZZ A;  2KNB A;  1E7U A;  3PHX B;  3TL5 A;  3LMN A;  3NS8 A;  3ECI A;  4MJS A;  1WX9 A;  3O65 B;  4BFR A;  1V86 A;  3H7P A;  4RM9 A;  2LI5 A;  5FR6 A;  3L08 A;  3M62 B;  5G55 A;  5LLI A;  4MEM A;  1WI0 A;  3W1S A;  1WGH A;  1WGR A;  2CHZ A;  1YJ1 A;  3HIZ A;  2OOB B;  4CYE A;  4M8M A;  1GUA B;  3QAR A;  5DCN A;  1WXS A;  2L0T A;  1OTR B;  2KFK B;  4GDL B;  4BOS C;  3A9J A;  4KZC A;  3ONS A;  3L16 A;  1Q0W B;  2LAS A;  4WAA A;  1EF1 A;  5E6P A;  2LUE A;  5HKH A;  3ZTC A;  2ZPY A;  2FCN A;  2LVQ A;  2J0K A;  2FCM A;  2KFJ A;  2KTR B;  2RSU A;  3IG3 A;  3PPA A;  4JL9 A;  3HM6 X;  5CHV C;  2ZCC A;  1KOT A;  5AEK B;  2CHX A;  2LVO A;  1WJN A;  3NHE B;  4MDK E;  4PS7 A;  4W9K A;  2BKR B;  2ZNV C;  4HK2 A;  4KV2 A;  4IUM B;  2XBB C;  1F9J A;  1J8C A;  3CSF A;  2EMS A;  4GMV A;  3WAN A;  1KJT A;  2KDI A;  3ENE A;  2GBN A;  3NY5 A;  1WJU A;  2BYF A;  3B0A A;  5E6O A;  2KJR A;  1WMH A;  4JIO U;  3KUZ A;  3EEC A;  3D32 A;  2DAJ A;  2GOW A;  1KM7 A;  3UIN B;  4HCP B;  1IYF A;  5DPW A;  2KQ7 A;  1E8Y A;  4MH0 E;  2AYO B;  4WWO A;  4WQO B;  2RR9 A;  4P7I A;  2KWV B;  4HPM B;  3C0R B;  4KVG B;  4IG7 B;  2IY0 B;  1ZKH A;  1BT0 A;  2JXX A;  2KMC A;  3TIX A;  1C1Y B;  2LGX A;  3T8M A;  3DQV A;  1UGM A;  3H9D A;  4IW0 A;  4DDG D;  3APD A;  1L2N A;  4LJP B;  2K8C A;  1GG3 A;  2C7M B;  4YL8 A;  5D2M B;  4TV3 A;  1OEY A;  1EO6 A;  4WJN A;  3RZW C;  3RZF A;  4GGQ A;  2JUO A;  3Q3F A;  2MLB A;  4F8C B;  2NBU A;  4W9D A;  3WA0 A;  2PE6 B;  2LZ6 A;  1S3S G;  2ASQ A;  2K25 A;  1WGD A;  1WM3 A;  2GBJ A;  3ALB A;  3H7S A;  3ZNZ B;  4XZ4 A;  4MGZ E;  3AXC A;  2MP2 B;  1WR6 E;  3KYC D;  3A9K B;  3PVL A;  5EDS A;  1QZE A;  2MX2 A;  1E8Z A;  2PPH A;  3APF A;  4JLC A;  2DYO A;  1VD2 A;  4AWJ A;  3PRM B;  2FID A;  3R7R A;  4OVU A;  2CU1 A;  2K6D B;  3A33 B;  4WWP A;  5JH5 C;  3A9K A;  3A1Q B;  3UF8 A;  2DZI A;  4BKS D;  4E71 A;  1V6E A;  5AZG A;  4URK A;  2ZVO A;  4JGH B;  2FNJ B;  3ZRC A;  4KIK B;  3PGE A;  2IYD B;  3ZLZ A;  2G4D B;  2N4F A;  1UD7 A;  2JRI B;  2L76 A;  3JSV A;  4ZDV A;  2LJ5 A;  4KSL C;  3B1L X;  3L10 B;  3RT3 B;  1WFY A;  3QK0 A;  4FJV B;  2MBB B;  2O2V A;  1WIA A;  3L13 A;  4ASW C;  2LD9 A;  3MHS D;  4HJK A;  3ZRF A;  2C7N B;  4W9E A;  5G2N A;  3DVN U;  2V3S A;  2DX5 B;  2BYE A;  2XK5 A;  3TMP B;  4EOY A;  1WY8 A;  2FUH B;  1H4R A;  4NJ7 A;  2JWZ A;  1WMH B;  3DBS A;  4AJY B;  5LXI B;  2VRR B;  5IA7 A;  2KJH B;  4IWQ A;  3M63 B;  1RLF A;  1Z2M A;  2XK5 B;  3M95 A;  2ZNV B;  2Z0D B;  4N9F 4;  3RYT A;  1WJ6 A;  3NOB A;  3W1S C;  1ISN A;  4DBG A;  2GBM A;  4DHJ D;  4E3C A;  3PSE B;  3AI5 A;  3QHT A;  1ZW7 A;  3OJ3 A;  4LJO B;  5D7G A;  1GJZ A;  5CX3 A;  2LVP A;  3EHV A;  3PT2 B;  2KXJ A;  4IM3 A;  4TUU A;  3RUL A;  4NAW B;  4PYZ A;  4B95 A;  3PRE A;  3VH4 B;  3GZN I;  1W6V A;  1WRD B;  2R2O A;  4W9C A;  3V6C B;  3SD5 A;  2JVC A;  4MSQ B;  4F7Z A;  1R4M I;  2G3Q B;  4CO7 A;  4DHZ E;  2NPT A;  4FA6 A;  3RD2 A;  2M17 A;  1WH3 A;  2L8J A;  1V9J A;  2KTR A;  1G6J A;  3EC8 A;  3ZNG C;  3ZW3 A;  2I1K A;  2IO0 B;  2N9P C;  1UH6 A;  1YX6 B;  5JHB A;  4BKS A;  3HM3 A;  4X57 B;  1WF9 A;  3SU8 X;  1V5O A;  4KZ0 A;  2KLG A;  4ANX A;  3VUX A;  2HTH A;  4PS8 A;  5KHQ A;  1WE7 A;  2RGF A;  4HVB A;  2XEW A;  3PV1 A;  1WJ4 A;  4BKG A;  1WXA A;  1YQB A;  4K1R B;  5IAA C;  4FBJ B;  2AL6 A;  2JF5 A;  3ZIM A;  1C3T A;  2AL3 A;  3A4R A;  1XD3 B;  3R3M A;  4DK5 A;  2KZR A;  4FJZ A;  2LGY A;  2KDB A;  3EFU A;  2CS4 A;  3LJ3 A;  2UYZ B;  4W9H A;  1GC6 A;  2KVR A;  1TGZ B;  1V49 A;  2J0J A;  2KWC A;  2MSE D;  3TCA A;  3VFK A;  3VTW A;  4ZRK A;  1YIW A;  2Z59 B;  2JZ3 B;  1I35 A;  4IM0 A;  3DBR I;  2J7Q B;  1YX5 B;  4LCD E;  1SE9 A;  2DHZ A;  2V4L A;  3DBL I;  4LDT D;  3W1Y A;  2IO1 B;  4PYU A;  2ZEQ A;  4BBN C;  5E6N A;  2REX A;  2KDF B;  3QQ8 B;  3H1U A;  4DXA B;  3U7D A;  3H6N A;  3VAW A;  2KX3 A;  