5CTWA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
b'AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5ctwA00
3VADA 4R3MA 2FXSA 3ZXOA 1NHIA 4L8ZA 1UYHA 4CWRA 3ZM7A 4MP7A 3C11A 2E0AA 4XCLA 3OMUA 4XD8A 3CRKA 2YGEA 1UYGA 2YK9A 4AWQA 2YGFA 1Y8OA 1GJVA 4LWIA 4CWOA 1B3QA 4LWHA 2WI4A 4ZKIA 4BAEA 2HG1A 2CCSA 4XE2A 2XD6A 2CCTA 1YC4A 3O0IA 3PEHA 3G75A 1UYEA 4URLA 4R3AA 2YE2A 1YERA 5IDMA 4P7AA 5J6AA 4HYMA 4BQGA 4O04A 2YEDA 5M4NA 2IWUA 3OWDA 5D6PA 1AM1A 4JAUA 4XKOA 4YKXA 4V26A 5IN9A 3HZ1A 5F3KA 1YT0A 4EMVA 2IOPA 2YEIA 4ASGA 3NMQA 4BIUA 3TUHA 1ZW9A 3RKZA 2WI5A 2YE4A 4YKTA 3FT5A 2XDUA 2YEJA 1I5DA 2BSMA 2XX5A 4P8OA 4E00A 4QPKA 1H7SA 2YEBA 2YE9A 4XIQA 2XX4A 1AH6A 2BU2A 1UYKA 3CRLA 4PRVA 4AWPA 2WI7A 4CWQA 4O0BA 1NHHA 2BYHA 1Y4SA 3KE6A 1U2OA 4XTJA 4NH7A 2ZKJA 1MU5A 4QPJA 2BRCA 4I3HA 4GQTA 1H7UA 2WERA 4EGIA 1THNA 3R91A 4CWFA 2BU8A 2FWYA 4L93A 4CE2A 4GFNA 4R1FA 3A0XA 3LPSA 4Q20A 3TZ2A 4KTNA 3SL2A 2BTZA 3BM9A 1Z59A 4WUBA 1B63A 3T10A 2XDSA 1I5BA 3B24A 2YI5A 2JKIA 4XKKA 4MPNA 1UYIA 4H85A 3H80A 4X9LA 4H7QA 3B25A 4XIPA 5CTUA 1A4HA 2VWCA 2K5BA 1Z5BA 2YEEA 4FMTA 4GGLA 2WI2A 2BU5A 4ASAA 1JM6A 2WEPA 2YECA 3R4MA 4YKYA 4MPEA 1GKZA 4HXWA 4O09A 3FT8A 3G7BA 4LP0A 4O05A 2XK2A 3WQ9A 4L94A 2XJGA 2JJCA 3T1KA 5BOCA 1I5CA 4MOTA 5D6QA 2ESAA 2IORA 3RLPA 2YEGA 2XDLA 2YEHA 5D7CA 2Q8GA 3T0HA 4EGKA 2QFOA 3U2KA 2QG0A 3A0RA 3ZXQA 4HYPA 4EEHA 3A0WA 4U7OA 1BXDA 3C0EA 1UY8A 3HYYA 4HXZA 2YJXA 4L91A 4FCPA 1YESA 2QG2A 2XABA 2XHXA 2YE6A 4HZ0A 4GCZA 4CE1A 5F5RA 3R4NA 4NH9A 4ASBA 4URNA 4LWEA 2VCIA 4L90A 2YKBA 4XITA 3PEJA 3A0YA 4AS9A 3TZ4A 4WUDA 1U0ZA 2VW5A 2CH4A 3A0TA 4B7PA 1ZXMA 3B27A 2VCJA 4YKRA 1EA6A 1YT1A 3OPDA 2WI6A 3EKRA 3R4OA 1YC1A 4KQVA 4U93A 2GQPA 4JAVA 1AMWA 3QDDA 3ZKBA 1UY7A 1EI1A 2YE5A 3EHJA 2YE3A 3VHDA 1QYEA 2YI6A 2XDXA 4MP2A 2YGAA 2YKJA 4BXIA 3H4LA 2CCUA 1YSZA 5L3JA 5GGZA 2XJXA 2WEQA 1Y4UA 3Q5KA 5FNFA 1BKNA 3D0BA 3EHGA 4JQLA 2BYIA 2YJWA 3EKOA 5M4PA 4V25A 3HEKA 2XHTA 4YKZA 2BU7A 2QF6A 3CGZA 2HCHA 4GEEA 4DUHA 1YT2A 1Y8PA 3Q5JA 4HY1A 4XKAA 5J71A 5M4EA 4E01A 3INXA 4O07A 2YK2A 3D36A 3EHFA 4UROA 5CF0A 4PL9A 3GIGA 1S16A 1OSFA 4FCRA 4HZ5A 4KSGA 1UYMA 3A0ZA 4B6CA 1UY6A 1GKXA 1QY8A 5FWKA 2Q2EB 3U67A 4CWPA 2YKEA 2CGFA 2YKIA 3K97A 4U7NA 4MB9A 4YKQA 3RLQA 5M4HA 2YKCA 4XCJA 1L0OA 5FNCA 1UYDA 1I5AA 4JASA 1PVGA 2YI7A 3OWBA 2PNRA 1AJ6A 4K4OA 1ZXNA 3B26A 4W7TA 4AWOA 2O1UA 2Q8IA 3FV5A 2YI0A 1I59A 4XC0A 1TC6A 2XDKA 4LWFA 3Q5LA 3T0ZA 4HY6A 3MNRP 4H81A 2XJJA 1US7A 5D7RA 4KFGA 1UY9A 4CWSA 2CG9A 2XCMA 4BIZA 2BZ5A 4PRXA 2O1WA 1UYCA 1ID0A 2GFDA 4CE3A 3K99A 3DGEA 3ZKDA 1B62A 2UWDA 1Z5AA 2YE8A 1UYLA 4I5SA 1I58A 1TC0A 4LPBA 2BREA 2HKJA 4PU9A 3O6OA 3CWVA 5D7DA 4EGHA 3TZ0A 4CWTA 1MX0A 3JZ3A 1R62A 3B28A 5C93A 1AH8A 2YE7A 4EFTA 2XX2A 2IWXA 3TZ5A 1BGQA 2BU6A 4WUCA 1BYQA 1TILA 1TIDA 5M4KA 5BODA 2IOQA 2WI1A 3LNUA 4KP4A 3BMYA 4E02A 3D2RA 3HZ5A 3O2FA 3TTZA 5M4MA 1TH8A 3R92A 5CTXA 4DZYA 2YEFA 3VHCA 4XIRA 4YKWA 2C2AA 2O1VA 1TBWA 4FPPA 3CGYA 3G7EA 4ASFA 1KZNA 1YSRA 3QTFA 3GIFA 1ZWHA 4MPCA 3RLRA 3HHUA 2FYPA 4KSHA 4MBCA 2ZBKB 5IDJA 3EHHA 3INWA 4CWNA 1NHJA 1UYFA 4XDMA 3GIGB 1S14A 1YS3A 2ZDYA 5CPHA 4EM7A 3K98A 4LWGA 2WI3A 4GT8A 1Z5CA 3WHAA 2AKPA 4ZVIA 5CTYA 2IWSA 1YETA 2YEAA 4BQJA 4URMA 2H55A 3IEDA 1Y8NA 3U2DA 2H8MA 2ZDXA 3OW6A 1YC3A 5FNDA 3HYZA 2FWZA 3VHAA 3R4PA 5CTWA 2BT0A 2XHRA 4NH8A 2EXLA 4YKUA 3GIEA 1KIJA 1QZRA 3T2SA 2Q8HA 4FCQA 4EFUA 2Q8FA 3K60A
