5CTWA

Crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
192
structure length
192
Chain Sequence
AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based discovery of DNA gyrase inhibitors targeting the ATPase subunit of GyrB.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 60
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5ctwA00
1NHHA 4PRVA 1YSRA 4GT8A 3ZKDA 1Z59A 2YK9A 5J6AA 2Q8FA 1S14A 1AH8A 5BOCA 2XHTA 3G7EA 2BYIA 3VADA 2YKIA 2BZ5A 5FWKA 1GKZA 3HYZA 1UYKA 1YC4A 3T1KA 2ZDYA 2YI5A 4XKAA 5D6QA 1YERA 5M4PA 4U7NA 4LP0A 1NHIA 1KIJA 4YKZA 4O07A 5FNDA 2WI2A 4PRXA 4ASGA 3R4NA 4EGHA 3ZXQA 1AH6A 2BU6A 4HY6A 5BODA 4JQLA 3CRLA 4CWSA 1BGQA 2WI4A 4NH7A 3LPSA 5J71A 4CWFA 1UYCA 2WERA 4CE3A 5CF0A 5GGZA 1TC6A 4U7OA 2E0AA 2XX4A 4V26A 3EKOA 1S16A 3B27A 4I3HA 2BREA 1YT0A 4EGIA 3OPDA 1ZW9A 4E01A 2CCSA 4AWPA 3O6OA 5CTYA 5CTXA 4BQJA 2BYHA 4AS9A 1H7SA 1B62A 4HXZA 5M4HA 3O0IA 3CWVA 2QFOA 3B24A 5IN9A 1YT1A 4EFUA 3IEDA 2YGAA 2O1VA 3HEKA 2IWUA 3T10A 4B6CA 5D6PA 4YKYA 3HZ5A 3T0ZA 2YI6A 1L0OA 4CE1A 2XJXA 2YEIA 2BU2A 3K99A 4PL9A 3SL2A 4ZVIA 2HCHA 3G7BA 4LWEA 3FT5A 2BTZA 1YC3A 1UYLA 4MBCA 1Y8PA 4MP7A 3C0EA 4L90A 4EEHA 2YEDA 3TZ4A 2VWCA 1U2OA 4XKKA 1A4HA 1BKNA 1BYQA 2XCMA 4GEEA 3TTZA 2ZKJA 1H7UA 4ASBA 4KSGA 3A0TA 4L93A 2H55A 3U67A 4L91A 3DGEA 1THNA 2YJWA 3MNRP 5CTWA 1UYHA 4WUDA 4P7AA 2QG0A 2Q8HA 3R91A 4HYMA 2QF6A 1AM1A 5CPHA 2YKBA 1TBWA 4DUHA 4LWFA 2YEJA 4O09A 1JM6A 4QPJA 4XTJA 4O04A 3T2SA 1I5CA 4XDMA 1UY9A 2Q8IA 3T0HA 2C2AA 1TILA 2YE9A 2YKJA 2K5BA 4YKRA 1Y8NA 4HXWA 5F5RA 2XDSA 4MOTA 5CTUA 4NH9A 4W7TA 1UY7A 4XC0A 1PVGA 4MPEA 3EHHA 1EA6A 4KQVA 2BSMA 4JAUA 5M4KA 3CGZA 1UYFA 5IDJA 3A0XA 1Y4UA 2XK2A 3Q5KA 2VW5A 4ZKIA 2WEPA 3OW6A 4DZYA 3EKRA 3VHAA 4FCPA 3Q5JA 4FMTA 2CCUA 2WI7A 2IWSA 4H85A 3TZ5A 2YE6A 2Q8GA 1ZWHA 4FCRA 1UYEA 2PNRA 2GFDA 2YI0A 5M4NA 4MPCA 2WI1A 4EM7A 2FYPA 4EFTA 2XDKA 1Y4SA 1AJ6A 3R4PA 1NHJA 3BM9A 5L3JA 3B26A 2YKCA 2QG2A 3VHCA 4EMVA 3U2KA 4XIQA 4FPPA 3BMYA 4L8ZA 2WI5A 1TIDA 1I58A 2CGFA 2BRCA 3R4OA 4BIZA 3B25A 2YE5A 2YEAA 1MX0A 4CWOA 1I5DA 3QTFA 5D7RA 2JJCA 3CGYA 2ESAA 1GJVA 4CWNA 1I5BA 2IORA 5D7DA 2O1WA 5F3KA 3VHDA 1TH8A 4KP4A 4NH8A 4UROA 1ID0A 1YETA 1OSFA 5M4EA 4YKTA 3B28A 1B3QA 3INWA 4QPKA 3K97A 2FXSA 3PEHA 4URLA 2EXLA 3ZXOA 3TUHA 3GIGB 4YKQA 1GKXA 3A0WA 4GQTA 2XHRA 3RLPA 2CG9A 4AWQA 5FNFA 1U0ZA 4FCQA 4BIUA 3H80A 1UY6A 2BU8A 4K4OA 1UY8A 3A0YA 4WUCA 1QZRA 2YI7A 3GIEA 4GGLA 4O0BA 2UWDA 2CCTA 2YEFA 1B63A 3R4MA 2YK2A 3A0RA 3HZ1A 2HKJA 1Z5BA 1YESA 2YE7A 2IWXA 2YEEA 3D36A 3RLRA 4BQGA 3D2RA 1TC0A 2XX2A 3EHFA 3C11A 2CH4A 4BXIA 2XABA 4XD8A 4LWIA 1EI1A 4U93A 3H4LA 2ZBKB 3INXA 4XIPA 4ASAA 3JZ3A 4AWOA 3O2FA 4URNA 2IOPA 2YEBA 1MU5A 4JAVA 4CWQA 3WQ9A 4HZ5A 1Z5CA 4LWGA 4EGKA 5FNCA 3Q5LA 1ZXMA 2VCJA 4HYPA 3RKZA 4CWPA 2YKEA 2JKIA 1Y8OA 2Q2EB 3OMUA 3U2DA 1I59A 4P8OA 4WUBA 4XE2A 3K98A 4MP2A 2YGFA 3EHGA 4XCJA 2FWYA 3NMQA 1BXDA 3EHJA 3GIGA 3HHUA 4Q20A 2BU5A 3WHAA 1AMWA 4KTNA 4YKWA 4E00A 4X9LA 2YECA 4XITA 2GQPA 4HY1A 4GCZA 1YS3A 4V25A 5M4MA 5IDMA 4LPBA 3D0BA 1ZXNA 2AKPA 4XIRA 1KZNA 3ZM7A 4B7PA 1QY8A 1R62A 4GFNA 1YSZA 3PEJA 4KFGA 3RLQA 2XX5A 3K60A 2XJGA 3OWDA 1UYIA 4I5SA 4MPNA 3TZ0A 1YT2A 2BU7A 3KE6A 3TZ2A 3HYYA 4XKOA 4LWHA 2YE8A 1UYGA 1QYEA 2XDUA 4JASA 4R3AA 4HZ0A 2YE2A 2ZDXA 4H81A 4YKUA 4CWTA 5D7CA 2YEGA 3R92A 2WI3A 1Z5AA 2XDLA 2YE4A 4H7QA 2IOQA 4CE2A 4O05A 4L94A 4URMA 1I5AA 2YEHA 3G75A 1UYDA 4KSHA 4PU9A 2YE3A 2FWZA 4CWRA 2BT0A 2XD6A 4ASFA 4BAEA 3FV5A 1UYMA 2XHXA 2WI6A 2H8MA 4R1FA 2XDXA 2WEQA 2O1UA 3A0ZA 4MB9A 4R3MA 1US7A 3ZKBA 2VCIA 3LNUA 2XJJA 3FT8A 5C93A 2YJXA 4XCLA 3OWBA 3QDDA 3CRKA 2YGEA 1YC1A 4E02A 3GIFA 4YKXA 2HG1A
