5CTWA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5ctwA00
1UYIA 2FWZA 4E01A 2Q8GA 1UYLA 4CWSA 5CTYA 1YERA 3INXA 2HKJA 1Z5AA 2YE2A 4ASBA 2XX4A 3K60A 1R62A 4WUBA 4CE1A 2CG9A 4PU9A 3CGZA 3T0ZA 5CF0A 3MNRP 4CWOA 4MPNA 5J6AA 5IN9A 2XHRA 3CGYA 5FNCA 1ZW9A 4XE2A 4B7PA 3QTFA 4XTJA 4BIUA 2WI7A 4CE3A 1YT1A 3CRKA 1YETA 4I5SA 2QF6A 3ZXOA 2WI4A 4ZKIA 1TILA 1AH8A 1TBWA 3FT8A 3R4PA 3HZ5A 4XITA 4BQGA 3R4MA 4KSGA 5D6QA 4GFNA 4H85A 3VHDA 3A0WA 4JAVA 4HXZA 3T2SA 3H80A 1UYMA 1Z5BA 4MPEA 2QG0A 1TC6A 5M4KA 3EHJA 2IOQA 2YKCA 1YC4A 3OMUA 2XK2A 4JQLA 5IDMA 2BU2A 4LWHA 1GKXA 2Q8HA 1I5DA 3GIEA 3EKRA 4KQVA 5M4MA 3HZ1A 2HG1A 4PL9A 4EFUA 3A0XA 3EHFA 1U0ZA 3R91A 2CCSA 3RLRA 5D6PA 2C2AA 4EGKA 5C93A 4KTNA 4LPBA 3VADA 4ASAA 3R4NA 4R3MA 4P8OA 4AWOA 2YEEA 1BYQA 1QYEA 3K99A 3RLQA 4YKQA 5IDJA 2YJXA 4YKTA 5F3KA 3Q5JA 4EFTA 2FXSA 3LNUA 1Y4SA 1ZWHA 4MP7A 1EI1A 2YI6A 3H4LA 1I58A 3B28A 1I5BA 2XJJA 4YKWA 3D2RA 1GKZA 3R4OA 5CTXA 3QDDA 1YS3A 2YEJA 4GT8A 1NHHA 3GIGB 4QPJA 3EKOA 2QFOA 2BSMA 5FNDA 4MPCA 4PRXA 2YKEA 2ZDXA 4O09A 1BXDA 3TUHA 3PEJA 2YE6A 1UYDA 2Q8FA 4I3HA 2XJGA 3O2FA 1UYCA 1UYKA 3EHGA 4BAEA 4HY6A 2IORA 2YEAA 1MU5A 2QG2A 1QY8A 3OPDA 2WERA 4R1FA 4UROA 4XKKA 4HZ0A 5CTWA 4YKZA 2CGFA 1AH6A 1AM1A 4DUHA 3CRLA 4JAUA 2WI3A 2BU7A 4XIPA 2YKIA 5D7CA 2BU8A 2YEBA 4ASFA 2XJXA 4NH7A 2XHXA 3BM9A 4LP0A 2YKJA 2YI7A 1UYHA 3PEHA 3Q5LA 2H55A 4MOTA 2YGEA 1S14A 2EXLA 3VHCA 4U7OA 2IWUA 2YE3A 2BU5A 2XDSA 4L94A 3T1KA 2WI1A 2BYIA 2ESAA 4H7QA 4L8ZA 3EHHA 2YGAA 3TZ2A 4EMVA 3JZ3A 4MP2A 1TH8A 4EGHA 3ZKDA 3A0ZA 3HHUA 1Y4UA 5CTUA 4XDMA 4LWGA 4EGIA 4L91A 1B63A 1YSRA 3TTZA 4E02A 3B25A 5M4PA 4YKYA 2BTZA 4V25A 2XX5A 4U7NA 3O6OA 4O04A 1Z5CA 1UY7A 5D7DA 1TIDA 2PNRA 3WHAA 4GCZA 4CWQA 2XHTA 3D0BA 1GJVA 4XIQA 2WI5A 1L0OA 4BIZA 2YEHA 3OWBA 2JJCA 2WI6A 3A0YA 1YSZA 4P7AA 1Y8OA 2VCJA 2YGFA 4ZVIA 4XKAA 1AJ6A 4FMTA 4Q20A 5F5RA 2YK2A 3K98A 1TC0A 3WQ9A 3TZ5A 1H7SA 4XKOA 2XABA 2BU6A 4O05A 3ZKBA 1UY8A 4URNA 2BZ5A 2YEDA 4YKRA 3CWVA 1YC1A 3B24A 2XD6A 4X9LA 3GIGA 2HCHA 4YKUA 2XDLA 5GGZA 3LPSA 3NMQA 3OW6A 3RKZA 2K5BA 1BKNA 5M4HA 3SL2A 2O1UA 3TZ0A 3RLPA 4JASA 2YE5A 5CPHA 5J71A 5BOCA 1I59A 3VHAA 2BYHA 3ZM7A 4U93A 4XCLA 4LWIA 1UY9A 4O0BA 4WUCA 4V26A 2IWXA 1S16A 5M4EA 4XC0A 4LWEA 2BT0A 4XD8A 2YE4A 2CCUA 3IEDA 4MB9A 4CWNA 4HYPA 3BMYA 1ID0A 3D36A 5FWKA 4HYMA 4DZYA 2Q8IA 2AKPA 1NHJA 1I5CA 4L90A 4FCQA 4B6CA 3U2KA 4CWPA 2VCIA 2O1WA 1AMWA 3DGEA 2E0AA 2FWYA 2GFDA 1JM6A 1H7UA 3U2DA 4PRVA 5D7RA 2YEGA 2O1VA 3GIFA 4LWFA 2BREA 4EM7A 3OWDA 4FCPA 2IOPA 3K97A 2CH4A 2YI0A 2VW5A 1NHIA 4QPKA 1QZRA 4BQJA 4O07A 2VWCA 3G7BA 3T10A 4ASGA 1BGQA 2YI5A 4URLA 1Z59A 2GQPA 4KP4A 1PVGA 2JKIA 4KFGA 2BRCA 2WEQA 1UYEA 1UYFA 3TZ4A 4HY1A 1YC3A 3HYYA 3O0IA 2YKBA 1A4HA 1OSFA 4HXWA 1YT2A 3G7EA 3ZXQA 2YJWA 1YESA 1UYGA 2WI2A 4AS9A 4AWQA 2YE8A 5M4NA 2XCMA 1MX0A 4YKXA 3C11A 4GGLA 3FV5A 2XDKA 1I5AA 2FYPA 1B62A 5L3JA 1THNA 2IWSA 2XX2A 4HZ5A 4NH8A 3U67A 1U2OA 1US7A 4GEEA 3R92A 4AWPA 1Y8PA 1ZXMA 1KIJA 2YK9A 3G75A 4H81A 2YEFA 4K4OA 3T0HA 1ZXNA 2H8MA 3A0TA 1KZNA 4MBCA 2CCTA 4FCRA 3HEKA 2ZBKB 4FPPA 4EEHA 1EA6A 4URMA 2YEIA 5BODA 4WUDA 4W7TA 3KE6A 2ZKJA 3Q5KA 4BXIA 1UY6A 5FNFA 4XCJA 4CWFA 1YT0A 2YE9A 4E00A 3INWA 4R3AA 3B26A 4XIRA 3FT5A 3HYZA 1B3QA 3C0EA 1Y8NA 2YECA 4CWTA 4NH9A 2ZDYA 4L93A 2YE7A 4CWRA 2XDXA 2Q2EB 2UWDA 2XDUA 4GQTA 4KSHA 4CE2A 3B27A 3A0RA 2WEPA