chains in the Genus database with same CATH superfamily
3VADA 4R3MA 2FXSA 3ZXOA 1NHIA 4L8ZA 1UYHA 4CWRA 3ZM7A 4MP7A 3C11A 2E0AA 4XCLA 3OMUA 4XD8A 3CRKA 2YGEA 1UYGA 2YK9A 4AWQA 2YGFA 1Y8OA 1GJVA 4LWIA 4CWOA 1B3QA 4LWHA 2WI4A 4ZKIA 4BAEA 2HG1A 2CCSA 4XE2A 2XD6A 2CCTA 1YC4A 3O0IA 3PEHA 3G75A 1UYEA 4URLA 3CYGA 4R3AA 2YE2A 1YERA 5IDMA 4P7AA 5J6AA 4HYMA 4BQGA 4O04A 2YEDA 5M4NA 2IWUA 3OWDA 5D6PA 1AM1A 4JAUA 4XKOA 4YKXA 4V26A 5IN9A 3HZ1A 5F3KA 1YT0A 4EMVA 2IOPA 2YEIA 4ASGA 3NMQA 4BIUA 3TUHA 1ZW9A 3RKZA 2WI5A 2YE4A 4YKTA 3FT5A 2XDUA 2YEJA 1I5DA 2BSMA 2XX5A 4P8OA 4E00A 4QPKA 1H7SA 2YEBA 2YE9A 4XIQA 2XX4A 1AH6A 2BU2A 1UYKA 3CRLA 4PRVA 4AWPA 2WI7A 4CWQA 4O0BA 1NHHA 2BYHA 1Y4SA 3KE6A 1U2OA 4XTJA 4NH7A 2ZKJA 1MU5A 4QPJA 2BRCA 4I3HA 4GQTA 1H7UA 2WERA 4EGIA 1THNA 3R91A 4CWFA 2BU8A 2FWYA 4L93A 4CE2A 4GFNA 4R1FA 3A0XA 3LPSA 4Q20A 3TZ2A 4KTNA 3SL2A 2BTZA 3BM9A 1Z59A 4WUBA 1B63A 3T10A 1IXMA 2XDSA 1I5BA 3B24A 2YI5A 2JKIA 4XKKA 4MPNA 1UYIA 4H85A 3H80A 4X9LA 2C1GA 4H7QA 3B25A 4XIPA 5CTUA 1A4HA 2VWCA 2K5BA 1Z5BA 2YEEA 4FMTA 4GGLA 2WI2A 2BU5A 4ASAA 1JM6A 2WEPA 2YECA 3R4MA 4YKYA 4MPEA 1GKZA 4HXWA 4O09A 3FT8A 3G7BA 4LP0A 4O05A 2XK2A 3WQ9A 4L94A 2XJGA 2JJCA 5JENA 3T1KA 5BOCA 1I5CA 4MOTA 5D6QA 2ESAA 2IORA 3RLPA 2YEGA 2XDLA 2YEHA 5D7CA 2Q8GA 3T0HA 4EGKA 2QFOA 3U2KA 2QG0A 3A0RA 3ZXQA 4HYPA 4EEHA 3A0WA 4U7OA 1BXDA 3C0EA 1UY8A 3HYYA 4HXZA 2YJXA 4L91A 4FCPA 1YESA 2QG2A 2XABA 2XHXA 2YE6A 4HZ0A 4GCZA 4CE1A 5F5RA 3R4NA 4NH9A 4ASBA 4URNA 4LWEA 2VCIA 4L90A 2YKBA 3S5TA 4XITA 3PEJA 3A0YA 4AS9A 3TZ4A 4WUDA 1U0ZA 2FTKA 2VW5A 2CH4A 3A0TA 4B7PA 1ZXMA 3B27A 2VCJA 4YKRA 1EA6A 1YT1A 3OPDA 2WI6A 3EKRA 3R4OA 1YC1A 4KQVA 4U93A 2GQPA 4JAVA 1AMWA 3QDDA 3ZKBA 1UY7A 1EI1A 2YE5A 3EHJA 2YE3A 3VHDA 1QYEA 2YI6A 2XDXA 4MP2A 2YGAA 2YKJA 4BXIA 3H4LA 2CCUA 1YSZA 5L3JA 5GGZA 2XJXA 2WEQA 1Y4UA 3Q5KA 5FNFA 1BKNA 3D0BA 3EHGA 4JQLA 2BYIA 2YJWA 3EKOA 5M4PA 4V25A 3HEKA 2XHTA 4YKZA 2BU7A 2QF6A 3CGZA 2HCHA 4GEEA 4DUHA 1YT2A 1Y8PA 3Q5JA 4HY1A 4XKAA 5J71A 5M4EA 4E01A 3INXA 4O07A 2YK2A 3D36A 3EHFA 4UROA 5CF0A 4PL9A 3GIGA 1S16A 1OSFA 4FCRA 4HZ5A 4KSGA 1UYMA 3A0ZA 4B6CA 1UY6A 1GKXA 1QY8A 5FWKA 2Q2EB 3U67A 4CWPA 2YKEA 2CGFA 2YKIA 3K97A 4U7NA 4MB9A 4YKQA 3RLQA 5M4HA 2YKCA 4XCJA 1L0OA 5FNCA 1UYDA 1I5AA 4JASA 1PVGA 2YI7A 3OWBA 2PNRA 1AJ6A 4K4OA 1ZXNA 3B26A 4W7TA 4AWOA 2O1UA 2Q8IA 3LMMA 3FV5A 2YI0A 1I59A 4XC0A 1TC6A 2XDKA 4LWFA 3Q5LA 3T0ZA 4HY6A 3MNRP 4H81A 2XJJA 4E72A 1US7A 5D7RA 4KFGA 1UY9A 4CWSA 2CG9A 2XCMA 4BIZA 2BZ5A 4PRXA 2O1WA 2HHIA 1UYCA 1ID0A 2GFDA 4CE3A 3K99A 3DGEA 3ZKDA 1B62A 2UWDA 1Z5AA 2YE8A 1UYLA 4I5SA 1I58A 1TC0A 4LPBA 2BREA 2HKJA 4PU9A 3O6OA 3CWVA 5D7DA 4EGHA 3TZ0A 4CWTA 1MX0A 3JZ3A 1R62A 3B28A 5C93A 1AH8A 2YE7A 4EFTA 2XX2A 2IWXA 3TZ5A 1BGQA 2BU6A 4WUCA 1BYQA 1TILA 1TIDA 5M4KA 5BODA 2IOQA 2WI1A 3LNUA 4KP4A 3BMYA 4E02A 3D2RA 3HZ5A 3O2FA 3TTZA 5M4MA 1TH8A 3R92A 5CTXA 4DZYA 