chains in the Genus database with same CATH superfamily
1NHHA 4PRVA 1YSRA 4GT8A 3ZKDA 1Z59A 2YK9A 5J6AA 2Q8FA 1S14A 1AH8A 5BOCA 2XHTA 3G7EA 2BYIA 3VADA 4E72A 2YKIA 2BZ5A 5FWKA 1GKZA 3HYZA 1UYKA 1YC4A 3T1KA 2ZDYA 2YI5A 4XKAA 5D6QA 1YERA 5M4PA 4U7NA 4LP0A 1NHIA 1KIJA 4YKZA 4O07A 5FNDA 2WI2A 4PRXA 4ASGA 3R4NA 4EGHA 3ZXQA 1AH6A 2BU6A 4HY6A 5BODA 4JQLA 3CRLA 4CWSA 1BGQA 2WI4A 4NH7A 3LPSA 5J71A 4CWFA 1UYCA 2WERA 4CE3A 5CF0A 5GGZA 1TC6A 4U7OA 2E0AA 2XX4A 4V26A 3EKOA 1S16A 3S5TA 3B27A 4I3HA 2BREA 1YT0A 4EGIA 3OPDA 1ZW9A 4E01A 2CCSA 4AWPA 3O6OA 5CTYA 5CTXA 4BQJA 2BYHA 4AS9A 1H7SA 1B62A 4HXZA 5M4HA 3O0IA 3CWVA 2QFOA 3B24A 5IN9A 1YT1A 4EFUA 3IEDA 2YGAA 2O1VA 3HEKA 2IWUA 3T10A 4B6CA 5D6PA 4YKYA 3HZ5A 3T0ZA 2YI6A 1L0OA 4CE1A 2XJXA 1IXMA 2YEIA 2BU2A 3K99A 4PL9A 3SL2A 4ZVIA 2HCHA 3G7BA 4LWEA 3FT5A 2BTZA 1YC3A 1UYLA 4MBCA 1Y8PA 4MP7A 3C0EA 4L90A 4EEHA 2YEDA 3TZ4A 2VWCA 1U2OA 4XKKA 1A4HA 1BKNA 1BYQA 2XCMA 4GEEA 3TTZA 2ZKJA 1H7UA 4ASBA 4KSGA 3A0TA 4L93A 2H55A 3U67A 4L91A 3DGEA 1THNA 2YJWA 3MNRP 5CTWA 1UYHA 4WUDA 4P7AA 2QG0A 2Q8HA 3R91A 4HYMA 2QF6A 1AM1A 5CPHA 2YKBA 1TBWA 4DUHA 4LWFA 2YEJA 2HHIA 4O09A 1JM6A 4QPJA 4XTJA 4O04A 3T2SA 1I5CA 4XDMA 2C1GA 1UY9A 2Q8IA 3T0HA 2C2AA 1TILA 2YE9A 2YKJA 2K5BA 4YKRA 1Y8NA 4HXWA 5F5RA 2XDSA 4MOTA 5CTUA 4NH9A 4W7TA 1UY7A 3LMMA 4XC0A 1PVGA 4MPEA 3EHHA 1EA6A 4KQVA 2BSMA 4JAUA 5M4KA 3CGZA 1UYFA 5IDJA 3A0XA 1Y4UA 2XK2A 3Q5KA 2VW5A 4ZKIA 2WEPA 3OW6A 4DZYA 3EKRA 3VHAA 4FCPA 3Q5JA 4FMTA 2CCUA 2WI7A 2IWSA 4H85A 3TZ5A 2YE6A 2Q8GA 1ZWHA 4FCRA 1UYEA 2PNRA 2GFDA 2YI0A 5M4NA 4MPCA 2WI1A 4EM7A 2FYPA 4EFTA 2XDKA 1Y4SA 1AJ6A 3R4PA 1NHJA 3BM9A 5L3JA 3B26A 2YKCA 2FTKA 2QG2A 3VHCA 4EMVA 3U2KA 4XIQA 4FPPA 3BMYA 4L8ZA 1F51A 2WI5A 1TIDA 1I58A 2CGFA 2BRCA 3R4OA 4BIZA 3B25A 2YE5A 2YEAA 1MX0A 4CWOA 1I5DA 3QTFA 5D7RA 2JJCA 3CGYA 2ESAA 1GJVA 4CWNA 1I5BA 2IORA 5D7DA 2O1WA 2C1IA 5F3KA 3VHDA 5JENA 1TH8A 4KP4A 4NH8A 4UROA 1ID0A 1YETA 1OSFA 5M4EA 4YKTA 3B28A 1B3QA 3INWA 4QPKA 3K97A 2FXSA 3PEHA 4URLA 2EXLA 3ZXOA 3TUHA 3GIGB 4YKQA 1GKXA 3A0WA 4GQTA 2XHRA 3RLPA 2CG9A 4AWQA 5FNFA 1U0ZA 4FCQA 4BIUA 3H80A 1UY6A 2BU8A 4K4OA 1UY8A 3A0YA 4WUCA 1QZRA 2YI7A 3GIEA 4GGLA 4O0BA 2UWDA 2CCTA 2YEFA 1B63A 3R4MA 2YK2A 3A0RA 3HZ1A 2HKJA 1Z5BA 1YESA 2YE7A 2IWXA 2YEEA 3D36A 3RLRA 4BQGA 3D2RA 1TC0A 2XX2A 3EHFA 3C11A 2CH4A 4BXIA 2XABA 4XD8A 4LWIA 1EI1A 4U93A 3H4LA 2ZBKB 3INXA 4XIPA 4ASAA 3JZ3A 4AWOA 3O2FA 4URNA 2IOPA 2YEBA 1MU5A 4JAVA 4CWQA 3WQ9A 4HZ5A 1Z5CA 4LWGA 4EGKA 5FNCA 3Q5LA 1ZXMA 2VCJA 4HYPA 3RKZA 4CWPA 2YKEA 2JKIA 1Y8OA 2Q2EB 3OMUA 3U2DA 1I59A 4P8OA 4WUBA 4XE2A 3K98A 4MP2A 2YGFA 3EHGA 4XCJA 2FWYA 3NMQA 1BXDA 3EHJA 3GIGA 3HHUA 4Q20A 2BU5A 3WHAA 1AMWA 4KTNA 4YKWA 4E00A 