5CV6A

Crystal structure of staphylococcal nuclease variant delta+phs v66h/i92e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/I92E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv6A00
4EQOA 5HURA 1EY5A 2WACA 2RBMA 4PMBA 2LKVA 1TR5A 4KY5A 4ME5A 3C1EA 3HEJA 4N9PA 4WORA 2KHSA 5C3XA 5ISRA 3LX0A 4E6IA 1KDAA 4HMJA 5EKKA 1STBA 2EXZA 2ENBA 1STHA 5IGBA 2EYLA 1KAAA 1EZ6A 5CV5A 5C5LA 2OXPA 2F0MA 4DGZA 2RDFA 5J22A 3MEHA 3NP8A 2HQEA 5CV8A 4F7XA 2F0OA 3SK6A 3MHBA 4K5VA 3EROA 5CV9A 3NXWA 4ZUJA 2SNSA 5CR3A 5K5PA 1KDCA 4F8MA 4G57A 2O4XA 3H6MA 5KIXA 3C1FA 3T16A 1EYDA 1EY0A 4K8IA 5JOBA 3EJIA 1AEXA 4J6HA 4NMZA 3RUZA 5KYIA 5KRUA 3OSOA 4YIJA 1IHZA 2EYJA 2PZUA 3D4DA 3OWFA 1JOQA 4NKLA 2F0EA 1F2YA 2F0NA 3OMCA 1SNMA 1SYBA 4OL7A 4R8NA 4J1MA 4B9XA 5C4ZA 1U9RA 2M00A 4KD3A 2KQ3A 1EY6A 3P1HA 2EYMA 2PW7A 5F2DA 5J39A 1SYCA 1SNQA 3U9OA 2QDBA 4NP5A 1RKNA 1SNCA 2F0IA 2OF1A 4KJNA 5DEHA 3SXHA 4EVOA 4S3SA 2F0LA 5IOCA 1EQVA 1SNPA 1ENAA 4DF7A 2F0TA 1TQOA 3T13A 5HGTA 5I6YA 4RKLA 4K5XA 3P75A 5C4HA 5I6WA 5NUCA 4KHVA 5IODA 3MXPA 4QF4A 3TP7A 3PMFA 3OMGA 4ZQ3A 3MVVA 5KYLA 2F0UA 2F0FA 1NSNS 2PZTA 4DFAA 5IIFA 4RKBA 1A2UA 3SK4A 3E5SA 3V2TA 5CGKA 4IALA 3TP5A 2F3WA 1F2MA 1NUCA 1STGA 5KGUA 1EY8A 2OEOA 3QOLA 3QB3A 5CV4A 4ZUIA 1STYA 1ENCA 3S9WA 3QOJA 4I65A 5IGDA 2F0VA 2EYFA 2RKSA 5IGGA 3R3OA 4K2LA 1EYCA 5C6AA 5DAUA 4KY6A 2PYKA 4KY7A 3NHHA 4K6DA 3HZXA 4WRDA 2EY5A 2EY2A 1SYEA 1SYFA 3SHLA 1EY7A 4KJOA 5J1ZA 3NUCA 1EY4A 2EYPA 2F0DA 5I9OA 1A2TA 1A3VA 1SNDA 4MIUA 2NUCA 1SNOA 3NQTA 4B9WA 1JORA 5E1FA 2F0HA 4IZ8A 4QB4A 1A3UA 1JOKA 3D4WA 4K5WA 4KV6A 4EQPA 3TP8A 4EQNA 4H7BA 3NK9A 4ID6A 5IGEA 1EZ8A 1II3A 1KDBA 4PMCA 1TT2A 3VA5A 3D8GA 1SYDA 5M9OA 3SK8A 2F0QA 4N9TA 1JOOA 4K8JA 2F0WA 2PZWA 3DMUA 4NDXA 1A3TA 4K2KA 5E3FA 2F0PA 2EY6A 3BDLA 3D6CA 1EY9A 3SR1A 4HMIA 5CC4A 2EYOA 1SYGA 4HTHA 4LAAA 2SOBA 4TRDA 4QMGA 5IGCA 2F0SA 3MZ5A 4KTAA 5CV6A 4DU9A 3TP6A 1STAA 2F3VA 2SNMA 5JAVA 2F0KA 1EYAA 5CV7A 1F2ZA 4KD4A 3ERQA 5C3WA 1KABA 2PQEA 5KEEA 5EKLA 3EVQA 5EGTA 3SK5A 2F0GA 3ITPA 4IUNA 4ODGA 2EYHA 3TMEA 5I9PA 2EY1A 3BDCA 5C5MA 3DHQA 5IGFA 4K14A 1STNA 2PW5A 2F0JA 4PNYA