chains in the Genus database with same CATH superfamily
1UYIA 2FWZA 4E01A 2Q8GA 1UYLA 4CWSA 5CTYA 1YERA 3INXA 2HKJA 1Z5AA 2YE2A 4ASBA 2XX4A 3K60A 1R62A 4WUBA 4CE1A 2CG9A 4PU9A 3CGZA 3T0ZA 5CF0A 3MNRP 4CWOA 4MPNA 5J6AA 5IN9A 2XHRA 3CGYA 5FNCA 1ZW9A 4XE2A 4B7PA 3QTFA 4XTJA 4BIUA 2WI7A 4CE3A 1YT1A 3CRKA 1YETA 4I5SA 2QF6A 3ZXOA 2WI4A 4ZKIA 1TILA 1AH8A 1TBWA 3FT8A 3R4PA 3HZ5A 4XITA 4BQGA 3R4MA 4KSGA 5D6QA 4GFNA 4H85A 3VHDA 3A0WA 4JAVA 4HXZA 3T2SA 3H80A 1UYMA 1Z5BA 4MPEA 2QG0A 1TC6A 5M4KA 3EHJA 2IOQA 2YKCA 1YC4A 3OMUA 2XK2A 4JQLA 5IDMA 2BU2A 4LWHA 1GKXA 2Q8HA 1I5DA 3GIEA 3EKRA 4KQVA 5M4MA 3HZ1A 2HG1A 4PL9A 4EFUA 3A0XA 3EHFA 1U0ZA 3R91A 2CCSA 3RLRA 5D6PA 2C2AA 4EGKA 5C93A 4KTNA 4LPBA 3VADA 4ASAA 3R4NA 4R3MA 4P8OA 4AWOA 2YEEA 1BYQA 1QYEA 3K99A 3RLQA 4YKQA 5IDJA 2YJXA 4YKTA 5F3KA 3Q5JA 4EFTA 2FXSA 3LNUA 1Y4SA 1ZWHA 4MP7A 1EI1A 2YI6A 3H4LA 1I58A 3B28A 1I5BA 2XJJA 4YKWA 3D2RA 1GKZA 3R4OA 5CTXA 3QDDA 1YS3A 2HHIA 2YEJA 4GT8A 1NHHA 3GIGB 4QPJA 3EKOA 2QFOA 2BSMA 5FNDA 4MPCA 4PRXA 2YKEA 2ZDXA 4O09A 1BXDA 3TUHA 3PEJA 1IXMA 2YE6A 1UYDA 2Q8FA 4I3HA 2XJGA 3CYGA 3O2FA 1UYCA 1UYKA 3EHGA 4BAEA 2C1IA 4HY6A 2IORA 2YEAA 1MU5A 2QG2A 1QY8A 3OPDA 2WERA 4R1FA 4UROA 4XKKA 4HZ0A 5CTWA 4YKZA 2CGFA 1AH6A 1AM1A 4DUHA 3CRLA 4JAUA 2WI3A 2BU7A 4XIPA 2YKIA 5D7CA 2BU8A 2YEBA 4ASFA 2XJXA 4NH7A 2XHXA 3BM9A 4LP0A 2YKJA 2YI7A 1UYHA 3PEHA 3Q5LA 2H55A 4MOTA 2YGEA 1S14A 2EXLA 3VHCA 4U7OA 2IWUA 2YE3A 2BU5A 2XDSA 4L94A 3T1KA 2WI1A 3LMMA 2BYIA 2ESAA 4H7QA 4L8ZA 3EHHA 2YGAA 3TZ2A 4EMVA 3JZ3A 4MP2A 1TH8A 4EGHA 3ZKDA 3A0ZA 3HHUA 1Y4UA 5CTUA 4XDMA 4LWGA 4EGIA 4L91A 1B63A 1YSRA 3TTZA 4E02A 3B25A 5M4PA 4YKYA 2BTZA 4V25A 2XX5A 4U7NA 3O6OA 4O04A 1Z5CA 1UY7A 5D7DA 1TIDA 2PNRA 3WHAA 4GCZA 4CWQA 2XHTA 3D0BA 1GJVA 4XIQA 2WI5A 1L0OA 4BIZA 2YEHA 3OWBA 2JJCA 2WI6A 3A0YA 1YSZA 4P7AA 1Y8OA 2VCJA 2YGFA 4ZVIA 4XKAA 1AJ6A 4FMTA 4Q20A 5F5RA 2YK2A 3K98A 1TC0A 3WQ9A 3TZ5A 1H7SA 4XKOA 2XABA 2BU6A 4O05A 3ZKBA 1UY8A 4URNA 2BZ5A 2YEDA 4YKRA 3CWVA 1YC1A 3B24A 2XD6A 4X9LA 3GIGA 2HCHA 4YKUA 2XDLA 5GGZA 3LPSA 3NMQA 3OW6A 3RKZA 2K5BA 1BKNA 5M4HA 3SL2A 2O1UA 3TZ0A 3RLPA 4JASA 2YE5A 5CPHA 5J71A 5BOCA 1I59A 3VHAA 2BYHA 3ZM7A 4U93A 4XCLA 4LWIA 1UY9A 4O0BA 4WUCA 4V26A 2IWXA 1S16A 5M4EA 4XC0A 4LWEA 2BT0A 4XD8A 2YE4A 2CCUA 3IEDA 4MB9A 4CWNA 4HYPA 3BMYA 1ID0A 3D36A 5FWKA 4HYMA 4DZYA 2Q8IA 2AKPA 1NHJA 1I5CA 4L90A 3S5TA 4FCQA 4B6CA 3U2KA 4CWPA 2VCIA 2O1WA 1AMWA 3DGEA 2E0AA 2FWYA 2GFDA 1JM6A 1H7UA 3U2DA 4PRVA 5D7RA 2YEGA 2O1VA 3GIFA 4LWFA 2BREA 4EM7A 2FTKA 3OWDA 4FCPA 2IOPA 3K97A 2CH4A 2YI0A 2VW5A 1NHIA 4QPKA 1QZRA 4BQJA 4O07A 2VWCA 2C1GA 3G7BA 3T10A 4ASGA 1BGQA 2YI5A 4URLA 1Z59A 2GQPA 4KP4A 1PVGA 2JKIA 4KFGA 2BRCA 2WEQA 1UYEA 1UYFA 3TZ4A 4HY1A 1YC3A 3HYYA 3O0IA 2YKBA 1A4HA 1OSFA 4HXWA 1YT2A 3G7EA 3ZXQA 2YJWA 1YESA 1UYGA 2WI2A 4AS9A 4AWQA 2YE8A 5M4NA 2XCMA 1F51A 1MX0A 4YKXA 3C11A 4GGLA 3FV5A 2XDKA 1I5AA 2FYPA 5JENA 1B62A 5L3JA 1THNA 2IWSA 2XX2A 4HZ5A 4NH8A 3U67A 1U2OA 1US7A 4GEEA 3R92A 4AWPA 1Y8PA 1ZXMA 1KIJA 2YK9A 3G75A 4H81A 2YEFA 4K4OA 3T0HA 1ZXNA 2H8MA 3A0TA 1KZNA 4MBCA 2CCTA 4FCRA 3HEKA 2ZBKB 4FPPA 4EEHA 1EA6A 4URMA 2YEIA 5BODA 4WUDA 4W7TA 3KE6A 4E72A 2ZKJA 3Q5KA 4BXIA 1UY6A 5FNFA 4XCJA 4CWFA 1YT0A 2YE9A 4E00A 3INWA 4R3AA 3B26A 4XIRA 3FT5A 3HYZA 1B3QA 3C0EA 1Y8NA 2YECA 4CWTA 4NH9A 2ZDYA 4L93A 2YE7A 4CWRA 2XDXA 2Q2EB 2UWDA 2XDUA 4GQTA 4KSHA 4CE2A 3B27A 3A0RA 2WEPA