2YEFA 3VHCA 4XIRA 4YKWA 2C2AA 2O1VA 1TBWA 4FPPA 3CGYA 3G7EA 4ASFA 1KZNA 1YSRA 3QTFA 3GIFA 1ZWHA 4MPCA 3RLRA 3HHUA 2FYPA 4KSHA 4MBCA 2ZBKB 5IDJA 3EHHA 3INWA 4CWNA 1NHJA 1UYFA 4XDMA 3GIGB 1S14A 1YS3A 2ZDYA 5CPHA 4EM7A 3K98A 4LWGA 2WI3A 4GT8A 1Z5CA 3WHAA 2AKPA 4ZVIA 5CTYA 2IWSA 1YETA 2YEAA 4BQJA 4URMA 2H55A 3IEDA 1Y8NA 3U2DA 2H8MA 2ZDXA 3OW6A 1YC3A 5FNDA 3HYZA 2C1IA 2FWZA 3VHAA 1F51A 3R4PA 5CTWA 2BT0A 2XHRA 4NH8A 2EXLA 4YKUA 3GIEA 1KIJA 1QZRA 3T2SA 2Q8HA 4FCQA 4EFUA 2Q8FA 3K60A
chains in the Genus database with same CATH topology
3VADA 4R3MA 2FXSA 3ZXOA 1NHIA 4L8ZA 1UYHA 4CWRA 3ZM7A 4MP7A 3C11A 2E0AA 4XCLA 3OMUA 4XD8A 3CRKA 2YGEA 1UYGA 2YK9A 4AWQA 2YGFA 1Y8OA 1GJVA 4LWIA 4CWOA 1B3QA 4LWHA 2WI4A 4ZKIA 4BAEA 2HG1A 2CCSA 4XE2A 2XD6A 2CCTA 1YC4A 3O0IA 3PEHA 3G75A 1UYEA 4URLA 4R3AA 2YE2A 1YERA 5IDMA 4P7AA 5J6AA 4HYMA 4BQGA 4O04A 2YEDA 5M4NA 2IWUA 3OWDA 5D6PA 1AM1A 4JAUA 4XKOA 4YKXA 4V26A 5IN9A 3HZ1A 5F3KA 1YT0A 4EMVA 2IOPA 2YEIA 4ASGA 3NMQA 4BIUA 3TUHA 1ZW9A 3RKZA 2WI5A 2YE4A 4YKTA 3FT5A 2XDUA 2YEJA 1I5DA 2BSMA 2XX5A 4P8OA 4E00A 4QPKA 1H7SA 2YEBA 2YE9A 4XIQA 2XX4A 1AH6A 2BU2A 1UYKA 3CRLA 4PRVA 4AWPA 2WI7A 4CWQA 4O0BA 1NHHA 2BYHA 1Y4SA 3KE6A 1U2OA 4XTJA 4NH7A 2ZKJA 1MU5A 4QPJA 2BRCA 4I3HA 4GQTA 1H7UA 2WERA 4EGIA 1THNA 3R91A 4CWFA 2BU8A 2FWYA 4L93A 4CE2A 4GFNA 4R1FA 3A0XA 3LPSA 4Q20A 3TZ2A 4KTNA 3SL2A 2BTZA 3BM9A 1Z59A 4WUBA 1B63A 3T10A 2XDSA 1I5BA 3B24A 2YI5A 2JKIA 4XKKA 4MPNA 1UYIA 4H85A 3H80A 4X9LA 4H7QA 3B25A 4XIPA 5CTUA 1A4HA 2VWCA 2K5BA 1Z5BA 2YEEA 4FMTA 4GGLA 2WI2A 2BU5A 4ASAA 1JM6A 2WEPA 2YECA 3R4MA 4YKYA 4MPEA 1GKZA 4HXWA 4O09A 3FT8A 3G7BA 4LP0A 4O05A 2XK2A 3WQ9A 4L94A 2XJGA 2JJCA 3T1KA 5BOCA 1I5CA 4MOTA 5D6QA 2ESAA 2IORA 3RLPA 2YEGA 2XDLA 2YEHA 5D7CA 2Q8GA 3T0HA 4EGKA 2QFOA 3U2KA 2QG0A 3A0RA 3ZXQA 4HYPA 4EEHA 3A0WA 4U7OA 1BXDA 3C0EA 1UY8A 3HYYA 4HXZA 2YJXA 4L91A 4FCPA 1YESA 2QG2A 2XABA 2XHXA 2YE6A 4HZ0A 4GCZA 4CE1A 5F5RA 3R4NA 4NH9A 4ASBA 4URNA 4LWEA 2VCIA 4L90A 2YKBA 4XITA 3PEJA 3A0YA 4AS9A 3TZ4A 4WUDA 1U0ZA 2VW5A 2CH4A 3A0TA 4B7PA 1ZXMA 3B27A 2VCJA 4YKRA 1EA6A 1YT1A 3OPDA 2WI6A 3EKRA 3R4OA 1YC1A 4KQVA 4U93A 2GQPA 4JAVA 1AMWA 3QDDA 3ZKBA 1UY7A 1EI1A 2YE5A 3EHJA 2YE3A 3VHDA 1QYEA 2YI6A 2XDXA 4MP2A 2YGAA 2YKJA 4BXIA 3H4LA 2CCUA 1YSZA 5L3JA 5GGZA 2XJXA 2WEQA 1Y4UA 3Q5KA 5FNFA 1BKNA 3D0BA 3EHGA 4JQLA 2BYIA 2YJWA 3EKOA 5M4PA 4V25A 3HEKA 2XHTA 4YKZA 2BU7A 2QF6A 3CGZA 2HCHA 4GEEA 4DUHA 1YT2A 1Y8PA 3Q5JA 4HY1A 4XKAA 5J71A 5M4EA 4E01A 3INXA 4O07A 2YK2A 3D36A 3EHFA 4UROA 5CF0A 4PL9A 3GIGA 1S16A 1OSFA 4FCRA 4HZ5A 4KSGA 1UYMA 3A0ZA 4B6CA 1UY6A 1GKXA 1QY8A 5FWKA 2Q2EB 3U67A 4CWPA 2YKEA 2CGFA 2YKIA 3K97A 4U7NA 4MB9A 4YKQA 3RLQA 5M4HA 2YKCA 4XCJA 1L0OA 5FNCA 1UYDA 1I5AA 4JASA 1PVGA 2YI7A 3OWBA 2PNRA 1AJ6A 4K4OA 1ZXNA 3B26A 4W7TA 4AWOA 2O1UA 2Q8IA 3FV5A 2YI0A 1I59A 4XC0A 1TC6A 2XDKA 4LWFA 3Q5LA 3T0ZA 4HY6A 3MNRP 4H81A 2XJJA 1US7A 5D7RA 4KFGA 1UY9A 4CWSA 2CG9A 2XCMA 4BIZA 2BZ5A 4PRXA 2O1WA 1UYCA 1ID0A 2GFDA 4CE3A 3K99A 3DGEA 3ZKDA 1B62A 2UWDA 1Z5AA 2YE8A 1UYLA 4I5SA 1I58A 1TC0A 4LPBA 2BREA 2HKJA 4PU9A 3O6OA 3CWVA 5D7DA 4EGHA 3TZ0A 4CWTA 1MX0A 3JZ3A 1R62A 