4X9LA 2YECA 4XITA 2GQPA 4HY1A 4GCZA 1YS3A 4V25A 5M4MA 5IDMA 4LPBA 3D0BA 1ZXNA 2AKPA 4XIRA 1KZNA 3ZM7A 4B7PA 1QY8A 1R62A 4GFNA 1YSZA 3PEJA 4KFGA 3RLQA 2XX5A 3K60A 2XJGA 3OWDA 1UYIA 4I5SA 4MPNA 3TZ0A 1YT2A 2BU7A 3KE6A 3TZ2A 3HYYA 4XKOA 4LWHA 2YE8A 1UYGA 1QYEA 2XDUA 4JASA 4R3AA 4HZ0A 2YE2A 2ZDXA 4H81A 4YKUA 4CWTA 5D7CA 2YEGA 3R92A 2WI3A 1Z5AA 2XDLA 2YE4A 4H7QA 3CYGA 2IOQA 4CE2A 4O05A 4L94A 4URMA 1I5AA 2YEHA 3G75A 1UYDA 4KSHA 4PU9A 2YE3A 2FWZA 4CWRA 2BT0A 2XD6A 4ASFA 4BAEA 3FV5A 1UYMA 2XHXA 2WI6A 2H8MA 4R1FA 2XDXA 2WEQA 2O1UA 3A0ZA 4MB9A 4R3MA 1US7A 3ZKBA 2VCIA 3LNUA 2XJJA 3FT8A 5C93A 2YJXA 4XCLA 3OWBA 3QDDA 3CRKA 2YGEA 1YC1A 4E02A 3GIFA 4YKXA 2HG1A
chains in the Genus database with same CATH topology
1NHHA 4PRVA 1YSRA 4GT8A 3ZKDA 1Z59A 2YK9A 5J6AA 2Q8FA 1S14A 1AH8A 5BOCA 2XHTA 3G7EA 2BYIA 3VADA 2YKIA 2BZ5A 5FWKA 1GKZA 3HYZA 1UYKA 1YC4A 3T1KA 2ZDYA 2YI5A 4XKAA 5D6QA 1YERA 5M4PA 4U7NA 4LP0A 1NHIA 1KIJA 4YKZA 4O07A 5FNDA 2WI2A 4PRXA 4ASGA 3R4NA 4EGHA 3ZXQA 1AH6A 2BU6A 4HY6A 5BODA 4JQLA 3CRLA 4CWSA 1BGQA 2WI4A 4NH7A 3LPSA 5J71A 4CWFA 1UYCA 2WERA 4CE3A 5CF0A 5GGZA 1TC6A 4U7OA 2E0AA 2XX4A 4V26A 3EKOA 1S16A 3B27A 4I3HA 2BREA 1YT0A 4EGIA 3OPDA 1ZW9A 4E01A 2CCSA 4AWPA 3O6OA 5CTYA 5CTXA 4BQJA 2BYHA 4AS9A 1H7SA 1B62A 4HXZA 5M4HA 3O0IA 3CWVA 2QFOA 3B24A 5IN9A 1YT1A 4EFUA 3IEDA 2YGAA 2O1VA 3HEKA 2IWUA 3T10A 4B6CA 5D6PA 4YKYA 3HZ5A 3T0ZA 2YI6A 1L0OA 4CE1A 2XJXA 2YEIA 2BU2A 3K99A 4PL9A 3SL2A 4ZVIA 2HCHA 3G7BA 4LWEA 3FT5A 2BTZA 1YC3A 1UYLA 4MBCA 1Y8PA 4MP7A 3C0EA 4L90A 4EEHA 2YEDA 3TZ4A 2VWCA 1U2OA 4XKKA 1A4HA 1BKNA 1BYQA 2XCMA 4GEEA 3TTZA 2ZKJA 1H7UA 4ASBA 4KSGA 3A0TA 4L93A 2H55A 3U67A 4L91A 3DGEA 1THNA 2YJWA 3MNRP 5CTWA 1UYHA 4WUDA 4P7AA 2QG0A 2Q8HA 3R91A 4HYMA 2QF6A 1AM1A 5CPHA 2YKBA 1TBWA 4DUHA 4LWFA 2YEJA 4O09A 1JM6A 4QPJA 4XTJA 4O04A 3T2SA 1I5CA 4XDMA 1UY9A 2Q8IA 3T0HA 2C2AA 1TILA 2YE9A 2YKJA 2K5BA 4YKRA 1Y8NA 4HXWA 5F5RA 2XDSA 4MOTA 5CTUA 4NH9A 4W7TA 1UY7A 4XC0A 1PVGA 4MPEA 3EHHA 1EA6A 4KQVA 2BSMA 4JAUA 5M4KA 3CGZA 1UYFA 5IDJA 3A0XA 1Y4UA 2XK2A 3Q5KA 2VW5A 4ZKIA 2WEPA 3OW6A 4DZYA 3EKRA 3VHAA 4FCPA 3Q5JA 4FMTA 2CCUA 2WI7A 2IWSA 4H85A 3TZ5A 2YE6A 2Q8GA 1ZWHA 4FCRA 1UYEA 2PNRA 2GFDA 2YI0A 5M4NA 4MPCA 2WI1A 4EM7A 2FYPA 4EFTA 2XDKA 1Y4SA 1AJ6A 3R4PA 1NHJA 3BM9A 5L3JA 3B26A 2YKCA 2QG2A 3VHCA 4EMVA 3U2KA 4XIQA 4FPPA 3BMYA 4L8ZA 2WI5A 1TIDA 1I58A 2CGFA 2BRCA 3R4OA 4BIZA 3B25A 2YE5A 2YEAA 1MX0A 4CWOA 1I5DA 3QTFA 5D7RA 2JJCA 3CGYA 2ESAA 1GJVA 4CWNA 1I5BA 2IORA 5D7DA 2O1WA 5F3KA 3VHDA 1TH8A 4KP4A 4NH8A 4UROA 1ID0A 1YETA 1OSFA 5M4EA 4YKTA 3B28A 1B3QA 3INWA 4QPKA 3K97A 2FXSA 3PEHA 4URLA 2EXLA 3ZXOA 3TUHA 3GIGB 4YKQA 1GKXA 3A0WA 4GQTA 2XHRA 3RLPA 2CG9A 4AWQA 5FNFA 1U0ZA 4FCQA 4BIUA 3H80A 1UY6A 2BU8A 4K4OA 1UY8A 3A0YA 4WUCA 1QZRA 2YI7A 3GIEA 4GGLA 4O0BA 2UWDA 2CCTA 2YEFA 1B63A 3R4MA 2YK2A 3A0RA 3HZ1A 2HKJA 1Z5BA 1YESA 2YE7A 2IWXA 2YEEA 3D36A 3RLRA 4BQGA 3D2RA 1TC0A 2XX2A 3EHFA 3C11A 2CH4A 4BXIA 2XABA 4XD8A 4LWIA 1EI1A 4U93A 3H4LA 2ZBKB 3INXA 4XIPA 4ASAA 3JZ3A 4AWOA 3O2FA 4URNA 2IOPA 2YEBA 1MU5A 4JAVA 4CWQA 3WQ9A 4HZ5A 1Z5CA 4LWGA 4EGKA 5FNCA 3Q5LA 1ZXMA 2VCJA 4HYPA 3RKZA 4CWPA 2YKEA 2JKIA 1Y8OA 