4MGI E;  2KTF A;  1P9D U;  3X23 A;  1SGH A;  3U8Z A;  1P3Q U;  3PS6 A;  1TTN A;  4EEW A;  1RFA A;  3P2B A;  2MBE A;  2KDE B;  4MM3 A;  2KC2 A;  2WX0 A;  2KN5 A;  3RCZ A;  1XQQ A;  2N7D A;  2DZM A;  1VCB A;  2L7R A;  3DPD A;  3ZUN A;  3PLV A;  2HE7 A;  2A5U A;  2L0F A;  4W9G A;  3V61 A;  3CF6 E;  2LRW A;  2NVU I;  1WR1 A;  2IY1 B;  3L0W B;  4M8N A;  1V5T A;  1S1Q B;  2FIF A;  2M4N A;  3NZU A;  2KFK A;  1WZ0 A;  2PJH A;  3KVF B;  4GDL A;  2DZJ A;  1GNU A;  4A3O A;  3QC8 B;  4MSM B;  3T9L A;  1LM8 B;  2A4Z A;  3L54 A;  4BVU C;  1H8C A;  4J6I A;  2N1V A;  3IBE A;  3UIP B;  1P1A A;  2N9X A;  4MJS B;  4MGY E;  4G3X B;  4NQL B;  3R7Q A;  3U30 A;  3ZTD A;  1D3Z A;  3H7P B;  2KKC A;  2KK8 A;  2ZVN A;  3ZNI D;  4DHZ B;  2MA9 B;  2RPQ A;  3QJZ A;  4BOZ B;  2K8H A;  1Q5W B;  1EUV B;  2G45 B;  1E7V A;  3Q3J A;  3OJ4 B;  4NPN A;  4HLE A;  1JRU A;  1A5R A;  4XC2 A;  2C5L C;  5D6J B;  3WIM A;  3OAW A;  2N7E A;  1IP9 A;  2BPS A;  2DYM A;  2O6V A;  4GIV A;  2GBK A;  2PE9 A;  2BKF A;  1WGG A;  2M1M A;  1Q1O A;  4DDI D;  3VTV A;  5KHO A;  4IM2 A;  2K39 A;  4NJ6 A;  3AUL A;  2GBR A;  1X1M A;  4GN1 A;  2ZPN A;  5AZF A;  3UQB A;  5J2R A;  4FUL A;  2J0M A;  1TBE A;  2NBV B;  4IWP A;  3HHM A;  4AJW A;  1WZ3 A;  3N32 A;  2LRU A;  3PTF C;  1UEL A;  4ZYN A;  3R66 C;  4ICV A;  4NAW A;  3ZNH B;  5DPT A;  4GU2 A;  2BYV E;  2BWE S;  2K1F A;  1V80 A;  2LGD A;  3NZS A;  1NDD A;  2GMI C;  1UZX B;  3WAL A;  2C60 A;  4A3P A;  2DAF A;  4EZJ A;  1WM2 A;  1LXD A;  2MQJ A;  4GDK B;  1J0G A;  5J17 A;  1R4N I;  4GB9 A;  3KUC B;  2LWP A;  4MGK E;  4TKN A;  1UBI A;  1WGY A;  4G0N B;  5JZE B;  2ZZP B;  2IBI B;  2UWQ A;  3MTN B;  4HPL B;  2MWS B;  2IO3 B;  4ANW A;  3RUI B;  2FAZ A;  2L05 A;  2CR5 A;  2KAN A;  3ML8 A;  2C9W B;  2ZCB A;  3DVG Y;  2NS5 A;  3I3T B;  4WJQ A;  3X0W A;  5J18 A;  4ZRJ A;  3K9P B;  4HDO A;  3QA8 A;  3VDZ A;  1KLV A;  4AP4 C;  4TQ0 A;  2W9N A;  4FAD A;  4DWF A;  2JT4 B;  3IHP C;  4AOF A; 
#chains in the Genus database with same CATH topology
 1AAR A;  1HZ5 A;  5JHA A;  2LGS A;  5DPR A;  3LDZ E;  2WXR A;  5AZH A;  3QAQ A;  4BBN F;  4ANV A;  1UWX A;  1JCK B;  2J53 A;  2WX1 A;  4ACF A;  3QWZ B;  4B0E A;  3L17 A;  5H8Y E;  3FIL A;  2M8S A;  1LFD A;  4RGO S;  1EWY C;  2WNM A;  3GB1 A;  1SJH D;  4KDL B;  3W2D A;  3V60 A;  2L83 A;  4B9K A;  1K53 A;  2K8B A;  3VUY A;  2JWU A;  3ZJU A;  3Q3M C;  1WE6 A;  1WXM A;  2N9E B;  1ENF A;  2SAK A;  2KVZ A;  4E74 A;  1YN4 A;  3WAP A;  3AE3 B;  3QCA A;  5LXH A;  2ON8 A;  2FUG 1;  3ZDT A;  2BGF A;  1FXT B;  4HWI B;  1C78 A;  2BS3 B;  2NPT B;  1ESF A;  2MRP A;  5C23 A;  3WAO A;  4FHK A;  3LB8 C;  2D3G A;  3CMM B;  4WJO A;  4A55 A;  1QLB B;  5BYR A;  1E5W A;  1NYQ A;  3IFW B;  2FCS A;  2EMT A;  1V2Y A;  5HI1 A;  3AM9 A;  2Y5P A;  3OWE B;  2NR2 A;  3DOW A;  4PS3 A;  1YN3 A;  3K9O B;  4PK1 A;  1NVI D;  3MJ5 A;  3A9J B;  3AED B;  1TS4 A;  1QOG A;  1SB3 C;  2EKI A;  3DCG A;  1SBB B;  1KLU D;  3PLU A;  3ZO5 B;  1C77 A;  4I6P A;  2MP2 A;  4M0W B;  4W9F A;  3PHW B;  3BIN A;  2DYB A;  4GDK A;  4K7W A;  3N30 A;  4O1N A;  1LO5 D;  1T0R C;  3NG0 A;  4F1S A;  2JPH A;  4EZL A;  1E8X A;  3B9J A;  4YT0 B;  1WX7 A;  3MP9 A;  1GAQ B;  3CWI A;  4MAC A;  4IWO A;  1FNV A;  3QX1 A;  2KWD A;  2N7J A;  1C4P A;  2O2V B;  4R3D A;  1VZ8 A;  3KUD B;  1KFY B;  1OFF A;  2KO3 A;  3RI7 C;  1IPG A;  1ACC A;  2NBW B;  4YTN B;  4H2A A;  3A4S C;  2CKH B;  4M02 A;  1VZ7 A;  2WQY B;  1WX9 A;  4BFR A;  4D2K A;  1V86 A;  1YNT E;  2KDM A;  4RM9 A;  2LI5 A;  4PT5 A;  1WI0 A;  3LYY A;  2CHZ A;  3MC8 A;  5FK9 C;  1DOI A;  3QAR A;  4BOS C;  3I63 C;  1E10 A;  4RNA A;  3R2T A;  1HTO A;  2LVQ A;  5BMG A;  4HRO A;  2KFJ A;  3RPF C;  2LVO A;  3NHE B;  4MDK E;  3DBL B;  2JX5 A;  3ZXV A;  4C7Y A;  5FKA C;  3CSF A;  3WAN A;  2QJL A;  1JRP A;  3N1Y C;  2BYF A;  3EEC A;  2GOW A;  1D6E C;  1KM7 A;  4HCP