5CTUA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
molecule keywords DNA gyrase subunit B
total genus 63
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5ctuA00
1MU5A 1TIDA 1ZXMA 4HYMA 4B7PA 2YE7A 1KIJA 3ZXQA 2YI7A 3K99A 4JQLA 4XKAA 4CE1A 2XDKA 4XDMA 4MPNA 2GQPA 4BQJA 1I5AA 2VCIA 1I5CA 2EXLA 2H8MA 2FWZA 3U67A 3GIEA 2BSMA 3EHJA 3Q5LA 2ZDYA 4BQGA 2IOQA 2BYIA 3R92A 2YKEA 5M4EA 2BU7A 4PRXA 2CG9A 1QY8A 3LNUA 3O6OA 2XX2A 4HZ0A 5M4KA 4FCRA 4FCQA 1GJVA 2CCUA 3D36A 1EA6A 1H7UA 1Y4UA 2XJXA 4XD8A 4LWGA 2Q2EB 2YEIA 2QF6A 3EHFA 4BAEA 4MBCA 2XX5A 3CGYA 1Y4SA 5CTYA 1UYMA 1UYFA 4WUDA 2BU2A 2WI4A 2CCSA 4V26A 3EKRA 2K5BA 2YE8A 3BMYA 3A0ZA 3A0TA 2Q8IA 5D7DA 3HYYA 2ZDXA 3H80A 4QPJA 3ZKDA 1I5BA 2AKPA 1TC6A 3FT5A 1KZNA 4AWPA 1YC1A 3K60A 3U2KA 1QYEA 2IOPA 5D6PA 3EHGA 1S16A 5IN9A 2BRCA 5D6QA 2VW5A 3A0YA 1YC4A 2IORA 4K4OA 3T2SA 4EGKA 4MP7A 1UYDA 3INWA 2YK9A 2IWUA 4KQVA 2WI3A 4B6CA 3R4NA 2QG0A 3OW6A 3T1KA 5CTUA 5FNFA 4CWRA 4E02A 2XHTA 1ID0A 4R1FA 1U0ZA 4ASBA 4MPEA 4HXWA 5FNDA 4P7AA 4XCLA 4BXIA 2BU6A 4X9LA 2WEPA 4NH8A 2WI1A 4YKZA 1UY9A 3B25A 2O1UA 5M4MA 3OMUA 1BKNA 3B28A 3MNRP 4E00A 5BOCA 4JAUA 4O04A 2E0AA 1BXDA 4EFTA 1UYHA 2YEBA 3PEJA 1UYKA 4XITA 4O05A 4PL9A 4CE2A 3HZ5A 3WQ9A 3VHDA 3ZKBA 2XDUA 1NHJA 4XKKA 3ZM7A 2XD6A 2C2AA 3A0XA 4XC0A 3Q5KA 2YEAA 1UY6A 2YK2A 4NH7A 4EGIA 4YKUA 5BODA 4YKTA 2FYPA 4DUHA 5M4HA 3RKZA 4CWPA 1Z5BA 4CWTA 2JKIA 5CTWA 5IDMA 3OWDA 2YGFA 4O07A 4JASA 3C0EA 2XDSA 2HCHA 3RLQA 2YJXA 4XIQA 2BREA 1UYIA 1YESA 5L3JA 4WUBA 4LWHA 3DGEA 1THNA 1Z5CA 1I5DA 2XJJA 4GFNA 4FMTA 3CWVA 1YC3A 1TH8A 2XK2A 2ZKJA 5J6AA 3H4LA 3T0ZA 3ZXOA 2XHRA 3O2FA 2BU5A 4KP4A 3CRLA 2BU8A 4W7TA 3KE6A 2YE5A 3NMQA 3K98A 3R4OA 2BZ5A 5F3KA 1A4HA 3U2DA 4GQTA 4R3AA 4LWFA 4H85A 4YKXA 3VHCA 2YJWA 1YSZA 2YE4A 4KSGA 2WI5A 2YI0A 3GIFA 3CRKA 4MP2A 2YE2A 3GIGB 3FV5A 3HYZA 4YKYA 4XIPA 2HG1A 1UYEA 4URMA 2Q8FA 3R4PA 4L8ZA 2O1WA 4KSHA 2YE9A 3HEKA 4XIRA 2YKBA 4CWFA 4NH9A 5CTXA 4XE2A 1AH8A 2YECA 5FWKA 2YKCA 2YEHA 4GEEA 2WI7A 3JZ3A 4I3HA 1AJ6A 2UWDA 4WUCA 2YEDA 4U7NA 4LWEA 5IDJA 4L94A 5D7RA 4U93A 1EI1A 2WI2A 4AWQA 1YSRA 4PRVA 2YE3A 3G75A 4L93A 3TZ2A 1S14A 1H7SA 2YI5A 2YEJA 5FNCA 4CWQA 3VADA 4XCJA 2BTZA 1ZWHA 4CE3A 3B26A 4YKWA 2YGEA 4CWSA 1UYLA 4EGHA 2CCTA 1QZRA 1TC0A 1UYGA 1R62A 4BIZA 3EKOA 4U7OA 2YKJA 3HHUA 4QPKA 2Q8GA 2VCJA 4EM7A 2HKJA 3WHAA 3LPSA 4CWNA 4ZVIA 3G7EA 4ASAA 2XJGA 2XX4A 3Q5JA 1MX0A 3D0BA 3T10A 3TZ5A 3C11A 5GGZA 3TUHA 5CPHA 3K97A 4H7QA 4MB9A 2VWCA 4URNA 4BIUA 4EEHA 4KFGA 2BYHA 4O09A 4ZKIA 3BM9A 3G7BA 5C93A 4ASGA 2YEEA 3OPDA 2FWYA 4P8OA 4GGLA 3A0RA 3R91A 1B62A 4GT8A 3TTZA 5M4NA 2FXSA 2WI6A 3GIGA 3QDDA 2WERA 3CGZA 5D7CA 1GKZA 1YT0A 1JM6A 4FPPA 1I58A 3D2RA 4H81A 4LPBA 1BYQA 3QTFA 4MPCA 4LP0A 3A0WA 1UY8A 2XDLA 2IWSA 4R3MA 1I59A 2YE6A 4YKQA 3EHHA 2ZBKB 4O0BA 4GCZA 4L90A 2CGFA 1UYCA 2YEGA 4EMVA 1YT1A 3RLRA 1L0OA 1Z5AA 4KTNA 2Q8HA 2WEQA 1YERA 1AH6A 1OSFA 2PNRA 2XCMA 2XDXA 4Q20A 2BT0A 4AWOA 1Y8PA 2GFDA 1PVGA 2YKIA 4PU9A 1YS3A 1Z59A 1UY7A 4DZYA 5M4PA 4XKOA 4XTJA 2YGAA 5CF0A 3TZ4A 1TBWA 4V25A 2YEFA 5J71A 1Y8NA 4YKRA 4LWIA 2QFOA 3PEHA 4L91A 4ASFA 1NHHA 4CWOA 4HY1A 4JAVA 1B63A 3INXA 3R4MA 2YI6A 2O1VA 3VHAA 1US7A 3B24A 3B27A 2XHXA 1GKXA 4HXZA 4HYPA 4FCPA 1YETA 2IWXA 3HZ1A 1U2OA 3SL2A 2CH4A 3O0IA 2H55A 1TILA 1AMWA 1AM1A 1NHIA 3TZ0A 1ZXNA 1YT2A 4MOTA 4EFUA 4UROA 2ESAA 4I5SA 1ZW9A 4AS9A 1Y8OA 3T0HA 5F5RA 3IEDA 2JJCA 3FT8A 4HZ5A 1B3QA 3OWBA 4E01A 2XABA 1BGQA 4URLA 4HY6A 2QG2A 3RLPA
