5CTRC

Crystal structure of human sart3 hat-c domain-human usp4 dusp-ubl domain complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
206
structure length
206
Chain Sequence
RPDAETQKSELGPLMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRKVVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recruiting and shuttling of the spliceosomal deubiquitinase USP4 by SART3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system, nuclear protein, rna binding protein, hydrola
molecule keywords Squamous cell carcinoma antigen recognized by T-cells 3
total genus 32
structure length 206
sequence length 206
chains with identical sequence D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06337 DUSP DUSP domain
C PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5ctrC02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 5ctrC01
3CSFA 2UWQA 2RR9A 2K6DB 3LDZE 3WAOA 1A5RA 3VH4B 4IG7B 1YQBA 1VCBA 1Q1OA 1P3QU 2LVPA 3MJWA 1UH6A 3QX1A 5CX3A 2RD0A 3DVGX 4EFOA 4FN2A 3UIPB 2KTRB 3A1QA 4ANWA 1UD7A 2XBBC 2HE7A 1WJUA 3LJ3A 2KQ7A 1Q5WB 1Z5SB 2K8BA 2O6VD 4K81A 1Q0WB 2LVOA 2CHXA 3U7DA 2ZPYA 2N4FA 2ZVOA 1LM8B 3TIXA 4DHJB 2YVCA 4K7WA 4TV3A 3TCAA 4M8MA 1IYFA 1UBQA 2PE9A 1V86A 2D07B 2HTHA 5JHBA 3IG3A 4EKUA 3ZDTA 1WI0A 4G50A 4KZ0A 3WALA 4ANUA 1WGYA 3HK0A 2N1WA 3T9LA 4TQ0A 2AWTA 2BGFA 2L76A 2ZNVB 3LMNA 3APDA 2KFJA 3DPDA 1WXSA 1Y8RC 1E7VA 4W9HA 5CHVC 5E6NA 4FBJB 2ZZPB 3HIZA 3ZNZB 2O2VA 2C7HA 5EDSA 3QIJA 4GOCA 3MHSD 1EF1A 4AUQC 3ZLZA 2KDBA 3EC8A 5J18A 2CS4A 3MTNB 3R66C 1IP9A 3R7RA 2BKFA 4GDLB 2V3SA 4I6NB 5IAAC 3H7PA 2DZIA 1P9DU 2AEHA 2LGXA 1UELA 4CYEA 3PHXB 1YX5B 2G4SA 1OEYJ 3DBLI 4RMAA 3RUIB 2ZPNA 2AL6A 1WH3A 4KSKC 2DZKA 3QHTA 2XEWA 3VHTC 3M3JA 4OVUA 2L00B 4ASWC 3APFA 4MJSA 2KDEB 4HDQA 2KD0A 4WAAA 5J17A 1WIAA 3HM6X 3DVNV 4IW0A 3DDCB 4MSQB 4ICUA 4GSWA 3QAQA 2Z59B 1WJ4A 3N30A 1IPGA 4LDTD 4GMVA 2M4NA 2GMIC 2O6VA 5HKHA 5AEKB 3AULA 4I6PA 2IY1B 3RT3B 4EEWA 3TMPB 1EUVB 1JRUA 2L0TA 2MX2A 4A3OA 3B1LX 4ZRJA 1V80A 4URKA 4IWQA 4IM3A 4OVVA 4GDLA 4HLEA 2N1VA 2ZCBA 2EMTA 3A4RA 4K1RB 2LASA 4EZLA 1WE6A 3U8ZA 2AL3A 3ZKJC 3PZDA 3A33B 2CKHB 3C0RB 4B9KA 2MBQA 3EFUA 1P0RA 5G2NA 1WX8A 2KX3A 4BOSC 1J0GA 2MP2B 3VTUA 4FADA 3L08A 2KFKB 4MGYE 1L2NA 1C1YB 3ZRFA 1WXAA 3WANA 4YL8A 2KO3A 4GDKA 2CHZA 4B6WA 4EUTA 3B08A 3QK0A 2KDFB 5AZFA 3L13A 1FXTB 4LCDE 3PREA 4W9GA 1PQSA 1YD8U 1RAXA 2BWES 2G45B 3ONSA 4MSMB 1X1MA 2EMSA 1WGHA 2WWZA 2KQSA 2YLMA 2KMAA 4RM9A 2K8HA 3PVLA 4N9F4 1V49A 2IO0B 3A9KA 3ML9A 4I6LB 3QJZA 2GBMA 1MG8A 2OJRA 3L10B 4KDLB 2LXAA 4DK5A 1V5OA 2N7EA 1P98A 2JXXA 1V9JA 3PRPB 4J6IA 3H9DA 4M8NA 2O2VB 4DHZB 4EZKA 2LUEA 2RSUA 1WXMA 1KM7A 2J0JA 3BY4B 3AU4A 3JVZX 4W9CA 2HD5B 2PPHA 3O65B 2L8JA 5E6PA 3K9PB 3EECA 4WWNA 2K1FA 3NS8A 5DPTA 5E6OA 2JF5A 2KTFA 2JRIB 4KDIC 4BFRA 2XK5B 4NNJB 2C60A 4WQOB 1RLFA 3NOBA 3KUCB 1Z2MA 3PGEA 4GU2A 1UGMA 1NBFC 1YIWA 3H7PB 3V6EB 2C7NB 2M17A 4W9KA 4JQWC 1NI2A 3WA0A 1KOTA 4FJVB 1H8CA 3KH0A 3D32A 2DAJA 4IM0A 3X0WA 3SHQA 3WAPA 4XC2A 1E8WA 3WAMA 2L05A 1WM3A 4NQKE 3RYTA 4ANXA 2RGFA 1E7UA 2PE6B 2V4LA 1L7YA 4ICVA 4E74A 4K7UA 4GN1A 3V61A 1OEYA 1WXVA 4MJSB 1WGDA 1TGZB 4G3XB 2KC1A 2MBOA 3DBRI 3RD2A 1WZ3A 4MELA 2DX5B 3W1SC 3GOEA 3KUDB 2B3AA 3ML8A 2BKRB 2D11A 1UBIA 4WJQA 4TKNA 3VTWA 4F7ZA 4HPMB 2GOWA 4KZCA 4MM3A 1GJZA 4W9LA 3OJ3A 2GBNA 5DPSA 2ZJDA 1BT0A 2LWPA 2ZNVC 3L0WB 3Q3FA 2M1MA 4HXDA 1OTRB 4M0WB 3L17A 3TJPA 2MW5A 3W1SA 4AJWA 3OJ4B 1TBEA 5IA7A 4MDKE 3M62B 2D2QA 2G3QB 1XT9B 3A1QB 3PS6A 2A5UA 1GNUA 2KK8A 5DPWA 2FIFA 3P2BA 4TUUA 3RULA 2K6QA 2NBVB 4KSLC 2IYDB 2FIDA 4W9EA 3DBSA 4BBNC 3ZVVA 2L3ZA 1WFYA 2KKCA 2FCNA 3ENEA 2N9EB 2KANA 4A3PA 5AZGA 4ANVA 3VFKA 2J0MA 3KYCD 3QA8A 3VTVA 3VXWA 3AXCA 2HJ8A 4BVUC 4AOFA 3NZUA 2JY6A 4II2B 2BF8B 1WGGA 4PYUA 5FR6A 3ZNHB 2KJ6A 4ZYNA 4DBGA 2MWSB 5JHAA 1WE7A 2JVCA 2KHWB 3A9JB 2DYMA 3JYUA 2ZCCA 3ZNID 2Z0EB 2MA9B 2KMCA 2NCNA 3APCA 3V6CB 1J8CA 1GC6A 2IO2B 3A9JA 3H7SA 2D10A 4HWIB 4FLHA 3UGBB 1E8XA 3PLVA 2KDIA 3HHMA 4F1SA 5KHQA 5D7GA 4BBNF 5G55A 3NY5A 3VVWB 2RPQA 2IO3B 3ZUNA 4EZJA 1LXDA 2CHWA 1D3ZA 3QC8B 1WX7A 2M0XA 2WX0A 2NBUA 4JIOU 4JLCA 1V5TA 1J19A 2KVRA 2NPTA 5DPRA 3TL5A 4A20A 2NPTB 2N7DA 1CMXB 2NBWB 1YX6B 2KZRA 4LJOB 4KIKA 1SIFA 3ZTDA 1KLVA 2IZVB 3JSVA 2VRRB 1WM2A 4HCNB 2LZ6A 4PS3A 4HCPB 3ZTCA 2KXJA 3VUXA 4NAWA 2DYOA 1ZKHA 2DHZA 2QHOA 1S1QB 3IHPC 5D94A 4BKTA 1WF9A 3N32A 4II3B 2KWVB 3EHVA 5GMVA 3RZFA 3RCZA 5CHFA 3CMMB 2PJHA 2LJ5A 4JL9A 4KIKB 3DVNU 3JSVB 2KJRA 2DYBA 4PS8A 3PLUA 2C7MB 1I42A 1KJTA 2C5LC 4DHJD 1VD2A 1RFAA 1G6JA 2MSED 1GC7A 3H6NA 4AWJA 3K9OB 3PHWB 2JZ3B 4ZDVA 2KLCA 5L95C 2KNBA 3ZW3A 2DAFA 4IWOA 2R2OA 3UQAA 2MLBA 2LD9A 2WYQA 2V1YA 3IFWB 2KX0A 3PV1A 3VUWA 1P1AA 2N9XA 3VUYA 4ZRKA 3B0AA 2FCSA 3T8MA 1QZEA 2KWCA 2LGDA 2GBJA 2LGYA 5D6JB 2L0FA 4HDOA 3RZWC 1LFDA 3ZIMA 1NDDA 2JWZA 3PT2B 4IM2A 4LDTB 4NJ6A 1F9JA 2C9WB 1H4RA 3UIOB 2BWFA 4HPLB 2G4DB 1V2YA 2MQJA 2REXA 3PRMB 2K25A 2O6VB 4MGKE 2IBIB 4MGZE 2LXCA 2NVUI 3OAWA 4JGHB 4PS7A 1XQQA 3R7QA 3OLMD 4IUMB 1SGHA 2DENB 3PTFC 2J7QB 2W9NA 3U30A 4BOZB 4GGQA 2R2QA 4GXBA 3TBLD 1OGWA 1E8ZA 1U4AA 2PEAA 1WYWB 1ZGUB 4NJ7A 2DZMA 1YJ1A 4W9JA 4FJYA 4MGIE 4WJPA 2KLGA 2LI5A 3SD5A 2IY0B 3ECIA 3PPAA 2MRPA 2WX1A 3VQIA 4K7SA 1K8RB 1WGRA 4DHZE 4G11A 2N9PC 2DZJA 3L16A 2WDTB 2I1JA 5LLIA 1WR6E 3NZSA 4MH0E 4P7IA 4GIVA 1UZXB 2IO1B 2KJHB 4HK2A 3DCGA 3KYDD 1WMHA 2KOXA 4EOYA 3ZRCA 4DDGD 3AU5A 2JPHA 2FAZA 5CTRC 4FHKA 4CHKA 2ASQA 5JH5C 1V6EA 4BKSD 2K8CA 1WJNA 4FJZA 5D2MB 4KVGB 4DXAB 2KFKA 3JW0X 1C3TA 1RRBA 4IC7B 3UF8A 4W9IA 2A4ZA 3M95A 4WJNA 5J2RA 2K39A 2MCNB 1E90A 3V60A 1W6VA 2EKEC 4FA6A 4PYZA 2Y5BB 5CHWA 2FCQA 3NHEB 1V81A 3PRZA 2L7RA 1WZ0A 3VH3B 1HE8A 2Z0DB 3A9KB 2NS5A 4IWPA 5DCNA 3SDLC 4BKGA 4KV2A 1WR1A 2KWUB 3HM3A 4NQLB 1ISNA 2I1KA 2XK5A 5AZHA 3Q3JA 4F8CB 1XD3B 4HVBA 2MBHA 1WRDB 2ZVNA 3QCAA 1OQYA 3UINB 2J0KA 2MBBB 3GZNI 4HJKA 4WJOA 2BPSA 2ZEQA 2CU1A 4W9DA 1R4NI 3DBHI 2LVQA 3QWZB 3VDZA 3ZNGC 1I35A 2FUHB 3A4SC 1WY8A 2BYVE 4LJPB 4E71A 3M63B 5BO4B 1TTNA 1ZW7A 2JT4B 1WMHB 3CSTA 4AP4C 3I3TB 4NPNA 1M94A 3QQ8B 4TQ1A 2KC2A 4X57B 2GBRA 3W1YA 3IVFA 3UQBA 2MBEA 3QARA 3KVFB 2FCMA 4XZ4A 1GUAB 3S2AA 1GG3A 5C23A 4AJYB 3ZO5B 3DVGY 1EO6A 1E5WA 1SE9A 4NY0A 4ZRIA 4B95A 2BYFA 2KN5A 5TR5A 1E8YA 1LQBA 2GBKA 2JRHA 4FULA 2BYEA 3PSEB 4DWFA 1EF5A 3ALBA 4GDKB 5L83A 3DOWA 5C1ZA 2AYOB 2UYZB 4FHJA 1T0YA 3H1UA 2MP2A 3VAWA 3ZDMC 4CO7A 5LXIB 4XX5A 1WX9A 1S3SG 3KW5B 3BINA 4RM8A 3AI5A 3R3MA 5KHOA 3IBEA 4WWOA 2CR5A 2JUOA 2NR2A 3V62A 5JZEB 2D3GA 4BKSA 1TZ1A 1AARA 3X23A 4W9FA 2LRWA 3CF6E 4NAWB 4DDID 4E3CA 2OOBB 3SU8X 4GB9A 3KUZA 4G0NB 3DQVA 2M8SA 1WJ6A 2JZZA 2FNJB 5LXHA 2KTRA 4WWPA 4MEMA 3N3KB 3WIMA 1R4MI 2LRUA 3L54A
chains in the Genus database with same CATH superfamily