B;  2KQ7 A;  3NRZ A;  4MH0 E;  2RR9 A;  3AE9 B;  1JQ4 A;  1IUE A;  2BW2 A;  3C0R B;  3P63 A;  1L4D B;  1GG3 A;  2C7M B;  3Q8C A;  1QOB A;  2LGI A;  2H89 B;  4WJN A;  4GGQ A;  2JUO A;  4F8C B;  4W9D A;  2CJO A;  2PE6 B;  3WA0 A;  1XF5 L;  3H7S A;  3VR9 B;  4LNO A;  1D5X C;  4XZ4 A;  1C9F A;  1WR6 E;  3PVL A;  2INN E;  2QCZ A;  5EDS A;  1QZE A;  5BYS A;  2MX2 A;  1E8Z A;  2PPH A;  2K9X A;  3MFG A;  1XLN A;  2K6D B;  5JH5 C;  3A9K A;  4BKS D;  4E71 A;  2IGH A;  1VZ6 A;  3OG5 A;  4XGA B;  3ZRC A;  3PGE A;  3RFZ B;  3ZLZ A;  3BVM A;  1UD7 A;  4ZDV A;  1MVK A;  3HRD D;  3L10 B;  3RT3 B;  1EM7 A;  1WIA A;  3L13 A;  4W9E A;  2ZW0 A;  5JXV A;  2BYE A;  1PYW D;  2FUH B;  2JWZ A;  1WMH B;  3DBS A;  3TEZ A;  2J4X A;  4XDC A;  3E9S A;  3BZD B;  1QF6 A;  4N9F 4;  3NOB A;  4DHJ D;  1JRO A;  2GBM A;  1V1O A;  1ZW7 A;  3OJ3 A;  4LJO B;  5CX3 A;  4RF0 A;  1E6E B;  2KXJ A;  4TUU A;  4PYZ A;  4B95 A;  1IBX B;  4JPS A;  3GZN I;  1WRD B;  4MSQ B;  4LNI A;  2WP9 B;  1R4M B;  1WH3 A;  3EC8 A;  2D3C A;  1UH6 A;  5LNK 1;  1HTQ A;  3SU8 X;  3W9C B;  5D3I B;  2HTH A;  4PS8 A;  5KHQ A;  1D5Z C;  1UWM A;  1C3T A;  2AL6 A;  3ZIM A;  2Y5C A;  4DK5 A;  2KZR A;  4FJZ A;  2LGY A;  2CS4 A;  2UYZ B;  4W9H A;  1NYR A;  1KTK A;  3VTW A;  3AEE B;  4XYC A;  1YIW A;  2Z59 B;  2K3U A;  4C56 C;  1K51 A;  4KKJ A;  4XWT A;  1B1Z A;  2J7Q B;  1SE9 A;  2DHZ A;  3W1Y A;  5E6N A;  3H1U A;  3U7D A;  3H6N A;  4MGI E;  3X23 A;  1SGH A;  1TTN A;  2RMM A;  4EEW A;  1MG4 A;  2W3R A;  2MEK A;  3ZUN A;  3ZGZ A;  2L0F A;  1Q10 A;  2IY1 B;  4M8N A;  2FIF A;  4A3O A;  2PJH A;  1WZ0 A;  1SSN A;  3AE7 B;  4MSM B;  1LM8 B;  3L54 A;  3UIP B;  1P1A A;  2N9X A;  1D3Z A;  1FXA A;  3U30 A;  1NEK B;  3PZ7 A;  3R2I A;  1KRH A;  3P1M A;  3Q3J A;  1VDV A;  3FIL B;  3WIM A;  1YMH E;  2N7E A;  2PE9 A;  2HDE A;  2M1M A;  3VTV A;  1TKY A;  2BQQ A;  4IM2 A;  5EE0 A;  2GBR A;  4P1C C;  4C7Z A;  2J0M A;  1TBE A;  2NBV B;  4IWP A;  4AJW A;  1WZ3 A;  2WS3 B;  3PTF C;  1PFD A;  1TJE A;  4NAW A;  1F1H A;  2ICI A;  5DPT A;  2BYV E;  1V80 A;  3AV8 A;  1WM2 A;  1LXD A;  2Q5W D;  3EFC A;  4GDK B;  4HRS A;  1J0G A;  1BUI C;  5J17 A;  3U7Z A;  1YN5 A;  3Q8E A;  3O13 A;  1RFK A;  4OVZ A;  1L4Z B;  2DNF A;  4HPL B;  3RUI B;  3ML8 A;  1SE3 A;  3DVG Y;  3X0W A;  3K9P B;  4RH6 A;  4OHJ A;  3EUB 2;  1KLV A;  3B2G A;  4AOF A;  4OVV A;  2JRH A;  5IOI A;  3DHI C;  4B0M A;  2M0X A;  4OZB A;  5MPO A;  3ZYY X;  4HKZ E;  1GB1 A;  4KIK A;  1K52 A;  3V6E B;  4FHJ A;  3JSV B;  1EU4 A;  1K50 A;  2DEN B;  2FCQ A;  2KWU B;  2R2Q A;  3TJP A;  2D11 A;  2D07 B;  2RD0 A;  2LHD A;  1TY2 A;  4RF1 A;  4C4V B;  1L6U A;  1P0R A;  1ZUD 2;  3VUW A;  3QIJ A;  4FJY A;  4XX5 A;  1ZDX A;  1WYW B;  4JQW C;  1PQS A;  2QEJ C;  4C00 A;  1L0Y B;  3Q3N C;  2AEH A;  3RNC C;  3DWM A;  2RDB C;  2LXA A;  4GXB A;  3PO0 A;  4AQ7 A;  2MBH A;  2ZJD A;  4RGM A;  5TR5 A;  1FCL A;  1XXG A;  2QDF A;  1V81 A;  4US9 A;  1QOF A;  1FCC C;  4G50 A;  4USA A;  3PRZ A;  1YD8 U;  3DWG C;  2WYQ A;  3N9Y C;  4HDQ A;  4AUQ C;  4RMA A;  3DVN V;  3HK0 A;  2G9H D;  4II3 B;  1ZDV A;  2V9H A;  3AEA B;  1WSP A;  2JXT A;  2PEA A;  1Z5S B;  3ZDM C;  5BMH A;  1STE A;  1BXT A;  1K8R B;  5EE3 A;  3M3J A;  2BBC A;  3KW5 B;  1JAL A;  5HHD G;  1B9R A;  5CHW A;  3VHT C;  2GLS A;  3HVD A;  2KQ4 X;  2D2Q A;  3VQI A;  2YLM A;  4DXF A;  3IT4 B;  4NQK E;  1RRB A;  2I1J A;  3JYU A;  2QIE B;  3AU4 A;  4ICU A;  2WDT B;  1UBQ A;  4KDI C;  3BII D;  3ZKJ C;  1PGB A;  3MJW A;  4EFO A;  5GMV A;  2BYT A;  2KHW B;  3SHQ A;  3DBH I;  2XN9 C;  1CMX B;  1OGW A;  5G5H A;  3BY4 B;  5BO4 B;  3NS1 A;  2IO2 B;  2GI9 A;  3TL5 A;  3LMN A;  3HVZ A;  4MJS A;  3TEY A;  3GE8 C;  3H7P A;  3IXS A;  2IPK D;  5FR6 A;  3L08 A;  4YSX B;  5LLI A;  2OED A;  1WGH A;  1WGR A;  2I38 A;  1YJ1 A;  5AUI A;  2OOB B;  4CYE A;  3DBR B;  5DCN A;  1VLB A;  1OTR B;  4GDL