chains in the Genus database with same CATH superfamily
1MU5A 1TIDA 1ZXMA 4HYMA 4B7PA 2YE7A 1KIJA 3ZXQA 2YI7A 3K99A 4JQLA 4XKAA 4CE1A 2XDKA 4XDMA 4MPNA 2GQPA 4BQJA 1I5AA 2VCIA 1I5CA 2EXLA 2H8MA 2FWZA 3U67A 3GIEA 2BSMA 3EHJA 3Q5LA 2ZDYA 4BQGA 2IOQA 2BYIA 3R92A 2YKEA 5M4EA 2BU7A 4PRXA 2CG9A 1QY8A 3LNUA 3O6OA 2XX2A 4HZ0A 5M4KA 4FCRA 4FCQA 1GJVA 2CCUA 3D36A 1EA6A 1H7UA 1Y4UA 2XJXA 4XD8A 4LWGA 2Q2EB 2YEIA 2QF6A 3EHFA 4BAEA 4MBCA 2XX5A 3CGYA 1Y4SA 5CTYA 1UYMA 1UYFA 4WUDA 2BU2A 2WI4A 2CCSA 4V26A 3EKRA 2K5BA 2YE8A 3BMYA 3A0ZA 3A0TA 2Q8IA 5D7DA 3HYYA 2ZDXA 3H80A 4QPJA 3ZKDA 1I5BA 2AKPA 1TC6A 3FT5A 1KZNA 4AWPA 1YC1A 3K60A 3U2KA 1QYEA 2IOPA 5D6PA 3EHGA 1S16A 5IN9A 2BRCA 5D6QA 2VW5A 3A0YA 1YC4A 2IORA 4K4OA 3T2SA 4E72A 4EGKA 4MP7A 1UYDA 3INWA 2YK9A 2IWUA 4KQVA 2WI3A 4B6CA 3R4NA 2QG0A 3OW6A 3T1KA 5CTUA 5FNFA 4CWRA 4E02A 2XHTA 1ID0A 4R1FA 1U0ZA 4ASBA 4MPEA 4HXWA 5FNDA 4P7AA 4XCLA 4BXIA 2BU6A 4X9LA 2WEPA 4NH8A 2WI1A 4YKZA 1UY9A 3B25A 2O1UA 5M4MA 3OMUA 1BKNA 3B28A 3MNRP 4E00A 5BOCA 4JAUA 4O04A 2E0AA 1BXDA 4EFTA 1UYHA 2YEBA 3PEJA 1UYKA 4XITA 4O05A 4PL9A 4CE2A 3HZ5A 3WQ9A 3VHDA 3ZKBA 2XDUA 1NHJA 4XKKA 3ZM7A 2XD6A 2C2AA 3A0XA 4XC0A 3Q5KA 2YEAA 1UY6A 2YK2A 4NH7A 4EGIA 4YKUA 5BODA 4YKTA 2FYPA 4DUHA 5M4HA 3RKZA 4CWPA 1Z5BA 4CWTA 2JKIA 5CTWA 5IDMA 3OWDA 2YGFA 4O07A 4JASA 3C0EA 2XDSA 2HCHA 3RLQA 2YJXA 4XIQA 2BREA 1UYIA 1YESA 5L3JA 4WUBA 4LWHA 3DGEA 1THNA 1Z5CA 1I5DA 2XJJA 4GFNA 4FMTA 3CWVA 1YC3A 1TH8A 2XK2A 2ZKJA 5J6AA 3H4LA 3T0ZA 3ZXOA 2XHRA 3O2FA 2BU5A 4KP4A 3CRLA 2BU8A 4W7TA 3KE6A 2YE5A 3NMQA 3K98A 3R4OA 2BZ5A 5F3KA 1A4HA 3U2DA 4GQTA 4R3AA 4LWFA 5JENA 4H85A 4YKXA 3VHCA 2YJWA 1YSZA 2YE4A 4KSGA 2WI5A 2YI0A 3GIFA 3CRKA 4MP2A 2YE2A 3GIGB 3FV5A 3HYZA 4YKYA 4XIPA 2HG1A 1UYEA 4URMA 2Q8FA 3R4PA 4L8ZA 2O1WA 4KSHA 2YE9A 3HEKA 4XIRA 2YKBA 4CWFA 4NH9A 5CTXA 4XE2A 1AH8A 2YECA 5FWKA 2YKCA 2YEHA 4GEEA 2WI7A 3JZ3A 4I3HA 1AJ6A 2UWDA 4WUCA 2YEDA 4U7NA 4LWEA 5IDJA 4L94A 5D7RA 4U93A 1EI1A 2WI2A 4AWQA 1YSRA 4PRVA 2YE3A 3G75A 4L93A 2FTKA 3TZ2A 1S14A 2C1IA 1H7SA 2YI5A 2YEJA 5FNCA 4CWQA 3VADA 4XCJA 2BTZA 1ZWHA 4CE3A 3B26A 4YKWA 2YGEA 4CWSA 1UYLA 4EGHA 2CCTA 1QZRA 1TC0A 1UYGA 1R62A 4BIZA 3EKOA 4U7OA 2YKJA 3HHUA 4QPKA 2Q8GA 2VCJA 4EM7A 2HKJA 3S5TA 3WHAA 3LPSA 4CWNA 4ZVIA 3G7EA 4ASAA 2XJGA 2XX4A 3Q5JA 1MX0A 3D0BA 3T10A 3TZ5A 3C11A 5GGZA 3TUHA 5CPHA 3K97A 4H7QA 4MB9A 2VWCA 4URNA 4BIUA 4EEHA 4KFGA 2BYHA 4O09A 4ZKIA 3BM9A 3G7BA 5C93A 4ASGA 2YEEA 3OPDA 2FWYA 4P8OA 4GGLA 3A0RA 3R91A 1B62A 4GT8A 3TTZA 5M4NA 2FXSA 2WI6A 3GIGA 3QDDA 2WERA 3LMMA 3CGZA 5D7CA 1GKZA 1YT0A 1JM6A 4FPPA 1I58A 3D2RA 4H81A 4LPBA 1BYQA 3QTFA 4MPCA 4LP0A 3A0WA 1UY8A 2XDLA 2IWSA 4R3MA 1I59A 2YE6A 4YKQA 3EHHA 2ZBKB 4O0BA 4GCZA 4L90A 2CGFA 1UYCA 2YEGA 4EMVA 1YT1A 3RLRA 2C1GA 1L0OA 1Z5AA 4KTNA 2Q8HA 2WEQA 1YERA 1AH6A 1OSFA 2PNRA 2XCMA 2XDXA 4Q20A 2BT0A 