chains in the Genus database with same CATH topology
1UYIA 2FWZA 4E01A 2Q8GA 1UYLA 4CWSA 5CTYA 1YERA 3INXA 2HKJA 1Z5AA 2YE2A 4ASBA 2XX4A 3K60A 1R62A 4WUBA 4CE1A 2CG9A 4PU9A 3CGZA 3T0ZA 5CF0A 3MNRP 4CWOA 4MPNA 5J6AA 5IN9A 2XHRA 3CGYA 5FNCA 1ZW9A 4XE2A 4B7PA 3QTFA 4XTJA 4BIUA 2WI7A 4CE3A 1YT1A 3CRKA 1YETA 4I5SA 2QF6A 3ZXOA 2WI4A 4ZKIA 1TILA 1AH8A 1TBWA 3FT8A 3R4PA 3HZ5A 4XITA 4BQGA 3R4MA 4KSGA 5D6QA 4GFNA 4H85A 3VHDA 3A0WA 4JAVA 4HXZA 3T2SA 3H80A 1UYMA 1Z5BA 4MPEA 2QG0A 1TC6A 5M4KA 3EHJA 2IOQA 2YKCA 1YC4A 3OMUA 2XK2A 4JQLA 5IDMA 2BU2A 4LWHA 1GKXA 2Q8HA 1I5DA 3GIEA 3EKRA 4KQVA 5M4MA 3HZ1A 2HG1A 4PL9A 4EFUA 3A0XA 3EHFA 1U0ZA 3R91A 2CCSA 3RLRA 5D6PA 2C2AA 4EGKA 5C93A 4KTNA 4LPBA 3VADA 4ASAA 3R4NA 4R3MA 4P8OA 4AWOA 2YEEA 1BYQA 1QYEA 3K99A 3RLQA 4YKQA 5IDJA 2YJXA 4YKTA 5F3KA 3Q5JA 4EFTA 2FXSA 3LNUA 1Y4SA 1ZWHA 4MP7A 1EI1A 2YI6A 3H4LA 1I58A 3B28A 1I5BA 2XJJA 4YKWA 3D2RA 1GKZA 3R4OA 5CTXA 3QDDA 1YS3A 2YEJA 4GT8A 1NHHA 3GIGB 4QPJA 3EKOA 2QFOA 2BSMA 5FNDA 4MPCA 4PRXA 2YKEA 2ZDXA 4O09A 1BXDA 3TUHA 3PEJA 2YE6A 1UYDA 2Q8FA 4I3HA 2XJGA 3O2FA 1UYCA 1UYKA 3EHGA 4BAEA 4HY6A 2IORA 2YEAA 1MU5A 2QG2A 1QY8A 3OPDA 2WERA 4R1FA 4UROA 4XKKA 4HZ0A 5CTWA 4YKZA 2CGFA 1AH6A 1AM1A 4DUHA 3CRLA 4JAUA 2WI3A 2BU7A 4XIPA 2YKIA 5D7CA 2BU8A 2YEBA 4ASFA 2XJXA 4NH7A 2XHXA 3BM9A 4LP0A 2YKJA 2YI7A 1UYHA 3PEHA 3Q5LA 2H55A 4MOTA 2YGEA 1S14A 2EXLA 3VHCA 4U7OA 2IWUA 2YE3A 2BU5A 2XDSA 4L94A 3T1KA 2WI1A 2BYIA 2ESAA 4H7QA 4L8ZA 3EHHA 2YGAA 3TZ2A 4EMVA 3JZ3A 4MP2A 1TH8A 4EGHA 3ZKDA 3A0ZA 3HHUA 1Y4UA 5CTUA 4XDMA 4LWGA 4EGIA 4L91A 1B63A 1YSRA 3TTZA 4E02A 3B25A 5M4PA 4YKYA 2BTZA 4V25A 2XX5A 4U7NA 3O6OA 4O04A 1Z5CA 1UY7A 5D7DA 1TIDA 2PNRA 3WHAA 4GCZA 4CWQA 2XHTA 3D0BA 1GJVA 4XIQA 2WI5A 1L0OA 4BIZA 2YEHA 3OWBA 2JJCA 2WI6A 3A0YA 1YSZA 4P7AA 1Y8OA 2VCJA 2YGFA 4ZVIA 4XKAA 1AJ6A 4FMTA 4Q20A 5F5RA 2YK2A 3K98A 1TC0A 3WQ9A 3TZ5A 1H7SA 4XKOA 2XABA 2BU6A 4O05A 3ZKBA 1UY8A 4URNA 2BZ5A 2YEDA 4YKRA 3CWVA 1YC1A 3B24A 2XD6A 4X9LA 3GIGA 2HCHA 4YKUA 2XDLA 5GGZA 3LPSA 3NMQA 3OW6A 3RKZA 2K5BA 1BKNA 5M4HA 3SL2A 2O1UA 3TZ0A 3RLPA 4JASA 2YE5A 5CPHA 5J71A 5BOCA 1I59A 3VHAA 2BYHA 3ZM7A 4U93A 4XCLA 4LWIA 1UY9A 4O0BA 4WUCA 4V26A 2IWXA 1S16A 5M4EA 4XC0A 4LWEA 2BT0A 4XD8A 2YE4A 2CCUA 3IEDA 4MB9A 4CWNA 4HYPA 3BMYA 1ID0A 3D36A 5FWKA 4HYMA 4DZYA 2Q8IA 2AKPA 1NHJA 1I5CA 4L90A 4FCQA 4B6CA 3U2KA 4CWPA 2VCIA 2O1WA 1AMWA 3DGEA 2E0AA 2FWYA 2GFDA 1JM6A 1H7UA 3U2DA 4PRVA 5D7RA 2YEGA 2O1VA 3GIFA 4LWFA 2BREA 4EM7A 3OWDA 4FCPA 2IOPA 3K97A 2CH4A 2YI0A 2VW5A 1NHIA 4QPKA 1QZRA 4BQJA 4O07A 2VWCA 3G7BA 3T10A 4ASGA 1BGQA 2YI5A 4URLA 1Z59A 2GQPA 4KP4A 1PVGA 2JKIA 4KFGA 2BRCA 2WEQA 1UYEA 1UYFA 3TZ4A 4HY1A 