B;  3ONS A;  2INC C;  2JZP A;  4WAA A;  4IDI A;  1EF1 A;  2V3N A;  5HKH A;  2WU5 B;  2J0K A;  4LLG M;  3IG3 A;  4JL9 A;  5CHV C;  2ZCC A;  2CHX A;  4OZA A;  1WJN A;  4PS7 A;  4W9K A;  3L4P A;  4KV2 A;  1F9J A;  3RMK C;  4GMV A;  2KAC A;  5E6O A;  1WMH A;  5I4D A;  2WLB A;  1MHX A;  4P7I A;  2KWV B;  4KVG B;  1BT0 A;  2KMC A;  1CK1 A;  1UGM A;  4DDG D;  3U4E G;  5GXG B;  2WXK A;  4TV3 A;  1OEY A;  3N1X C;  3AE2 B;  2QSD A;  3Q14 C;  4WWM A;  2LFI A;  1T5X D;  3Q3F A;  1YQ4 B;  1S3S G;  2CJN A;  1WGD A;  2GBJ A;  3ALB A;  3ZNZ B;  2N9L A;  1QIL A;  1MJD A;  3KYC D;  4A6Q A;  3A9K B;  3APF A;  1GPX A;  4LNF A;  4AWJ A;  1EU3 A;  1BML C;  4RFB A;  3TSS A;  3AEF B;  4HEA 1;  4ZHP A;  3A1Q B;  3UF8 A;  4URK A;  4JGH B;  2FNJ B;  2G4D B;  2N4F A;  2JRI B;  2L76 A;  2LJ5 A;  4ASW C;  4YWG G;  3VRB B;  4HJK A;  3DVN U;  1RWS A;  1WY8 A;  1L0X B;  1H4R A;  2VRR B;  5IA7 A;  2KJH B;  2MJE A;  1RLF A;  1Z2M A;  2XK5 B;  3ZJV A;  1TT5 B;  4XE0 A;  3RYT A;  1T0S C;  1TIF A;  3NVV A;  3W1S C;  4DBG A;  3QHT A;  3AI5 A;  5D7G A;  1GJZ A;  1TKE A;  3RUL A;  4NAW B;  1HZ6 A;  2BTE A;  2R2O A;  4W9C A;  3TUO A;  1ZXH A;  1R4M I;  4CO7 A;  3Q8A A;  4DXG A;  3RD2 A;  4ZYS A;  2JYE A;  1V9J A;  3ZNG C;  1E0Z A;  1YX6 B;  5JHB A;  1ZXI A;  4X57 B;  2KLG A;  4ANX A;  3VUX A;  3P4S B;  2D3A A;  1FM0 D;  2RGF A;  4L1B A;  3PV1 A;  4M0W A;  4BKG A;  1YQB A;  5C2T B;  3ZQ4 A;  2JF5 A;  3E56 A;  5HFY A;  2AL3 A;  3A4R A;  3R3M A;  2Z8L A;  2KDB A;  1ZE3 D;  3EFU A;  1CQV A;  3LJ3 A;  2KVR A;  1TGZ B;  3TCA A;  3VFK A;  5BYQ A;  1I4H A;  3Q8B A;  2D5G A;  4MH8 A;  1YX5 B;  2MJ3 A;  2IO1 B;  4PYU A;  2GB1 A;  4BBN C;  1I4R A;  3QQ8 B;  3GP7 A;  4DXA B;  3WCQ A;  1P9D U;  3PS6 A;  1XEE A;  2PMV A;  1N63 A;  2KDE B;  3J9C A;  4MM3 A;  5D3D A;  2L52 A;  2N7D A;  3DPD A;  1VCB A;  2VH2 A;  2IDY A;  4ZOH C;  3PLV A;  2HE7 A;  5T8I A;  4W9G A;  3CF6 E;  2LRW A;  1WR1 A;  1AYF A;  3T3N A;  1JWS D;  2QMT A;  3R8B A;  4J6I A;  3IBE A;  3GE3 C;  5IN7 A;  4G3X B;  2WDQ B;  3R7Q A;  1V1P A;  2ZVN A;  1XCQ L;  3ABV B;  2RPQ A;  3KWV A;  3QJZ A;  1Q5W B;  1JRU A;  2C5L C;  4NZL B;  2DYM A;  4GIV A;  2BKF A;  4DDI D;  4REZ A;  1Q1O A;  3Q6B A;  4C4V A;  2WU2 B;  2K39 A;  4RGT A;  3AUL A;  1WGK A;  1X1M A;  4EE2 A;  4YTM B;  3HHM A;  1QT9 A;  4YXD B;  4ZYN A;  3SFD B;  4GU2 A;  2C60 A;  4A3P A;  4EZJ A;  4JWS C;  2MQJ A;  2WXJ A;  4GB9 A;  4WAF A;  2WXO A;  4TKN A;  2PVG C;  1D5M C;  4KGS A;  1UBI A;  2VZK B;  4IOI E;  1ROE A;  2ZZP B;  2IBI B;  2UWQ A;  4ANW A;  1DOY A;  1HA5 A;  2FAZ A;  2CR5 A;  3URY A;  2C9W B;  4WJQ A;  2D3B A;  1I7H A;  3QA8 A;  1JWM D;  4TQ0 A;  4KX6 B;  3Q2A C;  1MHH E;  4FAD A;  2QC8 A;  1P7E A;  1HXY D;  2QIL A;  5AUK A;  2IZV B;  2MBQ A;  4G11 A;  1J19 A;  3APC A;  4TQ1 A;  3RNA C;  1TKG A;  4WIP A;  4NNJ B;  2AX5 A;  1JML A;  3GZN B;  1UF0 A;  4GOC A;  1RAX A;  2KN4 A;  3S2A A;  3N3K B;  2V3P A;  1C4C A;  1SXT A;  2Y5B B;  2OJR A;  2KOX A;  2G4S A;  4IC7 B;  5CTR C;  4MEL A;  1FO4 A;  1LGR A;  3VH3 B;  2YEP F;  4II2 B;  2KT7 A;  3AMZ A;  3WAM A;  2K5P A;  1SJE D;  2WXH A;  1M94 A;  1AW7 A;  4NY0 A;  4ZHO A;  1WXQ A;  5D94 A;  4ZRI A;  1FPY A;  4W9L A;  4P1B C;  4XWW A;  2MHJ A;  3PZ8 A;  2N1W A;  3H8H A;  3EA6 A;  2HD5 B;  2M19 A;  4GSW A;  1TS2 A;  4HCN B;  3C8Y A;  3DHG C;  5CHF A;  1WX8 A;  1T0Q C;  1GC7 A;  5DPS A;  2N9K A;  3ML9 A;  1V97 A;  2Z0E B;  4ITK A;  1XT9 B;  3KH0 A;  4P6V F;  4W9J A;  1VJK A;  4L2Y A;  3NVW A;  1FFV A;  4RCO A;  4HXD A;  1FNU A;  3IVF A;  4LNK A;  4K7S A;  3A1Q A;  1GB4 A;  4BZA A;  2B3A A;  2DZK A;  3DDC B;  2L3Z A;  3Q69 A;  1I4G A;  4LDT B;  4EUT A;  4LTU A;  2MCN B;  4EZK A;  1ZGU B;  3P4Q B;  5G5G A;  1WXV A;  3KYD D;  2LXC A;  2KMA A;  1ET6 A;  1YJI A;  2KD0 A;  1Y8R C;  4FXC A;  1OQY A;  4K81 A;  2JZZ A;  1E7U A;  3V3X A;  3NS8 A;  1F2R