3B28A 5C93A 1AH8A 2YE7A 4EFTA 2XX2A 2IWXA 3TZ5A 1BGQA 2BU6A 4WUCA 1BYQA 1TILA 1TIDA 5M4KA 5BODA 2IOQA 2WI1A 3LNUA 4KP4A 3BMYA 4E02A 3D2RA 3HZ5A 3O2FA 3TTZA 5M4MA 1TH8A 3R92A 5CTXA 4DZYA 2YEFA 3VHCA 4XIRA 4YKWA 2C2AA 2O1VA 1TBWA 4FPPA 3CGYA 3G7EA 4ASFA 1KZNA 1YSRA 3QTFA 3GIFA 1ZWHA 4MPCA 3RLRA 3HHUA 2FYPA 4KSHA 4MBCA 2ZBKB 5IDJA 3EHHA 3INWA 4CWNA 1NHJA 1UYFA 4XDMA 3GIGB 1S14A 1YS3A 2ZDYA 5CPHA 4EM7A 3K98A 4LWGA 2WI3A 4GT8A 1Z5CA 3WHAA 2AKPA 4ZVIA 5CTYA 2IWSA 1YETA 2YEAA 4BQJA 4URMA 2H55A 3IEDA 1Y8NA 3U2DA 2H8MA 2ZDXA 3OW6A 1YC3A 5FNDA 3HYZA 2FWZA 3VHAA 3R4PA 5CTWA 2BT0A 2XHRA 4NH8A 2EXLA 4YKUA 3GIEA 1KIJA 1QZRA 3T2SA 2Q8HA 4FCQA 4EFUA 2Q8FA 3K60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAD A;  4R3M A;  2FXS A;  3ZXO A;  1NHI A;  4L8Z A;  1UYH A;  4CWR A;  3ZM7 A;  4MP7 A;  3C11 A;  2E0A A;  4XCL A;  3OMU A;  4XD8 A;  3CRK A;  2YGE A;  1UYG A;  2YK9 A;  4AWQ A;  2YGF A;  1Y8O A;  1GJV A;  4LWI A;  4CWO A;  1B3Q A;  4LWH A;  2WI4 A;  4ZKI A;  4BAE A;  2HG1 A;  2CCS A;  4XE2 A;  2XD6 A;  2CCT A;  1YC4 A;  3O0I A;  3PEH A;  3G75 A;  1UYE A;  4URL A;  4R3A A;  2YE2 A;  1YER A;  5IDM A;  4P7A A;  5J6A A;  4HYM A;  4BQG A;  4O04 A;  2YED A;  5M4N A;  2IWU A;  3OWD A;  5D6P A;  1AM1 A;  4JAU A;  4XKO A;  4YKX A;  4V26 A;  5IN9 A;  3HZ1 A;  5F3K A;  1YT0 A;  4EMV A;  2IOP A;  2YEI A;  4ASG A;  3NMQ A;  4BIU A;  3TUH A;  1ZW9 A;  3RKZ A;  2WI5 A;  2YE4 A;  4YKT A;  3FT5 A;  2XDU A;  2YEJ A;  1I5D A;  2BSM A;  2XX5 A;  4P8O A;  4E00 A;  4QPK A;  1H7S A;  2YEB A;  2YE9 A;  4XIQ A;  2XX4 A;  1AH6 A;  2BU2 A;  1UYK A;  3CRL A;  4PRV A;  4AWP A;  2WI7 A;  4CWQ A;  4O0B A;  1NHH A;  2BYH A;  1Y4S A;  3KE6 A;  1U2O A;  4XTJ A;  4NH7 A;  2ZKJ A;  1MU5 A;  4QPJ A;  2BRC A;  4I3H A;  4GQT A;  1H7U A;  2WER A;  4EGI A;  1THN A;  3R91 A;  4CWF A;  2BU8 A;  2FWY A;  4L93 A;  4CE2 A;  4GFN A;  4R1F A;  3A0X A;  3LPS A;  4Q20 A;  3TZ2 A;  4KTN A;  3SL2 A;  2BTZ A;  3BM9 A;  1Z59 A;  4WUB A;  1B63 A;  3T10 A;  2XDS A;  1I5B A;  3B24 A;  2YI5 A;  2JKI A;  4XKK A;  4MPN A;  1UYI A;  4H85 A;  3H80 A;  4X9L A;  4H7Q A;  3B25 A;  4XIP A;  5CTU A;  1A4H A;  2VWC A;  2K5B A;  1Z5B A;  2YEE A;  4FMT A;  4GGL A;  2WI2 A;  2BU5 A;  4ASA A;  1JM6 A;  2WEP A;  2YEC A;  3R4M A;  4YKY A;  4MPE A;  1GKZ A;  4HXW A;  4O09 A;  3FT8 A;  3G7B A;  4LP0 A;  4O05 A;  2XK2 A;  3WQ9 A;  4L94 A;  2XJG A;  2JJC A;  3T1K A;  5BOC A;  1I5C A;  4MOT A;  5D6Q A;  2ESA A;  2IOR A;  3RLP A;  2YEG A;  2XDL A;  2YEH A;  5D7C A;  2Q8G A;  3T0H A;  4EGK A;  2QFO A;  3U2K A;  2QG0 A;  3A0R A;  3ZXQ A;  4HYP A;  4EEH A;  3A0W A;  4U7O A;  1BXD A;  3C0E A;  1UY8 A;  3HYY A;  4HXZ A;  2YJX A;  4L91 A;  4FCP A;  1YES A;  2QG2 A;  2XAB A;  2XHX A;  2YE6 A;  4HZ0 A;  4GCZ A;  4CE1 A;  5F5R A;  3R4N A;  4NH9 A;  4ASB A;  4URN A;  4LWE A;  2VCI A;  4L90 A;  2YKB A;  4XIT A;  3PEJ A;  3A0Y A;  4AS9 A;  3TZ4 A;  4WUD A;  1U0Z A;  2VW5 A;  2CH4 A;  3A0T A;  4B7P A;  1ZXM A;  3B27 A;  2VCJ A;  4YKR A;  1EA6 A;  1YT1 A;  3OPD A;  2WI6 A;  3EKR A;  3R4O A;  1YC1 A;  4KQV A;  4U93 A;  2GQP A;  4JAV A;  1AMW