chains in the Genus database with same CATH superfamily
4IFDI 5FO7B 2G9DA 4YCVA 2BE5D 3RZOB 1R4QB 2ZJRA 1B53A 2NTSA 3MEHA 1X9NA 4ZAIA 4RCNA 1WTRA 1PH3A 3EROA 4A3FG 5C3EH 3IL8A 2Q2TA 4ZK9B 3S1NH 3BVGA 2JP1A 1ZYRC 4K0KL 5EKIA 4K8IA 2ZXOA 1PA6A 1BR9A 1SNMA 2HHHQ 3BVZA 2KBNA 2MQHA 5M5WB 4XYQA 3CRKC 4IOAA 4FO2A 1VQOA 4A3DG 1EQVA 1AZPA 2F0TA 3E9IA 2QKIC 2UXBQ 1KQSA 1UAPA 3RZOH 1WTHA 5IT9c 1PV4A 1FJGQ 2VQFQ 3J81E 1SE8A 3AEVA 2KCTA 4JV5L 1A62A 2K5NA 2B2YC 2R7ZH 4JBMA 2K33A 1YNJC 1Z47A 2K04A 3A8KE 4JYAQ 3W1BA 1HRJA 4RAUC 4CDEC 1MJEA 4EQ5A 1D1IA 5M5WH 4DUYL 1Q81C 2YU9B 2OCEA 1Q8IA 4G7ZC 1VQ8A 2B63B 3PO3B 1CQVA 3RNUA 4OWXB 4R4CA 4HR7B 4DK0A 4H02A 2MP1A 1W3SA 4F88A 4MNOA 2JA7B 1RCVD 1TT2A 1EU4A 1XMQQ 4WJWA 1T5EA 3GD7A 3SR1A 2E76C 5IYCG 2KECA 2KHIA 3I4OA 4GKJL 1XWEA 5CV7A 3DEPA 2L5TA 1BBUA 3S1RB 3ITPA 2CH4W 4JW0A 3CMEA 2YV5A 5C5MA 4GZYC 3M7GA 1AP0A 2PQAB 2EPBA 4LMQD 4DR6Q 3GDEA 3H91A 4EQOA 2YU9H 1HUNA 2ZM6Q 1QUQA 1JQYD 4J8QA 1LYLA 2PNHA 4E6IA 1PH1A 1KDAA 1FVIA 1VQMA 4DV1L 4BY7G 3W2DA 2JA7H 1CSQA 4CKCA 1MGSA 1PTOB 5LMUL 1I5FA 2K5DA 4X3UA 1BQQT 1V43A 3A0JA 2EJFC 1U4LA 3JAML 2K75A 3HOUG 2R92G 2KQ3A 2ES2A 4C3IG 5J39A 3S1RH 3V96A 2QGQA 4DAYA 2CW0D 4JYAL 2KHJA 3SGIA 1Y1VB 4A3KG 3UI2A 2UUAQ 1TY0A 3TSSA 4NXNQ 3C46A 1X56A 4DFAA 5D3DA 4QY7A 1JMCA 1PTOH 2C9OA 5BN3A 1BCPD 1CKNA 4RGNA 4ULLA 4IOCA 3NTHA 1OXVA 5CV4A 4CKEA 3WWVA 4I65A 1H9SA 1HCZA 5C6AA 4HAEA 4A3BG 2C5CA 2JEBI 4PZ7A 3GTOH 1JWSD 4BS9A 2AQ1B 1PFBA 3NPPA 3HKZG 3K7UC 3NWTA 2KENA 4TVAB 2CVRA 3ZJYC 1MKHA 3RD4A 4FDBA 2Y0SE 3IFTA 2N88A 1EIGA 2PMZE 1ET9A 4C1NI 4PMWA 4LF5L 2NVYB 3K0YA 2BCOA 5M9OA 1SYDA 2A8VA 4K8JA 1L0WA 3ULPA 3F1ZA 1ESFA 1A3TA 2M2LA 2VB3X 2OQ0A 3B6YA 