4NJCA 2UWQA 1A5RA 4HRSA 1ZDVA 1VCBA 1P3QU 2LVPA 4R3DA 3A1QA 4ANWA 3AE6B 1UD7A 2HTME 1WJUA 1FRRA 3U7DA 1LM8B 1ET6A 3EGRA 1UBQA 2AQ1B 3IG3A 4G50A 4KZ0A 3T9LA 4TQ0A 2AWTA 2BGFA 2L76A 1PYWD 3LMNA 1UF0A 1WXSA 1E7VA 1BXTA 5CHVC 1T6BX 2HJ1A 3ZNZB 5EDSA 4GOCA 3MHSD 3ZLZA 3MTNB 3DBLB 2BKFA 4I6NB 2AEHA 2LGXA 3NVZA 1YX5B 2G4SA 1OEYJ 4PT5A 3MC0B 3RUIB 2ZPNA 4LK0M 1WH3A 2DZKA 3M3JA 4OVZA 2L00B 3LXFA 2UU7A 4HDQA 4MJSA 4WAAA 5J17A 3Q8CA 3N30A 5HFYA 5HKHA 3PZ8A 3AULA 3RT3B 3P1MA 2J53A 3UI3A 1EUVB 1JWMD 4ZRJA 1MVKA 1N63A 1YJIA 2ZCBA 1WE6A 1XCTL 3A33B 3AH7A 3ZYYX 4MM3B 5G2NA 4YSXB 3VTUA 4FADA 1C1YB 4GDKA 4EUTA 3QK0A 4LCDE 1PQSA 2BWES 1WGHA 2WWZA 2KMAA 4ZYSA 4N9F4 4M0WA 1QOBA 4C4VB 3ML9A 3QJZA 4LNKA 1LO5D 4DK5A 2LXAA 2YEPB 1HEZE 2LUEA 4LNIA 5EE0A 1KM7A 2J0JA 4MH8A 4DXFA 2HD5B 4L2YA 2PPHA 3I9V1 4P6VF 5E6PA 5EE9A 2VH1A 2EELA 3NS8A 3RN9C 4ZRQA 2KTFA 3EA6A 2WQYB 1NBFC 3H7PB 4W9KA 2BS4B 1NYQA 1KOTA 1V1PA 1H8CA 3NJTA 3WAMA 2PE6B 3KQ4A 1L7YA 4ICVA 3DBHB 3V61A 1TGZB 4MELA 3W1SC 1KFYB 2TSSA 2BKRB 4ZHOA 1YQ3B 3TEWA 4HPMB 1L6VA 4MM3A 4W9LA 3R8BA 5DPSA 2ZJDA 3L0WB 4C4VA 4JWUC 4HXDA 4M0WB 3L17A 4HJGE 3W9CB 3W1SA 1RYJA 1GB1A 1VR9A 2G3QB 1XT9B 1GNUA 4IKGA 2FIFA 1JRPA 1UUPA 2IYDB 1ZDXA 1HTOA 2L3ZA 3VFKA 3KYCD 2QJLA 4BVUC 2I2YA 1VDVA 3NZUA 4II2B 4PYUA 3ZNHB 4ZYNA 4DBGA 1ZOYB 1QKZA 2SAKA 3A9JB 2L32A 2Z0EB 1V1PB 2MA9B 2KMCA 2J52A 1J8CA 1VRAB 3RNAC 4FLHA 1MHHE 3PLVA 1UWXA 3I63C 1F0ZA 5IKCM 1LXDA 2ONQA 2CHWA 3NG0A 3QC8B 2M0XA 4L23A 1J19A 2PMVA 2N7DA 1CMXB 2N9KA 2KZRA 3URYA 2ACZB 4BAXA 2IZVB 3Q8FA 2VRRB 4PS3A 4A8XC 2KXJA 3VUXA 1S1QB 2X8XX 4II3B 5GMVA 2H89B 2LJ5A 2M0AA 2WXHA 3PLUA 1P7EA 3KWVA 4DHJD 2KYWA 1RFAA 3RFZB 3H6NA 3V05A 1E7PB 3PHWB 2KLCA 2INCC 3HUIA 3Q2AC 1C76A 1ACCA 2WYQA 2V1YA 3PV1A 4ZRKA 3B0AA 3R2IA 3NS1A 3T8MA 2KWCA 5D6JB 4HEA1 2L0FA 4HDOA 3PT2B 1L4ZB 1V2YA 4AS1A 2REXA 1SIJA 4PS7A 1XQQA 1PGBA 4IUMB 1SGHA 2DBYA 1FXIA 4BOZB 3TBLD 1OGWA 3NRZA 1WYWB 4NJ7A 3Q6BA 4MGIE 1D5ZC 2IY0B 1QF6A 3ECIA 4H2AA 4USAA 3HRDD 5FK9C 1NEKB 3MHZA 2WDTB 2WXLA 1ESFA 4M00A 3N1ZC 2KJHB 4HK2A 2L83A 3AU5A 4CHKA 2WXFA 1V6EA 4BKSD 4KVGB 2KFKA 2Y5PA 3JW0X 4IC7B 2AQ2B 3UF8A 1KTKA 4W9IA 4ZRPA 3AE9B 3M95A 1BUIC 2D3AA 5J2RA 2K39A 1ZE3D 1E90A 2MCNB 3V3XA 2Y5BB 1I4GA 2V0GA 3TUOA 1CK1A 3VH3B 3A9KB 2NS5A 5DCNA 1HZ5A 4JPSA 3TSSA 1QT9A 2Q5WD 2BW2A 4HVBA 1N62A 2ZVNA 3QCAA 1OQYA 4HJKA 1TYGB 2BYVE 2WXJA 4E71A 1STEA 1TTNA 4NPNA 1M94A 3AEDB 4HKQA 3IVFA 2MBEA 2QIEB 1TKEA 2FCMA 2QEJC 1GUAB 3B2GA 4KGTA 3DVGY 1EO6A 3ZO5B 3P63A 1FMAD 4ZRIA 3DWGC 4FULA 1J7AA 3VR9B 2OEDA 3KLSX 5EE1A 3H1UA 2MP2A 4XX5A 3J9CA 1S3SG 3AI5A 1GAQB 4JE3B 4W9FA 3CF6E 4A9AA 4DDID 2BS3B 1CJEA 2MH7A 2OOBB 1YN4A 3ABVB 1WJ6A 3Q14C 1SXTA 2KTRA 3Q8BA 4WWPA 3NZ3A 4OW0A 3WIMA 4A55A 2LRUA 3L54A 2RPVA 1A70A 2RR9A 2K6DB 3LDZE 4IOIE 4IG7B 1Q1OA 3QX1A 1B9RA 4YT0B 3CWIA 5MPOA 1AW7A 1R4MB 1FD6A 4FN2A 3LJ3A 2HE7A 2ZW1A 2K8BA 2O6VD 2ZPYA 2KT7A 3TIXA 2YVCA 3B9JA 3BIID 1IYFA 2WXIA 1V86A 4YXDB 4EKUA 3Q8EA 3WALA 3HK0A 2HDEA 2N9LA 5HG2A 3DPDA 3ZXVA 1MG4A 2IGGA 2M56B 2O2VA 2C7HA 4HPPA 4AUQC 3VRBB 2CS4A 1IP9A 1M4VA 2WXNA 2WGSA 1UWMA 2DZIA 2WU2B 2FBWB 2QILA 2AL6A 4KSKC 3NVWA 3VHTC 4OVUA 4RFBA 3DDCB 3AMZA 2GLSA 2W54A 1IPGA 2GMIC 4RH6A 2MX2A 2W3SA 1V80A 4RCOA 3AN1A 4OVVA 1PGXA 4GDLA 2KACA 4A90A 3U8ZA 2AL3A 1ZPSA 3PZDA 5C2TB 3C0RB 4B9KA 1JWSD 1P0RA 5AUKA 4O1NA 2KFKB 1L2NA 2CHZA 3B08A 3L13A 3PREA 3RNCC 4MSMB 1ET9A 1V49A 1C4CA 4K3BA 2CJNA 3IAM1 1C4PA 4I6LB 4LNOA 1TY0A 2GBMA 3RI7C 5IN7A 4C7ZA 2OJRA 4KDLB 1V5OA 1V9JA 3H9DA 4DHZB 1WXMA 3EFCA 3AU4A 3PO0A 5IO9A 3EUB2 1V8CA 1GOZA 3O65B 2L8JA 3K9PB 1B1ZA 4GLSC 1AN8A 4WWNA 4RGOS 1ZXHA 5E6OA 2JF5A 2AQ3B 4KKIA 3W5VB 2JRIB 4BFRA 2XK5B 4NNJB 2H88B 1JMLA 2LJIA 3PGEA 2ICIA 4GU2A 1YQ4B 1FCCC 3KH0A 3AE1B 4IM0A 3X0WA 3SHQA 4XC2A 1WM3A 4NQKE 3RYTA 2MJ3A 2RGFA 2V4LA 1L6UA 4K7UA 1GB4A 1WXVA 3FKYA 5H92C 1QOFA 3DBRI 3IAS1 3SR6A 1K50A 4ACFA 3GOEA 5G5GA 1ZXIA 1UBIA 4WJQA 4TKNA 1GJZA 1FEHA 3SFDB 1T3QA 4LNFA 3BVGA 2LWPA 2ZNVC 4S17A 1OTRB 4C7YA 4ARCA 3M62B 5DPWA 2KK8A 2K6QA 3ZVVA 3MP9A 2BQQA 2N7JA 4ANVA 2J0MA 3IT4B 1TKYA 1XEEA 3VXWA 3AXCA 4J3OD 1JROA 3Q3MC 1WGGA 4TSSA 2L1AA 1F2RC 2MWSB 3AB5A 1L0YB 2JVCA 1I4QA 2ZCCA 1L0XB 2EKIA 3BYYB 1IGCA 1SEBD 2PTLA 2D10A 4HWIB 2GI9A 3HHMA 4F1SA 5D7GA 5G55A 3NY5A 4B0EA 3ZUNA 1UGJA 1RWSA 1WX7A 3O13A 2WX0A 1FNWA 4JLCA 4DQOC 3SEBA 2NBWB 3LB8C 3JSVA 1SE4A 4M01A 1WM2A 1ZUD2 2LZ6A 3HVZA 3ZTCA 1ZKHA 3N32A 2D5GA 2KWVB 1I4RA 2I38A 2PJHA 1JWUD 2KJRA 4PS8A 1I42A 1KJTA 4XYCA 1TS4A 2C5LC 2MSED 3K9OB 2JZ3B 5L95C 3ZW3A 1VZ6A 5D3DA 3UQAA 2MLBA 2LD9A 3ZXRA 5AUIA 3N9YC 1SJHD 2FCSA 1QZEA 2GBJA 4LNNA 1LFDA 3ZIMA 1NDDA 4EE2A 4NJ6A 1F9JA 4HPLB 3RNBC 2MQJA 2KN4A 4MGZE 4MGKE 4XDDA 3OAWA 2J42A 3R7QA 3OLMD 2DENB 2J7QB 1C79A 1E8ZA 2MJEA 2PEAA 3VRAB 5BYRA 4NAMA 4WWMA 1E10A 2WDVB 2MHJA 4K7SA 1K8RB 2ZW0A 1E6EB 4DHZE 4G11A 2N9PC 2DZJA 1JW9D 1IGDA 2I1JA 1UZXB 1FM0D 3DCGA 2KOXA 1C77A 2PVGC 1IUEA 2GRIA 2ASQA 1T5XD 1WJNA 1N6ZA 1XLOA 1C3TA 1RRBA 2J4XA 2IGHA 3SFEB 3V60A 1W6VA 4WIPA 2EKEC 1V81A 1HE8A 2Z0DB 4IWPA 4P1CC 3HM3A 5AZHA 2NTTA 4F8CB 1WRDB 1N5WA 2FE8A 4WJOA 1EWCA 3B2FA 3BVMA 3DBHI 3QWZB 3VDZA 1VZ7A 2WP9B 3A4SC 1WY8A 4LJPB 2VH2A 3QQ8B 2X38A 3P4RB 2GBRA 2Y3AA 4US9A 3QARA 4XZ4A 4AJYB 2E3TA 4NY0A 5BMHA 4B95A 1E8YA 2GBKA 1EF5A 5L83A 5C1ZA 2AYOB 4FHJA 1T0YA 3ZDMC 4CO7A 5LXIB 4ZHPA 3N20C 1MHXA 3KW5B 4M02A 3IBEA 2CR5A 2MEKA 3V62A 2D3GA 1OFFA 1TZ1A 4NAWB 4G0NB 3DQVA 3NVVA 5LXHA 4YTPB 3AV8A 4MEMA 1FCLA 3NUHB 3VH4B 1VZ8A 1YQBA 1DOXA 1J7CA 3MJWA 1F52A 4XWTA 2WXPA 2G9HD 4C80A 4EFOA 2JQRB 3UIPB 2KTRB 1WXQA 1Q5WB 1Z5SB 1N5XA 1XO3A 4TV3A 3TCAA 4M8MA 4OHJA 2D07B 1QOGA 5JHBA 2OJWA 2XNAC 1WI0A 1BMLC 4ANUA 1WGYA 1L4DB 5E6NA 4FBJB 2ZZPB 3QIJA 1EF1A 2KDBA 1TKGA 5J18A 3R7RA 4GDLB 1TJEA 1WSPA 3PHXB 4RMAA 3DBLI 2M19A 1PGAA 3AE3B 3QHTA 1QQRA 4ASWC 1T0QC 1WIAA 3DVNV 2OHFA 4MSQB 2W82A 3R2TA 4ICUA 1Y56A 1WJ4A 4XWWA 1I4HA 1TS3A 4LDTD 2O6VA 5AEKB 2IY1B 1JRUA 2L0TA 4A3OA 3B1LX 4IM3A 3MJ5A 4HLEA 2QSDA 2N1VA 4K1RB 3ZKJC 2CKHB 4C00A 1KRHA 2JZPA 1JWBD 3L08A 4MACA 2BBCA 4MGYE 1WXAA 4YL8A 4B6WA 4OZCA 1TY2A 5AZFA 4REZA 4W9GA 1YD8U 1RAXA 3ONSA 2KQSA 3PVLA 3AE4B 2IO0B 4WURA 2RDHA 2BYTA 2JYTA 5BMIA 1MG8A 2QDFA 2WNMA 3L10B 2N7EA 1P98A 2JXXA 2LHDA 3PRPB 2O2VB 2RSUA 2K9XA 1WRIA 3BY4B 2WXKA 5G5HA 3EECA 2K1FA 2LGSA 5DPTA 3KWLA 5HI1A 3KUCB 1Z2MA 2N0SB 1UGMA 1YIWA 2C7NB 1HXYD 4JQWC 3WA0A 3D32A 2WXOA 1N60A 1E8WA 3BZDB 1SE3A 4E74A 1OEYA 4KX6B 1OQQA 4G3XB 2KC1A 3P4QB 3FAHA 4N58A 3KUDB 2B3AA 3ML8A 2D11A 2PLPA 1VJKA 2GBNA 1BT0A 3Q3FA 2M1MA 3TJPA 4AJWA 3PS6A 4TUUA 2FIDA 3DBSA 2DWQA 1YOVB 3ENEA 1QLBB 2JXTA 3QA8A 1XXGA 2HJ8A 4AOFA 4HKZE 5FR6A 2KJ6A 2B76B 5JHAA 1FPYA 1WE7A 3AE2B 2KHWB 5EE3A 3ZNID 5D3IB 2BTEA 2NCNA 3APCA 3V6CB 1GC6A 2IO2B 3T3OA 3H7SA 1D6EC 2W3RA 2KDIA 5KHQA 4YWGG 3VVWB 3GB1A 2RPQA 2IO3B 2KQ4X 1NI3A 3TEZA 2LMCA 4A20A 2KVRA 3DHHC 2AX5A 4XGAB 1YX6B 4LJOB 4KIKA 1SIFA 2IJ0A 4HCPB 4NAWA 2DYOA 2DHZA 2KWDA 4BKTA 1NENB 3CIRB 3TEYA 2WDQB 4TMAB 2Y5CA 3RZFA 3RCZA 5CHFA 3CMMB 2VZKD 3FC4A 4KIKB 3JSVB 4DXGA 2DYBA 3DWMA 3HVDA 1VD2A 2JYEA 2LEKA 1GC7A 1XCQL 3BVZA 4ZDVA 2KNBA 2DAFA 3RNGC 4WAFA 4KGSA 1P1AA 4P16A 2BB5A 3AE5B 2WU5B 3H8HA 3RZWC 2JWZA 4IM2A 4LDTB 3RNEC 1H4RA 3UIOB 2G4DB 4LLGM 4US8A 4RGMA 3PRMB 2FUG1 2O6VB 2IBIB 1IBXB 3PTFC 3Q3OC 1XLQA 3U30A 1V1OA 4GGQA 1D4BA 1R7SA 1ZGUB 2DZMA 1YJ1A 2PVOD 2WXMA 2KLGA 3SD5A 3ZQ4A 2E6XA 3PPAA 3VQIA 4KGRA 5TSSA 1FFUA 3AEBB 5LLIA 1MPEA 4MH0E 3ZJVA 1OQRA 4AQ7A 2INNE 2JSVX 1ROEA 2LHEA 4RGTA 3ZRCA 4DDGD 2JPHA 3GZNB 5CTRC 4FHKA 1R4NB 2NTSA 5D2MB 2IGDA 2D3BA 3BK1A 2R61A 2QC8A 4WJNA 3AEFB 2RDBC 5CHWA 2FCQA 3NHEB 3BYTB 2L7RA 3GE3C 4KV2A 1WR1A 2KWUB 2I1KA 2XK5A 4N59A 2MBHA 2MBBB 2BPSA 2CU1A 1MJDA 1R4NI 2LVQA 2FUHB 5BO4B 1XLNA 4AP4C 4ARIA 1JWAD 