A;  3QDD A;  3ZKB A;  1UY7 A;  1EI1 A;  2YE5 A;  3EHJ A;  2YE3 A;  3VHD A;  1QYE A;  2YI6 A;  2XDX A;  4MP2 A;  2YGA A;  2YKJ A;  4BXI A;  3H4L A;  2CCU A;  1YSZ A;  5L3J A;  5GGZ A;  2XJX A;  2WEQ A;  1Y4U A;  3Q5K A;  5FNF A;  1BKN A;  3D0B A;  3EHG A;  4JQL A;  2BYI A;  2YJW A;  3EKO A;  5M4P A;  4V25 A;  3HEK A;  2XHT A;  4YKZ A;  2BU7 A;  2QF6 A;  3CGZ A;  2HCH A;  4GEE A;  4DUH A;  1YT2 A;  1Y8P A;  3Q5J A;  4HY1 A;  4XKA A;  5J71 A;  5M4E A;  4E01 A;  3INX A;  4O07 A;  2YK2 A;  3D36 A;  3EHF A;  4URO A;  5CF0 A;  4PL9 A;  3GIG A;  1S16 A;  1OSF A;  4FCR A;  4HZ5 A;  4KSG A;  1UYM A;  3A0Z A;  4B6C A;  1UY6 A;  1GKX A;  1QY8 A;  5FWK A;  2Q2E B;  3U67 A;  4CWP A;  2YKE A;  2CGF A;  2YKI A;  3K97 A;  4U7N A;  4MB9 A;  4YKQ A;  3RLQ A;  5M4H A;  2YKC A;  4XCJ A;  1L0O A;  5FNC A;  1UYD A;  1I5A A;  4JAS A;  1PVG A;  2YI7 A;  3OWB A;  2PNR A;  1AJ6 A;  4K4O A;  1ZXN A;  3B26 A;  4W7T A;  4AWO A;  2O1U A;  2Q8I A;  3FV5 A;  2YI0 A;  1I59 A;  4XC0 A;  1TC6 A;  2XDK A;  4LWF A;  3Q5L A;  3T0Z A;  4HY6 A;  3MNR P;  4H81 A;  2XJJ A;  1US7 A;  5D7R A;  4KFG A;  1UY9 A;  4CWS A;  2CG9 A;  2XCM A;  4BIZ A;  2BZ5 A;  4PRX A;  2O1W A;  1UYC A;  1ID0 A;  2GFD A;  4CE3 A;  3K99 A;  3DGE A;  3ZKD A;  1B62 A;  2UWD A;  1Z5A A;  2YE8 A;  1UYL A;  4I5S A;  1I58 A;  1TC0 A;  4LPB A;  2BRE A;  2HKJ A;  4PU9 A;  3O6O A;  3CWV A;  5D7D A;  4EGH A;  3TZ0 A;  4CWT A;  1MX0 A;  3JZ3 A;  1R62 A;  3B28 A;  5C93 A;  1AH8 A;  2YE7 A;  4EFT A;  2XX2 A;  2IWX A;  3TZ5 A;  1BGQ A;  2BU6 A;  4WUC A;  1BYQ A;  1TIL A;  1TID A;  5M4K A;  5BOD A;  2IOQ A;  2WI1 A;  3LNU A;  4KP4 A;  3BMY A;  4E02 A;  3D2R A;  3HZ5 A;  3O2F A;  3TTZ A;  5M4M A;  1TH8 A;  3R92 A;  5CTX A;  4DZY A;  2YEF A;  3VHC A;  4XIR A;  4YKW A;  2C2A A;  2O1V A;  1TBW A;  4FPP A;  3CGY A;  3G7E A;  4ASF A;  1KZN A;  1YSR A;  3QTF A;  3GIF A;  1ZWH A;  4MPC A;  3RLR A;  3HHU A;  2FYP A;  4KSH A;  4MBC A;  2ZBK B;  5IDJ A;  3EHH A;  3INW A;  4CWN A;  1NHJ A;  1UYF A;  4XDM A;  3GIG B;  1S14 A;  1YS3 A;  2ZDY A;  5CPH A;  4EM7 A;  3K98 A;  4LWG A;  2WI3 A;  4GT8 A;  1Z5C A;  3WHA A;  2AKP A;  4ZVI A;  5CTY A;  2IWS A;  1YET A;  2YEA A;  4BQJ A;  4URM A;  2H55 A;  3IED A;  1Y8N A;  3U2D A;  2H8M A;  2ZDX A;  3OW6 A;  1YC3 A;  5FND A;  3HYZ A;  2FWZ A;  3VHA A;  3R4P A;  5CTW A;  2BT0 A;  2XHR A;  4NH8 A;  2EXL A;  4YKU A;  3GIE A;  1KIJ A;  1QZR A;  3T2S A;  2Q8H A;  4FCQ A;  4EFU A;  2Q8F A;  3K60 A; 
#chains in the Genus database with same CATH topology
 3VAD A;  4R3M A;  2FXS A;  3ZXO A;  1NHI A;  4L8Z A;  1UYH A;  4CWR A;  3ZM7 A;  4MP7 A;  3C11 A;  2E0A A;  4XCL A;  3OMU A;  4XD8 A;  3CRK A;  2YGE A;  1UYG A;  2YK9 A;  4AWQ A;  2YGF A;  1Y8O A;  1GJV A;  4LWI A;  4CWO A;  1B3Q A;  4LWH A;  2WI4 A;  4ZKI A;  4BAE A;  2HG1 A;  2CCS A;  4XE2 A;  2XD6 A;  2CCT A;  1YC4 A;  3O0I A;  3PEH A;  3G75 A;  1UYE A;  4URL A;  3CYG A;  4R3A A;  2YE2 A;  1YER A;  5IDM A;  4P7A A;  5J6A A;  4HYM A;  4BQG A;  4O04 A;  2YED A;  5M4N A;  2IWU A;  3OWD A;  5D6P A;  1AM1 A;  4JAU A;  4XKO A;  4YKX A;  4V26 A;  5IN9 A;  3HZ1 