1YC3A 3HYYA 3O0IA 2YKBA 1A4HA 1OSFA 4HXWA 1YT2A 3G7EA 3ZXQA 2YJWA 1YESA 1UYGA 2WI2A 4AS9A 4AWQA 2YE8A 5M4NA 2XCMA 1MX0A 4YKXA 3C11A 4GGLA 3FV5A 2XDKA 1I5AA 2FYPA 1B62A 5L3JA 1THNA 2IWSA 2XX2A 4HZ5A 4NH8A 3U67A 1U2OA 1US7A 4GEEA 3R92A 4AWPA 1Y8PA 1ZXMA 1KIJA 2YK9A 3G75A 4H81A 2YEFA 4K4OA 3T0HA 1ZXNA 2H8MA 3A0TA 1KZNA 4MBCA 2CCTA 4FCRA 3HEKA 2ZBKB 4FPPA 4EEHA 1EA6A 4URMA 2YEIA 5BODA 4WUDA 4W7TA 3KE6A 2ZKJA 3Q5KA 4BXIA 1UY6A 5FNFA 4XCJA 4CWFA 1YT0A 2YE9A 4E00A 3INWA 4R3AA 3B26A 4XIRA 3FT5A 3HYZA 1B3QA 3C0EA 1Y8NA 2YECA 4CWTA 4NH9A 2ZDYA 4L93A 2YE7A 4CWRA 2XDXA 2Q2EB 2UWDA 2XDUA 4GQTA 4KSHA 4CE2A 3B27A 3A0RA 2WEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UYI A;  2FWZ A;  4E01 A;  2Q8G A;  1UYL A;  4CWS A;  5CTY A;  1YER A;  3INX A;  2HKJ A;  1Z5A A;  2YE2 A;  4ASB A;  2XX4 A;  3K60 A;  1R62 A;  4WUB A;  4CE1 A;  2CG9 A;  4PU9 A;  3CGZ A;  3T0Z A;  5CF0 A;  3MNR P;  4CWO A;  4MPN A;  5J6A A;  5IN9 A;  2XHR A;  3CGY A;  5FNC A;  1ZW9 A;  4XE2 A;  4B7P A;  3QTF A;  4XTJ A;  4BIU A;  2WI7 A;  4CE3 A;  1YT1 A;  3CRK A;  1YET A;  4I5S A;  2QF6 A;  3ZXO A;  2WI4 A;  4ZKI A;  1TIL A;  1AH8 A;  1TBW A;  3FT8 A;  3R4P A;  3HZ5 A;  4XIT A;  4BQG A;  3R4M A;  4KSG A;  5D6Q A;  4GFN A;  4H85 A;  3VHD A;  3A0W A;  4JAV A;  4HXZ A;  3T2S A;  3H80 A;  1UYM A;  1Z5B A;  4MPE A;  2QG0 A;  1TC6 A;  5M4K A;  3EHJ A;  2IOQ A;  2YKC A;  1YC4 A;  3OMU A;  2XK2 A;  4JQL A;  5IDM A;  2BU2 A;  4LWH A;  1GKX A;  2Q8H A;  1I5D A;  3GIE A;  3EKR A;  4KQV A;  5M4M A;  3HZ1 A;  2HG1 A;  4PL9 A;  4EFU A;  3A0X A;  3EHF A;  1U0Z A;  3R91 A;  2CCS A;  3RLR A;  5D6P A;  2C2A A;  4EGK A;  5C93 A;  4KTN A;  4LPB A;  3VAD A;  4ASA A;  3R4N A;  4R3M A;  4P8O A;  4AWO A;  2YEE A;  1BYQ A;  1QYE A;  3K99 A;  3RLQ A;  4YKQ A;  5IDJ A;  2YJX A;  4YKT A;  5F3K A;  3Q5J A;  4EFT A;  2FXS A;  3LNU A;  1Y4S A;  1ZWH A;  4MP7 A;  1EI1 A;  2YI6 A;  3H4L A;  1I58 A;  3B28 A;  1I5B A;  2XJJ A;  4YKW A;  3D2R A;  1GKZ A;  3R4O A;  5CTX A;  3QDD A;  1YS3 A;  2YEJ A;  4GT8 A;  1NHH A;  3GIG B;  4QPJ A;  3EKO A;  2QFO A;  2BSM A;  5FND A;  4MPC A;  4PRX A;  2YKE A;  2ZDX A;  4O09 A;  1BXD A;  3TUH A;  3PEJ A;  2YE6 A;  1UYD A;  2Q8F A;  4I3H A;  2XJG A;  3O2F A;  1UYC A;  1UYK A;  3EHG A;  4BAE A;  4HY6 A;  2IOR A;  2YEA A;  1MU5 A;  2QG2 A;  1QY8 A;  3OPD A;  2WER A;  4R1F A;  4URO A;  4XKK A;  4HZ0 A;  5CTW A;  4YKZ A;  2CGF A;  1AH6 A;  1AM1 A;  4DUH A;  3CRL A;  4JAU A;  2WI3 A;  2BU7 A;  4XIP A;  2YKI A;  5D7C A;  2BU8 A;  2YEB A;  4ASF A;  2XJX A;  4NH7 A;  2XHX A;  3BM9 A;  4LP0 A;  2YKJ A;  2YI7 A;  1UYH A;  3PEH A;  3Q5L A;  2H55 A;  4MOT A;  2YGE A;  1S14 A;  2EXL A;  3VHC A;  4U7O A;  2IWU A;  2YE3 A;  2BU5 A;  2XDS A;  4L94 A;  3T1K A;  2WI1 A;  2BYI A;  2ESA A;  4H7Q A;  4L8Z A;  3EHH A;  2YGA A;  3TZ2 A;  4EMV A;  3JZ3 A;  4MP2 A;  1TH8 A;  4EGH A;  3ZKD A;  3A0Z A;  3HHU A;  1Y4U A;  5CTU A;  4XDM A;  4LWG A;  4EGI A;  4L91 A;  1B63 A;  1YSR A;  3TTZ A;  4E02 A;  3B25 A;  5M4P A;  4YKY A;  2BTZ A;  4V25 A;  2XX5 A;  4U7N A;  3O6O A;  4O04 A;  1Z5C A;  1UY7 A;  5D7D