4AWOA 1Y8PA 2GFDA 1PVGA 2YKIA 4PU9A 1YS3A 1Z59A 1UY7A 4DZYA 5M4PA 4XKOA 4XTJA 2YGAA 5CF0A 3TZ4A 1TBWA 4V25A 1F51A 2YEFA 5J71A 1Y8NA 4YKRA 4LWIA 2QFOA 3PEHA 4L91A 4ASFA 1NHHA 4CWOA 4HY1A 4JAVA 1B63A 3INXA 3R4MA 2YI6A 2O1VA 3VHAA 1US7A 3B24A 3B27A 2XHXA 1GKXA 4HXZA 4HYPA 4FCPA 1YETA 2IWXA 3HZ1A 1U2OA 3SL2A 2CH4A 3O0IA 2H55A 1TILA 1AMWA 1AM1A 1NHIA 3TZ0A 1ZXNA 2HHIA 1YT2A 4MOTA 4EFUA 4UROA 1IXMA 2ESAA 4I5SA 1ZW9A 4AS9A 1Y8OA 3T0HA 5F5RA 3IEDA 2JJCA 3FT8A 4HZ5A 1B3QA 3OWBA 4E01A 2XABA 1BGQA 4URLA 4HY6A 2QG2A 3RLPA 3CYGA
chains in the Genus database with same CATH topology
1MU5A 1TIDA 1ZXMA 4HYMA 4B7PA 2YE7A 1KIJA 3ZXQA 2YI7A 3K99A 4JQLA 4XKAA 4CE1A 2XDKA 4XDMA 4MPNA 2GQPA 4BQJA 1I5AA 2VCIA 1I5CA 2EXLA 2H8MA 2FWZA 3U67A 3GIEA 2BSMA 3EHJA 3Q5LA 2ZDYA 4BQGA 2IOQA 2BYIA 3R92A 2YKEA 5M4EA 2BU7A 4PRXA 2CG9A 1QY8A 3LNUA 3O6OA 2XX2A 4HZ0A 5M4KA 4FCRA 4FCQA 1GJVA 2CCUA 3D36A 1EA6A 1H7UA 1Y4UA 2XJXA 4XD8A 4LWGA 2Q2EB 2YEIA 2QF6A 3EHFA 4BAEA 4MBCA 2XX5A 3CGYA 1Y4SA 5CTYA 1UYMA 1UYFA 4WUDA 2BU2A 2WI4A 2CCSA 4V26A 3EKRA 2K5BA 2YE8A 3BMYA 3A0ZA 3A0TA 2Q8IA 5D7DA 3HYYA 2ZDXA 3H80A 4QPJA 3ZKDA 1I5BA 2AKPA 1TC6A 3FT5A 1KZNA 4AWPA 1YC1A 3K60A 3U2KA 1QYEA 2IOPA 5D6PA 3EHGA 1S16A 5IN9A 2BRCA 5D6QA 2VW5A 3A0YA 1YC4A 2IORA 4K4OA 3T2SA 4EGKA 4MP7A 1UYDA 3INWA 2YK9A 2IWUA 4KQVA 2WI3A 4B6CA 3R4NA 2QG0A 3OW6A 3T1KA 5CTUA 5FNFA 4CWRA 4E02A 2XHTA 1ID0A 4R1FA 1U0ZA 4ASBA 4MPEA 4HXWA 5FNDA 4P7AA 4XCLA 4BXIA 2BU6A 4X9LA 2WEPA 4NH8A 2WI1A 4YKZA 1UY9A 3B25A 2O1UA 5M4MA 3OMUA 1BKNA 3B28A 3MNRP 4E00A 5BOCA 4JAUA 4O04A 2E0AA 1BXDA 4EFTA 1UYHA 2YEBA 3PEJA 1UYKA 4XITA 4O05A 4PL9A 4CE2A 3HZ5A 3WQ9A 3VHDA 3ZKBA 2XDUA 1NHJA 4XKKA 3ZM7A 2XD6A 2C2AA 3A0XA 4XC0A 3Q5KA 2YEAA 1UY6A 2YK2A 4NH7A 4EGIA 4YKUA 5BODA 4YKTA 2FYPA 4DUHA 5M4HA 3RKZA 4CWPA 1Z5BA 4CWTA 2JKIA 5CTWA 5IDMA 3OWDA 2YGFA 4O07A 4JASA 3C0EA 2XDSA 2HCHA 3RLQA 2YJXA 4XIQA 2BREA 1UYIA 1YESA 5L3JA 4WUBA 4LWHA 3DGEA 1THNA 1Z5CA 1I5DA 2XJJA 4GFNA 4FMTA 3CWVA 1YC3A 1TH8A 2XK2A 2ZKJA 5J6AA 3H4LA 3T0ZA 3ZXOA 2XHRA 3O2FA 2BU5A 4KP4A 3CRLA 2BU8A 4W7TA 3KE6A 2YE5A 3NMQA 3K98A 3R4OA 2BZ5A 5F3KA 1A4HA 3U2DA 4GQTA 4R3AA 4LWFA 4H85A 4YKXA 3VHCA 2YJWA 1YSZA 2YE4A 4KSGA 2WI5A 2YI0A 3GIFA 3CRKA 4MP2A 2YE2A 3GIGB 3FV5A 3HYZA 4YKYA 4XIPA 2HG1A 1UYEA 4URMA 2Q8FA 3R4PA 4L8ZA 2O1WA 4KSHA 2YE9A 3HEKA 4XIRA 2YKBA 4CWFA 4NH9A 5CTXA 4XE2A 1AH8A 2YECA 5FWKA 2YKCA 2YEHA 4GEEA 2WI7A 3JZ3A 4I3HA 1AJ6A 2UWDA 4WUCA 2YEDA 4U7NA 4LWEA 5IDJA 4L94A 5D7RA 4U93A 1EI1A 2WI2A 4AWQA 1YSRA 4PRVA 2YE3A 3G75A 4L93A 3TZ2A 1S14A 1H7SA 2YI5A 2YEJA 5FNCA 4CWQA 3VADA 4XCJA 2BTZA 1ZWHA 4CE3A 3B26A 4YKWA 2YGEA 4CWSA 1UYLA 4EGHA 2CCTA 1QZRA 1TC0A 1UYGA 1R62A 4BIZA 3EKOA 4U7OA 2YKJA 3HHUA 4QPKA 2Q8GA 2VCJA 4EM7A 2HKJA 3WHAA 3LPSA 4CWNA 4ZVIA 3G7EA 4ASAA 2XJGA 2XX4A 3Q5JA 1MX0A 3D0BA 3T10A 3TZ5A 3C11A 5GGZA 3TUHA 5CPHA 3K97A 4H7QA 4MB9A 2VWCA 4URNA 4BIUA 4EEHA 4KFGA 2BYHA 4O09A 4ZKIA 3BM9A 3G7BA 5C93A 4ASGA 2YEEA 3OPDA 2FWYA 4P8OA 4GGLA 3A0RA 3R91A 1B62A 4GT8A 3TTZA 5M4NA 2FXSA 2WI6A 3GIGA 3QDDA 2WERA 3CGZA 5D7CA 1GKZA 1YT0A 1JM6A 4FPPA 1I58A 3D2RA 4H81A 4LPBA 1BYQA 3QTFA 4MPCA 4LP0A 3A0WA 