4TQ1A 2KC2A 3RNFC 3W1YA 3W2DA 1C9FA 3S2AA 1GG3A 3VR8B 1EWYC 3BWUD 1KF6B 3DBRB 2G1EA 2BYEA 3PSEB 3ALBA 1YMHE 4IDIA 3DOWA 4RNAA 2UYZB 3E9SA 3BK2A 3ETRA 2INDC 5FR3A 1AWDA 2Z8LA 1AYFA 4RM8A 2K0PA 3FILB 4WWOA 5JZEB 1AARA 2LRWA 4UDUC 4GB9A 2M8SA 4D2KA 5I4DA 2JZZA 3P42A 2KDMA 3N3KB 2GB1A 3CSFA 1PDXA 3WAOA 5BYQA 1UH6A 5CX3A 2RD0A 3DVGX 3PZ7A 2KAJA 1LGRA 1WGKA 3AE7B 2XBBC 1ENFA 1K51A 2KQ7A 2QMTA 4K81A 1L5PA 2KVZA 1Q0WB 2LVOA 2CHXA 2BS2B 4FXCA 2ZVOA 2N4FA 4DHJB 4K7WA 5IP4D 2PE9A 1KLUD 2HTHA 1SF0A 3ZDTA 1T0SC 2N1WA 2LFIA 2WHIA 2WS3B 2ZNVB 3APDA 2KFJA 2BB6A 1Y8RC 3ZJUA 2DNFA 2K5PA 4W9HA 3HIZA 3MFGA 2IDYA 3EC8A 3R66C 4S0RA 5HHDG 3C19A 2V3SA 5IAAC 1WYGA 3H7PA 1P9DU 1UELA 4CYEA 3RMKC 4WQMA 2XEWA 1CZPA 3APFA 2KDEB 2KD0A 4JWSC 3HM6X 4IW0A 4GSWA 3QAQA 2Z59B 1JQ4A 4OZAA 1DOIA 2PW9A 2M4NA 4GMVA 4EEWA 4I6PA 3TMPB 3E56A 3GS2A 1EM7A 3AM9A 2V3PA 4URKA 4IWQA 2EMTA 3A4RA 2LASA 4EZLA 2K3UA 2CU3A 2KMMA 2MBQA 3EFUA 1TS2A 1WX8A 2KX3A 4BOSC 1J0GA 2MP2B 4PK1A 3ZRFA 3C8YA 3WANA 1EU4A 2KO3A 1K53A 2WXRA 1SB3C 1Q10A 2KDFB 5BYSA 1FXTB 1FXAA 2G45B 1I4XA 1X1MA 2EMSA 2YLMA 1GPXA 4RM9A 2K8HA 3LYYA 1I4PA 3A9KA 1YJJA 4BZAA 1V97A 2RDGA 3ZJTA 4J6IA 4M8NA 4EZKA 1SBBB 1KLGD 3U4EG 1FO4A 4YTMB 3JVZX 3AEGB 4W9CA 1PUTA 2D3CA 1NVID 4ITKA 1IBXA 3AECB 4KDIC 2QCZA 2C60A 4WQOB 1RLFA 3NOBA 4NZLB 3V6EB 2M17A 1YN5A 4YSYB 1NI2A 4FJVB 3FILA 1HZ6A 2INPE 2DAJA 3WAPA 2L05A 1PFDA 4ANXA 1E7UA 3IXSA 3DHGC 1FFVA 4GN1A 4MJSB 2V3NA 1WGDA 1XLPA 2MBOA 3GP7A 1TZOA 3RD2A 5JXVA 1WZ3A 2DX5B 3N1YC 3RPFC 3VTWA 4F7ZA 2GOWA 4KZCA 1C78A 3OJ3A 1HA5A 1SJED 1KH0A 2L52A 3OG5A 4L1BA 1D5XC 2MW5A 3OJ4B 1TBEA 5IA7A 4YTNB 4MDKE 2D2QA 2WDRB 3A1QB 2A5UA 2WXGA 1DYQA 1DOYA 3P2BA 3RULA 3Q8AA 1N61A 3ZGZA 2NBVB 1QILA 4KSLC 5FKAC 4W9EA 4BBNC 4B0MA 1RFKA 1JALA 1WFYA 2KKCA 1CQVA 2FCNA 2N9EB 2KANA 4A3PA 5AZGA 5LNK1 3VTVA 3OWEB 2JY6A 2BF8B 1P7FA 4C56C 3MC9A 3P4PB 3Q69A 2JX5A 2NMQA 3JYUA 2DYMA 3W5UB 3Q3NC 3WCQA 3A9JA 2YEPF 3GE8C 3UGBB 1E8XA 4BBNF 2PIAA 3DHIC 4EZJA 1WWTA 1D3ZA 2NBUA 4JIOU 3TL5A 1V5TA 2XN9C 5DPRA 2NPTA 4P1BC 2NPTB 5GXGB 3ZTDA 1KLVA 4RGNA 4HCNB 1TS5A 4YSZB 2WLBA 4K3CA 2QHOA 3IHPC 5D94A 1TIFA 1WF9A 1E0ZA 3EHVA 4JX1C 2WXQA 4JL9A 1DGJA 3DVNU 2C7MB 1G6JA 2BT6A 4AWJA 1F2RI 5H8YE 2K22A 3P4SB 2VZKB 4N6EB 3TEXA 4IWOA 2R2OA 1T0RC 4RF0A 2BVCA 3IFWB 1L0VB 2KX0A 3I57A 1I7HA 3VUWA 3VUYA 2N9XA 3AEEB 4CQNA 2LGDA 1E9MA 2LGYA 5T8IA 1HTQA 2ON8A 2C9WB 2PKOA 2BWFA 2K25A 2LXCA 2NVUI 4RF1A 1C4AA 4JGHB 2W9NA 4GXBA 2R2QA 3N1XC 4OZBA 3U52E 1U4AA 5BMGA 4W9JA 4FJYA 1MI0A 4WJPA 2LI5A 3T3NA 2MRPA 2WX1A 4XE0A 4A6QA 1QOAA 1F77A 1WGRA 2LUMA 2V9HA 5C3JB 4XDCA 3L16A 1WR6E 3NZSA 3IT6B 4P7IA 4GIVA 1XF5L 3AEAB 5E6JA 2IO1B 3KYDD 4EOYA 1FRDA 1WMHA 1YNTE 2V4IB 2FAZA 2MJDA 5JH5C 1F1HA 2K8CA 4FJZA 4DXAB 3U7ZA 1TT5B 1JCKB 2A4ZA 1YN3A 4KKJA 1D5MC 2RMMA 1FIQA 2SEBD 1SSNA 4FA6A 4PYZA 3PRZA 1WZ0A 4BKGA 3SDLC 2W55A 4NQLB 1ISNA 4WH4A 3Q3JA 1XD3B 3AE8B 3L4PA 3UINB 2J0KA 3GZNI 2ZEQA 4QAYA 4W9DA 2JU6X 3ZNGC 1I35A 1SE2A 3M63B 1ZW7A 2JT4B 1WMHB 3CSTA 1RM6C 3I3TB 4MT5A 4X57B 1K52A 1FNVA 2DLBA 3UQBA 1EU3A 3NVYA 3KVFB 5C23A 1E5WA 1SE9A 4ZOHC 5IOIA 2BYFA 2KN5A 5TR5A 2JRHA 1LQBA 3MC8A 4DWFA 4GDKB 3I5JC 3VAWA 2CJOA 1WX9A 1FNUA 3BINA 2JWUA 3R3MA 5KHOA 2JUOA 1VLBA 2NR2A 2IPKD 4BKSA 3U2SC 3X23A 4LTUA 1NYRA 4E3CA 4HROA 3SU8X 2LGIA 3KUZA 1ZP0B 4Q2JA 1HQRD 2FNJB 1MFWA 1J7BA 1UNSA 1R4MI
chains in the Genus database with same CATH topology
3CSFA 2UWQA 2RR9A 2K6DB 3LDZE 3WAOA 1A5RA 3VH4B 4IG7B 1YQBA 1VCBA 1Q1OA 1P3QU 2LVPA 3MJWA 1UH6A 3QX1A 5CX3A 2RD0A 3DVGX 4EFOA 4FN2A 3UIPB 2KTRB 3A1QA 4ANWA 1UD7A 2XBBC 2HE7A 1WJUA 3LJ3A 2KQ7A 1Q5WB 1Z5SB 2K8BA 2O6VD 4K81A 1Q0WB 2LVOA 2CHXA 3U7DA 2ZPYA 2N4FA 2ZVOA 1LM8B 3TIXA 4DHJB 2YVCA 4K7WA 4TV3A 3TCAA 4M8MA 1IYFA 1UBQA 2PE9A 1V86A 2D07B 2HTHA 5JHBA 3IG3A 4EKUA 3ZDTA 1WI0A 4G50A 4KZ0A 3WALA 4ANUA 1WGYA 3HK0A 2N1WA 3T9LA 4TQ0A 2AWTA 2BGFA 2L76A 2ZNVB 3LMNA 3APDA 2KFJA 3DPDA 1WXSA 1Y8RC 1E7VA 4W9HA 5CHVC 5E6NA 4FBJB 2ZZPB 3HIZA 3ZNZB 2O2VA 2C7HA 5EDSA 3QIJA 4GOCA 3MHSD 1EF1A 4AUQC 3ZLZA 2KDBA 3EC8A 5J18A 2CS4A 3MTNB 3R66C 1IP9A 3R7RA 2BKFA 4GDLB 2V3SA 4I6NB 5IAAC 3H7PA 2DZIA 1P9DU 2AEHA 2LGXA 1UELA 4CYEA 3PHXB 1YX5B 2G4SA 1OEYJ 3DBLI 4RMAA 3RUIB 2ZPNA 2AL6A 1WH3A 4KSKC 2DZKA 3QHTA 2XEWA 3VHTC 3M3JA 4OVUA 2L00B 4ASWC 3APFA 4MJSA 2KDEB 4HDQA 2KD0A 4WAAA 5J17A 1WIAA 3HM6X 3DVNV 4IW0A 3DDCB 4MSQB 4ICUA 4GSWA 3QAQA 2Z59B 1WJ4A 3N30A 1IPGA 4LDTD 4GMVA 2M4NA 2GMIC 2O6VA 5HKHA 5AEKB 3AULA 4I6PA 2IY1B 3RT3B 4EEWA 3TMPB 1EUVB 1JRUA 2L0TA 2MX2A 4A3OA 3B1LX 4ZRJA 1V80A 4URKA 4IWQA 4IM3A 4OVVA 4GDLA 4HLEA 2N1VA 2ZCBA 2EMTA 3A4RA 4K1RB 2LASA 4EZLA 1WE6A 3U8ZA 2AL3A 3ZKJC 3PZDA 3A33B 2CKHB 3C0RB 4B9KA 2MBQA 3EFUA 1P0RA 5G2NA 1WX8A 2KX3A 4BOSC 1J0GA 2MP2B 3VTUA 4FADA 3L08A 2KFKB 4MGYE 1L2NA 1C1YB 3ZRFA 1WXAA 3WANA 4YL8A 2KO3A 4GDKA 2CHZA 4B6WA 4EUTA 3B08A 3QK0A 2KDFB 5AZFA 3L13A 1FXTB 4LCDE 3PREA 4W9GA 1PQSA 1YD8U 1RAXA 2BWES 2G45B 3ONSA 4MSMB 1X1MA 2EMSA 1WGHA 2WWZA 2KQSA 2YLMA 2KMAA 4RM9A 2K8HA 3PVLA 4N9F4 1V49A 2IO0B 3A9KA 3ML9A 4I6LB 3QJZA 2GBMA 1MG8A 2OJRA 3L10B 4KDLB 2LXAA 4DK5A 1V5OA 2N7EA 1P98A 2JXXA 1V9JA 3PRPB 4J6IA 3H9DA 4M8NA 2O2VB 4DHZB 4EZKA 2LUEA 2RSUA 1WXMA 1KM7A 2J0JA 3BY4B 3AU4A 3JVZX 4W9CA 2HD5B 2PPHA 3O65B 2L8JA 5E6PA 3K9PB 3EECA 4WWNA 2K1FA 3NS8A 5DPTA 5E6OA 2JF5A 2KTFA 2JRIB 4KDIC 4BFRA 2XK5B 4NNJB 2C60A 4WQOB 1RLFA 3NOBA 3KUCB 1Z2MA 3PGEA 4GU2A 1UGMA 1NBFC 1YIWA 3H7PB 3V6EB 2C7NB 2M17A 4W9KA 4JQWC 1NI2A 3WA0A 1KOTA 4FJVB 1H8CA 3KH0A 3D32A 2DAJA 4IM0A 3X0WA 3SHQA 3WAPA 4XC2A 1E8WA 3WAMA 2L05A 1WM3A 4NQKE 3RYTA 4ANXA 2RGFA 1E7UA 2PE6B 2V4LA 1L7YA 4ICVA 4E74A 4K7UA 4GN1A 3V61A 1OEYA 1WXVA 4MJSB 1WGDA 1TGZB 4G3XB 2KC1A 2MBOA 3DBRI 3RD2A 1WZ3A 4MELA 2DX5B 3W1SC 3GOEA 3KUDB 2B3AA 3ML8A 2BKRB 2D11A 1UBIA 4WJQA 4TKNA 3VTWA 4F7ZA 4HPMB 2GOWA 4KZCA 4MM3A 1GJZA 4W9LA 3OJ3A 2GBNA 5DPSA 2ZJDA 1BT0A 2LWPA 2ZNVC 3L0WB 3Q3FA 2M1MA 4HXDA 1OTRB 4M0WB 3L17A 3TJPA 2MW5A 3W1SA 4AJWA 3OJ4B 1TBEA 5IA7A 4MDKE 3M62B 2D2QA 2G3QB 1XT9B 3A1QB 3PS6A 2A5UA 1GNUA 2KK8A 5DPWA 2FIFA 3P2BA 4TUUA 3RULA 2K6QA 2NBVB 4KSLC 2IYDB 2FIDA 4W9EA 3DBSA 4BBNC 3ZVVA 2L3ZA 1WFYA 2KKCA 2FCNA 3ENEA 2N9EB 2KANA 4A3PA 5AZGA 4ANVA 3VFKA 2J0MA 3KYCD 3QA8A 3VTVA 3VXWA 3AXCA 2HJ8A 4BVUC 4AOFA 3NZUA 2JY6A 4II2B 2BF8B 1WGGA 4PYUA 5FR6A 3ZNHB 2KJ6A 4ZYNA 4DBGA 2MWSB 5JHAA 1WE7A 2JVCA 2KHWB 3A9JB 2DYMA 3JYUA 2ZCCA 3ZNID 2Z0EB 2MA9B 2KMCA 2NCNA 3APCA 3V6CB 1J8CA 1GC6A 2IO2B 3A9JA 3H7SA 2D10A 4HWIB 4FLHA 3UGBB 1E8XA 3PLVA 2KDIA 3HHMA 4F1SA 5KHQA 5D7GA 4BBNF 5G55A 3NY5A 3VVWB 2RPQA 2IO3B 3ZUNA 4EZJA 1LXDA 2CHWA 1D3ZA 3QC8B 1WX7A 2M0XA 2WX0A 2NBUA 4JIOU 4JLCA 1V5TA 1J19A 2KVRA 2NPTA 5DPRA 3TL5A 4A20A 2NPTB 2N7DA 1CMXB 2NBWB 1YX6B 2KZRA 4LJOB 4KIKA 1SIFA 3ZTDA 1KLVA 2IZVB 3JSVA 2VRRB 1WM2A 4HCNB 2LZ6A 4PS3A 4HCPB 3ZTCA 2KXJA 3VUXA 4NAWA 2DYOA 1ZKHA 2DHZA 2QHOA 1S1QB 3IHPC 5D94A 4BKTA 1WF9A 3N32A 4II3B 2KWVB 3EHVA 5GMVA 3RZFA 3RCZA 5CHFA 3CMMB 2PJHA 2LJ5A 4JL9A 4KIKB 3DVNU 3JSVB 2KJRA 2DYBA 4PS8A 3PLUA 2C7MB 1I42A 1KJTA 2C5LC 4DHJD 1VD2A 1RFAA 1G6JA 2MSED 1GC7A 3H6NA 4AWJA 3K9OB 3PHWB 2JZ3B 4ZDVA 2KLCA 5L95C 2KNBA 3ZW3A 2DAFA 4IWOA 2R2OA 3UQAA 2MLBA 2LD9A 2WYQA 2V1YA 3IFWB 2KX0A 3PV1A 3VUWA 1P1AA 2N9XA 