A;  1TID A;  2PNR A;  3WHA A;  4GCZ A;  4CWQ A;  2XHT A;  3D0B A;  1GJV A;  4XIQ A;  2WI5 A;  1L0O A;  4BIZ A;  2YEH A;  3OWB A;  2JJC A;  2WI6 A;  3A0Y A;  1YSZ A;  4P7A A;  1Y8O A;  2VCJ A;  2YGF A;  4ZVI A;  4XKA A;  1AJ6 A;  4FMT A;  4Q20 A;  5F5R A;  2YK2 A;  3K98 A;  1TC0 A;  3WQ9 A;  3TZ5 A;  1H7S A;  4XKO A;  2XAB A;  2BU6 A;  4O05 A;  3ZKB A;  1UY8 A;  4URN A;  2BZ5 A;  2YED A;  4YKR A;  3CWV A;  1YC1 A;  3B24 A;  2XD6 A;  4X9L A;  3GIG A;  2HCH A;  4YKU A;  2XDL A;  5GGZ A;  3LPS A;  3NMQ A;  3OW6 A;  3RKZ A;  2K5B A;  1BKN A;  5M4H A;  3SL2 A;  2O1U A;  3TZ0 A;  3RLP A;  4JAS A;  2YE5 A;  5CPH A;  5J71 A;  5BOC A;  1I59 A;  3VHA A;  2BYH A;  3ZM7 A;  4U93 A;  4XCL A;  4LWI A;  1UY9 A;  4O0B A;  4WUC A;  4V26 A;  2IWX A;  1S16 A;  5M4E A;  4XC0 A;  4LWE A;  2BT0 A;  4XD8 A;  2YE4 A;  2CCU A;  3IED A;  4MB9 A;  4CWN A;  4HYP A;  3BMY A;  1ID0 A;  3D36 A;  5FWK A;  4HYM A;  4DZY A;  2Q8I A;  2AKP A;  1NHJ A;  1I5C A;  4L90 A;  4FCQ A;  4B6C A;  3U2K A;  4CWP A;  2VCI A;  2O1W A;  1AMW A;  3DGE A;  2E0A A;  2FWY A;  2GFD A;  1JM6 A;  1H7U A;  3U2D A;  4PRV A;  5D7R A;  2YEG A;  2O1V A;  3GIF A;  4LWF A;  2BRE A;  4EM7 A;  3OWD A;  4FCP A;  2IOP A;  3K97 A;  2CH4 A;  2YI0 A;  2VW5 A;  1NHI A;  4QPK A;  1QZR A;  4BQJ A;  4O07 A;  2VWC A;  3G7B A;  3T10 A;  4ASG A;  1BGQ A;  2YI5 A;  4URL A;  1Z59 A;  2GQP A;  4KP4 A;  1PVG A;  2JKI A;  4KFG A;  2BRC A;  2WEQ A;  1UYE A;  1UYF A;  3TZ4 A;  4HY1 A;  1YC3 A;  3HYY A;  3O0I A;  2YKB A;  1A4H A;  1OSF A;  4HXW A;  1YT2 A;  3G7E A;  3ZXQ A;  2YJW A;  1YES A;  1UYG A;  2WI2 A;  4AS9 A;  4AWQ A;  2YE8 A;  5M4N A;  2XCM A;  1MX0 A;  4YKX A;  3C11 A;  4GGL A;  3FV5 A;  2XDK A;  1I5A A;  2FYP A;  1B62 A;  5L3J A;  1THN A;  2IWS A;  2XX2 A;  4HZ5 A;  4NH8 A;  3U67 A;  1U2O A;  1US7 A;  4GEE A;  3R92 A;  4AWP A;  1Y8P A;  1ZXM A;  1KIJ A;  2YK9 A;  3G75 A;  4H81 A;  2YEF A;  4K4O A;  3T0H A;  1ZXN A;  2H8M A;  3A0T A;  1KZN A;  4MBC A;  2CCT A;  4FCR A;  3HEK A;  2ZBK B;  4FPP A;  4EEH A;  1EA6 A;  4URM A;  2YEI A;  5BOD A;  4WUD A;  4W7T A;  3KE6 A;  2ZKJ A;  3Q5K A;  4BXI A;  1UY6 A;  5FNF A;  4XCJ A;  4CWF A;  1YT0 A;  2YE9 A;  4E00 A;  3INW A;  4R3A A;  3B26 A;  4XIR A;  3FT5 A;  3HYZ A;  1B3Q A;  3C0E A;  1Y8N A;  2YEC A;  4CWT A;  4NH9 A;  2ZDY A;  4L93 A;  2YE7 A;  4CWR A;  2XDX A;  2Q2E B;  2UWD A;  2XDU A;  4GQT A;  4KSH A;  4CE2 A;  3B27 A;  3A0R A;  2WEP A; 
#chains in the Genus database with same CATH topology
 1UYI A;  2FWZ A;  4E01 A;  2Q8G A;  1UYL A;  4CWS A;  5CTY A;  1YER A;  3INX A;  2HKJ A;  1Z5A A;  2YE2 A;  4ASB A;  2XX4 A;  3K60 A;  1R62 A;  4WUB A;  4CE1 A;  2CG9 A;  4PU9 A;  3CGZ A;  3T0Z A;  5CF0 A;  3MNR P;  4CWO A;  4MPN A;  5J6A A;  5IN9 A;  2XHR A;  3CGY A;  5FNC A;  1ZW9 A;  4XE2 A;  4B7P A;  3QTF A;  4XTJ A;  4BIU A;  2WI7 A;  4CE3 A;  1YT1 A;  3CRK A;  1YET A;  4I5S A;  2QF6 A;  3ZXO A;  2WI4 A;  4ZKI A;  1TIL A;  1AH8 A;  1TBW A;  3FT8 A;  3R4P A;  3HZ5 A;  4XIT A;  4BQG A;  3R4M A;  4KSG A;  5D6Q A;  4GFN A;  4H85 A;  3VHD A;  3A0W A;  4JAV A;  4HXZ A;  3T2S