1UY8A 2XDLA 2IWSA 4R3MA 1I59A 2YE6A 4YKQA 3EHHA 2ZBKB 4O0BA 4GCZA 4L90A 2CGFA 1UYCA 2YEGA 4EMVA 1YT1A 3RLRA 1L0OA 1Z5AA 4KTNA 2Q8HA 2WEQA 1YERA 1AH6A 1OSFA 2PNRA 2XCMA 2XDXA 4Q20A 2BT0A 4AWOA 1Y8PA 2GFDA 1PVGA 2YKIA 4PU9A 1YS3A 1Z59A 1UY7A 4DZYA 5M4PA 4XKOA 4XTJA 2YGAA 5CF0A 3TZ4A 1TBWA 4V25A 2YEFA 5J71A 1Y8NA 4YKRA 4LWIA 2QFOA 3PEHA 4L91A 4ASFA 1NHHA 4CWOA 4HY1A 4JAVA 1B63A 3INXA 3R4MA 2YI6A 2O1VA 3VHAA 1US7A 3B24A 3B27A 2XHXA 1GKXA 4HXZA 4HYPA 4FCPA 1YETA 2IWXA 3HZ1A 1U2OA 3SL2A 2CH4A 3O0IA 2H55A 1TILA 1AMWA 1AM1A 1NHIA 3TZ0A 1ZXNA 1YT2A 4MOTA 4EFUA 4UROA 2ESAA 4I5SA 1ZW9A 4AS9A 1Y8OA 3T0HA 5F5RA 3IEDA 2JJCA 3FT8A 4HZ5A 1B3QA 3OWBA 4E01A 2XABA 1BGQA 4URLA 4HY6A 2QG2A 3RLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MU5 A;  1TID A;  1ZXM A;  4HYM A;  4B7P A;  2YE7 A;  1KIJ A;  3ZXQ A;  2YI7 A;  3K99 A;  4JQL A;  4XKA A;  4CE1 A;  2XDK A;  4XDM A;  4MPN A;  2GQP A;  4BQJ A;  1I5A A;  2VCI A;  1I5C A;  2EXL A;  2H8M A;  2FWZ A;  3U67 A;  3GIE A;  2BSM A;  3EHJ A;  3Q5L A;  2ZDY A;  4BQG A;  2IOQ A;  2BYI A;  3R92 A;  2YKE A;  5M4E A;  2BU7 A;  4PRX A;  2CG9 A;  1QY8 A;  3LNU A;  3O6O A;  2XX2 A;  4HZ0 A;  5M4K A;  4FCR A;  4FCQ A;  1GJV A;  2CCU A;  3D36 A;  1EA6 A;  1H7U A;  1Y4U A;  2XJX A;  4XD8 A;  4LWG A;  2Q2E B;  2YEI A;  2QF6 A;  3EHF A;  4BAE A;  4MBC A;  2XX5 A;  3CGY A;  1Y4S A;  5CTY A;  1UYM A;  1UYF A;  4WUD A;  2BU2 A;  2WI4 A;  2CCS A;  4V26 A;  3EKR A;  2K5B A;  2YE8 A;  3BMY A;  3A0Z A;  3A0T A;  2Q8I A;  5D7D A;  3HYY A;  2ZDX A;  3H80 A;  4QPJ A;  3ZKD A;  1I5B A;  2AKP A;  1TC6 A;  3FT5 A;  1KZN A;  4AWP A;  1YC1 A;  3K60 A;  3U2K A;  1QYE A;  2IOP A;  5D6P A;  3EHG A;  1S16 A;  5IN9 A;  2BRC A;  5D6Q A;  2VW5 A;  3A0Y A;  1YC4 A;  2IOR A;  4K4O A;  3T2S A;  4EGK A;  4MP7 A;  1UYD A;  3INW A;  2YK9 A;  2IWU A;  4KQV A;  2WI3 A;  4B6C A;  3R4N A;  2QG0 A;  3OW6 A;  3T1K A;  5CTU A;  5FNF A;  4CWR A;  4E02 A;  2XHT A;  1ID0 A;  4R1F A;  1U0Z A;  4ASB A;  4MPE A;  4HXW A;  5FND A;  4P7A A;  4XCL A;  4BXI A;  2BU6 A;  4X9L A;  2WEP A;  4NH8 A;  2WI1 A;  4YKZ A;  1UY9 A;  3B25 A;  2O1U A;  5M4M A;  3OMU A;  1BKN A;  3B28 A;  3MNR P;  4E00 A;  5BOC A;  4JAU A;  4O04 A;  2E0A A;  1BXD A;  4EFT A;  1UYH A;  2YEB A;  3PEJ A;  1UYK A;  4XIT A;  4O05 A;  4PL9 A;  4CE2 A;  3HZ5 A;  3WQ9 A;  3VHD A;  3ZKB A;  2XDU A;  1NHJ A;  4XKK A;  3ZM7 A;  2XD6 A;  2C2A A;  3A0X A;  4XC0 A;  3Q5K A;  2YEA A;  1UY6 A;  2YK2 A;  4NH7 A;  4EGI A;  4YKU A;  5BOD A;  4YKT A;  2FYP A;  4DUH A;  5M4H A;  3RKZ A;  4CWP A;  1Z5B A;  4CWT A;  2JKI A;  5CTW A;  5IDM A;  3OWD A;  2YGF A;  4O07 A;  4JAS A;  3C0E A;  2XDS A;  2HCH A;  3RLQ A;  2YJX A;  4XIQ A;  2BRE A;  1UYI A;  1YES A;  5L3J A;  4WUB A;  4LWH A;  3DGE A;  1THN A;  1Z5C A;  1I5D A;  2XJJ A;  4GFN A;  4FMT A;  3CWV A;  1YC3 A;  1TH8 A;  2XK2 A;  2ZKJ A;  5J6A A;  3H4L A;  3T0Z A;  3ZXO A;  2XHR A;  3O2F A;  2BU5 A;  4KP4 A;  3CRL A;  2BU8 A;  4W7T A;  3KE6 A;  2YE5 A;  3NMQ A;  3K98 A;  3R4O A;  2BZ5 A;  5F3K A;  1A4H A;  3U2D A;  4GQT A;  4R3A A;  4LWF A;  4H85 A;  4YKX A;  3VHC A;  2YJW