I;  4K3C A;  3NUH B;  3O65 B;  2IGG A;  2PW9 A;  2WXP A;  4MEM A;  2M56 B;  3W1S A;  3U52 E;  4ZRP A;  4M8M A;  1ZP0 B;  2L0T A;  2KFK B;  1I4X A;  1Q0W B;  1C4A A;  2LUM A;  2ACZ B;  2LUE A;  1F2R C;  2W54 A;  1WYG A;  2FBW B;  3ZTC A;  2LJI A;  2ZPY A;  1JWU D;  2FCN A;  2FCM A;  2RSU A;  3HM6 X;  2BKR B;  1DGJ A;  1N61 A;  2XBB C;  1J8C A;  2EMS A;  1KJT A;  1WJU A;  3TEW A;  3B0A A;  4JIO U;  3KUZ A;  2WDV B;  3D32 A;  2DAJ A;  1IYF A;  4JWU C;  5DPW A;  1E8Y A;  4WWO A;  3RNB C;  2E6X A;  4CQN A;  4IG7 B;  3TIX A;  1C1Y B;  2LGX A;  3T8M A;  4LJP B;  2K8C A;  5D2M B;  2I2Y A;  1EO6 A;  3RZF A;  2OHF A;  2H88 B;  4OW0 A;  1I4P A;  2LZ6 A;  2DBY A;  1SE2 A;  1ET9 A;  2ASQ A;  2K25 A;  5H92 C;  5EE9 A;  4UDU C;  4MGZ E;  1CJE A;  1T3Q A;  1FNW A;  3AXC A;  2L32 A;  1SE4 A;  2ZW1 A;  3R7R A;  3B2F A;  2CU1 A;  4OVU A;  2DZI A;  1V6E A;  5AZG A;  2ZVO A;  3AE1 B;  2IYD B;  1L0V B;  4KSL C;  2CU3 A;  1QOA A;  2X8X X;  1V1P B;  4K3B A;  3P4P B;  3N20 C;  3BK2 A;  2W3S A;  3MHS D;  2C7N B;  5G2N A;  5BMI A;  2V3S A;  2XK5 A;  3TMP B;  4EOY A;  3BWU D;  3ZXR A;  1XLP A;  4NJ7 A;  4AJY B;  5LXI B;  1FEH A;  3M95 A;  2Z0D B;  1ISN A;  3RNF C;  3PSE B;  1M4V A;  2LVP A;  3EHV A;  3PT2 B;  1KF6 B;  4IM3 A;  2WXM A;  2LEK A;  3VH4 B;  3SD5 A;  4FA6 A;  2G3Q B;  2WXG A;  2NPT A;  2FE8 A;  2BB5 A;  3KQ4 A;  3AE6 B;  2KTR A;  1G6J A;  1PDX A;  1R7S A;  1KLG D;  2I1K A;  2LHE A;  4N58 A;  3FC4 A;  3KWL A;  4BKS A;  1UGJ A;  1R4N B;  4HVB A;  2XEW A;  4WH4 A;  1WXA A;  4K1R B;  4WQM A;  4US8 A;  1EWC A;  1FIQ A;  3RN9 C;  1V49 A;  3AE8 B;  4ZRK A;  2KAJ A;  3RNE C;  3SEB A;  4LCD E;  3DBL I;  1CZP A;  2OJW A;  2HJ1 A;  5FR3 A;  2MJD A;  1FRR A;  3U8Z A;  1P3Q U;  1RFA A;  4HPP A;  2MBE A;  1XCT L;  3HUI A;  3AE5 B;  2WX0 A;  1XQQ A;  2DZM A;  2L7R A;  2E3T A;  1XLQ A;  3V61 A;  2NVU I;  3MHZ A;  1S1Q B;  3NZU A;  4GDL A;  1JWA D;  1MFW A;  2NMQ A;  2A4Z A;  2J42 A;  1H8C A;  2N1V A;  1N60 A;  3SFE B;  3ZTD A;  3Q3O C;  2L1A A;  4DHZ B;  4BOZ B;  1WWT A;  2K8H A;  2WXI A;  2G45 B;  1AN8 A;  1E7V A;  3IT6 B;  4NPN A;  4HLE A;  1A5R A;  3IAM 1;  5D6J B;  2INP E;  2BPS A;  1WGG A;  2WXL A;  4A9A A;  3NZ3 A;  2JU6 X;  2K22 A;  2ZPN A;  5AZF A;  3UQB A;  4FUL A;  3ZJT A;  1UEL A;  3R66 C;  3ZNH B;  1N5X A;  4QAY A;  2BWE S;  2K1F A;  3NZS A;  1NDD A;  2GMI C;  2GRI A;  1UZX B;  2DAF A;  4XDD A;  3KUC B;  2LWP A;  4MGK E;  1IGD A;  1WGY A;  4G0N B;  1RYJ A;  2IO3 B;  1VRA B;  2L05 A;  4KKI A;  4GLS C;  4MT5 A;  3CIR B;  4L23 A;  4M01 A;  2NS5 A;  3I3T B;  5J18 A;  1FFU A;  4ZRJ A;  3SR6 A;  4A90 A;  1I4Q A;  1QKZ A;  4DWF A;  1UNS A;  1L7Y A;  3GOE A;  4KSK C;  4A20 A;  2VH1 A;  2O6V D;  5C1Z A;  3UIO B;  1MG8 A;  4NJC A;  3N1Z C;  3V62 A;  3AEC B;  1P98 A;  1F52 A;  1E90 A;  1NI3 A;  2O6V B;  2D10 A;  2RDG A;  5L83 A;  1PUT A;  2NTT A;  2HJ8 A;  2BF8 B;  2MBO A;  2RDH A;  2AQ3 B;  2X38 A;  1XO3 A;  1SIF A;  2EKE C;  4BKT A;  4DHJ B;  1FD6 A;  1E8W A;  4EKU A;  1NI2 A;  4FLH A;  4B6W A;  3PZD A;  2K6Q A;  4JX1 C;  1NBF C;  3FAH A;  3I9V 1;  3AU5 A;  1F77 A;  2IND C;  2KX0 A;  1HE8 A;  3CST A;  1U4A A;  2WWZ A;  2Y3A A;  4ANU A;  1SIJ A;  1XLO A;  2MW5 A;  4OZC A;  3AEB B;  1I42 A;  1D4B A;  1J7B A;  1RM6 C;  3JVZ X;  4FN2 A;  1TYG B;  3MC0 B;  4Q2J A;  2KLC A;  3U2S C;  3UGB B;  4RM8 A;  2C7H A;  5L95 C;  5IO9 A;  1N5W A;  4ZRQ A;  3P4R B;  4M00 A;  2CHW A;  3V05 A;  3UQA A;  1EF5 A;  2KQS A;  2N0S B;  1OQQ A;  2BWF A;  2M0A A;  2ONQ A;  3SDL C;  2L00 B;  2KJ6 A;  4WJP A;  3VVW B;  1A70 A;  2K0P A;  2V0G A;  1YJJ A;  2NCN A;  1T0Y A;  2YVC A;  2TSS A;  2B76 B;  1PGA A;  1Y56 A;  3JW0 X;  2W55 A;  1TZO A;  5TSS A;  3DVG X;  4W9I A;  2JY6 A;  3TBL D;  1LQB A;  1TZ1 A;  4WWN A;  2UU7 A;  4K7U A;  2YEP B;  2AWT A;  2IJ0 A;  2QHO A;  4CHK A;  4IKG A;  3P42 A;  4MM3 B;  2KC1 A;  