1G6PA 1PFSA 1A6XA 1XTDA 1S5ED 1BUVT 4QMGA 2CQOA 4DV6Q 3K7AB 5IE8A 3PUWA 3HS0C 3ER0A 1RDPD 3BDCA 2CFMA 5GQOA 4DAPA 4PNYA 5HURA 4JI6L 3HOVG 4JPBW 4N9PA 2JA6H 1E2WA 2Z8LA 1T5XD 2XSCA 3M4QA 2L15A 4A3JG 2NVYH 5JJLA 4IJLA 3EQLC 2F52A 1S4ZA 2IHEA 3PO2G 1XNQQ 4YY3L 4M1UB 2O4XA 3OIQA 3G48A 1EY0A 1DGSA 3HOXG 5KYIA 2EYJA 1X55A 3K7AH 2F0NA 4OL7A 1EU3A 4KD3A 1EQQA 1V1OA 4ILWA 1VQ6A 5IYDG 3PUZA 5M5XB 1TWAB 4GLVB 2EIFA 4CDFC 4X66Q 2DUDA 1LTLA 1DOMA 4R4IA 2F4VQ 2JXMB 1BF4A 2VS1A 3GTMH 4RMFA 3D31A 4RFBA 3J7AF 4DV3Q 4XYOA 3OTOQ 5CGKA 3D3RA 4A3MB 2OWOA 2HQLA 5C3EG 4APVA 2K4KA 1CQFA 3EA6A 3S2DB 3Q0AA 4G4KA 1BOSA 2SEBD 2A6EC 4MTKA 1EYCA 4JG2A 3L2PA 1O78A 4A4IA 1VMPA 3VYTA 3OW2A 2F0DA 5M5XH 1TWAH 4FVMA 1QCBD 2IT1A 1WTPA 2WB1E 1QE6A 4IFDH 3VYUA 4FF1A 4H7BA 1QWYA 1KRSA 5T1IA 2X6GA 1GJXA 1SE4A 2BA1A 3G7LA 1UE1A 2PZWA 1VQAA 3DMUA 1CHPD 3CAMA 3E0JA 2EY6A 4A3MH 4JI8Q 1B9NA 2HIVA 3G6EA 2R7ZG 4EGVA 2JE6I 3I4NB 3S2DH 1F2ZA 3KBGA 4OELB 4NB3A 3S16B 4WJ3M 1KABA 1RHPA 3K6OA 1XNQL 1XMOQ 3R93A 5BR8L 3TMEA 2BDOA 2PW5A 2WIIB 1Q1EA 3R2TA 4BXXH 4R4TA 2B2VA 3E3XA 4KY5A 1HR0Q 2NVXB 1HNWL 4DR5Q 4QIWE 3PQIA 1PTOD 1EZ6A 5C5LA 2WAQE 5LHY1 1C7YA 2R3ZA 1X3EA 2AMCB 4KHPL 1HA5A 5CV9A 5I2YA 4ZUJA 5K5PA 2QCPX 3A54A 1KDCA 3X3MA 4F8MA 3M4OB 4A75A 4XT1B 1YNNC 5JPMC 5KRUA 3CQZB 3OTOL 3I4NH 1JOQA 4NKLA 5IT9E 4R8NA 3FKIG 1K8AC 1K28A 3S16H 3P1HA 3LWEA 4YHHL 1RKNA 5JJKA 5JJIA 2IX1A 3I2ZA 2NZOA 4IO9A 5HGTA 3SVMA 3J81i 2MO0A 2ICEC 3P75A 2NVXH 1CM9A 2L55A 1YVCA 4WJ4A 1QILA 2Z4IA 4QF4A 3O13A 3TP7A 3OMGA 1VQBA 4HIMA 2JA7G 1XPRA 4MHEA 1I4XA 1VF5C 1B9MA 2DNEA 2K5QA 1I50H 1BXTA 1HQMC 4B3SQ 4B3RL 3MEFA 1WI5A 3CQZH 3VA7A 4DNRB 2J4XA 4BY7B 1QVGA 4HIDA 3PIO3 1HTLD 1EEFD 4MIUA 2XGTA 2NUCA 1LM0A 4YWMA 1JORA 3M3YB 1MHWC 5ELCA 1B50A 1A3UA 3D4WA 1M4VA 1HZBA 3DLLA 5E4WC 1YBYA 1II3A 5IYCH 4CBVA 1L1OB 3SK8A 1PTOF 4XIGS 5GADC 4M8AA 4DN4M 3HOUB 2R92B 1EY9A 1NR2A 2YYZA 3T1HQ 4C56C 