A;  1YSZ A;  2YE4 A;  4KSG A;  2WI5 A;  2YI0 A;  3GIF A;  3CRK A;  4MP2 A;  2YE2 A;  3GIG B;  3FV5 A;  3HYZ A;  4YKY A;  4XIP A;  2HG1 A;  1UYE A;  4URM A;  2Q8F A;  3R4P A;  4L8Z A;  2O1W A;  4KSH A;  2YE9 A;  3HEK A;  4XIR A;  2YKB A;  4CWF A;  4NH9 A;  5CTX A;  4XE2 A;  1AH8 A;  2YEC A;  5FWK A;  2YKC A;  2YEH A;  4GEE A;  2WI7 A;  3JZ3 A;  4I3H A;  1AJ6 A;  2UWD A;  4WUC A;  2YED A;  4U7N A;  4LWE A;  5IDJ A;  4L94 A;  5D7R A;  4U93 A;  1EI1 A;  2WI2 A;  4AWQ A;  1YSR A;  4PRV A;  2YE3 A;  3G75 A;  4L93 A;  3TZ2 A;  1S14 A;  1H7S A;  2YI5 A;  2YEJ A;  5FNC A;  4CWQ A;  3VAD A;  4XCJ A;  2BTZ A;  1ZWH A;  4CE3 A;  3B26 A;  4YKW A;  2YGE A;  4CWS A;  1UYL A;  4EGH A;  2CCT A;  1QZR A;  1TC0 A;  1UYG A;  1R62 A;  4BIZ A;  3EKO A;  4U7O A;  2YKJ A;  3HHU A;  4QPK A;  2Q8G A;  2VCJ A;  4EM7 A;  2HKJ A;  3WHA A;  3LPS A;  4CWN A;  4ZVI A;  3G7E A;  4ASA A;  2XJG A;  2XX4 A;  3Q5J A;  1MX0 A;  3D0B A;  3T10 A;  3TZ5 A;  3C11 A;  5GGZ A;  3TUH A;  5CPH A;  3K97 A;  4H7Q A;  4MB9 A;  2VWC A;  4URN A;  4BIU A;  4EEH A;  4KFG A;  2BYH A;  4O09 A;  4ZKI A;  3BM9 A;  3G7B A;  5C93 A;  4ASG A;  2YEE A;  3OPD A;  2FWY A;  4P8O A;  4GGL A;  3A0R A;  3R91 A;  1B62 A;  4GT8 A;  3TTZ A;  5M4N A;  2FXS A;  2WI6 A;  3GIG A;  3QDD A;  2WER A;  3CGZ A;  5D7C A;  1GKZ A;  1YT0 A;  1JM6 A;  4FPP A;  1I58 A;  3D2R A;  4H81 A;  4LPB A;  1BYQ A;  3QTF A;  4MPC A;  4LP0 A;  3A0W A;  1UY8 A;  2XDL A;  2IWS A;  4R3M A;  1I59 A;  2YE6 A;  4YKQ A;  3EHH A;  2ZBK B;  4O0B A;  4GCZ A;  4L90 A;  2CGF A;  1UYC A;  2YEG A;  4EMV A;  1YT1 A;  3RLR A;  1L0O A;  1Z5A A;  4KTN A;  2Q8H A;  2WEQ A;  1YER A;  1AH6 A;  1OSF A;  2PNR A;  2XCM A;  2XDX A;  4Q20 A;  2BT0 A;  4AWO A;  1Y8P A;  2GFD A;  1PVG A;  2YKI A;  4PU9 A;  1YS3 A;  1Z59 A;  1UY7 A;  4DZY A;  5M4P A;  4XKO A;  4XTJ A;  2YGA A;  5CF0 A;  3TZ4 A;  1TBW A;  4V25 A;  2YEF A;  5J71 A;  1Y8N A;  4YKR A;  4LWI A;  2QFO A;  3PEH A;  4L91 A;  4ASF A;  1NHH A;  4CWO A;  4HY1 A;  4JAV A;  1B63 A;  3INX A;  3R4M A;  2YI6 A;  2O1V A;  3VHA A;  1US7 A;  3B24 A;  3B27 A;  2XHX A;  1GKX A;  4HXZ A;  4HYP A;  4FCP A;  1YET A;  2IWX A;  3HZ1 A;  1U2O A;  3SL2 A;  2CH4 A;  3O0I A;  2H55 A;  1TIL A;  1AMW A;  1AM1 A;  1NHI A;  3TZ0 A;  1ZXN A;  1YT2 A;  4MOT A;  4EFU A;  4URO A;  2ESA A;  4I5S A;  1ZW9 A;  4AS9 A;  1Y8O A;  3T0H A;  5F5R A;  3IED A;  2JJC A;  3FT8 A;  4HZ5 A;  1B3Q A;  3OWB A;  4E01 A;  2XAB A;  1BGQ A;  4URL A;  4HY6 A;  2QG2 A;  3RLP A; 
#chains in the Genus database with same CATH topology
 1MU5 A;  1TID A;  1ZXM A;  4HYM A;  4B7P A;  2YE7 A;  1KIJ A;  3ZXQ A;  2YI7 A;  3K99 A;  4JQL A;  4XKA A;  4CE1 A;  2XDK A;  4XDM A;  4MPN A;  2GQP A;  4BQJ A;  1I5A A;  2VCI A;  1I5C A;  2EXL A;  2H8M A;  2FWZ A;  3U67 A;  3GIE A;  2BSM A;  3EHJ A;  3Q5L A;  2ZDY A;  4BQG A;  2IOQ A;  2BYI A;  3R92 A;  2YKE A;  5M4E A;  2BU7 A;  4PRX A;  2CG9 A;  1QY8 A;  3LNU A;  3O6O A;  2XX2 A;  4HZ0 A;  5M4K A;  4FCR A;  4FCQ A;  1GJV A;  2CCU A;  3D36 A;  1EA6 A;  1H7U A;  1Y4U A;  2XJX A;  4XD8 A;  4LWG A;  2Q2E B;  2YEI A;  2QF6 A;  3EHF A;  