3VUYA 4ZRKA 3B0AA 2FCSA 3T8MA 1QZEA 2KWCA 2LGDA 2GBJA 2LGYA 5D6JB 2L0FA 4HDOA 3RZWC 1LFDA 3ZIMA 1NDDA 2JWZA 3PT2B 4IM2A 4LDTB 4NJ6A 1F9JA 2C9WB 1H4RA 3UIOB 2BWFA 4HPLB 2G4DB 1V2YA 2MQJA 2REXA 3PRMB 2K25A 2O6VB 4MGKE 2IBIB 4MGZE 2LXCA 2NVUI 3OAWA 4JGHB 4PS7A 1XQQA 3R7QA 3OLMD 4IUMB 1SGHA 2DENB 3PTFC 2J7QB 2W9NA 3U30A 4BOZB 4GGQA 2R2QA 4GXBA 3TBLD 1OGWA 1E8ZA 1U4AA 2PEAA 1WYWB 1ZGUB 4NJ7A 2DZMA 1YJ1A 4W9JA 4FJYA 4MGIE 4WJPA 2KLGA 2LI5A 3SD5A 2IY0B 3ECIA 3PPAA 2MRPA 2WX1A 3VQIA 4K7SA 1K8RB 1WGRA 4DHZE 4G11A 2N9PC 2DZJA 3L16A 2WDTB 2I1JA 5LLIA 1WR6E 3NZSA 4MH0E 4P7IA 4GIVA 1UZXB 2IO1B 2KJHB 4HK2A 3DCGA 3KYDD 1WMHA 2KOXA 4EOYA 3ZRCA 4DDGD 3AU5A 2JPHA 2FAZA 5CTRC 4FHKA 4CHKA 2ASQA 5JH5C 1V6EA 4BKSD 2K8CA 1WJNA 4FJZA 5D2MB 4KVGB 4DXAB 2KFKA 3JW0X 1C3TA 1RRBA 4IC7B 3UF8A 4W9IA 2A4ZA 3M95A 4WJNA 5J2RA 2K39A 2MCNB 1E90A 3V60A 1W6VA 2EKEC 4FA6A 4PYZA 2Y5BB 5CHWA 2FCQA 3NHEB 1V81A 3PRZA 2L7RA 1WZ0A 3VH3B 1HE8A 2Z0DB 3A9KB 2NS5A 4IWPA 5DCNA 3SDLC 4BKGA 4KV2A 1WR1A 2KWUB 3HM3A 4NQLB 1ISNA 2I1KA 2XK5A 5AZHA 3Q3JA 4F8CB 1XD3B 4HVBA 2MBHA 1WRDB 2ZVNA 3QCAA 1OQYA 3UINB 2J0KA 2MBBB 3GZNI 4HJKA 4WJOA 2BPSA 2ZEQA 2CU1A 4W9DA 1R4NI 3DBHI 2LVQA 3QWZB 3VDZA 3ZNGC 1I35A 2FUHB 3A4SC 1WY8A 2BYVE 4LJPB 4E71A 3M63B 5BO4B 1TTNA 1ZW7A 2JT4B 1WMHB 3CSTA 4AP4C 3I3TB 4NPNA 1M94A 3QQ8B 4TQ1A 2KC2A 4X57B 2GBRA 3W1YA 3IVFA 3UQBA 2MBEA 3QARA 3KVFB 2FCMA 4XZ4A 1GUAB 3S2AA 1GG3A 5C23A 4AJYB 3ZO5B 3DVGY 1EO6A 1E5WA 1SE9A 4NY0A 4ZRIA 4B95A 2BYFA 2KN5A 5TR5A 1E8YA 1LQBA 2GBKA 2JRHA 4FULA 2BYEA 3PSEB 4DWFA 1EF5A 3ALBA 4GDKB 5L83A 3DOWA 5C1ZA 2AYOB 2UYZB 4FHJA 1T0YA 3H1UA 2MP2A 3VAWA 3ZDMC 4CO7A 5LXIB 4XX5A 1WX9A 1S3SG 3KW5B 3BINA 4RM8A 3AI5A 3R3MA 5KHOA 3IBEA 4WWOA 2CR5A 2JUOA 2NR2A 3V62A 5JZEB 2D3GA 4BKSA 1TZ1A 1AARA 3X23A 4W9FA 2LRWA 3CF6E 4NAWB 4DDID 4E3CA 2OOBB 3SU8X 4GB9A 3KUZA 4G0NB 3DQVA 2M8SA 1WJ6A 2JZZA 2FNJB 5LXHA 2KTRA 4WWPA 4MEMA 3N3KB 3WIMA 1R4MI 2LRUA 3L54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSF A;  2UWQ A;  2RR9 A;  2K6D B;  3LDZ E;  3WAO A;  1A5R A;  3VH4 B;  4IG7 B;  1YQB A;  1VCB A;  1Q1O A;  1P3Q U;  2LVP A;  3MJW A;  1UH6 A;  3QX1 A;  5CX3 A;  2RD0 A;  3DVG X;  4EFO A;  4FN2 A;  3UIP B;  2KTR B;  3A1Q A;  4ANW A;  1UD7 A;  2XBB C;  2HE7 A;  1WJU A;  3LJ3 A;  2KQ7 A;  1Q5W B;  1Z5S B;  2K8B A;  2O6V D;  4K81 A;  1Q0W B;  2LVO A;  2CHX A;  3U7D A;  2ZPY A;  2N4F A;  2ZVO A;  1LM8 B;  3TIX A;  4DHJ B;  2YVC A;  4K7W A;  4TV3 A;  3TCA A;  4M8M A;  1IYF A;  1UBQ A;  2PE9 A;  1V86 A;  2D07 B;  2HTH A;  5JHB A;  3IG3 A;  4EKU A;  3ZDT A;  1WI0 A;  4G50 A;  4KZ0 A;  3WAL A;  4ANU A;  1WGY A;  3HK0 A;  2N1W A;  3T9L A;  4TQ0 A;  2AWT A;  2BGF A;  2L76 A;  2ZNV B;  3LMN A;  3APD A;  2KFJ A;  3DPD A;  1WXS A;  1Y8R C;  1E7V A;  4W9H A;  5CHV C;  5E6N A;  4FBJ B;  2ZZP B;  3HIZ A;  3ZNZ B;  2O2V A;  2C7H A;  5EDS A;  3QIJ A;  4GOC A;  3MHS D;  1EF1 A;  4AUQ C;  3ZLZ A;  2KDB A;  3EC8 A;  5J18 A;  2CS4 A;  3MTN B;  3R66 C;  1IP9 A;  3R7R A;  2BKF A;  4GDL B;  2V3S A;  4I6N B;  5IAA C;  3H7P A;  2DZI A;  1P9D U;  2AEH A;  2LGX A;  1UEL A;  4CYE A;  3PHX B;  1YX5 B;  2G4S A;  1OEY J;  3DBL I;  4RMA A;  3RUI B;  2ZPN A;  2AL6 A;  1WH3 A;  4KSK C;  2DZK A;  3QHT A;  2XEW A;  3VHT C;  3M3J A;  4OVU A;  2L00 B;  4ASW C;  3APF A;  4MJS A;  2KDE B;  4HDQ A;  2KD0 A;  4WAA A;  5J17 A;  1WIA A;  3HM6 X;  3DVN V;  4IW0 A;  3DDC B;  4MSQ B;  4ICU A;  4GSW A;  3QAQ A;  2Z59 B;  1WJ4 A;  3N30 A;  1IPG A;  4LDT D;  4GMV A;  2M4N A;  2GMI C;  2O6V A;  5HKH A;  5AEK B;  3AUL A;  4I6P A;  2IY1 B;  3RT3 B;  4EEW A;  3TMP B;  1EUV B;  1JRU A;  2L0T A;  2MX2 A;  4A3O A;  3B1L X;  4ZRJ A;  1V80 A;  4URK A;  4IWQ A;  4IM3 A;  4OVV A;  4GDL A;  4HLE A;  2N1V A;  2ZCB A;  2EMT A;  3A4R A;  4K1R B;  2LAS A;  4EZL A;  1WE6 A;  3U8Z A;  2AL3 A;  3ZKJ C;  3PZD A;  3A33 B;  2CKH B;  3C0R B;  4B9K A;  2MBQ A;  3EFU A;  1P0R A;  5G2N A;  1WX8 A;  2KX3 A;  4BOS C;  1J0G A;  2MP2 B;  3VTU A;  4FAD A;  3L08 A;  2KFK B;  4MGY E;  1L2N A;  1C1Y B;  3ZRF A;  1WXA A;  3WAN A;  4YL8 A;  2KO3 A;  4GDK A;  2CHZ A;  4B6W A;  4EUT A;  3B08 A;  3QK0 A;  2KDF B;  5AZF A;  3L13 A;  1FXT B;  4LCD E;  3PRE A;  4W9G A;  1PQS A;  1YD8 U;  1RAX A;  2BWE S;  2G45 B;  3ONS A;  4MSM B;  1X1M A;  2EMS A;  1WGH A;  2WWZ A;  2KQS A;  2YLM A;  2KMA A;  4RM9 A;  2K8H A;  3PVL A;  4N9F 4;  1V49 A;  2IO0 B;  3A9K A;  3ML9 A;  4I6L B;  3QJZ A;  2GBM A;  1MG8 A;  2OJR A;  3L10 B;  4KDL B;  2LXA A;  4DK5 A;  1V5O A;  2N7E A;  1P98 A;  2JXX A;  1V9J A;  3PRP B;  4J6I A;  3H9D A;  4M8N A;  2O2V B;  4DHZ B;  4EZK A;  2LUE A;  2RSU A;  1WXM A;  1KM7 A;  2J0J A;  3BY4 B;  3AU4 A;  3JVZ X;  4W9C A;  2HD5 B;  2PPH A;  3O65 B;  2L8J A;  5E6P A;  3K9P B;  3EEC A;  4WWN A;  2K1F A;  3NS8 A;  5DPT A;  5E6O A;  2JF5 A;  2KTF A;  2JRI B;  4KDI C;  4BFR A;  2XK5 B;  4NNJ B;  2C60 A;  4WQO B;  1RLF A;  3NOB A;  3KUC B;  1Z2M A;  3PGE A;  4GU2 A;  1UGM A;  1NBF C;  1YIW A;  3H7P B;  3V6E B;  2C7N B;  2M17 A;  4W9K A;  4JQW C;  1NI2 A;  3WA0 A;  1KOT A;  4FJV B;  1H8C A;  3KH0 A;  3D32 A;  2DAJ A;  4IM0 A;  3X0W A;  3SHQ A;  3WAP A;  4XC2 A;  1E8W A;  3WAM A;  2L05 A;  1WM3 A;  4NQK E;  3RYT A;  4ANX A;  2RGF A;  1E7U A;  2PE6 B;  2V4L A;  1L7Y A;  4ICV A;  4E74 A;  4K7U A;  4GN1 A;  3V61 A;  1OEY A;  1WXV A;  4MJS B;  1WGD A;  1TGZ B;  4G3X B;  2KC1 A;  2MBO A;  3DBR I;  3RD2 A;  1WZ3 A;  4MEL A;  2DX5 B;  3W1S C;  3GOE A;  3KUD B;  2B3A A;  3ML8 A;  2BKR B;  2D11 A;  1UBI A;  4WJQ A;  4TKN A;  3VTW A;  4F7Z A;  4HPM B;  2GOW A;  4KZC A;  4MM3 A;  1GJZ A;  4W9L A;  3OJ3 A;  2GBN A;  5DPS A;  2ZJD A;  1BT0 A;  2LWP A;  2ZNV C;  3L0W B;  3Q3F A;  2M1M A;  4HXD A;  1OTR B;  4M0W B;  3L17 A;  3TJP A;  2MW5 A;  3W1S A;  4AJW A;  3OJ4 B;  1TBE A;  5IA7 A;  4MDK E;  3M62 B;  2D2Q A;  2G3Q B;  1XT9 B;  3A1Q B;  3PS6 A;  2A5U A;  1GNU A;  2KK8 A;  5DPW A;  2FIF A;  3P2B A;  4TUU A;  3RUL A;  2K6Q A;  2NBV B;  4KSL C;  2IYD B;  2FID A;  4W9E A;  3DBS A;  4BBN C;  3ZVV A;  2L3Z A;  1WFY A;  2KKC A;  2FCN A;  3ENE A;  2N9E B;  2KAN A;  4A3P A;  5AZG A;  4ANV A;  3VFK A;  2J0M A;  3KYC D;  3QA8 A;  3VTV A;  3VXW A;  3AXC A;  2HJ8 A;  4BVU C;  4AOF A;  3NZU A;  2JY6 A;  4II2 B;  2BF8 B;  1WGG A;  4PYU A;  5FR6 A;  3ZNH B;  2KJ6 A;  4ZYN A;  4DBG A;  2MWS B;  5JHA A;  1WE7 A;  2JVC A;  2KHW B;  3A9J B;  2DYM A;  3JYU A;  2ZCC A;  3ZNI D;  2Z0E B;  2MA9 B;  2KMC A;  2NCN A;  3APC A;  3V6C B;  1J8C A;  1GC6 A;  2IO2 B;  3A9J A;  3H7S A;  2D10 A;  4HWI B;  4FLH A;  3UGB B;  1E8X A;  3PLV A;  2KDI A;  3HHM A;  4F1S A;  5KHQ A;  5D7G A;  4BBN F;  5G55 A;  3NY5 A;  3VVW B;  2RPQ A;  2IO3 B;  3ZUN A;  4EZJ A;  1LXD A;  2CHW A;  1D3Z A;  3QC8 B;  1WX7 A;  2M0X A;  2WX0 A;  2NBU A;  4JIO U;  4JLC A;  1V5T A;  1J19 A;  2KVR A;  2NPT A;  5DPR A;  3TL5 A;  4A20 A;  2NPT B;  2N7D A;  1CMX B;  2NBW B;  1YX6 B;  2KZR A;  4LJO B;  4KIK A;  1SIF A;  3ZTD A;  1KLV A;  2IZV B;  3JSV A;  2VRR B;  1WM2 A;  4HCN B;  2LZ6 A;  4PS3 A;  4HCP B;  3ZTC A;  2KXJ A;  3VUX A;  4NAW A;  2DYO A;  1ZKH A;  2DHZ A;  2QHO A;  1S1Q B;  3IHP C;  5D94 A;  4BKT A;  1WF9 A;  3N32 