A;  5F3K A;  1YT0 A;  4EMV A;  2IOP A;  2YEI A;  4ASG A;  3NMQ A;  4BIU A;  3TUH A;  1ZW9 A;  3RKZ A;  2WI5 A;  2YE4 A;  4YKT A;  3FT5 A;  2XDU A;  2YEJ A;  1I5D A;  2BSM A;  2XX5 A;  4P8O A;  4E00 A;  4QPK A;  1H7S A;  2YEB A;  2YE9 A;  4XIQ A;  2XX4 A;  1AH6 A;  2BU2 A;  1UYK A;  3CRL A;  4PRV A;  4AWP A;  2WI7 A;  4CWQ A;  4O0B A;  1NHH A;  2BYH A;  1Y4S A;  3KE6 A;  1U2O A;  4XTJ A;  4NH7 A;  2ZKJ A;  1MU5 A;  4QPJ A;  2BRC A;  4I3H A;  4GQT A;  1H7U A;  2WER A;  4EGI A;  1THN A;  3R91 A;  4CWF A;  2BU8 A;  2FWY A;  4L93 A;  4CE2 A;  4GFN A;  4R1F A;  3A0X A;  3LPS A;  4Q20 A;  3TZ2 A;  4KTN A;  3SL2 A;  2BTZ A;  3BM9 A;  1Z59 A;  4WUB A;  1B63 A;  3T10 A;  1IXM A;  2XDS A;  1I5B A;  3B24 A;  2YI5 A;  2JKI A;  4XKK A;  4MPN A;  1UYI A;  4H85 A;  3H80 A;  4X9L A;  2C1G A;  4H7Q A;  3B25 A;  4XIP A;  5CTU A;  1A4H A;  2VWC A;  2K5B A;  1Z5B A;  2YEE A;  4FMT A;  4GGL A;  2WI2 A;  2BU5 A;  4ASA A;  1JM6 A;  2WEP A;  2YEC A;  3R4M A;  4YKY A;  4MPE A;  1GKZ A;  4HXW A;  4O09 A;  3FT8 A;  3G7B A;  4LP0 A;  4O05 A;  2XK2 A;  3WQ9 A;  4L94 A;  2XJG A;  2JJC A;  5JEN A;  3T1K A;  5BOC A;  1I5C A;  4MOT A;  5D6Q A;  2ESA A;  2IOR A;  3RLP A;  2YEG A;  2XDL A;  2YEH A;  5D7C A;  2Q8G A;  3T0H A;  4EGK A;  2QFO A;  3U2K A;  2QG0 A;  3A0R A;  3ZXQ A;  4HYP A;  4EEH A;  3A0W A;  4U7O A;  1BXD A;  3C0E A;  1UY8 A;  3HYY A;  4HXZ A;  2YJX A;  4L91 A;  4FCP A;  1YES A;  2QG2 A;  2XAB A;  2XHX A;  2YE6 A;  4HZ0 A;  4GCZ A;  4CE1 A;  5F5R A;  3R4N A;  4NH9 A;  4ASB A;  4URN A;  4LWE A;  2VCI A;  4L90 A;  2YKB A;  3S5T A;  4XIT A;  3PEJ A;  3A0Y A;  4AS9 A;  3TZ4 A;  4WUD A;  1U0Z A;  2FTK A;  2VW5 A;  2CH4 A;  3A0T A;  4B7P A;  1ZXM A;  3B27 A;  2VCJ A;  4YKR A;  1EA6 A;  1YT1 A;  3OPD A;  2WI6 A;  3EKR A;  3R4O A;  1YC1 A;  4KQV A;  4U93 A;  2GQP A;  4JAV A;  1AMW A;  3QDD A;  3ZKB A;  1UY7 A;  1EI1 A;  2YE5 A;  3EHJ A;  2YE3 A;  3VHD A;  1QYE A;  2YI6 A;  2XDX A;  4MP2 A;  2YGA A;  2YKJ A;  4BXI A;  3H4L A;  2CCU A;  1YSZ A;  5L3J A;  5GGZ A;  2XJX A;  2WEQ A;  1Y4U A;  3Q5K A;  5FNF A;  1BKN A;  3D0B A;  3EHG A;  4JQL A;  2BYI A;  2YJW A;  3EKO A;  5M4P A;  4V25 A;  3HEK A;  2XHT A;  4YKZ A;  2BU7 A;  2QF6 A;  3CGZ A;  2HCH A;  4GEE A;  4DUH A;  1YT2 A;  1Y8P A;  3Q5J A;  4HY1 A;  4XKA A;  5J71 A;  5M4E A;  4E01 A;  3INX A;  4O07 A;  2YK2 A;  3D36 A;  3EHF A;  4URO A;  5CF0 A;  4PL9 A;  3GIG A;  1S16 A;  1OSF A;  4FCR A;  4HZ5 A;  4KSG A;  1UYM A;  3A0Z A;  4B6C A;  1UY6 A;  1GKX A;  1QY8 A;  5FWK A;  2Q2E B;  3U67 A;  4CWP A;  2YKE A;  2CGF A;  2YKI A;  3K97 A;  4U7N A;  4MB9 A;  4YKQ A;  3RLQ A;  5M4H A;  2YKC A;  4XCJ A;  1L0O A;  5FNC A;  1UYD A;  1I5A A;  4JAS A;  1PVG A;  2YI7 A;  3OWB A;  2PNR A;  1AJ6 A;  4K4O A;  1ZXN A;  3B26 A;  4W7T A;  4AWO A;  2O1U A;  2Q8I A;  3LMM A;  3FV5 A;  2YI0 A;  1I59 A;  4XC0 A;  1TC6 A;  2XDK A;  4LWF A;  3Q5L A;  3T0Z A;  4HY6 A;  3MNR P;  4H81 A;  2XJJ A;  4E72 A;  1US7 A;  5D7R A;  4KFG A;  1UY9 A;  4CWS A;  2CG9 A;  2XCM A;  4BIZ A;  2BZ5 A;  4PRX A;  2O1W A;  2HHI A;  1UYC A;  1ID0 A;  2GFD A;  4CE3 A;  