2Q2EB 3OMUA 3U2DA 1I59A 4P8OA 4WUBA 4XE2A 3K98A 4MP2A 2YGFA 3EHGA 4XCJA 2FWYA 3NMQA 1BXDA 3EHJA 3GIGA 3HHUA 4Q20A 2BU5A 3WHAA 1AMWA 4KTNA 4YKWA 4E00A 4X9LA 2YECA 4XITA 2GQPA 4HY1A 4GCZA 1YS3A 4V25A 5M4MA 5IDMA 4LPBA 3D0BA 1ZXNA 2AKPA 4XIRA 1KZNA 3ZM7A 4B7PA 1QY8A 1R62A 4GFNA 1YSZA 3PEJA 4KFGA 3RLQA 2XX5A 3K60A 2XJGA 3OWDA 1UYIA 4I5SA 4MPNA 3TZ0A 1YT2A 2BU7A 3KE6A 3TZ2A 3HYYA 4XKOA 4LWHA 2YE8A 1UYGA 1QYEA 2XDUA 4JASA 4R3AA 4HZ0A 2YE2A 2ZDXA 4H81A 4YKUA 4CWTA 5D7CA 2YEGA 3R92A 2WI3A 1Z5AA 2XDLA 2YE4A 4H7QA 2IOQA 4CE2A 4O05A 4L94A 4URMA 1I5AA 2YEHA 3G75A 1UYDA 4KSHA 4PU9A 2YE3A 2FWZA 4CWRA 2BT0A 2XD6A 4ASFA 4BAEA 3FV5A 1UYMA 2XHXA 2WI6A 2H8MA 4R1FA 2XDXA 2WEQA 2O1UA 3A0ZA 4MB9A 4R3MA 1US7A 3ZKBA 2VCIA 3LNUA 2XJJA 3FT8A 5C93A 2YJXA 4XCLA 3OWBA 3QDDA 3CRKA 2YGEA 1YC1A 4E02A 3GIFA 4YKXA 2HG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHH A;  4PRV A;  1YSR A;  4GT8 A;  3ZKD A;  1Z59 A;  2YK9 A;  5J6A A;  2Q8F A;  1S14 A;  1AH8 A;  5BOC A;  2XHT A;  3G7E A;  2BYI A;  3VAD A;  2YKI A;  2BZ5 A;  5FWK A;  1GKZ A;  3HYZ A;  1UYK A;  1YC4 A;  3T1K A;  2ZDY A;  2YI5 A;  4XKA A;  5D6Q A;  1YER A;  5M4P A;  4U7N A;  4LP0 A;  1NHI A;  1KIJ A;  4YKZ A;  4O07 A;  5FND A;  2WI2 A;  4PRX A;  4ASG A;  3R4N A;  4EGH A;  3ZXQ A;  1AH6 A;  2BU6 A;  4HY6 A;  5BOD A;  4JQL A;  3CRL A;  4CWS A;  1BGQ A;  2WI4 A;  4NH7 A;  3LPS A;  5J71 A;  4CWF A;  1UYC A;  2WER A;  4CE3 A;  5CF0 A;  5GGZ A;  1TC6 A;  4U7O A;  2E0A A;  2XX4 A;  4V26 A;  3EKO A;  1S16 A;  3B27 A;  4I3H A;  2BRE A;  1YT0 A;  4EGI A;  3OPD A;  1ZW9 A;  4E01 A;  2CCS A;  4AWP A;  3O6O A;  5CTY A;  5CTX A;  4BQJ A;  2BYH A;  4AS9 A;  1H7S A;  1B62 A;  4HXZ A;  5M4H A;  3O0I A;  3CWV A;  2QFO A;  3B24 A;  5IN9 A;  1YT1 A;  4EFU A;  3IED A;  2YGA A;  2O1V A;  3HEK A;  2IWU A;  3T10 A;  4B6C A;  5D6P A;  4YKY A;  3HZ5 A;  3T0Z A;  2YI6 A;  1L0O A;  4CE1 A;  2XJX A;  2YEI A;  2BU2 A;  3K99 A;  4PL9 A;  3SL2 A;  4ZVI A;  2HCH A;  3G7B A;  4LWE A;  3FT5 A;  2BTZ A;  1YC3 A;  1UYL A;  4MBC A;  1Y8P A;  4MP7 A;  3C0E A;  4L90 A;  4EEH A;  2YED A;  3TZ4 A;  2VWC A;  1U2O A;  4XKK A;  1A4H A;  1BKN A;  1BYQ A;  2XCM A;  4GEE A;  3TTZ A;  2ZKJ A;  1H7U A;  4ASB A;  4KSG A;  3A0T A;  4L93 A;  2H55 A;  3U67 A;  4L91 A;  3DGE A;  1THN A;  2YJW A;  3MNR P;  5CTW A;  1UYH A;  4WUD A;  4P7A A;  2QG0 A;  2Q8H A;  3R91 A;  4HYM A;  2QF6 A;  1AM1 A;  5CPH A;  2YKB A;  1TBW A;  4DUH A;  4LWF A;  2YEJ A;  4O09 A;  1JM6 A;  4QPJ A;  4XTJ A;  4O04 A;  3T2S A;  1I5C A;  4XDM A;  1UY9 A;  2Q8I A;  3T0H A;  2C2A A;  1TIL A;  2YE9 A;  2YKJ A;  2K5B A;  4YKR A;  1Y8N A;  4HXW A;  5F5R A;  2XDS A;  4MOT A;  5CTU A;  4NH9 A;  4W7T A;  1UY7 A;  4XC0 A;  1PVG A;  4MPE A;  3EHH A;  1EA6 A;  4KQV A;  2BSM A;  4JAU A;  5M4K A;  3CGZ A;  1UYF A;  5IDJ A;  3A0X A;  1Y4U A;  2XK2 A;  3Q5K A;  2VW5 A;  4ZKI A;  2WEP A;  3OW6 A;  4DZY A;  3EKR A;  3VHA A;  4FCP A;  3Q5J A;  4FMT A;  2CCU A;  2WI7 A;  2IWS A;  4H85 A;  3TZ5 A;  2YE6 A;  2Q8G A;  1ZWH A;  4FCR A;  1UYE A;  2PNR A;  2GFD A;  2YI0 A;  5M4N A;  4MPC A;  2WI1 A;  4EM7 A;  2FYP A;  4EFT A;  2XDK A;  1Y4S A;  