A;  4II3 B;  2KWV B;  3EHV A;  5GMV A;  3RZF A;  3RCZ A;  5CHF A;  3CMM B;  2PJH A;  2LJ5 A;  4JL9 A;  4KIK B;  3DVN U;  3JSV B;  2KJR A;  2DYB A;  4PS8 A;  3PLU A;  2C7M B;  1I42 A;  1KJT A;  2C5L C;  4DHJ D;  1VD2 A;  1RFA A;  1G6J A;  2MSE D;  1GC7 A;  3H6N A;  4AWJ A;  3K9O B;  3PHW B;  2JZ3 B;  4ZDV A;  2KLC A;  5L95 C;  2KNB A;  3ZW3 A;  2DAF A;  4IWO A;  2R2O A;  3UQA A;  2MLB A;  2LD9 A;  2WYQ A;  2V1Y A;  3IFW B;  2KX0 A;  3PV1 A;  3VUW A;  1P1A A;  2N9X A;  3VUY A;  4ZRK A;  3B0A A;  2FCS A;  3T8M A;  1QZE A;  2KWC A;  2LGD A;  2GBJ A;  2LGY A;  5D6J B;  2L0F A;  4HDO A;  3RZW C;  1LFD A;  3ZIM A;  1NDD A;  2JWZ A;  3PT2 B;  4IM2 A;  4LDT B;  4NJ6 A;  1F9J A;  2C9W B;  1H4R A;  3UIO B;  2BWF A;  4HPL B;  2G4D B;  1V2Y A;  2MQJ A;  2REX A;  3PRM B;  2K25 A;  2O6V B;  4MGK E;  2IBI B;  4MGZ E;  2LXC A;  2NVU I;  3OAW A;  4JGH B;  4PS7 A;  1XQQ A;  3R7Q A;  3OLM D;  4IUM B;  1SGH A;  2DEN B;  3PTF C;  2J7Q B;  2W9N A;  3U30 A;  4BOZ B;  4GGQ A;  2R2Q A;  4GXB A;  3TBL D;  1OGW A;  1E8Z A;  1U4A A;  2PEA A;  1WYW B;  1ZGU B;  4NJ7 A;  2DZM A;  1YJ1 A;  4W9J A;  4FJY A;  4MGI E;  4WJP A;  2KLG A;  2LI5 A;  3SD5 A;  2IY0 B;  3ECI A;  3PPA A;  2MRP A;  2WX1 A;  3VQI A;  4K7S A;  1K8R B;  1WGR A;  4DHZ E;  4G11 A;  2N9P C;  2DZJ A;  3L16 A;  2WDT B;  2I1J A;  5LLI A;  1WR6 E;  3NZS A;  4MH0 E;  4P7I A;  4GIV A;  1UZX B;  2IO1 B;  2KJH B;  4HK2 A;  3DCG A;  3KYD D;  1WMH A;  2KOX A;  4EOY A;  3ZRC A;  4DDG D;  3AU5 A;  2JPH A;  2FAZ A;  5CTR C;  4FHK A;  4CHK A;  2ASQ A;  5JH5 C;  1V6E A;  4BKS D;  2K8C A;  1WJN A;  4FJZ A;  5D2M B;  4KVG B;  4DXA B;  2KFK A;  3JW0 X;  1C3T A;  1RRB A;  4IC7 B;  3UF8 A;  4W9I A;  2A4Z A;  3M95 A;  4WJN A;  5J2R A;  2K39 A;  2MCN B;  1E90 A;  3V60 A;  1W6V A;  2EKE C;  4FA6 A;  4PYZ A;  2Y5B B;  5CHW A;  2FCQ A;  3NHE B;  1V81 A;  3PRZ A;  2L7R A;  1WZ0 A;  3VH3 B;  1HE8 A;  2Z0D B;  3A9K B;  2NS5 A;  4IWP A;  5DCN A;  3SDL C;  4BKG A;  4KV2 A;  1WR1 A;  2KWU B;  3HM3 A;  4NQL B;  1ISN A;  2I1K A;  2XK5 A;  5AZH A;  3Q3J A;  4F8C B;  1XD3 B;  4HVB A;  2MBH A;  1WRD B;  2ZVN A;  3QCA A;  1OQY A;  3UIN B;  2J0K A;  2MBB B;  3GZN I;  4HJK A;  4WJO A;  2BPS A;  2ZEQ A;  2CU1 A;  4W9D A;  1R4N I;  3DBH I;  2LVQ A;  3QWZ B;  3VDZ A;  3ZNG C;  1I35 A;  2FUH B;  3A4S C;  1WY8 A;  2BYV E;  4LJP B;  4E71 A;  3M63 B;  5BO4 B;  1TTN A;  1ZW7 A;  2JT4 B;  1WMH B;  3CST A;  4AP4 C;  3I3T B;  4NPN A;  1M94 A;  3QQ8 B;  4TQ1 A;  2KC2 A;  4X57 B;  2GBR A;  3W1Y A;  3IVF A;  3UQB A;  2MBE A;  3QAR A;  3KVF B;  2FCM A;  4XZ4 A;  1GUA B;  3S2A A;  1GG3 A;  5C23 A;  4AJY B;  3ZO5 B;  3DVG Y;  1EO6 A;  1E5W A;  1SE9 A;  4NY0 A;  4ZRI A;  4B95 A;  2BYF A;  2KN5 A;  5TR5 A;  1E8Y A;  1LQB A;  2GBK A;  2JRH A;  4FUL A;  2BYE A;  3PSE B;  4DWF A;  1EF5 A;  3ALB A;  4GDK B;  5L83 A;  3DOW A;  5C1Z A;  2AYO B;  2UYZ B;  4FHJ A;  1T0Y A;  3H1U A;  2MP2 A;  3VAW A;  3ZDM C;  4CO7 A;  5LXI B;  4XX5 A;  1WX9 A;  1S3S G;  3KW5 B;  3BIN A;  4RM8 A;  3AI5 A;  3R3M A;  5KHO A;  3IBE A;  4WWO A;  2CR5 A;  2JUO A;  2NR2 A;  3V62 A;  5JZE B;  2D3G A;  4BKS A;  1TZ1 A;  1AAR A;  3X23 A;  4W9F A;  2LRW A;  3CF6 E;  4NAW B;  4DDI D;  4E3C A;  2OOB B;  3SU8 X;  4GB9 A;  3KUZ A;  4G0N B;  3DQV A;  2M8S A;  1WJ6 A;  2JZZ A;  2FNJ B;  5LXH A;  2KTR A;  4WWP A;  4MEM A;  3N3K B;  3WIM A;  1R4M I;  2LRU A;  3L54 A; 
#chains in the Genus database with same CATH topology
 4NJC A;  2UWQ A;  1A5R A;  4HRS A;  1ZDV A;  1VCB A;  1P3Q U;  2LVP A;  4R3D A;  3A1Q A;  4ANW A;  3AE6 B;  1UD7 A;  2HTM E;  1WJU A;  1FRR A;  3U7D A;  1LM8 B;  1ET6 A;  3EGR A;  1UBQ A;  2AQ1 B;  3IG3 A;  4G50 A;  4KZ0 A;  3T9L A;  4TQ0 A;  2AWT A;  2BGF A;  2L76 A;  1PYW D;  3LMN A;  1UF0 A;  1WXS A;  1E7V A;  1BXT A;  5CHV C;  1T6B X;  2HJ1 A;  3ZNZ B;  5EDS A;  4GOC A;  3MHS D;  3ZLZ A;  3MTN B;  3DBL B;  2BKF A;  4I6N B;  2AEH A;  2LGX A;  3NVZ A;  1YX5 B;  2G4S A;  1OEY J;  4PT5 A;  3MC0 B;  3RUI B;  2ZPN A;  4LK0 M;  1WH3 A;  2DZK A;  3M3J A;  4OVZ A;  2L00 B;  3LXF A;  2UU7 A;  4HDQ A;  4MJS A;  4WAA A;  5J17 A;  3Q8C A;  3N30 A;  5HFY A;  5HKH A;  3PZ8 A;  3AUL A;  3RT3 B;  3P1M A;  2J53 A;  3UI3 A;  1EUV B;  1JWM D;  4ZRJ A;  1MVK A;  1N63 A;  1YJI A;  2ZCB A;  1WE6 A;  1XCT L;  3A33 B;  3AH7 A;  3ZYY X;  4MM3 B;  5G2N A;  4YSX B;  3VTU A;  4FAD A;  1C1Y B;  4GDK A;  4EUT A;  3QK0 A;  4LCD E;  1PQS A;  2BWE S;  1WGH A;  2WWZ A;  2KMA A;  4ZYS A;  4N9F 4;  4M0W A;  1QOB A;  4C4V B;  3ML9 A;  3QJZ A;  4LNK A;  1LO5 D;  4DK5 A;  2LXA A;  2YEP B;  1HEZ E;  2LUE A;  4LNI A;  5EE0 A;  1KM7 A;  2J0J A;  4MH8 A;  4DXF A;  2HD5 B;  4L2Y A;  2PPH A;  3I9V 1;  4P6V F;  5E6P A;  5EE9 A;  2VH1 A;  2EEL A;  3NS8 A;  3RN9 C;  4ZRQ A;  2KTF A;  3EA6 A;  2WQY B;  1NBF C;  3H7P B;  4W9K A;  2BS4 B;  1NYQ A;  1KOT A;  1V1P A;  1H8C A;  3NJT A;  3WAM A;  2PE6 B;  3KQ4 A;  1L7Y A;  4ICV A;  3DBH B;  3V61 A;  1TGZ B;  4MEL A;  3W1S C;  1KFY B;  2TSS A;  2BKR B;  4ZHO A;  1YQ3 B;  3TEW A;  4HPM B;  1L6V A;  4MM3 A;  4W9L A;  3R8B A;  5DPS A;  2ZJD A;  3L0W B;  4C4V A;  4JWU C;  4HXD A;  4M0W B;  3L17 A;  4HJG E;  3W9C B;  3W1S A;  1RYJ A;  1GB1 A;  1VR9 A;  2G3Q B;  1XT9 B;  1GNU A;  4IKG A;  2FIF A;  1JRP A;  1UUP A;  2IYD B;  1ZDX A;  1HTO A;  2L3Z A;  3VFK A;  3KYC D;  2QJL A;  4BVU C;  2I2Y A;  1VDV A;  3NZU A;  4II2 B;  4PYU A;  3ZNH B;  4ZYN A;  4DBG A;  1ZOY B;  1QKZ A;  2SAK A;  3A9J B;  2L32 A;  2Z0E B;  1V1P B;  2MA9 B;  2KMC A;  2J52 A;  1J8C A;  1VRA B;  3RNA C;  4FLH A;  1MHH E;  3PLV A;  1UWX A;  3I63 C;  1F0Z A;  5IKC M;  1LXD A;  2ONQ A;  2CHW A;  3NG0 A;  3QC8 B;  2M0X A;  4L23 A;  1J19 A;  2PMV A;  2N7D A;  1CMX B;  2N9K A;  2KZR A;  3URY A;  2ACZ B;  4BAX A;  2IZV B;  3Q8F A;  2VRR B;  4PS3 A;  4A8X C;  2KXJ A;  3VUX A;  1S1Q B;  2X8X X;  4II3 B;  5GMV A;  2H89 B;  2LJ5 A;  2M0A A;  2WXH A;  3PLU A;  1P7E A;  3KWV A;  4DHJ D;  2KYW A;  1RFA A;  3RFZ B;  3H6N A;  3V05 A;  1E7P B;  3PHW B;  2KLC A;  2INC C;  3HUI A;  3Q2A C;  1C76 A;  1ACC A;  2WYQ A;  2V1Y A;  3PV1 A;  4ZRK A;  3B0A A;  3R2I A;  3NS1 A;  3T8M A;  2KWC A;  5D6J B;  4HEA 1;  2L0F A;  4HDO A;  3PT2 B;  1L4Z B;  1V2Y A;  4AS1 A;  2REX A;  1SIJ A;  4PS7 A;  1XQQ A;  1PGB A;  4IUM B;  1SGH A;  2DBY A;  1FXI A;  4BOZ B;  3TBL D;  1OGW A;  3NRZ A;  1WYW B;  4NJ7 A;  3Q6B A;  4MGI E;  1D5Z C;  2IY0 B;  1QF6 A;  3ECI A;  4H2A A;  4USA A;  3HRD D;  5FK9 C;  1NEK B;  3MHZ A;  2WDT B;  2WXL A;  1ESF A;  4M00 A;  3N1Z C;  2KJH B;  4HK2 A;  2L83 A;  3AU5 A;  4CHK A;  2WXF A;  1V6E A;  4BKS D;  4KVG B;  2KFK A;  2Y5P A;  3JW0 X;  4IC7 B;  2AQ2 B;  3UF8 A;  1KTK A;  4W9I A;  4ZRP A;  3AE9 B;  3M95 A;  1BUI C;  2D3A A;  5J2R A;  2K39 A;  1ZE3 D;  1E90 A;  2MCN B;  3V3X A;  2Y5B B;  1I4G A;  2V0G A;  3TUO A;  1CK1 A;  3VH3 B;  3A9K B;  2NS5 A;  5DCN A;  1HZ5 A;  4JPS A;  3TSS A;  1QT9 A;  2Q5W D;  2BW2 A;  4HVB A;  1N62 A;  2ZVN A;  3QCA A;  1OQY A;  4HJK A;  1TYG B;  2BYV E;  2WXJ A;  4E71 A;  1STE A;  1TTN A;  4NPN A;  1M94 A;  3AED B;  4HKQ A;  3IVF A;  2MBE A;  2QIE B;  1TKE A;  2FCM A;  2QEJ C;  1GUA B;  3B2G A;  4KGT