3K99 A;  3DGE A;  3ZKD A;  1B62 A;  2UWD A;  1Z5A A;  2YE8 A;  1UYL A;  4I5S A;  1I58 A;  1TC0 A;  4LPB A;  2BRE A;  2HKJ A;  4PU9 A;  3O6O A;  3CWV A;  5D7D A;  4EGH A;  3TZ0 A;  4CWT A;  1MX0 A;  3JZ3 A;  1R62 A;  3B28 A;  5C93 A;  1AH8 A;  2YE7 A;  4EFT A;  2XX2 A;  2IWX A;  3TZ5 A;  1BGQ A;  2BU6 A;  4WUC A;  1BYQ A;  1TIL A;  1TID A;  5M4K A;  5BOD A;  2IOQ A;  2WI1 A;  3LNU A;  4KP4 A;  3BMY A;  4E02 A;  3D2R A;  3HZ5 A;  3O2F A;  3TTZ A;  5M4M A;  1TH8 A;  3R92 A;  5CTX A;  4DZY A;  2YEF A;  3VHC A;  4XIR A;  4YKW A;  2C2A A;  2O1V A;  1TBW A;  4FPP A;  3CGY A;  3G7E A;  4ASF A;  1KZN A;  1YSR A;  3QTF A;  3GIF A;  1ZWH A;  4MPC A;  3RLR A;  3HHU A;  2FYP A;  4KSH A;  4MBC A;  2ZBK B;  5IDJ A;  3EHH A;  3INW A;  4CWN A;  1NHJ A;  1UYF A;  4XDM A;  3GIG B;  1S14 A;  1YS3 A;  2ZDY A;  5CPH A;  4EM7 A;  3K98 A;  4LWG A;  2WI3 A;  4GT8 A;  1Z5C A;  3WHA A;  2AKP A;  4ZVI A;  5CTY A;  2IWS A;  1YET A;  2YEA A;  4BQJ A;  4URM A;  2H55 A;  3IED A;  1Y8N A;  3U2D A;  2H8M A;  2ZDX A;  3OW6 A;  1YC3 A;  5FND A;  3HYZ A;  2C1I A;  2FWZ A;  3VHA A;  1F51 A;  3R4P A;  5CTW A;  2BT0 A;  2XHR A;  4NH8 A;  2EXL A;  4YKU A;  3GIE A;  1KIJ A;  1QZR A;  3T2S A;  2Q8H A;  4FCQ A;  4EFU A;  2Q8F A;  3K60 A; 
#chains in the Genus database with same CATH homology
 3VAD A;  4R3M A;  2FXS A;  3ZXO A;  1NHI A;  4L8Z A;  1UYH A;  4CWR A;  3ZM7 A;  4MP7 A;  3C11 A;  2E0A A;  4XCL A;  3OMU A;  4XD8 A;  3CRK A;  2YGE A;  1UYG A;  2YK9 A;  4AWQ A;  2YGF A;  1Y8O A;  1GJV A;  4LWI A;  4CWO A;  1B3Q A;  4LWH A;  2WI4 A;  4ZKI A;  4BAE A;  2HG1 A;  2CCS A;  4XE2 A;  2XD6 A;  2CCT A;  1YC4 A;  3O0I A;  3PEH A;  3G75 A;  1UYE A;  4URL A;  4R3A A;  2YE2 A;  1YER A;  5IDM A;  4P7A A;  5J6A A;  4HYM A;  4BQG A;  4O04 A;  2YED A;  5M4N A;  2IWU A;  3OWD A;  5D6P A;  1AM1 A;  4JAU A;  4XKO A;  4YKX A;  4V26 A;  5IN9 A;  3HZ1 A;  5F3K A;  1YT0 A;  4EMV A;  2IOP A;  2YEI A;  4ASG A;  3NMQ A;  4BIU A;  3TUH A;  1ZW9 A;  3RKZ A;  2WI5 A;  2YE4 A;  4YKT A;  3FT5 A;  2XDU A;  2YEJ A;  1I5D A;  2BSM A;  2XX5 A;  4P8O A;  4E00 A;  4QPK A;  1H7S A;  2YEB A;  2YE9 A;  4XIQ A;  2XX4 A;  1AH6 A;  2BU2 A;  1UYK A;  3CRL A;  4PRV A;  4AWP A;  2WI7 A;  4CWQ A;  4O0B A;  1NHH A;  2BYH A;  1Y4S A;  3KE6 A;  1U2O A;  4XTJ A;  4NH7 A;  2ZKJ A;  1MU5 A;  4QPJ A;  2BRC A;  4I3H A;  4GQT A;  1H7U A;  2WER A;  4EGI A;  1THN A;  3R91 A;  4CWF A;  2BU8 A;  2FWY A;  4L93 A;  4CE2 A;  4GFN A;  4R1F A;  3A0X A;  3LPS A;  4Q20 A;  3TZ2 A;  4KTN A;  3SL2 A;  2BTZ A;  3BM9 A;  1Z59 A;  4WUB A;  1B63 A;  3T10 A;  2XDS A;  1I5B A;  3B24 A;  2YI5 A;  2JKI A;  4XKK A;  4MPN A;  1UYI A;  4H85 A;  3H80 A;  4X9L A;  4H7Q A;  3B25 A;  4XIP A;  5CTU A;  1A4H A;  2VWC A;  2K5B A;  1Z5B A;  2YEE A;  4FMT A;  4GGL A;  2WI2 A;  2BU5 A;  4ASA A;  1JM6 A;  2WEP A;  2YEC A;  3R4M A;  4YKY A;  4MPE A;  1GKZ A;  4HXW A;  4O09 A;  3FT8 A;  3G7B A;  4LP0 A;  4O05 A;  2XK2 A;  3WQ9 A;  4L94 A;  2XJG A;  2JJC A;  3T1K A;  5BOC A;  1I5C A;  4MOT A;  5D6Q A;  2ESA A;  2IOR A;  3RLP A;  2YEG A;  2XDL A;  2YEH A;  5D7C A;  2Q8G A;  