4BAE A;  4MBC A;  2XX5 A;  3CGY A;  1Y4S A;  5CTY A;  1UYM A;  1UYF A;  4WUD A;  2BU2 A;  2WI4 A;  2CCS A;  4V26 A;  3EKR A;  2K5B A;  2YE8 A;  3BMY A;  3A0Z A;  3A0T A;  2Q8I A;  5D7D A;  3HYY A;  2ZDX A;  3H80 A;  4QPJ A;  3ZKD A;  1I5B A;  2AKP A;  1TC6 A;  3FT5 A;  1KZN A;  4AWP A;  1YC1 A;  3K60 A;  3U2K A;  1QYE A;  2IOP A;  5D6P A;  3EHG A;  1S16 A;  5IN9 A;  2BRC A;  5D6Q A;  2VW5 A;  3A0Y A;  1YC4 A;  2IOR A;  4K4O A;  3T2S A;  4E72 A;  4EGK A;  4MP7 A;  1UYD A;  3INW A;  2YK9 A;  2IWU A;  4KQV A;  2WI3 A;  4B6C A;  3R4N A;  2QG0 A;  3OW6 A;  3T1K A;  5CTU A;  5FNF A;  4CWR A;  4E02 A;  2XHT A;  1ID0 A;  4R1F A;  1U0Z A;  4ASB A;  4MPE A;  4HXW A;  5FND A;  4P7A A;  4XCL A;  4BXI A;  2BU6 A;  4X9L A;  2WEP A;  4NH8 A;  2WI1 A;  4YKZ A;  1UY9 A;  3B25 A;  2O1U A;  5M4M A;  3OMU A;  1BKN A;  3B28 A;  3MNR P;  4E00 A;  5BOC A;  4JAU A;  4O04 A;  2E0A A;  1BXD A;  4EFT A;  1UYH A;  2YEB A;  3PEJ A;  1UYK A;  4XIT A;  4O05 A;  4PL9 A;  4CE2 A;  3HZ5 A;  3WQ9 A;  3VHD A;  3ZKB A;  2XDU A;  1NHJ A;  4XKK A;  3ZM7 A;  2XD6 A;  2C2A A;  3A0X A;  4XC0 A;  3Q5K A;  2YEA A;  1UY6 A;  2YK2 A;  4NH7 A;  4EGI A;  4YKU A;  5BOD A;  4YKT A;  2FYP A;  4DUH A;  5M4H A;  3RKZ A;  4CWP A;  1Z5B A;  4CWT A;  2JKI A;  5CTW A;  5IDM A;  3OWD A;  2YGF A;  4O07 A;  4JAS A;  3C0E A;  2XDS A;  2HCH A;  3RLQ A;  2YJX A;  4XIQ A;  2BRE A;  1UYI A;  1YES A;  5L3J A;  4WUB A;  4LWH A;  3DGE A;  1THN A;  1Z5C A;  1I5D A;  2XJJ A;  4GFN A;  4FMT A;  3CWV A;  1YC3 A;  1TH8 A;  2XK2 A;  2ZKJ A;  5J6A A;  3H4L A;  3T0Z A;  3ZXO A;  2XHR A;  3O2F A;  2BU5 A;  4KP4 A;  3CRL A;  2BU8 A;  4W7T A;  3KE6 A;  2YE5 A;  3NMQ A;  3K98 A;  3R4O A;  2BZ5 A;  5F3K A;  1A4H A;  3U2D A;  4GQT A;  4R3A A;  4LWF A;  5JEN A;  4H85 A;  4YKX A;  3VHC A;  2YJW A;  1YSZ A;  2YE4 A;  4KSG A;  2WI5 A;  2YI0 A;  3GIF A;  3CRK A;  4MP2 A;  2YE2 A;  3GIG B;  3FV5 A;  3HYZ A;  4YKY A;  4XIP A;  2HG1 A;  1UYE A;  4URM A;  2Q8F A;  3R4P A;  4L8Z A;  2O1W A;  4KSH A;  2YE9 A;  3HEK A;  4XIR A;  2YKB A;  4CWF A;  4NH9 A;  5CTX A;  4XE2 A;  1AH8 A;  2YEC A;  5FWK A;  2YKC A;  2YEH A;  4GEE A;  2WI7 A;  3JZ3 A;  4I3H A;  1AJ6 A;  2UWD A;  4WUC A;  2YED A;  4U7N A;  4LWE A;  5IDJ A;  4L94 A;  5D7R A;  4U93 A;  1EI1 A;  2WI2 A;  4AWQ A;  1YSR A;  4PRV A;  2YE3 A;  3G75 A;  4L93 A;  2FTK A;  3TZ2 A;  1S14 A;  2C1I A;  1H7S A;  2YI5 A;  2YEJ A;  5FNC A;  4CWQ A;  3VAD A;  4XCJ A;  2BTZ A;  1ZWH A;  4CE3 A;  3B26 A;  4YKW A;  2YGE A;  4CWS A;  1UYL A;  4EGH A;  2CCT A;  1QZR A;  1TC0 A;  1UYG A;  1R62 A;  4BIZ A;  3EKO A;  4U7O A;  2YKJ A;  3HHU A;  4QPK A;  2Q8G A;  2VCJ A;  4EM7 A;  2HKJ A;  3S5T A;  3WHA A;  3LPS A;  4CWN A;  4ZVI A;  3G7E A;  4ASA A;  2XJG A;  2XX4 A;  3Q5J A;  1MX0 A;  3D0B A;  3T10 A;  3TZ5 A;  3C11 A;  5GGZ A;  3TUH A;  5CPH A;  3K97 A;  4H7Q A;  4MB9 A;  2VWC A;  4URN A;  4BIU A;  4EEH A;  4KFG A;  2BYH A;  4O09 A;  4ZKI A;  3BM9 A;  3G7B A;  5C93 A;  4ASG A;  2YEE A;  3OPD A;  2FWY A;  4P8O A;  4GGL A;  3A0R A;  3R91 A;  1B62 A;  4GT8 A;  3TTZ A;  5M4N A;  2FXS A;  2WI6 A;  3GIG A;  3QDD