1AJ6 A;  3R4P A;  1NHJ A;  3BM9 A;  5L3J A;  3B26 A;  2YKC A;  2QG2 A;  3VHC A;  4EMV A;  3U2K A;  4XIQ A;  4FPP A;  3BMY A;  4L8Z A;  2WI5 A;  1TID A;  1I58 A;  2CGF A;  2BRC A;  3R4O A;  4BIZ A;  3B25 A;  2YE5 A;  2YEA A;  1MX0 A;  4CWO A;  1I5D A;  3QTF A;  5D7R A;  2JJC A;  3CGY A;  2ESA A;  1GJV A;  4CWN A;  1I5B A;  2IOR A;  5D7D A;  2O1W A;  5F3K A;  3VHD A;  1TH8 A;  4KP4 A;  4NH8 A;  4URO A;  1ID0 A;  1YET A;  1OSF A;  5M4E A;  4YKT A;  3B28 A;  1B3Q A;  3INW A;  4QPK A;  3K97 A;  2FXS A;  3PEH A;  4URL A;  2EXL A;  3ZXO A;  3TUH A;  3GIG B;  4YKQ A;  1GKX A;  3A0W A;  4GQT A;  2XHR A;  3RLP A;  2CG9 A;  4AWQ A;  5FNF A;  1U0Z A;  4FCQ A;  4BIU A;  3H80 A;  1UY6 A;  2BU8 A;  4K4O A;  1UY8 A;  3A0Y A;  4WUC A;  1QZR A;  2YI7 A;  3GIE A;  4GGL A;  4O0B A;  2UWD A;  2CCT A;  2YEF A;  1B63 A;  3R4M A;  2YK2 A;  3A0R A;  3HZ1 A;  2HKJ A;  1Z5B A;  1YES A;  2YE7 A;  2IWX A;  2YEE A;  3D36 A;  3RLR A;  4BQG A;  3D2R A;  1TC0 A;  2XX2 A;  3EHF A;  3C11 A;  2CH4 A;  4BXI A;  2XAB A;  4XD8 A;  4LWI A;  1EI1 A;  4U93 A;  3H4L A;  2ZBK B;  3INX A;  4XIP A;  4ASA A;  3JZ3 A;  4AWO A;  3O2F A;  4URN A;  2IOP A;  2YEB A;  1MU5 A;  4JAV A;  4CWQ A;  3WQ9 A;  4HZ5 A;  1Z5C A;  4LWG A;  4EGK A;  5FNC A;  3Q5L A;  1ZXM A;  2VCJ A;  4HYP A;  3RKZ A;  4CWP A;  2YKE A;  2JKI A;  1Y8O A;  2Q2E B;  3OMU A;  3U2D A;  1I59 A;  4P8O A;  4WUB A;  4XE2 A;  3K98 A;  4MP2 A;  2YGF A;  3EHG A;  4XCJ A;  2FWY A;  3NMQ A;  1BXD A;  3EHJ A;  3GIG A;  3HHU A;  4Q20 A;  2BU5 A;  3WHA A;  1AMW A;  4KTN A;  4YKW A;  4E00 A;  4X9L A;  2YEC A;  4XIT A;  2GQP A;  4HY1 A;  4GCZ A;  1YS3 A;  4V25 A;  5M4M A;  5IDM A;  4LPB A;  3D0B A;  1ZXN A;  2AKP A;  4XIR A;  1KZN A;  3ZM7 A;  4B7P A;  1QY8 A;  1R62 A;  4GFN A;  1YSZ A;  3PEJ A;  4KFG A;  3RLQ A;  2XX5 A;  3K60 A;  2XJG A;  3OWD A;  1UYI A;  4I5S A;  4MPN A;  3TZ0 A;  1YT2 A;  2BU7 A;  3KE6 A;  3TZ2 A;  3HYY A;  4XKO A;  4LWH A;  2YE8 A;  1UYG A;  1QYE A;  2XDU A;  4JAS A;  4R3A A;  4HZ0 A;  2YE2 A;  2ZDX A;  4H81 A;  4YKU A;  4CWT A;  5D7C A;  2YEG A;  3R92 A;  2WI3 A;  1Z5A A;  2XDL A;  2YE4 A;  4H7Q A;  2IOQ A;  4CE2 A;  4O05 A;  4L94 A;  4URM A;  1I5A A;  2YEH A;  3G75 A;  1UYD A;  4KSH A;  4PU9 A;  2YE3 A;  2FWZ A;  4CWR A;  2BT0 A;  2XD6 A;  4ASF A;  4BAE A;  3FV5 A;  1UYM A;  2XHX A;  2WI6 A;  2H8M A;  4R1F A;  2XDX A;  2WEQ A;  2O1U A;  3A0Z A;  4MB9 A;  4R3M A;  1US7 A;  3ZKB A;  2VCI A;  3LNU A;  2XJJ A;  3FT8 A;  5C93 A;  2YJX A;  4XCL A;  3OWB A;  3QDD A;  3CRK A;  2YGE A;  1YC1 A;  4E02 A;  3GIF A;  4YKX A;  2HG1 A; 
#chains in the Genus database with same CATH topology
 1NHH A;  4PRV A;  1YSR A;  4GT8 A;  3ZKD A;  1Z59 A;  2YK9 A;  5J6A A;  2Q8F A;  1S14 A;  1AH8 A;  5BOC A;  2XHT A;  3G7E A;  2BYI A;  3VAD A;  4E72 A;  2YKI A;  2BZ5 A;  5FWK A;  1GKZ A;  3HYZ A;  1UYK A;  1YC4 A;  3T1K A;  2ZDY A;  2YI5 A;  4XKA A;  5D6Q A;  1YER A;  5M4P A;  4U7N A;  4LP0 A;  1NHI A;  1KIJ A;  4YKZ A;  4O07 A;  5FND A;  2WI2 A;  4PRX A;  4ASG A;  3R4N A;  4EGH A;  3ZXQ A;  1AH6 A;  2BU6 A;  4HY6 A;  5BOD A;  4JQL A;  3CRL A;  4CWS A;  1BGQ A;  2WI4 