3T0H A;  4EGK A;  2QFO A;  3U2K A;  2QG0 A;  3A0R A;  3ZXQ A;  4HYP A;  4EEH A;  3A0W A;  4U7O A;  1BXD A;  3C0E A;  1UY8 A;  3HYY A;  4HXZ A;  2YJX A;  4L91 A;  4FCP A;  1YES A;  2QG2 A;  2XAB A;  2XHX A;  2YE6 A;  4HZ0 A;  4GCZ A;  4CE1 A;  5F5R A;  3R4N A;  4NH9 A;  4ASB A;  4URN A;  4LWE A;  2VCI A;  4L90 A;  2YKB A;  4XIT A;  3PEJ A;  3A0Y A;  4AS9 A;  3TZ4 A;  4WUD A;  1U0Z A;  2VW5 A;  2CH4 A;  3A0T A;  4B7P A;  1ZXM A;  3B27 A;  2VCJ A;  4YKR A;  1EA6 A;  1YT1 A;  3OPD A;  2WI6 A;  3EKR A;  3R4O A;  1YC1 A;  4KQV A;  4U93 A;  2GQP A;  4JAV A;  1AMW A;  3QDD A;  3ZKB A;  1UY7 A;  1EI1 A;  2YE5 A;  3EHJ A;  2YE3 A;  3VHD A;  1QYE A;  2YI6 A;  2XDX A;  4MP2 A;  2YGA A;  2YKJ A;  4BXI A;  3H4L A;  2CCU A;  1YSZ A;  5L3J A;  5GGZ A;  2XJX A;  2WEQ A;  1Y4U A;  3Q5K A;  5FNF A;  1BKN A;  3D0B A;  3EHG A;  4JQL A;  2BYI A;  2YJW A;  3EKO A;  5M4P A;  4V25 A;  3HEK A;  2XHT A;  4YKZ A;  2BU7 A;  2QF6 A;  3CGZ A;  2HCH A;  4GEE A;  4DUH A;  1YT2 A;  1Y8P A;  3Q5J A;  4HY1 A;  4XKA A;  5J71 A;  5M4E A;  4E01 A;  3INX A;  4O07 A;  2YK2 A;  3D36 A;  3EHF A;  4URO A;  5CF0 A;  4PL9 A;  3GIG A;  1S16 A;  1OSF A;  4FCR A;  4HZ5 A;  4KSG A;  1UYM A;  3A0Z A;  4B6C A;  1UY6 A;  1GKX A;  1QY8 A;  5FWK A;  2Q2E B;  3U67 A;  4CWP A;  2YKE A;  2CGF A;  2YKI A;  3K97 A;  4U7N A;  4MB9 A;  4YKQ A;  3RLQ A;  5M4H A;  2YKC A;  4XCJ A;  1L0O A;  5FNC A;  1UYD A;  1I5A A;  4JAS A;  1PVG A;  2YI7 A;  3OWB A;  2PNR A;  1AJ6 A;  4K4O A;  1ZXN A;  3B26 A;  4W7T A;  4AWO A;  2O1U A;  2Q8I A;  3FV5 A;  2YI0 A;  1I59 A;  4XC0 A;  1TC6 A;  2XDK A;  4LWF A;  3Q5L A;  3T0Z A;  4HY6 A;  3MNR P;  4H81 A;  2XJJ A;  1US7 A;  5D7R A;  4KFG A;  1UY9 A;  4CWS A;  2CG9 A;  2XCM A;  4BIZ A;  2BZ5 A;  4PRX A;  2O1W A;  1UYC A;  1ID0 A;  2GFD A;  4CE3 A;  3K99 A;  3DGE A;  3ZKD A;  1B62 A;  2UWD A;  1Z5A A;  2YE8 A;  1UYL A;  4I5S A;  1I58 A;  1TC0 A;  4LPB A;  2BRE A;  2HKJ A;  4PU9 A;  3O6O A;  3CWV A;  5D7D A;  4EGH A;  3TZ0 A;  4CWT A;  1MX0 A;  3JZ3 A;  1R62 A;  3B28 A;  5C93 A;  1AH8 A;  2YE7 A;  4EFT A;  2XX2 A;  2IWX A;  3TZ5 A;  1BGQ A;  2BU6 A;  4WUC A;  1BYQ A;  1TIL A;  1TID A;  5M4K A;  5BOD A;  2IOQ A;  2WI1 A;  3LNU A;  4KP4 A;  3BMY A;  4E02 A;  3D2R A;  3HZ5 A;  3O2F A;  3TTZ A;  5M4M A;  1TH8 A;  3R92 A;  5CTX A;  4DZY A;  2YEF A;  3VHC A;  4XIR A;  4YKW A;  2C2A A;  2O1V A;  1TBW A;  4FPP A;  3CGY A;  3G7E A;  4ASF A;  1KZN A;  1YSR A;  3QTF A;  3GIF A;  1ZWH A;  4MPC A;  3RLR A;  3HHU A;  2FYP A;  4KSH A;  4MBC A;  2ZBK B;  5IDJ A;  3EHH A;  3INW A;  4CWN A;  1NHJ A;  1UYF A;  4XDM A;  3GIG B;  1S14 A;  1YS3 A;  2ZDY A;  5CPH A;  4EM7 A;  3K98 A;  4LWG A;  2WI3 A;  4GT8 A;  1Z5C A;  3WHA A;  2AKP A;  4ZVI A;  5CTY A;  2IWS A;  1YET A;  2YEA A;  4BQJ A;  4URM A;  2H55 A;  3IED A;  1Y8N A;  3U2D A;  2H8M A;  2ZDX A;  3OW6 A;  1YC3 A;  5FND A;  3HYZ A;  2FWZ A;  3VHA A;  3R4P A;  5CTW A;  2BT0 A;  2XHR A;  4NH8 A;  2EXL A;  4YKU A;  3GIE A;  1KIJ A;  1QZR A;  3T2S A;  2Q8H A;  4FCQ A;  4EFU A;  2Q8F A;  3K60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...