A;  3DVG Y;  1EO6 A;  3ZO5 B;  3P63 A;  1FMA D;  4ZRI A;  3DWG C;  4FUL A;  1J7A A;  3VR9 B;  2OED A;  3KLS X;  5EE1 A;  3H1U A;  2MP2 A;  4XX5 A;  3J9C A;  1S3S G;  3AI5 A;  1GAQ B;  4JE3 B;  4W9F A;  3CF6 E;  4A9A A;  4DDI D;  2BS3 B;  1CJE A;  2MH7 A;  2OOB B;  1YN4 A;  3ABV B;  1WJ6 A;  3Q14 C;  1SXT A;  2KTR A;  3Q8B A;  4WWP A;  3NZ3 A;  4OW0 A;  3WIM A;  4A55 A;  2LRU A;  3L54 A;  2RPV A;  1A70 A;  2RR9 A;  2K6D B;  3LDZ E;  4IOI E;  4IG7 B;  1Q1O A;  3QX1 A;  1B9R A;  4YT0 B;  3CWI A;  5MPO A;  1AW7 A;  1R4M B;  1FD6 A;  4FN2 A;  3LJ3 A;  2HE7 A;  2ZW1 A;  2K8B A;  2O6V D;  2ZPY A;  2KT7 A;  3TIX A;  2YVC A;  3B9J A;  3BII D;  1IYF A;  2WXI A;  1V86 A;  4YXD B;  4EKU A;  3Q8E A;  3WAL A;  3HK0 A;  2HDE A;  2N9L A;  5HG2 A;  3DPD A;  3ZXV A;  1MG4 A;  2IGG A;  2M56 B;  2O2V A;  2C7H A;  4HPP A;  4AUQ C;  3VRB B;  2CS4 A;  1IP9 A;  1M4V A;  2WXN A;  2WGS A;  1UWM A;  2DZI A;  2WU2 B;  2FBW B;  2QIL A;  2AL6 A;  4KSK C;  3NVW A;  3VHT C;  4OVU A;  4RFB A;  3DDC B;  3AMZ A;  2GLS A;  2W54 A;  1IPG A;  2GMI C;  4RH6 A;  2MX2 A;  2W3S A;  1V80 A;  4RCO A;  3AN1 A;  4OVV A;  1PGX A;  4GDL A;  2KAC A;  4A90 A;  3U8Z A;  2AL3 A;  1ZPS A;  3PZD A;  5C2T B;  3C0R B;  4B9K A;  1JWS D;  1P0R A;  5AUK A;  4O1N A;  2KFK B;  1L2N A;  2CHZ A;  3B08 A;  3L13 A;  3PRE A;  3RNC C;  4MSM B;  1ET9 A;  1V49 A;  1C4C A;  4K3B A;  2CJN A;  3IAM 1;  1C4P A;  4I6L B;  4LNO A;  1TY0 A;  2GBM A;  3RI7 C;  5IN7 A;  4C7Z A;  2OJR A;  4KDL B;  1V5O A;  1V9J A;  3H9D A;  4DHZ B;  1WXM A;  3EFC A;  3AU4 A;  3PO0 A;  5IO9 A;  3EUB 2;  1V8C A;  1GOZ A;  3O65 B;  2L8J A;  3K9P B;  1B1Z A;  4GLS C;  1AN8 A;  4WWN A;  4RGO S;  1ZXH A;  5E6O A;  2JF5 A;  2AQ3 B;  4KKI A;  3W5V B;  2JRI B;  4BFR A;  2XK5 B;  4NNJ B;  2H88 B;  1JML A;  2LJI A;  3PGE A;  2ICI A;  4GU2 A;  1YQ4 B;  1FCC C;  3KH0 A;  3AE1 B;  4IM0 A;  3X0W A;  3SHQ A;  4XC2 A;  1WM3 A;  4NQK E;  3RYT A;  2MJ3 A;  2RGF A;  2V4L A;  1L6U A;  4K7U A;  1GB4 A;  1WXV A;  3FKY A;  5H92 C;  1QOF A;  3DBR I;  3IAS 1;  3SR6 A;  1K50 A;  4ACF A;  3GOE A;  5G5G A;  1ZXI A;  1UBI A;  4WJQ A;  4TKN A;  1GJZ A;  1FEH A;  3SFD B;  1T3Q A;  4LNF A;  3BVG A;  2LWP A;  2ZNV C;  4S17 A;  1OTR B;  4C7Y A;  4ARC A;  3M62 B;  5DPW A;  2KK8 A;  2K6Q A;  3ZVV A;  3MP9 A;  2BQQ A;  2N7J A;  4ANV A;  2J0M A;  3IT4 B;  1TKY A;  1XEE A;  3VXW A;  3AXC A;  4J3O D;  1JRO A;  3Q3M C;  1WGG A;  4TSS A;  2L1A A;  1F2R C;  2MWS B;  3AB5 A;  1L0Y B;  2JVC A;  1I4Q A;  2ZCC A;  1L0X B;  2EKI A;  3BYY B;  1IGC A;  1SEB D;  2PTL A;  2D10 A;  4HWI B;  2GI9 A;  3HHM A;  4F1S A;  5D7G A;  5G55 A;  3NY5 A;  4B0E A;  3ZUN A;  1UGJ A;  1RWS A;  1WX7 A;  3O13 A;  2WX0 A;  1FNW A;  4JLC A;  4DQO C;  3SEB A;  2NBW B;  3LB8 C;  3JSV A;  1SE4 A;  4M01 A;  1WM2 A;  1ZUD 2;  2LZ6 A;  3HVZ A;  3ZTC A;  1ZKH A;  3N32 A;  2D5G A;  2KWV B;  1I4R A;  2I38 A;  2PJH A;  1JWU D;  2KJR A;  4PS8 A;  1I42 A;  1KJT A;  4XYC A;  1TS4 A;  2C5L C;  2MSE D;  3K9O B;  2JZ3 B;  5L95 C;  3ZW3 A;  1VZ6 A;  5D3D A;  3UQA A;  2MLB A;  2LD9 A;  3ZXR A;  5AUI A;  3N9Y C;  1SJH D;  2FCS A;  1QZE A;  2GBJ A;  4LNN A;  1LFD A;  3ZIM A;  1NDD A;  4EE2 A;  4NJ6 A;  1F9J A;  4HPL B;  3RNB C;  2MQJ A;  2KN4 A;  4MGZ E;  4MGK E;  4XDD A;  3OAW A;  2J42 A;  3R7Q A;  3OLM D;  2DEN B;  2J7Q B;  1C79 A;  1E8Z A;  2MJE A;  2PEA A;  3VRA B;  5BYR A;  4NAM A;  4WWM A;  1E10 A;  2WDV B;  2MHJ A;  4K7S A;  1K8R B;  2ZW0 A;  1E6E B;  4DHZ E;  4G11 A;  2N9P C;  2DZJ A;  1JW9 D;  1IGD A;  2I1J A;  1UZX B;  1FM0 D;  3DCG A;  2KOX A;  1C77 A;  2PVG C;  1IUE A;  2GRI A;  2ASQ A;  1T5X D;  1WJN A;  1N6Z A;  1XLO A;  1C3T A;  1RRB A;  2J4X A;  2IGH A;  3SFE B;  3V60 A;  1W6V A;  4WIP A;  2EKE C;  1V81 A;  1HE8 A;  2Z0D B;  4IWP A;  4P1C C;  3HM3 A;  5AZH A;  2NTT A;  4F8C B;  1WRD B;  1N5W A;  2FE8 A;  4WJO A;  1EWC A;  3B2F A;  3BVM A;  3DBH I;  3QWZ B;  3VDZ A;  1VZ7 A;  2WP9 B;  3A4S C;  1WY8 A;  4LJP B;  2VH2 A;  3QQ8 B;  2X38 A;  3P4R B;  2GBR A;  2Y3A A;  4US9 A;  3QAR A;  4XZ4 A;  4AJY B;  2E3T A;  4NY0 A;  5BMH A;  4B95 A;  1E8Y A;  2GBK A;  1EF5 A;  5L83 A;  5C1Z A;  2AYO B;  4FHJ A;  1T0Y A;  3ZDM C;  4CO7 A;  5LXI B;  4ZHP A;  3N20 C;  1MHX A;  3KW5 B;  4M02 A;  3IBE A;  2CR5 A;  2MEK A;  3V62 A;  2D3G A;  1OFF A;  1TZ1 A;  4NAW B;  4G0N B;  3DQV A;  3NVV A;  5LXH A;  4YTP B;  3AV8 A;  4MEM A;  1FCL A;  3NUH B;  3VH4 B;  1VZ8 A;  1YQB A;  1DOX A;  1J7C A;  3MJW A;  1F52 A;  4XWT A;  2WXP A;  2G9H D;  4C80 A;  4EFO A;  2JQR B;  3UIP B;  2KTR B;  1WXQ A;  1Q5W B;  1Z5S B;  1N5X A;  1XO3 A;  4TV3 A;  3TCA A;  4M8M A;  4OHJ A;  2D07 B;  1QOG A;  5JHB A;  2OJW A;  2XNA C;  1WI0 A;  1BML C;  4ANU A;  1WGY A;  1L4D B;  5E6N A;  4FBJ B;  2ZZP B;  3QIJ A;  1EF1 A;  2KDB A;  1TKG A;  5J18 A;  3R7R A;  4GDL B;  1TJE A;  1WSP A;  3PHX B;  4RMA A;  3DBL I;  2M19 A;  1PGA A;  3AE3 B;  3QHT A;  1QQR A;  4ASW C;  1T0Q C;  1WIA A;  3DVN V;  2OHF A;  4MSQ B;  2W82 A;  3R2T A;  4ICU A;  1Y56 A;  1WJ4 A;  4XWW A;  1I4H A;  1TS3 A;  4LDT D;  2O6V A;  5AEK B;  2IY1 B;  1JRU A;  2L0T A;  4A3O A;  3B1L X;  4IM3 A;  3MJ5 A;  4HLE A;  2QSD A;  2N1V A;  4K1R B;  3ZKJ C;  2CKH B;  4C00 A;  1KRH A;  2JZP A;  1JWB D;  3L08 A;  4MAC A;  2BBC A;  4MGY E;  1WXA A;  4YL8 A;  4B6W A;  4OZC A;  1TY2 A;  5AZF A;  4REZ A;  4W9G A;  1YD8 U;  1RAX A;  3ONS A;  2KQS A;  3PVL A;  3AE4 B;  2IO0 B;  4WUR A;  2RDH A;  2BYT A;  2JYT A;  5BMI A;  1MG8 A;  2QDF A;  2WNM A;  3L10 B;  2N7E A;  1P98 A;  2JXX A;  2LHD A;  3PRP B;  2O2V B;  2RSU A;  2K9X A;  1WRI A;  3BY4 B;  2WXK A;  5G5H A;  3EEC A;  2K1F A;  2LGS A;  5DPT A;  3KWL A;  5HI1 A;  3KUC B;  1Z2M A;  2N0S B;  1UGM A;  1YIW A;  2C7N B;  1HXY D;  4JQW C;  3WA0 A;  3D32 A;  2WXO A;  1N60 A;  1E8W A;  3BZD B;  1SE3 A;  4E74 A;  1OEY A;  4KX6 B;  1OQQ A;  4G3X B;  2KC1 A;  3P4Q B;  3FAH A;  4N58 A;  3KUD B;  2B3A A;  3ML8 A;  2D11 A;  2PLP A;  1VJK A;  2GBN A;  1BT0 A;  3Q3F A;  2M1M A;  3TJP A;  4AJW A;  3PS6 A;  4TUU A;  2FID A;  3DBS A;  2DWQ A;  1YOV B;  3ENE A;  1QLB B;  2JXT A;  3QA8 A;  1XXG A;  2HJ8 A;  4AOF A;  4HKZ E;  5FR6 A;  2KJ6 A;  2B76 B;  5JHA A;  1FPY A;  1WE7 A;  3AE2 B;  2KHW B;  5EE3 A;  3ZNI D;  5D3I B;  2BTE A;  2NCN A;  3APC A;  3V6C B;  1GC6 A;  2IO2 B;  3T3O A;  3H7S A;  1D6E C;  2W3R A;  2KDI A;  5KHQ A;  4YWG G;  3VVW B;  3GB1 A;  2RPQ A;  2IO3 B;  2KQ4 X;  1NI3 A;  3TEZ A;  2LMC A;  4A20 A;  2KVR A;  3DHH C;  2AX5 A;  4XGA B;  1YX6 B;  4LJO B;  4KIK A;  1SIF A;  2IJ0 A;  4HCP B;  4NAW A;  2DYO A;  2DHZ A;  2KWD A;  4BKT A;  1NEN B;  3CIR B;  3TEY A;  2WDQ B;  4TMA B;  2Y5C A;  3RZF A;  3RCZ A;  5CHF A;  3CMM B;  2VZK D;  3FC4 A;  4KIK B;  3JSV B;  4DXG A;  2DYB A;  3DWM A;  3HVD A;  1VD2 A;  2JYE A;  2LEK A;  1GC7 A;  1XCQ L;  3BVZ A;  4ZDV A;  2KNB A;  2DAF A;  3RNG C;  4WAF A;  4KGS A;  1P1A A;  4P16 A;  2BB5 A;  3AE5 B;  2WU5 B;  3H8H A;  3RZW C;  2JWZ A;  4IM2 A;  4LDT B;  3RNE C;  1H4R A;  3UIO B;  2G4D B;  4LLG M;  4US8 A;  4RGM A;  3PRM B;  2FUG 1;  2O6V B;  2IBI B;  1IBX B;  3PTF C;  3Q3O C;  1XLQ A;  3U30 A;  1V1O A;  4GGQ A;  1D4B A;  1R7S