3PRP B;  3W5V B;  3B08 A;  3VXW A;  2WXN A;  3OLM D;  2G1E A;  4I6L B;  2WHI A;  2BB6 A;  3VTU A;  1OEY J;  2V1Y A;  4NAM A;  4I6N B;  3ZVV A;  2BS2 B;  1N62 A;  2KNB A;  3PHX B;  2JYT A;  4S0R A;  3ECI A;  1FMA D;  2MH7 A;  3M62 B;  5G55 A;  3HIZ A;  3UI3 A;  2KMM A;  1GUA B;  1WXS A;  2SEB D;  3A9J A;  4KZC A;  1HEZ E;  3L16 A;  2LAS A;  3W5U B;  3AEG B;  5E6P A;  4N6E B;  2KTR B;  3PPA A;  1N6Z A;  2HTM E;  4JE3 B;  3Q8F A;  1KOT A;  5AEK B;  3C19 A;  2LMC A;  1E7P B;  2ZNV C;  4HK2 A;  4IUM B;  1T6B X;  2KDI A;  3ENE A;  2GBN A;  3NY5 A;  2KJR A;  3UIN B;  2JQR B;  2AYO B;  2W82 A;  4WQO B;  2WXF A;  2PVO D;  3AE4 B;  4HPM B;  2IY0 B;  1ZKH A;  2JXX A;  3DQV A;  3H9D A;  4IW0 A;  3APD A;  2DWQ A;  1L2N A;  3KLS X;  3RNG C;  4YL8 A;  3RZW C;  3NVZ A;  4LNN A;  4N59 A;  2VZK D;  2AQ2 B;  2MLB A;  2NBU A;  3BYT B;  1DOX A;  4KGT A;  3I57 A;  1WM3 A;  1JWB D;  1QQR A;  1AWD A;  2MP2 B;  1SF0 A;  4JLC A;  1JW9 D;  2BT6 A;  1L5P A;  2DYO A;  1VD2 A;  3PRM B;  2FID A;  4LK0 M;  3A33 B;  2J52 A;  4WWP A;  2EEL A;  2WGS A;  4KIK B;  3JSV A;  4ARC A;  3B1L X;  1WFY A;  1ZOY B;  3AB5 A;  4FJV B;  2MBB B;  3QK0 A;  2O2V A;  1TY0 A;  1YOV B;  2V4I B;  2LD9 A;  4WUR A;  3ZRF A;  3VR8 B;  1PGX A;  4C80 A;  4TMA B;  2DX5 B;  1L6V A;  1FXI A;  4IWQ A;  3M63 B;  4YSZ B;  1GOZ A;  2ZNV B;  1WJ6 A;  4HKQ A;  2BS4 B;  5E6J A;  4E3C A;  2XNA C;  5IP4 D;  4ARI A;  2BVC A;  3MC9 A;  1WRI A;  1HQR D;  3PRE A;  5HG2 A;  1W6V A;  1MPE A;  1P7F A;  3V6C B;  2JVC A;  3BVG A;  4F7Z A;  4DHZ E;  2WDR B;  3DBH B;  3AH7 A;  1IGC A;  2KYW A;  2M17 A;  2L8J A;  3ZW3 A;  2IO0 B;  2N9P C;  3BK1 A;  3ETR A;  3HM3 A;  1WF9 A;  1V5O A;  4KZ0 A;  3EGR A;  1WE7 A;  2AQ1 B;  1WJ4 A;  5IAA C;  2IGD A;  1TS5 A;  2RPV A;  4FBJ B;  1XD3 B;  2PKO A;  3BYY B;  1GC6 A;  2J0J A;  2KWC A;  1ZPS A;  2MSE D;  3BVZ A;  2JZ3 B;  1I35 A;  4IM0 A;  3DBR I;  1C79 A;  5IKC M;  2V4L A;  4LDT D;  1J7A A;  1UUP A;  2R61 A;  3NVY A;  2ZEQ A;  2JSV X;  1J7C A;  5EE1 A;  2REX A;  2KDF B;  2PIA A;  3GS2 A;  4DQO C;  1YQ3 B;  1TS3 A;  3VAW A;  2KX3 A;  2KTF A;  1E9M A;  1DYQ A;  2WXQ A;  2PLP A;  3P2B A;  2KC2 A;  2KN5 A;  4TSS A;  3RCZ A;  3FKY A;  4HJG E;  4A8X C;  2A5U A;  4S17 A;  3AN1 A;  3L0W B;  4NQL B;  1V5T A;  2M4N A;  3KVF B;  2KFK A;  2DZJ A;  1GNU A;  3QC8 B;  3T9L A;  4BVU C;  3DHH C;  1NEN B;  4MGY E;  4MJS B;  3H7P B;  2KKC A;  2KK8 A;  3ZNI D;  4RGN A;  2MA9 B;  4YTP B;  1EUV B;  3OJ4 B;  4XC2 A;  3OAW A;  1IP9 A;  3NJT A;  2O6V A;  2GBK A;  4YSY B;  5KHO A;  4NJ6 A;  4GN1 A;  5J2R A;  4J3O D;  1MI0 A;  3N32 A;  2LRU A;  2PTL A;  4ICV A;  1IBX A;  2LGD A;  3WAL A;  4AS1 A;  3VRA B;  3TEX A;  2DLB A;  4P16 A;  1R4N I;  3IAS 1;  1V8C A;  3LXF A;  1OQR A;  4KGR A;  5JZE B;  1SEB D;  3T3O A;  1FRD A;  3MTN B;  2MWS B;  2KAN A;  3I5J C;  2ZCB A;  5C3J B;  1KH0 A;  4HDO A;  1F0Z A;  3VDZ A;  2NTS A;  1VR9 A;  4AP4 C;  2W9N A;  4BAX A;  1C76 A;  2JT4 B;  3IHP C; 
#chains in the Genus database with same CATH homology
 1AAR A;  5JHA A;  4OVV A;  2IZV B;  2JRH A;  1L7Y A;  3LDZ E;  3GOE A;  5DPR A;  5AZH A;  2MBQ A;  4G11 A;  3QAQ A;  4KSK C;  2M0X A;  4A20 A;  1J19 A;  3APC A;  4BBN F;  4ANV A;  4KIK A;  4TQ1 A;  2O6V D;  3V6E B;  5C1Z A;  4FHJ A;  2WX1 A;  3JSV B;  3UIO B;  3QWZ B;  1MG8 A;  2DEN B;  2FCQ A;  2KWU B;  2R2Q A;  4NNJ B;  3V62 A;  1P98 A;  3TJP A;  3L17 A;  2D11 A;  2D07 B;  1E90 A;  2RD0 A;  2M8S A;  2O6V B;  2D10 A;  1LFD A;  4GOC A;  5L83 A;  1RAX A;  2HJ8 A;  4KDL B;  2BF8 B;  2MBO A;  3V60 A;  1P0R A;  3S2A A;  3N3K B;  3VUW A;  3QIJ A;  4B9K A;  4FJY A;  2K8B A;  4XX5 A;  2Y5B B;  3VUY A;  2OJR A;  1WYW B;  2KOX A;  2G4S A;  1SIF A;  2EKE C;  4BKT A;  1WE6 A;  1WXM A;  2N9E B;  1PQS A;  4IC7 B;  4JQW C;  5CTR C;  4DHJ B;  4MEL A;  4E74 A;  3VH3 B;  2AEH A;  4II2 B;  1E8W A;  4EKU A;  3WAM A;  