A;  2WER A;  3LMM A;  3CGZ A;  5D7C A;  1GKZ A;  1YT0 A;  1JM6 A;  4FPP A;  1I58 A;  3D2R A;  4H81 A;  4LPB A;  1BYQ A;  3QTF A;  4MPC A;  4LP0 A;  3A0W A;  1UY8 A;  2XDL A;  2IWS A;  4R3M A;  1I59 A;  2YE6 A;  4YKQ A;  3EHH A;  2ZBK B;  4O0B A;  4GCZ A;  4L90 A;  2CGF A;  1UYC A;  2YEG A;  4EMV A;  1YT1 A;  3RLR A;  2C1G A;  1L0O A;  1Z5A A;  4KTN A;  2Q8H A;  2WEQ A;  1YER A;  1AH6 A;  1OSF A;  2PNR A;  2XCM A;  2XDX A;  4Q20 A;  2BT0 A;  4AWO A;  1Y8P A;  2GFD A;  1PVG A;  2YKI A;  4PU9 A;  1YS3 A;  1Z59 A;  1UY7 A;  4DZY A;  5M4P A;  4XKO A;  4XTJ A;  2YGA A;  5CF0 A;  3TZ4 A;  1TBW A;  4V25 A;  1F51 A;  2YEF A;  5J71 A;  1Y8N A;  4YKR A;  4LWI A;  2QFO A;  3PEH A;  4L91 A;  4ASF A;  1NHH A;  4CWO A;  4HY1 A;  4JAV A;  1B63 A;  3INX A;  3R4M A;  2YI6 A;  2O1V A;  3VHA A;  1US7 A;  3B24 A;  3B27 A;  2XHX A;  1GKX A;  4HXZ A;  4HYP A;  4FCP A;  1YET A;  2IWX A;  3HZ1 A;  1U2O A;  3SL2 A;  2CH4 A;  3O0I A;  2H55 A;  1TIL A;  1AMW A;  1AM1 A;  1NHI A;  3TZ0 A;  1ZXN A;  2HHI A;  1YT2 A;  4MOT A;  4EFU A;  4URO A;  1IXM A;  2ESA A;  4I5S A;  1ZW9 A;  4AS9 A;  1Y8O A;  3T0H A;  5F5R A;  3IED A;  2JJC A;  3FT8 A;  4HZ5 A;  1B3Q A;  3OWB A;  4E01 A;  2XAB A;  1BGQ A;  4URL A;  4HY6 A;  2QG2 A;  3RLP A;  3CYG A; 
#chains in the Genus database with same CATH homology
 1MU5 A;  1TID A;  1ZXM A;  4HYM A;  4B7P A;  2YE7 A;  1KIJ A;  3ZXQ A;  2YI7 A;  3K99 A;  4JQL A;  4XKA A;  4CE1 A;  2XDK A;  4XDM A;  4MPN A;  2GQP A;  4BQJ A;  1I5A A;  2VCI A;  1I5C A;  2EXL A;  2H8M A;  2FWZ A;  3U67 A;  3GIE A;  2BSM A;  3EHJ A;  3Q5L A;  2ZDY A;  4BQG A;  2IOQ A;  2BYI A;  3R92 A;  2YKE A;  5M4E A;  2BU7 A;  4PRX A;  2CG9 A;  1QY8 A;  3LNU A;  3O6O A;  2XX2 A;  4HZ0 A;  5M4K A;  4FCR A;  4FCQ A;  1GJV A;  2CCU A;  3D36 A;  1EA6 A;  1H7U A;  1Y4U A;  2XJX A;  4XD8 A;  4LWG A;  2Q2E B;  2YEI A;  2QF6 A;  3EHF A;  4BAE A;  4MBC A;  2XX5 A;  3CGY A;  1Y4S A;  5CTY A;  1UYM A;  1UYF A;  4WUD A;  2BU2 A;  2WI4 A;  2CCS A;  4V26 A;  3EKR A;  2K5B A;  2YE8 A;  3BMY A;  3A0Z A;  3A0T A;  2Q8I A;  5D7D A;  3HYY A;  2ZDX A;  3H80 A;  4QPJ A;  3ZKD A;  1I5B A;  2AKP A;  1TC6 A;  3FT5 A;  1KZN A;  4AWP A;  1YC1 A;  3K60 A;  3U2K A;  1QYE A;  2IOP A;  5D6P A;  3EHG A;  1S16 A;  5IN9 A;  2BRC A;  5D6Q A;  2VW5 A;  3A0Y A;  1YC4 A;  2IOR A;  4K4O A;  3T2S A;  4EGK A;  4MP7 A;  1UYD A;  3INW A;  2YK9 A;  2IWU A;  4KQV A;  2WI3 A;  4B6C A;  3R4N A;  2QG0 A;  3OW6 A;  3T1K A;  5CTU A;  5FNF A;  4CWR A;  4E02 A;  2XHT A;  1ID0 A;  4R1F A;  1U0Z A;  4ASB A;  4MPE A;  4HXW A;  5FND A;  4P7A A;  4XCL A;  4BXI A;  2BU6 A;  4X9L A;  2WEP A;  4NH8 A;  2WI1 A;  4YKZ A;  1UY9 A;  3B25 A;  2O1U A;  5M4M A;  3OMU A;  1BKN A;  3B28 A;  3MNR P;  4E00 A;  5BOC A;  4JAU A;  4O04 A;  2E0A A;  1BXD A;  4EFT A;  1UYH A;  2YEB A;  3PEJ A;  1UYK A;  4XIT A;  4O05 A;  4PL9 A;  4CE2 A;  3HZ5 A;  3WQ9 A;  3VHD A;  3ZKB A;  2XDU A;  1NHJ A;  4XKK A;  3ZM7 A;  2XD6 A;  2C2A A;  3A0X A;  4XC0 A;  3Q5K A;  2YEA A;  1UY6 A;  2YK2 A;  4NH7 A;  4EGI A;  4YKU A;  5BOD A;  4YKT A;  2FYP A;  4DUH A;  5M4H A;  3RKZ A;  