A;  1ZGU B;  2DZM A;  1YJ1 A;  2PVO D;  2WXM A;  2KLG A;  3SD5 A;  3ZQ4 A;  2E6X A;  3PPA A;  3VQI A;  4KGR A;  5TSS A;  1FFU A;  3AEB B;  5LLI A;  1MPE A;  4MH0 E;  3ZJV A;  1OQR A;  4AQ7 A;  2INN E;  2JSV X;  1ROE A;  2LHE A;  4RGT A;  3ZRC A;  4DDG D;  2JPH A;  3GZN B;  5CTR C;  4FHK A;  1R4N B;  2NTS A;  5D2M B;  2IGD A;  2D3B A;  3BK1 A;  2R61 A;  2QC8 A;  4WJN A;  3AEF B;  2RDB C;  5CHW A;  2FCQ A;  3NHE B;  3BYT B;  2L7R A;  3GE3 C;  4KV2 A;  1WR1 A;  2KWU B;  2I1K A;  2XK5 A;  4N59 A;  2MBH A;  2MBB B;  2BPS A;  2CU1 A;  1MJD A;  1R4N I;  2LVQ A;  2FUH B;  5BO4 B;  1XLN A;  4AP4 C;  4ARI A;  1JWA D;  4TQ1 A;  2KC2 A;  3RNF C;  3W1Y A;  3W2D A;  1C9F A;  3S2A A;  1GG3 A;  3VR8 B;  1EWY C;  3BWU D;  1KF6 B;  3DBR B;  2G1E A;  2BYE A;  3PSE B;  3ALB A;  1YMH E;  4IDI A;  3DOW A;  4RNA A;  2UYZ B;  3E9S A;  3BK2 A;  3ETR A;  2IND C;  5FR3 A;  1AWD A;  2Z8L A;  1AYF A;  4RM8 A;  2K0P A;  3FIL B;  4WWO A;  5JZE B;  1AAR A;  2LRW A;  4UDU C;  4GB9 A;  2M8S A;  4D2K A;  5I4D A;  2JZZ A;  3P42 A;  2KDM A;  3N3K B;  2GB1 A;  3CSF A;  1PDX A;  3WAO A;  5BYQ A;  1UH6 A;  5CX3 A;  2RD0 A;  3DVG X;  3PZ7 A;  2KAJ A;  1LGR A;  1WGK A;  3AE7 B;  2XBB C;  1ENF A;  1K51 A;  2KQ7 A;  2QMT A;  4K81 A;  1L5P A;  2KVZ A;  1Q0W B;  2LVO A;  2CHX A;  2BS2 B;  4FXC A;  2ZVO A;  2N4F A;  4DHJ B;  4K7W A;  5IP4 D;  2PE9 A;  1KLU D;  2HTH A;  1SF0 A;  3ZDT A;  1T0S C;  2N1W A;  2LFI A;  2WHI A;  2WS3 B;  2ZNV B;  3APD A;  2KFJ A;  2BB6 A;  1Y8R C;  3ZJU A;  2DNF A;  2K5P A;  4W9H A;  3HIZ A;  3MFG A;  2IDY A;  3EC8 A;  3R66 C;  4S0R A;  5HHD G;  3C19 A;  2V3S A;  5IAA C;  1WYG A;  3H7P A;  1P9D U;  1UEL A;  4CYE A;  3RMK C;  4WQM A;  2XEW A;  1CZP A;  3APF A;  2KDE B;  2KD0 A;  4JWS C;  3HM6 X;  4IW0 A;  4GSW A;  3QAQ A;  2Z59 B;  1JQ4 A;  4OZA A;  1DOI A;  2PW9 A;  2M4N A;  4GMV A;  4EEW A;  4I6P A;  3TMP B;  3E56 A;  3GS2 A;  1EM7 A;  3AM9 A;  2V3P A;  4URK A;  4IWQ A;  2EMT A;  3A4R A;  2LAS A;  4EZL A;  2K3U A;  2CU3 A;  2KMM A;  2MBQ A;  3EFU A;  1TS2 A;  1WX8 A;  2KX3 A;  4BOS C;  1J0G A;  2MP2 B;  4PK1 A;  3ZRF A;  3C8Y A;  3WAN A;  1EU4 A;  2KO3 A;  1K53 A;  2WXR A;  1SB3 C;  1Q10 A;  2KDF B;  5BYS A;  1FXT B;  1FXA A;  2G45 B;  1I4X A;  1X1M A;  2EMS A;  2YLM A;  1GPX A;  4RM9 A;  2K8H A;  3LYY A;  1I4P A;  3A9K A;  1YJJ A;  4BZA A;  1V97 A;  2RDG A;  3ZJT A;  4J6I A;  4M8N A;  4EZK A;  1SBB B;  1KLG D;  3U4E G;  1FO4 A;  4YTM B;  3JVZ X;  3AEG B;  4W9C A;  1PUT A;  2D3C A;  1NVI D;  4ITK A;  1IBX A;  3AEC B;  4KDI C;  2QCZ A;  2C60 A;  4WQO B;  1RLF A;  3NOB A;  4NZL B;  3V6E B;  2M17 A;  1YN5 A;  4YSY B;  1NI2 A;  4FJV B;  3FIL A;  1HZ6 A;  2INP E;  2DAJ A;  3WAP A;  2L05 A;  1PFD A;  4ANX A;  1E7U A;  3IXS A;  3DHG C;  1FFV A;  4GN1 A;  4MJS B;  2V3N A;  1WGD A;  1XLP A;  2MBO A;  3GP7 A;  1TZO A;  3RD2 A;  5JXV A;  1WZ3 A;  2DX5 B;  3N1Y C;  3RPF C;  3VTW A;  4F7Z A;  2GOW A;  4KZC A;  1C78 A;  3OJ3 A;  1HA5 A;  1SJE D;  1KH0 A;  2L52 A;  3OG5 A;  4L1B A;  1D5X C;  2MW5 A;  3OJ4 B;  1TBE A;  5IA7 A;  4YTN B;  4MDK E;  2D2Q A;  2WDR B;  3A1Q B;  2A5U A;  2WXG A;  1DYQ A;  1DOY A;  3P2B A;  3RUL A;  3Q8A A;  1N61 A;  3ZGZ A;  2NBV B;  1QIL A;  4KSL C;  5FKA C;  4W9E A;  4BBN C;  4B0M A;  1RFK A;  1JAL A;  1WFY A;  2KKC A;  1CQV A;  2FCN A;  2N9E B;  2KAN A;  4A3P A;  5AZG A;  5LNK 1;  3VTV A;  3OWE B;  2JY6 A;  2BF8 B;  1P7F A;  4C56 C;  3MC9 A;  3P4P B;  3Q69 A;  2JX5 A;  2NMQ A;  3JYU A;  2DYM A;  3W5U B;  3Q3N C;  3WCQ A;  3A9J A;  2YEP F;  3GE8 C;  3UGB B;  1E8X A;  4BBN F;  2PIA A;  3DHI C;  4EZJ A;  1WWT A;  1D3Z A;  2NBU A;  4JIO U;  3TL5 A;  1V5T A;  2XN9 C;  5DPR A;  2NPT A;  4P1B C;  2NPT B;  5GXG B;  3ZTD A;  1KLV A;  4RGN A;  4HCN B;  1TS5 A;  4YSZ B;  2WLB A;  4K3C A;  2QHO A;  3IHP C;  5D94 A;  1TIF A;  1WF9 A;  1E0Z A;  3EHV A;  4JX1 C;  2WXQ A;  4JL9 A;  1DGJ A;  3DVN U;  2C7M B;  1G6J A;  2BT6 A;  4AWJ A;  1F2R I;  5H8Y E;  2K22 A;  3P4S B;  2VZK B;  4N6E B;  3TEX A;  4IWO A;  2R2O A;  1T0R C;  4RF0 A;  2BVC A;  3IFW B;  1L0V B;  2KX0 A;  3I57 A;  1I7H A;  3VUW A;  3VUY A;  2N9X A;  3AEE B;  4CQN A;  2LGD A;  1E9M A;  2LGY A;  5T8I A;  1HTQ A;  2ON8 A;  2C9W B;  2PKO A;  2BWF A;  2K25 A;  2LXC A;  2NVU I;  4RF1 A;  1C4A A;  4JGH B;  2W9N A;  4GXB A;  2R2Q A;  3N1X C;  4OZB A;  3U52 E;  1U4A A;  5BMG A;  4W9J A;  4FJY A;  1MI0 A;  4WJP A;  2LI5 A;  3T3N A;  2MRP A;  2WX1 A;  4XE0 A;  4A6Q A;  1QOA A;  1F77 A;  1WGR A;  2LUM A;  2V9H A;  5C3J B;  4XDC A;  3L16 A;  1WR6 E;  3NZS A;  3IT6 B;  4P7I A;  4GIV A;  1XF5 L;  3AEA B;  5E6J A;  2IO1 B;  3KYD D;  4EOY A;  1FRD A;  1WMH A;  1YNT E;  2V4I B;  2FAZ A;  2MJD A;  5JH5 C;  1F1H A;  2K8C A;  4FJZ A;  4DXA B;  3U7Z A;  1TT5 B;  1JCK B;  2A4Z A;  1YN3 A;  4KKJ A;  1D5M C;  2RMM A;  1FIQ A;  2SEB D;  1SSN A;  4FA6 A;  4PYZ A;  3PRZ A;  1WZ0 A;  4BKG A;  3SDL C;  2W55 A;  4NQL B;  1ISN A;  4WH4 A;  3Q3J A;  1XD3 B;  3AE8 B;  3L4P A;  3UIN B;  2J0K A;  3GZN I;  2ZEQ A;  4QAY A;  4W9D A;  2JU6 X;  3ZNG C;  1I35 A;  1SE2 A;  3M63 B;  1ZW7 A;  2JT4 B;  1WMH B;  3CST A;  1RM6 C;  3I3T B;  4MT5 A;  4X57 B;  1K52 A;  1FNV A;  2DLB A;  3UQB A;  1EU3 A;  3NVY A;  3KVF B;  5C23 A;  1E5W A;  1SE9 A;  4ZOH C;  5IOI A;  2BYF A;  2KN5 A;  5TR5 A;  2JRH A;  1LQB A;  3MC8 A;  4DWF A;  4GDK B;  3I5J C;  3VAW A;  2CJO A;  1WX9 A;  1FNU A;  3BIN A;  2JWU A;  3R3M A;  5KHO A;  2JUO A;  1VLB A;  2NR2 A;  2IPK D;  4BKS A;  3U2S C;  3X23 A;  4LTU A;  1NYR A;  4E3C A;  4HRO A;  3SU8 X;  2LGI A;  3KUZ A;  1ZP0 B;  4Q2J A;  1HQR D;  2FNJ B;  1MFW A;  1J7B A;  1UNS A;  1R4M I; 
#chains in the Genus database with same CATH homology
 3CSF A;  2UWQ A;  2RR9 A;  2K6D B;  3LDZ E;  3WAO A;  1A5R A;  3VH4 B;  4IG7 B;  1YQB A;  1VCB A;  1Q1O A;  1P3Q U;  2LVP A;  3MJW A;  1UH6 A;  3QX1 A;  5CX3 A;  2RD0 A;  3DVG X;  4EFO A;  4FN2 A;  3UIP B;  2KTR B;  3A1Q A;  4ANW A;  1UD7 A;  2XBB C;  2HE7 A;  1WJU A;  3LJ3 A;  2KQ7 A;  1Q5W B;  1Z5S B;  2K8B A;  2O6V D;  4K81 A;  1Q0W B;  2LVO A;  2CHX A;  3U7D A;  2ZPY A;  2N4F A;  2ZVO A;  1LM8 B;  3TIX A;  4DHJ B;  2YVC A;  4K7W A;  4TV3 A;  3TCA A;  4M8M A;  1IYF A;  1UBQ A;  2PE9 A;  1V86 A;  2D07 B;  2HTH A;  5JHB A;  3IG3 A;  4EKU A;  3ZDT A;  1WI0 A;  4G50 A;  4KZ0 A;  3WAL A;  4ANU A;  1WGY A;  3HK0 A;  2N1W A;  3T9L A;  4TQ0 A;  2AWT A;  2BGF A;  2L76 A;  2ZNV B;  3LMN A;  3APD A;  2KFJ A;  3DPD A;  1WXS A;  1Y8R C;  1E7V A;  4W9H A;  5CHV C;  5E6N A;  4FBJ B;  2ZZP B;  3HIZ A;  3ZNZ B;  2O2V A;  2C7H A;  5EDS A;  3QIJ A;  4GOC A;  3MHS D;  1EF1 A;  4AUQ C;  3ZLZ A;  2KDB A;  3EC8 A;  5J18 A;  2CS4 A;  3MTN B;  3R66 C;  1IP9 A;  3R7R A;  2BKF A;  4GDL B;  2V3S A;  4I6N B;  5IAA C;  3H7P A;  2DZI A;  1P9D U;  2AEH A;  2LGX A;  1UEL A;  4CYE A;  3PHX B;  1YX5 B;  2G4S A;  1OEY J;  3DBL I;  4RMA A;  3RUI B;  2ZPN A;  2AL6 A;  1WH3 A;  4KSK C;  2DZK A;  3QHT A;  2XEW A;  3VHT C;  3M3J A;  4OVU A;  2L00 B;  4ASW C;  3APF A;  4MJS A;  2KDE B;  4HDQ A;  2KD0 A;  4WAA A;  5J17 A;  1WIA A;  3HM6 X;  3DVN V;  4IW0 A;  3DDC B;  4MSQ B;  4ICU A;  4GSW A;  3QAQ A;  2Z59 B;  1WJ4 