1NI2 A;  4FLH A;  4B6W A;  3PZD A;  2K6Q A;  3WAP A;  1NBF C;  3QCA A;  5LXH A;  3AU5 A;  1M94 A;  4NY0 A;  2LXA A;  3ZDT A;  4GXB A;  2KX0 A;  1HE8 A;  5D94 A;  3CST A;  4ZRI A;  2BGF A;  1FXT B;  1U4A A;  2MBH A;  2WWZ A;  4HWI B;  4W9L A;  2NPT B;  4ANU A;  2ZJD A;  2MW5 A;  5TR5 A;  2N1W A;  2MRP A;  5C23 A;  1I42 A;  2HD5 B;  4FN2 A;  3JVZ X;  4GSW A;  1V81 A;  3WAO A;  4FHK A;  4G50 A;  2KLC A;  3PRZ A;  3UGB B;  2D3G A;  1YD8 U;  3CMM B;  4RM8 A;  2WYQ A;  2C7H A;  4HCN B;  5L95 C;  4HDQ A;  4WJO A;  4AUQ C;  5CHF A;  4RMA A;  1WX8 A;  1E5W A;  3IFW B;  3DVN V;  2FCS A;  3HK0 A;  2EMT A;  4II3 B;  1V2Y A;  2CHW A;  3UQA A;  1GC7 A;  1EF5 A;  2KQS A;  2NR2 A;  3DOW A;  4PS3 A;  5DPS A;  3K9O B;  3ML9 A;  2PEA A;  1Z5S B;  3ZDM C;  3A9J B;  2BWF A;  3SDL C;  2L00 B;  2Z0E B;  3DCG A;  1K8R B;  2KJ6 A;  4WJP A;  3PLU A;  1XT9 B;  3KH0 A;  3VVW B;  3M3J A;  3ZO5 B;  3KW5 B;  4W9J A;  4I6P A;  2MP2 A;  2NCN A;  5CHW A;  4M0W B;  3PHW B;  1T0Y A;  2YVC A;  3BIN A;  2DYB A;  4GDK A;  4K7W A;  4HXD A;  4W9F A;  3VHT C;  3N30 A;  3JW0 X;  2D2Q A;  3VQI A;  3IVF A;  2YLM A;  4F1S A;  3DVG X;  2JPH A;  4K7S A;  4W9I A;  3A1Q A;  2JY6 A;  4NQK E;  3TBL D;  4EZL A;  1LQB A;  1E8X A;  1TZ1 A;  4WWN A;  1WX7 A;  1RRB A;  2I1J A;  4K7U A;  3JYU A;  2B3A A;  2DZK A;  3DDC B;  2AWT A;  2QHO A;  3AU4 A;  4ICU A;  2WDT B;  4IWO A;  4CHK A;  2L3Z A;  1UBQ A;  3QX1 A;  4KDI C;  2KC1 A;  3PRP B;  4LDT B;  3ZKJ C;  4EUT A;  3B08 A;  3VXW A;  2O2V B;  3MJW A;  3OLM D;  2MCN B;  4EZK A;  3KUD B;  4EFO A;  5GMV A;  4I6L B;  1ZGU B;  1WXV A;  3KYD D;  2KO3 A;  3VTU A;  1OEY J;  2LXC A;  1IPG A;  2KMA A;  2KHW B;  3SHQ A;  2NBW B;  3DBH I;  2V1Y A;  1CMX B;  2KD0 A;  1Y8R C;  1OGW A;  4I6N B;  3ZVV A;  3A4S C;  2CKH B;  1OQY A;  3BY4 B;  5BO4 B;  4K81 A;  2IO2 B;  2JZZ A;  2KNB A;  1E7U A;  3PHX B;  3TL5 A;  3LMN A;  3NS8 A;  3ECI A;  4MJS A;  1WX9 A;  3O65 B;  4BFR A;  1V86 A;  3H7P A;  4RM9 A;  2LI5 A;  5FR6 A;  3L08 A;  3M62 B;  5G55 A;  5LLI A;  4MEM A;  1WI0 A;  3W1S A;  1WGH A;  1WGR A;  2CHZ A;  1YJ1 A;  3HIZ A;  2OOB B;  4CYE A;  4M8M A;  1GUA B;  3QAR A;  5DCN A;  1WXS A;  2L0T A;  1OTR B;  2KFK B;  4GDL B;  4BOS C;  3A9J A;  4KZC A;  3ONS A;  3L16 A;  1Q0W B;  2LAS A;  4WAA A;  1EF1 A;  5E6P A;  2LUE A;  5HKH A;  3ZTC A;  2ZPY A;  2FCN A;  2LVQ A;  2J0K A;  2FCM A;  2KFJ A;  2KTR B;  2RSU A;  3IG3 A;  3PPA A;  4JL9 A;  3HM6 X;  5CHV C;  2ZCC A;  1KOT A;  5AEK B;  2CHX A;  2LVO A;  1WJN A;  3NHE B;  4MDK E;  4PS7 A;  4W9K A;  2BKR B;  2ZNV C;  4HK2 A;  4KV2 A;  4IUM B;  2XBB C;  1F9J A;  1J8C A;  3CSF A;  2EMS A;  4GMV A;  3WAN A;  1KJT A;  2KDI A;  3ENE A;  2GBN A;  3NY5 A;  1WJU A;  2BYF A;  3B0A A;  5E6O A;  2KJR A;  1WMH A;  4JIO U;  3KUZ A;  3EEC A;  3D32 A;  2DAJ A;  2GOW A;  1KM7 A;  3UIN B;  4HCP B;  1IYF A;  5DPW A;  2KQ7 A;  1E8Y A;  4MH0 E;  2AYO B;  4WWO A;  4WQO B;  2RR9 A;  4P7I A;  2KWV B;  4HPM B;  3C0R B;  4KVG B;  4IG7 B;  2IY0 B;  1ZKH A;  1BT0 A;  2JXX A;  2KMC A;  3TIX A;  1C1Y B;  2LGX A;  3T8M A;  3DQV A;  1UGM A;  3H9D A;  4IW0 A;  4DDG D;  3APD A;  1L2N A;  4LJP B;  2K8C A;  1GG3 A;  2C7M B;  4YL8 A;  5D2M B;  4TV3 A;  1OEY A;  1EO6 A;  4WJN A;  3RZW C;  3RZF A;  4GGQ A;  2JUO A;  3Q3F A;  2MLB A;  4F8C B;  2NBU A;  4W9D A;  3WA0 A;  2PE6 B;  2LZ6 A;  1S3S G;  2ASQ A;  2K25 A;  1WGD A;  1WM3 A;  2GBJ A;  3ALB A;  3H7S A;  3ZNZ B;  4XZ4 A;  4MGZ E;  3AXC A;  2MP2 B;  1WR6 E;  3KYC D;  3A9K B;  3PVL A;  5EDS A;  1QZE A;  2MX2 A;  1E8Z A;  2PPH A;  3APF A;  4JLC A;  2DYO A;  1VD2 A;  4AWJ A;  3PRM B;  2FID A;  3R7R A;  4OVU A;  2CU1 A;  2K6D B;  3A33 B;  4WWP A;  5JH5 C;  3A9K A;  3A1Q B;  3UF8 A;  2DZI A;  4BKS D;  4E71 A;  1V6E A;  5AZG A;  4URK A;  2ZVO A;  4JGH B;  2FNJ B;  3ZRC A;  4KIK B;  3PGE A;  2IYD B;  3ZLZ A;  2G4D B;  2N4F A;  1UD7 