1DCZA 1VQFA 4JC0A 4GNXA 1VQCA 2F0KA 1JR0D 1GUGA 4KD4A 4DK6C 4PZ6A 1HZCA 4LF4L 3K0XA 1IBLQ 2DJGC 4JI7Q 1IYUA 3CCRA 5D14A 3K5NA 3PIP3 1GUWA 1WCMB 2PNRC 4JI4Q 3MXGA 3WOEA 5C3XA 3M3YH 1VQ5A 4GN4B 2ENBA 1STHA 2ID0A 4A76A 3S1MB 1KAAA 3K8AA 1ZKOA 5CV8A 2HQEA 1SMYC 4HCSA 3ZYYX 4A3BB 2OT2A 2AQ2B 2JJQA 2LSSA 1XXGA 3J80c 1NE3A 3HKZB 3NTKA 4J6HA 1BVSA 1GO3E 4H13C 2CWAA 4Z9CB 3TDQA 3P7JA 5JJZA 3STBC 1X3QA 1HNXQ 1JB3A 3F2CA 5JVH3 3KK7A 2NZHA 4A3LH 1WTQA 4EVOA 4DF7A 2E5LQ 2IX0A 2Z9HA 3CW2C 1ICWA 1S72A 1WCMH 3UE1A 2JA6G 3T4AC 4DPGA 5FLXc 1M1KC 3S1MH 5KYLA 2NN6I 2DNCA 3SK4A 4TSSA 4B3ML 1C9OA 1FR3A 1L0YB 1STGA 3CKIB 4RGTA 4CKBA 4LFCL 1F9SA 4DR7L 4DR3L 2BE5C 1O7YA 4HSPA 3NHHA 1B8AA 3KLSA 2LMCB 2RCFA 4KJOA 4ZCKA 3CHBD 4K0KQ 4JI3Q 1YJ9A 4QB4A 3PO2B 4IUVA 1PH4A 2LFNA 1DZ1A 3OHXC 1ILQA 3IRBA 3J80L 1C8CA 1JOOA 4OIKA 4P72A 2ICIA 2R7DA 1GHJA 1NMFA 4FXKC 4DA2A 2VW9A 1BCPB 3A8JE 4HTHA 1SYGA 3GP7A 2SOBA 4XDXA 2F3VA 2XVSA 4R8IA 4AH6A 3FP9A 5C3WA 4LUZA 3GV6A 1X54A 2BA0A 4JI1L 2B2UA 1P8LA 1WYDA 4JV5Q 2K05A 5K36H 5GAHC 1B70B 4DV4L 1EY5A 3QIAA 2KJXA 3HEJA 1YHQA 1LTID 2KHSA 1DM0B 1MI2A 3PO2H 5C3EB 2IX3A 2B2UC 4IFDG 1GD7A 4RA8A 1SE2A 3U50C 3S1NB 1CZGA 3E6ZX 2PCFB 5DM63 1GXDC 4DUYQ 1SN8A 4K5VA 3MFYA 1Y8NB 5C0XI 4DKAC 3OOCA 2D62A 4G57A 1PFMA 2E2DC 4A3MG 1EYDA 5IY0A 5JOBA 2R93B 2Z1CA 2HUGA 2TMPA 5AJ3L 1PH8A 1CHQD 2EQSA 4OX9L 3VR4A 1IYJB 3N52A 1H9RA 1KAWA 1SYCA 4KLKA 3CPWA 1GUTA 2RDGA 3GO5A 2Q2HA 1YITA 4X64L 4BXXG 3W1GA 3BG3A 1WOCA 3FDTA 4GKJQ 3K58A 2R7ZB 1K8GA 1QUQB 1RF2D 3KYHC 2KEDA 1S40A 1UE6A 4JI3L 5A2QE 3V2TA 3NBIA 3MXUA 5LMNW 2NTTA 5I4DA 3CF5A 3H0GH 1ENCA 4IPHA 3I7FA 2R93H 4DV1Q 3I91A 4GN3B 3R3OA 3A55A 3I4NG 2F4IA 4WRDA 2B2YA 4R1JA 5LMUQ 1EY7A 4X3KA 1H9MA 3PIOA 4NW2A 4GOPB 1BO0A 1Q1BA 4DR2L 4C3HB 4DAYB 1S5FD 3CCEA 5GROA 2R61A 3FPPA 5LL6S 4POGA 4OHJA 1E1TA 3FKIB 4DV0Q 3VR2A 1A15A 5IYBH 2F0PA 3D6CA 4CDCC 1SJHD 3IAYA 1AH9A 4V190 3ULLA 