A;  4NH7 A;  3LPS A;  5J71 A;  4CWF A;  1UYC A;  2WER A;  4CE3 A;  5CF0 A;  5GGZ A;  1TC6 A;  4U7O A;  2E0A A;  2XX4 A;  4V26 A;  3EKO A;  1S16 A;  3S5T A;  3B27 A;  4I3H A;  2BRE A;  1YT0 A;  4EGI A;  3OPD A;  1ZW9 A;  4E01 A;  2CCS A;  4AWP A;  3O6O A;  5CTY A;  5CTX A;  4BQJ A;  2BYH A;  4AS9 A;  1H7S A;  1B62 A;  4HXZ A;  5M4H A;  3O0I A;  3CWV A;  2QFO A;  3B24 A;  5IN9 A;  1YT1 A;  4EFU A;  3IED A;  2YGA A;  2O1V A;  3HEK A;  2IWU A;  3T10 A;  4B6C A;  5D6P A;  4YKY A;  3HZ5 A;  3T0Z A;  2YI6 A;  1L0O A;  4CE1 A;  2XJX A;  1IXM A;  2YEI A;  2BU2 A;  3K99 A;  4PL9 A;  3SL2 A;  4ZVI A;  2HCH A;  3G7B A;  4LWE A;  3FT5 A;  2BTZ A;  1YC3 A;  1UYL A;  4MBC A;  1Y8P A;  4MP7 A;  3C0E A;  4L90 A;  4EEH A;  2YED A;  3TZ4 A;  2VWC A;  1U2O A;  4XKK A;  1A4H A;  1BKN A;  1BYQ A;  2XCM A;  4GEE A;  3TTZ A;  2ZKJ A;  1H7U A;  4ASB A;  4KSG A;  3A0T A;  4L93 A;  2H55 A;  3U67 A;  4L91 A;  3DGE A;  1THN A;  2YJW A;  3MNR P;  5CTW A;  1UYH A;  4WUD A;  4P7A A;  2QG0 A;  2Q8H A;  3R91 A;  4HYM A;  2QF6 A;  1AM1 A;  5CPH A;  2YKB A;  1TBW A;  4DUH A;  4LWF A;  2YEJ A;  2HHI A;  4O09 A;  1JM6 A;  4QPJ A;  4XTJ A;  4O04 A;  3T2S A;  1I5C A;  4XDM A;  2C1G A;  1UY9 A;  2Q8I A;  3T0H A;  2C2A A;  1TIL A;  2YE9 A;  2YKJ A;  2K5B A;  4YKR A;  1Y8N A;  4HXW A;  5F5R A;  2XDS A;  4MOT A;  5CTU A;  4NH9 A;  4W7T A;  1UY7 A;  3LMM A;  4XC0 A;  1PVG A;  4MPE A;  3EHH A;  1EA6 A;  4KQV A;  2BSM A;  4JAU A;  5M4K A;  3CGZ A;  1UYF A;  5IDJ A;  3A0X A;  1Y4U A;  2XK2 A;  3Q5K A;  2VW5 A;  4ZKI A;  2WEP A;  3OW6 A;  4DZY A;  3EKR A;  3VHA A;  4FCP A;  3Q5J A;  4FMT A;  2CCU A;  2WI7 A;  2IWS A;  4H85 A;  3TZ5 A;  2YE6 A;  2Q8G A;  1ZWH A;  4FCR A;  1UYE A;  2PNR A;  2GFD A;  2YI0 A;  5M4N A;  4MPC A;  2WI1 A;  4EM7 A;  2FYP A;  4EFT A;  2XDK A;  1Y4S A;  1AJ6 A;  3R4P A;  1NHJ A;  3BM9 A;  5L3J A;  3B26 A;  2YKC A;  2FTK A;  2QG2 A;  3VHC A;  4EMV A;  3U2K A;  4XIQ A;  4FPP A;  3BMY A;  4L8Z A;  1F51 A;  2WI5 A;  1TID A;  1I58 A;  2CGF A;  2BRC A;  3R4O A;  4BIZ A;  3B25 A;  2YE5 A;  2YEA A;  1MX0 A;  4CWO A;  1I5D A;  3QTF A;  5D7R A;  2JJC A;  3CGY A;  2ESA A;  1GJV A;  4CWN A;  1I5B A;  2IOR A;  5D7D A;  2O1W A;  2C1I A;  5F3K A;  3VHD A;  5JEN A;  1TH8 A;  4KP4 A;  4NH8 A;  4URO A;  1ID0 A;  1YET A;  1OSF A;  5M4E A;  4YKT A;  3B28 A;  1B3Q A;  3INW A;  4QPK A;  3K97 A;  2FXS A;  3PEH A;  4URL A;  2EXL A;  3ZXO A;  3TUH A;  3GIG B;  4YKQ A;  1GKX A;  3A0W A;  4GQT A;  2XHR A;  3RLP A;  2CG9 A;  4AWQ A;  5FNF A;  1U0Z A;  4FCQ A;  4BIU A;  3H80 A;  1UY6 A;  2BU8 A;  4K4O A;  1UY8 A;  3A0Y A;  4WUC A;  1QZR A;  2YI7 A;  3GIE A;  4GGL A;  4O0B A;  2UWD A;  2CCT A;  2YEF A;  1B63 A;  3R4M A;  2YK2 A;  3A0R A;  3HZ1 A;  2HKJ A;  1Z5B A;  1YES A;  2YE7 A;  2IWX A;  2YEE A;  3D36 A;  3RLR A;  4BQG A;  3D2R A;  1TC0 A;  2XX2 A;  3EHF A;  3C11 A;  2CH4 A;  4BXI A;  2XAB A;  4XD8 A;  4LWI A;  1EI1 A;  4U93 A;  3H4L A;  2ZBK B;  3INX A;  4XIP A;  4ASA A;  3JZ3 A;  4AWO A;  3O2F A;  4URN A;  2IOP A;  2YEB A;  1MU5 A;  4JAV A;  4CWQ A;  3WQ9 A;  4HZ5 A;  1Z5C A;  4LWG A;  4EGK A;  5FNC A;  3Q5L A;  1ZXM