A;  3N30 A;  1IPG A;  4LDT D;  4GMV A;  2M4N A;  2GMI C;  2O6V A;  5HKH A;  5AEK B;  3AUL A;  4I6P A;  2IY1 B;  3RT3 B;  4EEW A;  3TMP B;  1EUV B;  1JRU A;  2L0T A;  2MX2 A;  4A3O A;  3B1L X;  4ZRJ A;  1V80 A;  4URK A;  4IWQ A;  4IM3 A;  4OVV A;  4GDL A;  4HLE A;  2N1V A;  2ZCB A;  2EMT A;  3A4R A;  4K1R B;  2LAS A;  4EZL A;  1WE6 A;  3U8Z A;  2AL3 A;  3ZKJ C;  3PZD A;  3A33 B;  2CKH B;  3C0R B;  4B9K A;  2MBQ A;  3EFU A;  1P0R A;  5G2N A;  1WX8 A;  2KX3 A;  4BOS C;  1J0G A;  2MP2 B;  3VTU A;  4FAD A;  3L08 A;  2KFK B;  4MGY E;  1L2N A;  1C1Y B;  3ZRF A;  1WXA A;  3WAN A;  4YL8 A;  2KO3 A;  4GDK A;  2CHZ A;  4B6W A;  4EUT A;  3B08 A;  3QK0 A;  2KDF B;  5AZF A;  3L13 A;  1FXT B;  4LCD E;  3PRE A;  4W9G A;  1PQS A;  1YD8 U;  1RAX A;  2BWE S;  2G45 B;  3ONS A;  4MSM B;  1X1M A;  2EMS A;  1WGH A;  2WWZ A;  2KQS A;  2YLM A;  2KMA A;  4RM9 A;  2K8H A;  3PVL A;  4N9F 4;  1V49 A;  2IO0 B;  3A9K A;  3ML9 A;  4I6L B;  3QJZ A;  2GBM A;  1MG8 A;  2OJR A;  3L10 B;  4KDL B;  2LXA A;  4DK5 A;  1V5O A;  2N7E A;  1P98 A;  2JXX A;  1V9J A;  3PRP B;  4J6I A;  3H9D A;  4M8N A;  2O2V B;  4DHZ B;  4EZK A;  2LUE A;  2RSU A;  1WXM A;  1KM7 A;  2J0J A;  3BY4 B;  3AU4 A;  3JVZ X;  4W9C A;  2HD5 B;  2PPH A;  3O65 B;  2L8J A;  5E6P A;  3K9P B;  3EEC A;  4WWN A;  2K1F A;  3NS8 A;  5DPT A;  5E6O A;  2JF5 A;  2KTF A;  2JRI B;  4KDI C;  4BFR A;  2XK5 B;  4NNJ B;  2C60 A;  4WQO B;  1RLF A;  3NOB A;  3KUC B;  1Z2M A;  3PGE A;  4GU2 A;  1UGM A;  1NBF C;  1YIW A;  3H7P B;  3V6E B;  2C7N B;  2M17 A;  4W9K A;  4JQW C;  1NI2 A;  3WA0 A;  1KOT A;  4FJV B;  1H8C A;  3KH0 A;  3D32 A;  2DAJ A;  4IM0 A;  3X0W A;  3SHQ A;  3WAP A;  4XC2 A;  1E8W A;  3WAM A;  2L05 A;  1WM3 A;  4NQK E;  3RYT A;  4ANX A;  2RGF A;  1E7U A;  2PE6 B;  2V4L A;  1L7Y A;  4ICV A;  4E74 A;  4K7U A;  4GN1 A;  3V61 A;  1OEY A;  1WXV A;  4MJS B;  1WGD A;  1TGZ B;  4G3X B;  2KC1 A;  2MBO A;  3DBR I;  3RD2 A;  1WZ3 A;  4MEL A;  2DX5 B;  3W1S C;  3GOE A;  3KUD B;  2B3A A;  3ML8 A;  2BKR B;  2D11 A;  1UBI A;  4WJQ A;  4TKN A;  3VTW A;  4F7Z A;  4HPM B;  2GOW A;  4KZC A;  4MM3 A;  1GJZ A;  4W9L A;  3OJ3 A;  2GBN A;  5DPS A;  2ZJD A;  1BT0 A;  2LWP A;  2ZNV C;  3L0W B;  3Q3F A;  2M1M A;  4HXD A;  1OTR B;  4M0W B;  3L17 A;  3TJP A;  2MW5 A;  3W1S A;  4AJW A;  3OJ4 B;  1TBE A;  5IA7 A;  4MDK E;  3M62 B;  2D2Q A;  2G3Q B;  1XT9 B;  3A1Q B;  3PS6 A;  2A5U A;  1GNU A;  2KK8 A;  5DPW A;  2FIF A;  3P2B A;  4TUU A;  3RUL A;  2K6Q A;  2NBV B;  4KSL C;  2IYD B;  2FID A;  4W9E A;  3DBS A;  4BBN C;  3ZVV A;  2L3Z A;  1WFY A;  2KKC A;  2FCN A;  3ENE A;  2N9E B;  2KAN A;  4A3P A;  5AZG A;  4ANV A;  3VFK A;  2J0M A;  3KYC D;  3QA8 A;  3VTV A;  3VXW A;  3AXC A;  2HJ8 A;  4BVU C;  4AOF A;  3NZU A;  2JY6 A;  4II2 B;  2BF8 B;  1WGG A;  4PYU A;  5FR6 A;  3ZNH B;  2KJ6 A;  4ZYN A;  4DBG A;  2MWS B;  5JHA A;  1WE7 A;  2JVC A;  2KHW B;  3A9J B;  2DYM A;  3JYU A;  2ZCC A;  3ZNI D;  2Z0E B;  2MA9 B;  2KMC A;  2NCN A;  3APC A;  3V6C B;  1J8C A;  1GC6 A;  2IO2 B;  3A9J A;  3H7S A;  2D10 A;  4HWI B;  4FLH A;  3UGB B;  1E8X A;  3PLV A;  2KDI A;  3HHM A;  4F1S A;  5KHQ A;  5D7G A;  4BBN F;  5G55 A;  3NY5 A;  3VVW B;  2RPQ A;  2IO3 B;  3ZUN A;  4EZJ A;  1LXD A;  2CHW A;  1D3Z A;  3QC8 B;  1WX7 A;  2M0X A;  2WX0 A;  2NBU A;  4JIO U;  4JLC A;  1V5T A;  1J19 A;  2KVR A;  2NPT A;  5DPR A;  3TL5 A;  4A20 A;  2NPT B;  2N7D A;  1CMX B;  2NBW B;  1YX6 B;  2KZR A;  4LJO B;  4KIK A;  1SIF A;  3ZTD A;  1KLV A;  2IZV B;  3JSV A;  2VRR B;  1WM2 A;  4HCN B;  2LZ6 A;  4PS3 A;  4HCP B;  3ZTC A;  2KXJ A;  3VUX A;  4NAW A;  2DYO A;  1ZKH A;  2DHZ A;  2QHO A;  1S1Q B;  3IHP C;  5D94 A;  4BKT A;  1WF9 A;  3N32 A;  4II3 B;  2KWV B;  3EHV A;  5GMV A;  3RZF A;  3RCZ A;  5CHF A;  3CMM B;  2PJH A;  2LJ5 A;  4JL9 A;  4KIK B;  3DVN U;  3JSV B;  2KJR A;  2DYB A;  4PS8 A;  3PLU A;  2C7M B;  1I42 A;  1KJT A;  2C5L C;  4DHJ D;  1VD2 A;  1RFA A;  1G6J A;  2MSE D;  1GC7 A;  3H6N A;  4AWJ A;  3K9O B;  3PHW B;  2JZ3 B;  4ZDV A;  2KLC A;  5L95 C;  2KNB A;  3ZW3 A;  2DAF A;  4IWO A;  2R2O A;  3UQA A;  2MLB A;  2LD9 A;  2WYQ A;  2V1Y A;  3IFW B;  2KX0 A;  3PV1 A;  3VUW A;  1P1A A;  2N9X A;  3VUY A;  4ZRK A;  3B0A A;  2FCS A;  3T8M A;  1QZE A;  2KWC A;  2LGD A;  2GBJ A;  2LGY A;  5D6J B;  2L0F A;  4HDO A;  3RZW C;  1LFD A;  3ZIM A;  1NDD A;  2JWZ A;  3PT2 B;  4IM2 A;  4LDT B;  4NJ6 A;  1F9J A;  2C9W B;  1H4R A;  3UIO B;  2BWF A;  4HPL B;  2G4D B;  1V2Y A;  2MQJ A;  2REX A;  3PRM B;  2K25 A;  2O6V B;  4MGK E;  2IBI B;  4MGZ E;  2LXC A;  2NVU I;  3OAW A;  4JGH B;  4PS7 A;  1XQQ A;  3R7Q A;  3OLM D;  4IUM B;  1SGH A;  2DEN B;  3PTF C;  2J7Q B;  2W9N A;  3U30 A;  4BOZ B;  4GGQ A;  2R2Q A;  4GXB A;  3TBL D;  1OGW A;  1E8Z A;  1U4A A;  2PEA A;  1WYW B;  1ZGU B;  4NJ7 A;  2DZM A;  1YJ1 A;  4W9J A;  4FJY A;  4MGI E;  4WJP A;  2KLG A;  2LI5 A;  3SD5 A;  2IY0 B;  3ECI A;  3PPA A;  2MRP A;  2WX1 A;  3VQI A;  4K7S A;  1K8R B;  1WGR A;  4DHZ E;  4G11 A;  2N9P C;  2DZJ A;  3L16 A;  2WDT B;  2I1J A;  5LLI A;  1WR6 E;  3NZS A;  4MH0 E;  4P7I A;  4GIV A;  1UZX B;  2IO1 B;  2KJH B;  4HK2 A;  3DCG A;  3KYD D;  1WMH A;  2KOX A;  4EOY A;  3ZRC A;  4DDG D;  3AU5 A;  2JPH A;  2FAZ A;  5CTR C;  4FHK A;  4CHK A;  2ASQ A;  5JH5 C;  1V6E A;  4BKS D;  2K8C A;  1WJN A;  4FJZ A;  5D2M B;  4KVG B;  4DXA B;  2KFK A;  3JW0 X;  1C3T A;  1RRB A;  4IC7 B;  3UF8 A;  4W9I A;  2A4Z A;  3M95 A;  4WJN A;  5J2R A;  2K39 A;  2MCN B;  1E90 A;  3V60 A;  1W6V A;  2EKE C;  4FA6 A;  4PYZ A;  2Y5B B;  5CHW A;  2FCQ A;  3NHE B;  1V81 A;  3PRZ A;  2L7R A;  1WZ0 A;  3VH3 B;  1HE8 A;  2Z0D B;  3A9K B;  2NS5 A;  4IWP A;  5DCN A;  3SDL C;  4BKG A;  4KV2 A;  1WR1 A;  2KWU B;  3HM3 A;  4NQL B;  1ISN A;  2I1K A;  2XK5 A;  5AZH A;  3Q3J A;  4F8C B;  1XD3 B;  4HVB A;  2MBH A;  1WRD B;  2ZVN A;  3QCA A;  1OQY A;  3UIN B;  2J0K A;  2MBB B;  3GZN I;  4HJK A;  4WJO A;  2BPS A;  2ZEQ A;  2CU1 A;  4W9D A;  1R4N I;  3DBH I;  2LVQ A;  3QWZ B;  3VDZ A;  3ZNG C;  1I35 A;  2FUH B;  3A4S C;  1WY8 A;  2BYV E;  4LJP B;  4E71 A;  3M63 B;  5BO4 B;  1TTN A;  1ZW7 A;  2JT4 B;  1WMH B;  3CST A;  4AP4 C;  3I3T B;  4NPN A;  1M94 A;  3QQ8 B;  4TQ1 A;  2KC2 A;  4X57 B;  2GBR A;  3W1Y A;  3IVF A;  3UQB A;  2MBE A;  3QAR A;  3KVF B;  2FCM A;  4XZ4 A;  1GUA B;  3S2A A;  1GG3 A;  5C23 A;  4AJY B;  3ZO5 B;  3DVG Y;  1EO6 A;  1E5W A;  1SE9 A;  4NY0 A;  4ZRI A;  4B95 A;  2BYF A;  2KN5 A;  5TR5 A;  1E8Y A;  1LQB A;  2GBK A;  2JRH A;  4FUL A;  2BYE A;  3PSE B;  4DWF A;  1EF5 A;  3ALB A;  4GDK B;  5L83 A;  3DOW A;  5C1Z A;  2AYO B;  2UYZ B;  4FHJ A;  1T0Y A;  3H1U A;  2MP2 A;  3VAW A;  3ZDM C;  4CO7 A;  5LXI B;  4XX5 A;  1WX9 A;  1S3S G;  3KW5 B;  3BIN A;  4RM8 A;  3AI5 A;  3R3M A;  5KHO A;  3IBE A;  4WWO A;  2CR5 A;  2JUO A;  2NR2 A;  3V62 A;  5JZE B;  2D3G A;  4BKS A;  1TZ1 A;  1AAR A;  3X23 A;  4W9F A;  2LRW A;  3CF6 E;  4NAW B;  4DDI D;  4E3C A;  2OOB B;  3SU8 X;  4GB9 A;  3KUZ A;  4G0N B;  3DQV A;  2M8S A;  1WJ6 A;  2JZZ A;  2FNJ B;  5LXH A;  2KTR A;  4WWP A;  4MEM A;  3N3K B;  3WIM A;  1R4M I;  2LRU A;  3L54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...