2CW0C 2SNMA 3M9BA 1JICA 1O7ZA 2Q2UA 3BS1A 1V8QA 1Y1WB 1D1KA 3JAMc 4IUNA 4CJ0B 1H9SB 3LGJA 2RSNA 1STNA 1Z6HA 4H44C 3OPOA 1DOKA 2RBMA 2Y0SB 1QZGA 3D0FA 1C4QA 4ZRZA 3PIPA 1VS0A 2PMZB 4ME5A 1B44D 1TWFB 2QA4A 4C3HH 2JA8B 2FFKB 1MJCA 2FINB 2EYLA 3RLFA 2K32A 1AZQA 3G4SA 2B2WA 1IW7D 5AFWA 1F2LA 4IFDJ 4OO1I 2H1EA 3FKIH 2A69D 2V4DA 5CMDA 1K3RA 4DNIA 4NXML 2OQKA 3OIPA 4IUPA 3ND9A 2PZUA 4LF5Q 2AWOA 2B2WC 2A5HA 2HDMA 2M00A 2J0TD 1EY6A 5CBAE 1Y1WH 2F03A 2AUJD 2F0LA 1O80A 1UWVA 2Z6KA 3A7LA 4L5RC 1TQOA 4L5TA 1GUOA 5I6YA 3GTKB 1TWFH 1CK1A 3HOWH 1WD0A 4KHVA 5IODA 2JA8H 3J7ZC 1SMXA 2EXDA 4XQQA 2Z6KC 3E5SA 1PDQA 3TZDA 2I46A 4JI6Q 4LF7L 2Q8RE 1NUCA 2CH4A 5KGUA 1TXYA 3GTOB 5ELOA 1PFNA 2EJGC 3D6WA 1VMCA 5IGGA 4JOIC 4DV0L 1T9HA 2B8GA 2DN8A 3S14H 1SYFA 3SHLA 1TWHB 1VQPA 3EBEA 4YY3Q 4A3LG 3HOYH 1JE4A 4DR1L 1YNJD 4JI5L 3NENA 4EQPA 4DV2L 3GTKH 1WCMG 3NK9A 1KLGD 2QEJC 3MA2B 4KMUC 1EFWA 1S3OA 4TRDA 4G7HC 2F0SA 2FJ2A 4RGOS 3E9HA 1E2VA 5KEEA 2K03A 1Q46A 4HSVA 2JA6B 3L9AX 1DXMA 1LV9A 1OO9B 2HT1A 3L3OC 1TWHH 4IJHA 5GAGC 2WB1B 4LFBL 1LTAD 4HJAA 2ZJQA 1OXTA 4UHVA 1NMGA 3K5MA 4QQBX 3BYTB 2UXDQ 2EXZA 4CJ1B 5CV5A 2OXPA 1PXUA 1X3PA 3NP8A 1TIID 2A6HD 1WTXA 2F0OA 5EBCA 2NN6H 4Y7NB 3PUXA 1D2BA 5FLMH 4ZKBB 1MIUA 1IZ6A 4QUCA 5EQ0A 1Y69U 5FLXE 1HUMA 1BNZA 2K5HA 4IUUA 2Z4HA 3U9OA 1FYCA 4GKKL 2ZT9C 2QEXA 2XIWA 5EAYA 1LUZA 3HG9A 3GTMB 2PI2A 5K36G 4QIWB 1NNXA 4HEDA 5HGQA 2WAQB 1TU2B 4DAVA 3M85A 4X6AH 1E24A 1TS5A 5HY6A 5FJ8H 5BR8Q 4DV7L 1NY4A 5JEAG 4B3TQ 1A2UA 2I5LX 4G7OC 1BCPF 3HOZB 4Y7NH 1EY8A 4HJ9A 1HNWQ 3QOLA 1HZAA 1LLRD 1X3GA 3AU7A 1STYA 1LTTD 3I70A 3QO2A 1HZ9A 2MO1A 4OWTB 4A3GB 2ZXPA 3NTIA 2KEEA 3CU7A 4KHPQ 1PTOC 3GTLB 1QNUA 4AQYL 3KLSX 4L8JA 4LF8L 2QDLA 1OXXK 4YCWA 3H3VC 1VQLA 1NR4A 3SE0A 3LNNA 4RCOA 1UNSA 4KN4C 5IGEA 5M3FB 1VQJA 3KF6A 4UDUC 1UE5A 4YHHQ 1B2TA 3D8GA 1UUPA 4F87A 3AFQA 4HJ8A 1CA6A 2F1MA 1F9PA 2UXDL 1V1QA 3GQBA 5D65A 4DV5L 