A;  3H80 A;  1UYM A;  1Z5B A;  4MPE A;  2QG0 A;  1TC6 A;  5M4K A;  3EHJ A;  2IOQ A;  2YKC A;  1YC4 A;  3OMU A;  2XK2 A;  4JQL A;  5IDM A;  2BU2 A;  4LWH A;  1GKX A;  2Q8H A;  1I5D A;  3GIE A;  3EKR A;  4KQV A;  5M4M A;  3HZ1 A;  2HG1 A;  4PL9 A;  4EFU A;  3A0X A;  3EHF A;  1U0Z A;  3R91 A;  2CCS A;  3RLR A;  5D6P A;  2C2A A;  4EGK A;  5C93 A;  4KTN A;  4LPB A;  3VAD A;  4ASA A;  3R4N A;  4R3M A;  4P8O A;  4AWO A;  2YEE A;  1BYQ A;  1QYE A;  3K99 A;  3RLQ A;  4YKQ A;  5IDJ A;  2YJX A;  4YKT A;  5F3K A;  3Q5J A;  4EFT A;  2FXS A;  3LNU A;  1Y4S A;  1ZWH A;  4MP7 A;  1EI1 A;  2YI6 A;  3H4L A;  1I58 A;  3B28 A;  1I5B A;  2XJJ A;  4YKW A;  3D2R A;  1GKZ A;  3R4O A;  5CTX A;  3QDD A;  1YS3 A;  2HHI A;  2YEJ A;  4GT8 A;  1NHH A;  3GIG B;  4QPJ A;  3EKO A;  2QFO A;  2BSM A;  5FND A;  4MPC A;  4PRX A;  2YKE A;  2ZDX A;  4O09 A;  1BXD A;  3TUH A;  3PEJ A;  1IXM A;  2YE6 A;  1UYD A;  2Q8F A;  4I3H A;  2XJG A;  3CYG A;  3O2F A;  1UYC A;  1UYK A;  3EHG A;  4BAE A;  2C1I A;  4HY6 A;  2IOR A;  2YEA A;  1MU5 A;  2QG2 A;  1QY8 A;  3OPD A;  2WER A;  4R1F A;  4URO A;  4XKK A;  4HZ0 A;  5CTW A;  4YKZ A;  2CGF A;  1AH6 A;  1AM1 A;  4DUH A;  3CRL A;  4JAU A;  2WI3 A;  2BU7 A;  4XIP A;  2YKI A;  5D7C A;  2BU8 A;  2YEB A;  4ASF A;  2XJX A;  4NH7 A;  2XHX A;  3BM9 A;  4LP0 A;  2YKJ A;  2YI7 A;  1UYH A;  3PEH A;  3Q5L A;  2H55 A;  4MOT A;  2YGE A;  1S14 A;  2EXL A;  3VHC A;  4U7O A;  2IWU A;  2YE3 A;  2BU5 A;  2XDS A;  4L94 A;  3T1K A;  2WI1 A;  3LMM A;  2BYI A;  2ESA A;  4H7Q A;  4L8Z A;  3EHH A;  2YGA A;  3TZ2 A;  4EMV A;  3JZ3 A;  4MP2 A;  1TH8 A;  4EGH A;  3ZKD A;  3A0Z A;  3HHU A;  1Y4U A;  5CTU A;  4XDM A;  4LWG A;  4EGI A;  4L91 A;  1B63 A;  1YSR A;  3TTZ A;  4E02 A;  3B25 A;  5M4P A;  4YKY A;  2BTZ A;  4V25 A;  2XX5 A;  4U7N A;  3O6O A;  4O04 A;  1Z5C A;  1UY7 A;  5D7D A;  1TID A;  2PNR A;  3WHA A;  4GCZ A;  4CWQ A;  2XHT A;  3D0B A;  1GJV A;  4XIQ A;  2WI5 A;  1L0O A;  4BIZ A;  2YEH A;  3OWB A;  2JJC A;  2WI6 A;  3A0Y A;  1YSZ A;  4P7A A;  1Y8O A;  2VCJ A;  2YGF A;  4ZVI A;  4XKA A;  1AJ6 A;  4FMT A;  4Q20 A;  5F5R A;  2YK2 A;  3K98 A;  1TC0 A;  3WQ9 A;  3TZ5 A;  1H7S A;  4XKO A;  2XAB A;  2BU6 A;  4O05 A;  3ZKB A;  1UY8 A;  4URN A;  2BZ5 A;  2YED A;  4YKR A;  3CWV A;  1YC1 A;  3B24 A;  2XD6 A;  4X9L A;  3GIG A;  2HCH A;  4YKU A;  2XDL A;  5GGZ A;  3LPS A;  3NMQ A;  3OW6 A;  3RKZ A;  2K5B A;  1BKN A;  5M4H A;  3SL2 A;  2O1U A;  3TZ0 A;  3RLP A;  4JAS A;  2YE5 A;  5CPH A;  5J71 A;  5BOC A;  1I59 A;  3VHA A;  2BYH A;  3ZM7 A;  4U93 A;  4XCL A;  4LWI A;  1UY9 A;  4O0B A;  4WUC A;  4V26 A;  2IWX A;  1S16 A;  5M4E A;  4XC0 A;  4LWE A;  2BT0 A;  4XD8 A;  2YE4 A;  2CCU A;  3IED A;  4MB9 A;  4CWN A;  4HYP A;  3BMY A;  1ID0 A;  3D36 A;  5FWK A;  4HYM A;  4DZY A;  2Q8I A;  2AKP A;  1NHJ A;  1I5C A;  4L90 A;  3S5T A;  4FCQ A;  4B6C A;  3U2K A;  4CWP A;  2VCI A;  2O1W A;  1AMW A;  3DGE A;  2E0A A;  2FWY A;  2GFD A;  1JM6 A;  1H7U A;  3U2D A;  4PRV A;  5D7R A;  2YEG A;  2O1V A;  3GIF A;  4LWF A;  2BRE A;  4EM7 A;  2FTK A;  3OWD A;  4FCP A;  2IOP A;  3K97 A;  2CH4 