4CWP A;  1Z5B A;  4CWT A;  2JKI A;  5CTW A;  5IDM A;  3OWD A;  2YGF A;  4O07 A;  4JAS A;  3C0E A;  2XDS A;  2HCH A;  3RLQ A;  2YJX A;  4XIQ A;  2BRE A;  1UYI A;  1YES A;  5L3J A;  4WUB A;  4LWH A;  3DGE A;  1THN A;  1Z5C A;  1I5D A;  2XJJ A;  4GFN A;  4FMT A;  3CWV A;  1YC3 A;  1TH8 A;  2XK2 A;  2ZKJ A;  5J6A A;  3H4L A;  3T0Z A;  3ZXO A;  2XHR A;  3O2F A;  2BU5 A;  4KP4 A;  3CRL A;  2BU8 A;  4W7T A;  3KE6 A;  2YE5 A;  3NMQ A;  3K98 A;  3R4O A;  2BZ5 A;  5F3K A;  1A4H A;  3U2D A;  4GQT A;  4R3A A;  4LWF A;  4H85 A;  4YKX A;  3VHC A;  2YJW A;  1YSZ A;  2YE4 A;  4KSG A;  2WI5 A;  2YI0 A;  3GIF A;  3CRK A;  4MP2 A;  2YE2 A;  3GIG B;  3FV5 A;  3HYZ A;  4YKY A;  4XIP A;  2HG1 A;  1UYE A;  4URM A;  2Q8F A;  3R4P A;  4L8Z A;  2O1W A;  4KSH A;  2YE9 A;  3HEK A;  4XIR A;  2YKB A;  4CWF A;  4NH9 A;  5CTX A;  4XE2 A;  1AH8 A;  2YEC A;  5FWK A;  2YKC A;  2YEH A;  4GEE A;  2WI7 A;  3JZ3 A;  4I3H A;  1AJ6 A;  2UWD A;  4WUC A;  2YED A;  4U7N A;  4LWE A;  5IDJ A;  4L94 A;  5D7R A;  4U93 A;  1EI1 A;  2WI2 A;  4AWQ A;  1YSR A;  4PRV A;  2YE3 A;  3G75 A;  4L93 A;  3TZ2 A;  1S14 A;  1H7S A;  2YI5 A;  2YEJ A;  5FNC A;  4CWQ A;  3VAD A;  4XCJ A;  2BTZ A;  1ZWH A;  4CE3 A;  3B26 A;  4YKW A;  2YGE A;  4CWS A;  1UYL A;  4EGH A;  2CCT A;  1QZR A;  1TC0 A;  1UYG A;  1R62 A;  4BIZ A;  3EKO A;  4U7O A;  2YKJ A;  3HHU A;  4QPK A;  2Q8G A;  2VCJ A;  4EM7 A;  2HKJ A;  3WHA A;  3LPS A;  4CWN A;  4ZVI A;  3G7E A;  4ASA A;  2XJG A;  2XX4 A;  3Q5J A;  1MX0 A;  3D0B A;  3T10 A;  3TZ5 A;  3C11 A;  5GGZ A;  3TUH A;  5CPH A;  3K97 A;  4H7Q A;  4MB9 A;  2VWC A;  4URN A;  4BIU A;  4EEH A;  4KFG A;  2BYH A;  4O09 A;  4ZKI A;  3BM9 A;  3G7B A;  5C93 A;  4ASG A;  2YEE A;  3OPD A;  2FWY A;  4P8O A;  4GGL A;  3A0R A;  3R91 A;  1B62 A;  4GT8 A;  3TTZ A;  5M4N A;  2FXS A;  2WI6 A;  3GIG A;  3QDD A;  2WER A;  3CGZ A;  5D7C A;  1GKZ A;  1YT0 A;  1JM6 A;  4FPP A;  1I58 A;  3D2R A;  4H81 A;  4LPB A;  1BYQ A;  3QTF A;  4MPC A;  4LP0 A;  3A0W A;  1UY8 A;  2XDL A;  2IWS A;  4R3M A;  1I59 A;  2YE6 A;  4YKQ A;  3EHH A;  2ZBK B;  4O0B A;  4GCZ A;  4L90 A;  2CGF A;  1UYC A;  2YEG A;  4EMV A;  1YT1 A;  3RLR A;  1L0O A;  1Z5A A;  4KTN A;  2Q8H A;  2WEQ A;  1YER A;  1AH6 A;  1OSF A;  2PNR A;  2XCM A;  2XDX A;  4Q20 A;  2BT0 A;  4AWO A;  1Y8P A;  2GFD A;  1PVG A;  2YKI A;  4PU9 A;  1YS3 A;  1Z59 A;  1UY7 A;  4DZY A;  5M4P A;  4XKO A;  4XTJ A;  2YGA A;  5CF0 A;  3TZ4 A;  1TBW A;  4V25 A;  2YEF A;  5J71 A;  1Y8N A;  4YKR A;  4LWI A;  2QFO A;  3PEH A;  4L91 A;  4ASF A;  1NHH A;  4CWO A;  4HY1 A;  4JAV A;  1B63 A;  3INX A;  3R4M A;  2YI6 A;  2O1V A;  3VHA A;  1US7 A;  3B24 A;  3B27 A;  2XHX A;  1GKX A;  4HXZ A;  4HYP A;  4FCP A;  1YET A;  2IWX A;  3HZ1 A;  1U2O A;  3SL2 A;  2CH4 A;  3O0I A;  2H55 A;  1TIL A;  1AMW A;  1AM1 A;  1NHI A;  3TZ0 A;  1ZXN A;  1YT2 A;  4MOT A;  4EFU A;  4URO A;  2ESA A;  4I5S A;  1ZW9 A;  4AS9 A;  1Y8O A;  3T0H A;  5F5R A;  3IED A;  2JJC A;  3FT8 A;  4HZ5 A;  1B3Q A;  3OWB A;  4E01 A;  2XAB A;  1BGQ A;  4URL A;  4HY6 A;  2QG2 A;  3RLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...