1I94L 3HOZH 5C0XH 4KKSA 3H0GG 2IPKD 4UP8A 2R93G 1CKOA 3EVQA 4A3GH 5IGFA 2EOTA 3GTLH 1JWMD 4K14A 2D2CC 1TS4A 3PV0A 2RHSB 1KC8C 4FYDA 1EQRA 3CCMA 1D8LA 1LO5D 2YTVA 4B3RQ 1STBA 4POFA 2KOLA 1GUNA 1ZXTA 5M3FH 1FL0A 1RL2A 3S1QB 2UUBL 4LF6L 2RDHA 2UXCL 2C35B 5IYBG 4KKTA 1VQ9A 3I72A 2WP8J 4DXFA 1AEXA 3DWAA 4YIJA 1IHZA 3NBHA 4B3TL 3NEMA 1VQEA 2KCNA 1U5KA 4HIOA 1U9RA 4GNXB 1C48A 3BZDB 3RLNA 1EWCA 2O2LD 3J81c 2RVLA 1AE2A 1IBML 1DD2A 2FMMA 4NPSA 1PYSB 1PMRA 3TQYA 3Q22A 4K5XA 2IY5B 1G8ZD 1RD9D 4C3HG 3MXPA 4LF4Q 1Q7YC 2F0UA 4RWSC 1I50B 1XYIA 2RCNA 3S1QH 3QG1A 1K9MC 4KI0A 1WFQA 5KNDA 1LACA 3K57A 2CWPA 1XTCD 5DLQE 2O5JC 3S24A 4ME3A 4K6DA 2I0QA 4I7ZC 2V1CC 1VQGA 2EYPA 1Y1WG 1KNAA 1R4PB 3RLOA 3U4ZA 2BOSA 4BBRB 3KFUA 1SNOA 3NQTA 2WINB 3X3NA 5C4XB 4ALPA 4KKUA 4CHTB 2UUCL 3CC4A 3J7YW 2Y0SG 1N9WA 1B1ZA 4FXDA 4RHRA 4UP9A 3HOWG 2A6ED 4P2CB 2JA8G 3W3AA 3JAME 4XTCS 5ELFA 1OTCA 5E3FA 1X6OA 1I4GA 4YWLA 5LMNL 2F3IA 3ICEA 3C2PA 2RHQB 3KJPA 2GVAA 3GTPH 4OO1H 4JVZA 3DXJC 5JAVA 1KXLA 3J81L 1A63A 3AYHB 1SFOB 2O5IC 2PQEA 1YZ6A 5GAEC 3LWUA 1UE7A 2MHVA 2EYHA 1PRTB 2HIXA 1K3BC 4B3MQ 5EBDA 2IHFA 1FD7D 2HCIA 1A0IA 4LFCQ 4BBRH 3HOYG 5C4XH 4DR7Q 4DR3Q 2LS01 1IBKL 1TKWB 1R9TB 1PZJD 3A7AB 2K7VA 4I7AA 1LTSD 1B3AA 1I4RA 5J22A 1PH6A 4L5SA 2NYZD 2VUMB 3CCVA 3E0EA 2M9VA 5A35A 3UDXA 1U4MA 2KUMA 3OSOA 3OWFA 4RHSA 3A8IE 3IKJA 1SFOH 2VY3A 1RTNA 2JA9A 4NP5A 1D5ZC 3K81C 4DR4L 1JE5A 1VQDA 1K8OA 5I6WA 2Z6BA 2Z0SA 4JI1Q 1R9TH 2GVBA 1YHAA 4RKBA 1PYBA 4DV4Q 1G6ZA 2VUMH 4BWGB 2VL6A 2AHOB 2NN6G 1N36L 5IWAL 1YEZA 2NB0A 4XT3B 5FLMG 2UU9L 3T53B 2F0VA 4XQNA 3HP3A 3KF8B 2RF4A 2DGYA 3H3VI 3K5LA 1CUKA 3CCQA 1AW7A 1SNDA 3TEHB 2DY7A 2ZTDA 1IKLA 1VQIA 5EPLA 2A68D 1JOKA 2N78A 4LUOA 5AJ3Q 4DUZL 2WB1G 4X3SA 2H5XA 4OX9Q 3NE5B 2N55A 5EPJA 1WJJA 1N33Q 2I07B 5ELDA 1I6VC 5FJ8G 1S5DD 5FKAC 1Y8PB 4X64Q 1YIJA 3A74A 1HFGA 4KTAA 2XN9C 1STAA 1P16A 1Z9FA 3VR6A 1FNVA 4L63B 1J5EQ 4BY1G 