A;  2YI0 A;  2VW5 A;  1NHI A;  4QPK A;  1QZR A;  4BQJ A;  4O07 A;  2VWC A;  2C1G A;  3G7B A;  3T10 A;  4ASG A;  1BGQ A;  2YI5 A;  4URL A;  1Z59 A;  2GQP A;  4KP4 A;  1PVG A;  2JKI A;  4KFG A;  2BRC A;  2WEQ A;  1UYE A;  1UYF A;  3TZ4 A;  4HY1 A;  1YC3 A;  3HYY A;  3O0I A;  2YKB A;  1A4H A;  1OSF A;  4HXW A;  1YT2 A;  3G7E A;  3ZXQ A;  2YJW A;  1YES A;  1UYG A;  2WI2 A;  4AS9 A;  4AWQ A;  2YE8 A;  5M4N A;  2XCM A;  1F51 A;  1MX0 A;  4YKX A;  3C11 A;  4GGL A;  3FV5 A;  2XDK A;  1I5A A;  2FYP A;  5JEN A;  1B62 A;  5L3J A;  1THN A;  2IWS A;  2XX2 A;  4HZ5 A;  4NH8 A;  3U67 A;  1U2O A;  1US7 A;  4GEE A;  3R92 A;  4AWP A;  1Y8P A;  1ZXM A;  1KIJ A;  2YK9 A;  3G75 A;  4H81 A;  2YEF A;  4K4O A;  3T0H A;  1ZXN A;  2H8M A;  3A0T A;  1KZN A;  4MBC A;  2CCT A;  4FCR A;  3HEK A;  2ZBK B;  4FPP A;  4EEH A;  1EA6 A;  4URM A;  2YEI A;  5BOD A;  4WUD A;  4W7T A;  3KE6 A;  4E72 A;  2ZKJ A;  3Q5K A;  4BXI A;  1UY6 A;  5FNF A;  4XCJ A;  4CWF A;  1YT0 A;  2YE9 A;  4E00 A;  3INW A;  4R3A A;  3B26 A;  4XIR A;  3FT5 A;  3HYZ A;  1B3Q A;  3C0E A;  1Y8N A;  2YEC A;  4CWT A;  4NH9 A;  2ZDY A;  4L93 A;  2YE7 A;  4CWR A;  2XDX A;  2Q2E B;  2UWD A;  2XDU A;  4GQT A;  4KSH A;  4CE2 A;  3B27 A;  3A0R A;  2WEP A; 
#chains in the Genus database with same CATH homology
 1UYI A;  2FWZ A;  4E01 A;  2Q8G A;  1UYL A;  4CWS A;  5CTY A;  1YER A;  3INX A;  2HKJ A;  1Z5A A;  2YE2 A;  4ASB A;  2XX4 A;  3K60 A;  1R62 A;  4WUB A;  4CE1 A;  2CG9 A;  4PU9 A;  3CGZ A;  3T0Z A;  5CF0 A;  3MNR P;  4CWO A;  4MPN A;  5J6A A;  5IN9 A;  2XHR A;  3CGY A;  5FNC A;  1ZW9 A;  4XE2 A;  4B7P A;  3QTF A;  4XTJ A;  4BIU A;  2WI7 A;  4CE3 A;  1YT1 A;  3CRK A;  1YET A;  4I5S A;  2QF6 A;  3ZXO A;  2WI4 A;  4ZKI A;  1TIL A;  1AH8 A;  1TBW A;  3FT8 A;  3R4P A;  3HZ5 A;  4XIT A;  4BQG A;  3R4M A;  4KSG A;  5D6Q A;  4GFN A;  4H85 A;  3VHD A;  3A0W A;  4JAV A;  4HXZ A;  3T2S A;  3H80 A;  1UYM A;  1Z5B A;  4MPE A;  2QG0 A;  1TC6 A;  5M4K A;  3EHJ A;  2IOQ A;  2YKC A;  1YC4 A;  3OMU A;  2XK2 A;  4JQL A;  5IDM A;  2BU2 A;  4LWH A;  1GKX A;  2Q8H A;  1I5D A;  3GIE A;  3EKR A;  4KQV A;  5M4M A;  3HZ1 A;  2HG1 A;  4PL9 A;  4EFU A;  3A0X A;  3EHF A;  1U0Z A;  3R91 A;  2CCS A;  3RLR A;  5D6P A;  2C2A A;  4EGK A;  5C93 A;  4KTN A;  4LPB A;  3VAD A;  4ASA A;  3R4N A;  4R3M A;  4P8O A;  4AWO A;  2YEE A;  1BYQ A;  1QYE A;  3K99 A;  3RLQ A;  4YKQ A;  5IDJ A;  2YJX A;  4YKT A;  5F3K A;  3Q5J A;  4EFT A;  2FXS A;  3LNU A;  1Y4S A;  1ZWH A;  4MP7 A;  1EI1 A;  2YI6 A;  3H4L A;  1I58 A;  3B28 A;  1I5B A;  2XJJ A;  4YKW A;  3D2R A;  1GKZ A;  3R4O A;  5CTX A;  3QDD A;  1YS3 A;  2YEJ A;  4GT8 A;  1NHH A;  3GIG B;  4QPJ A;  3EKO A;  2QFO A;  2BSM A;  5FND A;  4MPC A;  4PRX A;  2YKE A;  2ZDX A;  4O09 A;  1BXD A;  3TUH A;  3PEJ A;  2YE6 A;  1UYD A;  2Q8F A;  4I3H A;  2XJG A;  3O2F A;  1UYC A;  1UYK A;  3EHG A;  4BAE A;  4HY6 A;  2IOR A;  2YEA A;  1MU5 A;  2QG2 A;  1QY8 A;  3OPD A;  2WER A;  4R1F A;  4URO A;  4XKK A;  4HZ0 A;  5CTW A;  4YKZ A;  2CGF A;  1AH6 A;  1AM1 A;  4DUH A;  3CRL A;  4JAU A;  2WI3 A;  2BU7 A;  4XIP A;  2YKI