A;  2VCJ A;  4HYP A;  3RKZ A;  4CWP A;  2YKE A;  2JKI A;  1Y8O A;  2Q2E B;  3OMU A;  3U2D A;  1I59 A;  4P8O A;  4WUB A;  4XE2 A;  3K98 A;  4MP2 A;  2YGF A;  3EHG A;  4XCJ A;  2FWY A;  3NMQ A;  1BXD A;  3EHJ A;  3GIG A;  3HHU A;  4Q20 A;  2BU5 A;  3WHA A;  1AMW A;  4KTN A;  4YKW A;  4E00 A;  4X9L A;  2YEC A;  4XIT A;  2GQP A;  4HY1 A;  4GCZ A;  1YS3 A;  4V25 A;  5M4M A;  5IDM A;  4LPB A;  3D0B A;  1ZXN A;  2AKP A;  4XIR A;  1KZN A;  3ZM7 A;  4B7P A;  1QY8 A;  1R62 A;  4GFN A;  1YSZ A;  3PEJ A;  4KFG A;  3RLQ A;  2XX5 A;  3K60 A;  2XJG A;  3OWD A;  1UYI A;  4I5S A;  4MPN A;  3TZ0 A;  1YT2 A;  2BU7 A;  3KE6 A;  3TZ2 A;  3HYY A;  4XKO A;  4LWH A;  2YE8 A;  1UYG A;  1QYE A;  2XDU A;  4JAS A;  4R3A A;  4HZ0 A;  2YE2 A;  2ZDX A;  4H81 A;  4YKU A;  4CWT A;  5D7C A;  2YEG A;  3R92 A;  2WI3 A;  1Z5A A;  2XDL A;  2YE4 A;  4H7Q A;  3CYG A;  2IOQ A;  4CE2 A;  4O05 A;  4L94 A;  4URM A;  1I5A A;  2YEH A;  3G75 A;  1UYD A;  4KSH A;  4PU9 A;  2YE3 A;  2FWZ A;  4CWR A;  2BT0 A;  2XD6 A;  4ASF A;  4BAE A;  3FV5 A;  1UYM A;  2XHX A;  2WI6 A;  2H8M A;  4R1F A;  2XDX A;  2WEQ A;  2O1U A;  3A0Z A;  4MB9 A;  4R3M A;  1US7 A;  3ZKB A;  2VCI A;  3LNU A;  2XJJ A;  3FT8 A;  5C93 A;  2YJX A;  4XCL A;  3OWB A;  3QDD A;  3CRK A;  2YGE A;  1YC1 A;  4E02 A;  3GIF A;  4YKX A;  2HG1 A; 
#chains in the Genus database with same CATH homology
 1NHH A;  4PRV A;  1YSR A;  4GT8 A;  3ZKD A;  1Z59 A;  2YK9 A;  5J6A A;  2Q8F A;  1S14 A;  1AH8 A;  5BOC A;  2XHT A;  3G7E A;  2BYI A;  3VAD A;  2YKI A;  2BZ5 A;  5FWK A;  1GKZ A;  3HYZ A;  1UYK A;  1YC4 A;  3T1K A;  2ZDY A;  2YI5 A;  4XKA A;  5D6Q A;  1YER A;  5M4P A;  4U7N A;  4LP0 A;  1NHI A;  1KIJ A;  4YKZ A;  4O07 A;  5FND A;  2WI2 A;  4PRX A;  4ASG A;  3R4N A;  4EGH A;  3ZXQ A;  1AH6 A;  2BU6 A;  4HY6 A;  5BOD A;  4JQL A;  3CRL A;  4CWS A;  1BGQ A;  2WI4 A;  4NH7 A;  3LPS A;  5J71 A;  4CWF A;  1UYC A;  2WER A;  4CE3 A;  5CF0 A;  5GGZ A;  1TC6 A;  4U7O A;  2E0A A;  2XX4 A;  4V26 A;  3EKO A;  1S16 A;  3B27 A;  4I3H A;  2BRE A;  1YT0 A;  4EGI A;  3OPD A;  1ZW9 A;  4E01 A;  2CCS A;  4AWP A;  3O6O A;  5CTY A;  5CTX A;  4BQJ A;  2BYH A;  4AS9 A;  1H7S A;  1B62 A;  4HXZ A;  5M4H A;  3O0I A;  3CWV A;  2QFO A;  3B24 A;  5IN9 A;  1YT1 A;  4EFU A;  3IED A;  2YGA A;  2O1V A;  3HEK A;  2IWU A;  3T10 A;  4B6C A;  5D6P A;  4YKY A;  3HZ5 A;  3T0Z A;  2YI6 A;  1L0O A;  4CE1 A;  2XJX A;  2YEI A;  2BU2 A;  3K99 A;  4PL9 A;  3SL2 A;  4ZVI A;  2HCH A;  3G7B A;  4LWE A;  3FT5 A;  2BTZ A;  1YC3 A;  1UYL A;  4MBC A;  1Y8P A;  4MP7 A;  3C0E A;  4L90 A;  4EEH A;  2YED A;  3TZ4 A;  2VWC A;  1U2O A;  4XKK A;  1A4H A;  1BKN A;  1BYQ A;  2XCM A;  4GEE A;  3TTZ A;  2ZKJ A;  1H7U A;  4ASB A;  4KSG A;  3A0T A;  4L93 A;  2H55 A;  3U67 A;  4L91 A;  3DGE A;  1THN A;  2YJW A;  3MNR P;  5CTW A;  1UYH A;  4WUD A;  4P7A A;  2QG0 A;  2Q8H A;  3R91 A;  4HYM A;  2QF6 A;  1AM1 A;  5CPH A;  2YKB A;  1TBW A;  4DUH A;  4LWF A;  2YEJ A;  4O09 A;  1JM6 A;  4QPJ A;  4XTJ A;  4O04 A;  3T2S A;  1I5C A;  4XDM A;  1UY9 A;  2Q8I A;  3T0H A;  2C2A A;  1TIL A;  2YE9 A;  2YKJ A;  2K5B A;  4YKR A;  1Y8N A;  4HXW A;  5F5R