3SK5A 1MD2D 4HJ7A 1ML0D 1AFPA 2BH2A 2F0JA 1SDFA 2LKVA 3ULJA 5BN5A 5EKKA 4AYBE 2N49A 1JJGA 1WTOA 1IKMA 4Q0FA 2RDFA 2WAQG 1WTWA 3MFGA 3KDFA 4LJZC 3I8ZA 4P71A 5CR3A 3A56A 1F77A 1LT6D 1U0LA 4DR2Q 4TKOB 3T16A 2R7FA 2MJ8A 3EJIA 3RUZA 2N3SA 2D9UA 3HOZG 5C0XG 3I3CA 2F0EA 4LF9L 2A73B 3BVMA 5F2DA 1EEID 5FK9C 1LT5D 4A3GG 3NWSA 5DEHA 4LUVA 4X65L 1Q12A 2DY8A 1Q3LA 1ENAA 3U9SA 2IWHA 5JEAH 4X3TA 3UDGA 1LABA 4FNFA 5L37A 2ASBA 2KVMA 2VXWA 2B2TC 4JI0Q 3H0GB 1CKMA 2L12A 3GTGB 3TBIB 5M3FG 4EX5A 2L9HA 3STBD 4IALA 2F3WA 1QOHA 1TY2A 2G9HD 1SLJA 2JEAI 3KUPA 3F2BA 1N33L 2X6LA 5IGDA 1Y14B 1N8RC 2L11A 3TS0A 1FNUA 3FRPB 2K01A 3CRLC 2EY2A 1SYEA 4LWCA 5IP9H 1IYVA 1PLFA 1EIYB 1IW7C 4H0LC 3CXCA 4NXMQ 1J5EL 2A69C 2ALYB 4ZLTF 1G291 2A1AA 2B39A 2QF7A 4K5WA 4OONA 1SE3A 3OYYA 1I4QA 3J7AV 1ET6A 4PV1C 2L1BA 4AIMA 2OTLA 3GTGH 2PPBC 3PSIA 4K2KA 3BDLA 4QJFA 3J7A5 1EWIA 1QVCA 4QCLA 1X32A 5IGCA 3M4PA 5ELEA 1N34Q 1PRTD 5KNBA 4P73A 1K83B 1ILPA 3CCSA 3HFZB 4O0AA 4O42A 3UE0A 1J6QA 1LTBD 4YCUA 4LF7Q 4A3CH 4IUQA 1HH2P 1U4PA 2MGSA 4A3IB 4WORA 2A19A 3BZKA 1PH5A 2MFIA 4X62L 4J15A 2F0MA 3CCLA 3DWPA 2J7ZA 1GKHA 2TSSA 4CDDC 2SNSA 1CKNB 2WKCA 1VQHA 4DR1Q 1SXTA 1NBWA 1HR0W 4JI5Q 3MXNA 4QUFA 4JI0L 4DV2Q 4OO1G 3D4DA 1CT1D 1E2ZA 5E4XA 1KD1C 1O7IA 4B9XA 1MSGA 1K83H 3H94A 2EYMA 2HD3A 4JI2L 5C0XJ 2QDBA 1B3QA 1SNCA 3HOWB 1BCPC 1V1PA 1XNRL 5IOCA 1SNPA 1I4HA 3R8BA 3MTSA 4BBRG 3T13A 3BJUA 2VQEQ 4LFAL 4A3IH 1FNWA 3UDIA 5C4XG 3MVVA 2N8NA 3T1YL 2F0FA 1XPUA 4RH6A 1PH9A 3F8TA 2BH8A 1JJ2A 4LFBQ 4BBSB 3DM3A 2B29A 3S14B 5M5YB 4ZUIA 3S9WA 3QOJA 2L0CA 4IUTA 2K5VA 2LXJA 3HOYB 5DNFA 1GM5A 4KY7A 1PRTF 1GUSA 3CP0A 1ZEQX 3W5OA 3HZXA 1KTKA 3I90A 1RIPA 2IW3A 1K0RA 4R4OA 3ERSX 1PZID 5J1ZA 1ZYRD 3NUCA 2A6HC 5I9OA 1A2TA 1DOLA 4GS3A 4PG3A 4B9WA 5M3MB 1N34L 1CA5A 1FGBD 3T56B 4A3EB 5E1FA 3Q24A 4R4QA 3TRZA 1B7YB 2F0HA 4IZ8A 5IT9L 3CC2A 4ZYSA 4JBKA 3QJYA 4JOIA 1F9RA 4KHZA 3JAMi 3TP8A 4ZKCB 