A;  5D7C A;  2BU8 A;  2YEB A;  4ASF A;  2XJX A;  4NH7 A;  2XHX A;  3BM9 A;  4LP0 A;  2YKJ A;  2YI7 A;  1UYH A;  3PEH A;  3Q5L A;  2H55 A;  4MOT A;  2YGE A;  1S14 A;  2EXL A;  3VHC A;  4U7O A;  2IWU A;  2YE3 A;  2BU5 A;  2XDS A;  4L94 A;  3T1K A;  2WI1 A;  2BYI A;  2ESA A;  4H7Q A;  4L8Z A;  3EHH A;  2YGA A;  3TZ2 A;  4EMV A;  3JZ3 A;  4MP2 A;  1TH8 A;  4EGH A;  3ZKD A;  3A0Z A;  3HHU A;  1Y4U A;  5CTU A;  4XDM A;  4LWG A;  4EGI A;  4L91 A;  1B63 A;  1YSR A;  3TTZ A;  4E02 A;  3B25 A;  5M4P A;  4YKY A;  2BTZ A;  4V25 A;  2XX5 A;  4U7N A;  3O6O A;  4O04 A;  1Z5C A;  1UY7 A;  5D7D A;  1TID A;  2PNR A;  3WHA A;  4GCZ A;  4CWQ A;  2XHT A;  3D0B A;  1GJV A;  4XIQ A;  2WI5 A;  1L0O A;  4BIZ A;  2YEH A;  3OWB A;  2JJC A;  2WI6 A;  3A0Y A;  1YSZ A;  4P7A A;  1Y8O A;  2VCJ A;  2YGF A;  4ZVI A;  4XKA A;  1AJ6 A;  4FMT A;  4Q20 A;  5F5R A;  2YK2 A;  3K98 A;  1TC0 A;  3WQ9 A;  3TZ5 A;  1H7S A;  4XKO A;  2XAB A;  2BU6 A;  4O05 A;  3ZKB A;  1UY8 A;  4URN A;  2BZ5 A;  2YED A;  4YKR A;  3CWV A;  1YC1 A;  3B24 A;  2XD6 A;  4X9L A;  3GIG A;  2HCH A;  4YKU A;  2XDL A;  5GGZ A;  3LPS A;  3NMQ A;  3OW6 A;  3RKZ A;  2K5B A;  1BKN A;  5M4H A;  3SL2 A;  2O1U A;  3TZ0 A;  3RLP A;  4JAS A;  2YE5 A;  5CPH A;  5J71 A;  5BOC A;  1I59 A;  3VHA A;  2BYH A;  3ZM7 A;  4U93 A;  4XCL A;  4LWI A;  1UY9 A;  4O0B A;  4WUC A;  4V26 A;  2IWX A;  1S16 A;  5M4E A;  4XC0 A;  4LWE A;  2BT0 A;  4XD8 A;  2YE4 A;  2CCU A;  3IED A;  4MB9 A;  4CWN A;  4HYP A;  3BMY A;  1ID0 A;  3D36 A;  5FWK A;  4HYM A;  4DZY A;  2Q8I A;  2AKP A;  1NHJ A;  1I5C A;  4L90 A;  4FCQ A;  4B6C A;  3U2K A;  4CWP A;  2VCI A;  2O1W A;  1AMW A;  3DGE A;  2E0A A;  2FWY A;  2GFD A;  1JM6 A;  1H7U A;  3U2D A;  4PRV A;  5D7R A;  2YEG A;  2O1V A;  3GIF A;  4LWF A;  2BRE A;  4EM7 A;  3OWD A;  4FCP A;  2IOP A;  3K97 A;  2CH4 A;  2YI0 A;  2VW5 A;  1NHI A;  4QPK A;  1QZR A;  4BQJ A;  4O07 A;  2VWC A;  3G7B A;  3T10 A;  4ASG A;  1BGQ A;  2YI5 A;  4URL A;  1Z59 A;  2GQP A;  4KP4 A;  1PVG A;  2JKI A;  4KFG A;  2BRC A;  2WEQ A;  1UYE A;  1UYF A;  3TZ4 A;  4HY1 A;  1YC3 A;  3HYY A;  3O0I A;  2YKB A;  1A4H A;  1OSF A;  4HXW A;  1YT2 A;  3G7E A;  3ZXQ A;  2YJW A;  1YES A;  1UYG A;  2WI2 A;  4AS9 A;  4AWQ A;  2YE8 A;  5M4N A;  2XCM A;  1MX0 A;  4YKX A;  3C11 A;  4GGL A;  3FV5 A;  2XDK A;  1I5A A;  2FYP A;  1B62 A;  5L3J A;  1THN A;  2IWS A;  2XX2 A;  4HZ5 A;  4NH8 A;  3U67 A;  1U2O A;  1US7 A;  4GEE A;  3R92 A;  4AWP A;  1Y8P A;  1ZXM A;  1KIJ A;  2YK9 A;  3G75 A;  4H81 A;  2YEF A;  4K4O A;  3T0H A;  1ZXN A;  2H8M A;  3A0T A;  1KZN A;  4MBC A;  2CCT A;  4FCR A;  3HEK A;  2ZBK B;  4FPP A;  4EEH A;  1EA6 A;  4URM A;  2YEI A;  5BOD A;  4WUD A;  4W7T A;  3KE6 A;  2ZKJ A;  3Q5K A;  4BXI A;  1UY6 A;  5FNF A;  4XCJ A;  4CWF A;  1YT0 A;  2YE9 A;  4E00 A;  3INW A;  4R3A A;  3B26 A;  4XIR A;  3FT5 A;  3HYZ A;  1B3Q A;  3C0E A;  1Y8N A;  2YEC A;  4CWT A;  4NH9 A;  2ZDY A;  4L93 A;  2YE7 A;  4CWR A;  2XDX A;  2Q2E B;  2UWD A;  2XDU A;  4GQT A;  4KSH A;  4CE2 A;  3B27 A;  3A0R A;  2WEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...