A;  2JRI B;  2L76 A;  3JSV A;  4ZDV A;  2LJ5 A;  4KSL C;  3B1L X;  3L10 B;  3RT3 B;  1WFY A;  3QK0 A;  4FJV B;  2MBB B;  2O2V A;  1WIA A;  3L13 A;  4ASW C;  2LD9 A;  3MHS D;  4HJK A;  3ZRF A;  2C7N B;  4W9E A;  5G2N A;  3DVN U;  2V3S A;  2DX5 B;  2BYE A;  2XK5 A;  3TMP B;  4EOY A;  1WY8 A;  2FUH B;  1H4R A;  4NJ7 A;  2JWZ A;  1WMH B;  3DBS A;  4AJY B;  5LXI B;  2VRR B;  5IA7 A;  2KJH B;  4IWQ A;  3M63 B;  1RLF A;  1Z2M A;  2XK5 B;  3M95 A;  2ZNV B;  2Z0D B;  4N9F 4;  3RYT A;  1WJ6 A;  3NOB A;  3W1S C;  1ISN A;  4DBG A;  2GBM A;  4DHJ D;  4E3C A;  3PSE B;  3AI5 A;  3QHT A;  1ZW7 A;  3OJ3 A;  4LJO B;  5D7G A;  1GJZ A;  5CX3 A;  2LVP A;  3EHV A;  3PT2 B;  2KXJ A;  4IM3 A;  4TUU A;  3RUL A;  4NAW B;  4PYZ A;  4B95 A;  3PRE A;  3VH4 B;  3GZN I;  1W6V A;  1WRD B;  2R2O A;  4W9C A;  3V6C B;  3SD5 A;  2JVC A;  4MSQ B;  4F7Z A;  1R4M I;  2G3Q B;  4CO7 A;  4DHZ E;  2NPT A;  4FA6 A;  3RD2 A;  2M17 A;  1WH3 A;  2L8J A;  1V9J A;  2KTR A;  1G6J A;  3EC8 A;  3ZNG C;  3ZW3 A;  2I1K A;  2IO0 B;  2N9P C;  1UH6 A;  1YX6 B;  5JHB A;  4BKS A;  3HM3 A;  4X57 B;  1WF9 A;  3SU8 X;  1V5O A;  4KZ0 A;  2KLG A;  4ANX A;  3VUX A;  2HTH A;  4PS8 A;  5KHQ A;  1WE7 A;  2RGF A;  4HVB A;  2XEW A;  3PV1 A;  1WJ4 A;  4BKG A;  1WXA A;  1YQB A;  4K1R B;  5IAA C;  4FBJ B;  2AL6 A;  2JF5 A;  3ZIM A;  1C3T A;  2AL3 A;  3A4R A;  1XD3 B;  3R3M A;  4DK5 A;  2KZR A;  4FJZ A;  2LGY A;  2KDB A;  3EFU A;  2CS4 A;  3LJ3 A;  2UYZ B;  4W9H A;  1GC6 A;  2KVR A;  1TGZ B;  1V49 A;  2J0J A;  2KWC A;  2MSE D;  3TCA A;  3VFK A;  3VTW A;  4ZRK A;  1YIW A;  2Z59 B;  2JZ3 B;  1I35 A;  4IM0 A;  3DBR I;  2J7Q B;  1YX5 B;  4LCD E;  1SE9 A;  2DHZ A;  2V4L A;  3DBL I;  4LDT D;  3W1Y A;  2IO1 B;  4PYU A;  2ZEQ A;  4BBN C;  5E6N A;  2REX A;  2KDF B;  3QQ8 B;  3H1U A;  4DXA B;  3U7D A;  3H6N A;  3VAW A;  2KX3 A;  4MGI E;  2KTF A;  1P9D U;  3X23 A;  1SGH A;  3U8Z A;  1P3Q U;  3PS6 A;  1TTN A;  4EEW A;  1RFA A;  3P2B A;  2MBE A;  2KDE B;  4MM3 A;  2KC2 A;  2WX0 A;  2KN5 A;  3RCZ A;  1XQQ A;  2N7D A;  2DZM A;  1VCB A;  2L7R A;  3DPD A;  3ZUN A;  3PLV A;  2HE7 A;  2A5U A;  2L0F A;  4W9G A;  3V61 A;  3CF6 E;  2LRW A;  2NVU I;  1WR1 A;  2IY1 B;  3L0W B;  4M8N A;  1V5T A;  1S1Q B;  2FIF A;  2M4N A;  3NZU A;  2KFK A;  1WZ0 A;  2PJH A;  3KVF B;  4GDL A;  2DZJ A;  1GNU A;  4A3O A;  3QC8 B;  4MSM B;  3T9L A;  1LM8 B;  2A4Z A;  3L54 A;  4BVU C;  1H8C A;  4J6I A;  2N1V A;  3IBE A;  3UIP B;  1P1A A;  2N9X A;  4MJS B;  4MGY E;  4G3X B;  4NQL B;  3R7Q A;  3U30 A;  3ZTD A;  1D3Z A;  3H7P B;  2KKC A;  2KK8 A;  2ZVN A;  3ZNI D;  4DHZ B;  2MA9 B;  2RPQ A;  3QJZ A;  4BOZ B;  2K8H A;  1Q5W B;  1EUV B;  2G45 B;  1E7V A;  3Q3J A;  3OJ4 B;  4NPN A;  4HLE A;  1JRU A;  1A5R A;  4XC2 A;  2C5L C;  5D6J B;  3WIM A;  3OAW A;  2N7E A;  1IP9 A;  2BPS A;  2DYM A;  2O6V A;  4GIV A;  2GBK A;  2PE9 A;  2BKF A;  1WGG A;  2M1M A;  1Q1O A;  4DDI D;  3VTV A;  5KHO A;  4IM2 A;  2K39 A;  4NJ6 A;  3AUL A;  2GBR A;  1X1M A;  4GN1 A;  2ZPN A;  5AZF A;  3UQB A;  5J2R A;  4FUL A;  2J0M A;  1TBE A;  2NBV B;  4IWP A;  3HHM A;  4AJW A;  1WZ3 A;  3N32 A;  2LRU A;  3PTF C;  1UEL A;  4ZYN A;  3R66 C;  4ICV A;  4NAW A;  3ZNH B;  5DPT A;  4GU2 A;  2BYV E;  2BWE S;  2K1F A;  1V80 A;  2LGD A;  3NZS A;  1NDD A;  2GMI C;  1UZX B;  3WAL A;  2C60 A;  4A3P A;  2DAF A;  4EZJ A;  1WM2 A;  1LXD A;  2MQJ A;  4GDK B;  1J0G A;  5J17 A;  1R4N I;  4GB9 A;  3KUC B;  2LWP A;  4MGK E;  4TKN A;  1UBI A;  1WGY A;  4G0N B;  5JZE B;  2ZZP B;  2IBI B;  2UWQ A;  3MTN B;  4HPL B;  2MWS B;  2IO3 B;  4ANW A;  3RUI B;  2FAZ A;  2L05 A;  2CR5 A;  2KAN A;  3ML8 A;  2C9W B;  2ZCB A;  3DVG Y;  2NS5 A;  3I3T B;  4WJQ A;  3X0W A;  5J18 A;  4ZRJ A;  3K9P B;  4HDO A;  3QA8 A;  3VDZ A;  1KLV A;  4AP4 C;  4TQ0 A;  2W9N A;  4FAD A;  4DWF A;  2JT4 B;  3IHP C;  4AOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...