A;  2XDS A;  4MOT A;  5CTU A;  4NH9 A;  4W7T A;  1UY7 A;  4XC0 A;  1PVG A;  4MPE A;  3EHH A;  1EA6 A;  4KQV A;  2BSM A;  4JAU A;  5M4K A;  3CGZ A;  1UYF A;  5IDJ A;  3A0X A;  1Y4U A;  2XK2 A;  3Q5K A;  2VW5 A;  4ZKI A;  2WEP A;  3OW6 A;  4DZY A;  3EKR A;  3VHA A;  4FCP A;  3Q5J A;  4FMT A;  2CCU A;  2WI7 A;  2IWS A;  4H85 A;  3TZ5 A;  2YE6 A;  2Q8G A;  1ZWH A;  4FCR A;  1UYE A;  2PNR A;  2GFD A;  2YI0 A;  5M4N A;  4MPC A;  2WI1 A;  4EM7 A;  2FYP A;  4EFT A;  2XDK A;  1Y4S A;  1AJ6 A;  3R4P A;  1NHJ A;  3BM9 A;  5L3J A;  3B26 A;  2YKC A;  2QG2 A;  3VHC A;  4EMV A;  3U2K A;  4XIQ A;  4FPP A;  3BMY A;  4L8Z A;  2WI5 A;  1TID A;  1I58 A;  2CGF A;  2BRC A;  3R4O A;  4BIZ A;  3B25 A;  2YE5 A;  2YEA A;  1MX0 A;  4CWO A;  1I5D A;  3QTF A;  5D7R A;  2JJC A;  3CGY A;  2ESA A;  1GJV A;  4CWN A;  1I5B A;  2IOR A;  5D7D A;  2O1W A;  5F3K A;  3VHD A;  1TH8 A;  4KP4 A;  4NH8 A;  4URO A;  1ID0 A;  1YET A;  1OSF A;  5M4E A;  4YKT A;  3B28 A;  1B3Q A;  3INW A;  4QPK A;  3K97 A;  2FXS A;  3PEH A;  4URL A;  2EXL A;  3ZXO A;  3TUH A;  3GIG B;  4YKQ A;  1GKX A;  3A0W A;  4GQT A;  2XHR A;  3RLP A;  2CG9 A;  4AWQ A;  5FNF A;  1U0Z A;  4FCQ A;  4BIU A;  3H80 A;  1UY6 A;  2BU8 A;  4K4O A;  1UY8 A;  3A0Y A;  4WUC A;  1QZR A;  2YI7 A;  3GIE A;  4GGL A;  4O0B A;  2UWD A;  2CCT A;  2YEF A;  1B63 A;  3R4M A;  2YK2 A;  3A0R A;  3HZ1 A;  2HKJ A;  1Z5B A;  1YES A;  2YE7 A;  2IWX A;  2YEE A;  3D36 A;  3RLR A;  4BQG A;  3D2R A;  1TC0 A;  2XX2 A;  3EHF A;  3C11 A;  2CH4 A;  4BXI A;  2XAB A;  4XD8 A;  4LWI A;  1EI1 A;  4U93 A;  3H4L A;  2ZBK B;  3INX A;  4XIP A;  4ASA A;  3JZ3 A;  4AWO A;  3O2F A;  4URN A;  2IOP A;  2YEB A;  1MU5 A;  4JAV A;  4CWQ A;  3WQ9 A;  4HZ5 A;  1Z5C A;  4LWG A;  4EGK A;  5FNC A;  3Q5L A;  1ZXM A;  2VCJ A;  4HYP A;  3RKZ A;  4CWP A;  2YKE A;  2JKI A;  1Y8O A;  2Q2E B;  3OMU A;  3U2D A;  1I59 A;  4P8O A;  4WUB A;  4XE2 A;  3K98 A;  4MP2 A;  2YGF A;  3EHG A;  4XCJ A;  2FWY A;  3NMQ A;  1BXD A;  3EHJ A;  3GIG A;  3HHU A;  4Q20 A;  2BU5 A;  3WHA A;  1AMW A;  4KTN A;  4YKW A;  4E00 A;  4X9L A;  2YEC A;  4XIT A;  2GQP A;  4HY1 A;  4GCZ A;  1YS3 A;  4V25 A;  5M4M A;  5IDM A;  4LPB A;  3D0B A;  1ZXN A;  2AKP A;  4XIR A;  1KZN A;  3ZM7 A;  4B7P A;  1QY8 A;  1R62 A;  4GFN A;  1YSZ A;  3PEJ A;  4KFG A;  3RLQ A;  2XX5 A;  3K60 A;  2XJG A;  3OWD A;  1UYI A;  4I5S A;  4MPN A;  3TZ0 A;  1YT2 A;  2BU7 A;  3KE6 A;  3TZ2 A;  3HYY A;  4XKO A;  4LWH A;  2YE8 A;  1UYG A;  1QYE A;  2XDU A;  4JAS A;  4R3A A;  4HZ0 A;  2YE2 A;  2ZDX A;  4H81 A;  4YKU A;  4CWT A;  5D7C A;  2YEG A;  3R92 A;  2WI3 A;  1Z5A A;  2XDL A;  2YE4 A;  4H7Q A;  2IOQ A;  4CE2 A;  4O05 A;  4L94 A;  4URM A;  1I5A A;  2YEH A;  3G75 A;  1UYD A;  4KSH A;  4PU9 A;  2YE3 A;  2FWZ A;  4CWR A;  2BT0 A;  2XD6 A;  4ASF A;  4BAE A;  3FV5 A;  1UYM A;  2XHX A;  2WI6 A;  2H8M A;  4R1F A;  2XDX A;  2WEQ A;  2O1U A;  3A0Z A;  4MB9 A;  4R3M A;  1US7 A;  3ZKB A;  2VCI A;  3LNU A;  2XJJ A;  3FT8 A;  5C93 A;  2YJX A;  4XCL A;  3OWB A;  3QDD A;  3CRK A;  2YGE A;  1YC1 A;  4E02 A;  3GIF A;  4YKX A;  2HG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...