4ID6A 1KDBA 4LNQA 5IP7H 2B63H 3PO3H 2HHHL 1EL0A 3K59A 4GKKQ 1SAPA 1WTVA 4AYBG 4JK1C 2WKDA 4DAMA 2D0PA 2VUMG 3CCUA 4BBSH 1HFNA 3OWEB 2K5WA 5M5YH 2UXBL 1EYAA 3DM1A 4C2MB 1QJOA 3ERQA 3FEWX 2E74C 2CQAA 4U68A 4DV7Q 3SDZA 5EKLA 4C3JB 1FJGL 2VQFL 3KLRA 5COYA 3DHQA 1EIFA 3RR5A 2VZAA 4IQZA 1Y8OB 5ELBA 1QVFA 3PGZA 1GOZA 5M3MH 4GOPA 1TR5A 2CHBD 1XX8A 4A3EH 5ISRA 4DGZA 4AQYQ 2AUKA 1E3PA 4LF8Q 4JBWA 3KF6B 1J8IA 4GOPC 2VQEL 5T1GA 5KIXA 3C1FA 1QG7A 1KHIA 2R6GA 3I4MG 4OXPA 3PUVA 4C2MH 4JBJA 3M4YA 4C3JH 3J80E 1ESRA 2OF1A 1XMQL 1BKBA 3H3VH 1E22A 4DV5Q 1I94Q 5G3LD 1HNZQ 1VQNA 4N8FA 1D6EC 2K28A 1Z7TA 4V0BA 1EQTA 1NCVA 5EJWA 1PZKD 4UY8C 3AB9A 4LK1C 1Y1VH 3NQIA 2PZTA 3N6RA 4PQXA 4RGMA 1G91A 3CC7A 1SRUA 1PH2A 3G71A 4BY1B 4OEMB 1YJWA 4DR6L 3PF5A 2E8GA 1G2TA 1XPOA 1IXRA 3K80C 2ZM6L 2H4OA 4O1NA 3H15A 3QB3A 3TS2A 3R2IA 3RMHA 1E7ZA 1ASZA 2HCCA 2AWNA 1EWHA 1I3QB 2PQAA 5DAUA 1TS3A 2MUYA 2OTJA 1CZWA 2UUBQ 4LF6Q 3NBHB 4MZ9A 2JN4A 2UXCQ 1A3VA 2D5DA 2PI2E 4MN3A 2JA5B 2VB2X 1YHBA 2IL8A 4KV6A 1UEBA 4L5QA 2SDFA 2IJ0A 3C3LA 2F0WA 5C44B 4FF3A 2K1BA 4WFN3 2I5MX 3QR8A 1YI2A 2EDGA 4BY1H 1PHJA 1IBMQ 3BDOA 1KRTA 2QW7A 3MZ5A 3A5ZB 3TP6A 1Q90A 2UUAL 3QWNA 1DJRD 2L4NA 4NXNL 3TZUA 2WFWA 2B8FA 1D7QA 1I3QH 2F0GA 1GHKA 4A93G 1K8MA 1D5XC 2GA4B 4O2DA 1HQRD 1JCKB 5FO8B 5IP9G 3Q6SA 1EIHA 2EE1A 2YTYA 2E75C 1AE3A 1AN8A 5I2XA 4GLXA 3TREA 2JA5H 5G3LF 1SR3A 2YTXA 1G51A 4JCVE 2ZJPA 5E7NA 2WV6D 3SEBA 2HDLA 4HJ5A 2EJMA 1Q82C 3SK6A 1VCIA 1QNKA 2ZTCA 3HRZC 1HNZL 3NXWA 3G6JB 5C44H 3H6MA 2UUCQ 5C4JB 1KL9A 1MSHA 1SJED 1W6JA 3F2UA 3DWQA 3OMCA 1IL2A 1VQ7A 3URYA 2ZTEA 2F0IA 4KJNA 3HGBA 1W2BA 1XJVA 3S17B 5LMNQ 4A3CG 1L2FA 1SROA 3MWYW 3RN2A 1DONA 4DV6L 3P20A 3GV3A 2AQ3B 1H9KA 4QL5A 4ZQ3A 4A3FB 2ZXRA 2RQXA 1NSNS 2DJFC 5IIFA 3L7ZC 3WDNA 3BZCA 1JWUD 2EVBA 3GTJB 2MPMA 1PVOA 4C1NK 2OEOA 4UP7A 1S5CD 1VF7A 1IBKQ 2VNUD 5EPKA 3Q8DA 5C4JH 1KIXA 4L6TB 2E2HB 2EYFA 2GN5A 3A5UA 2FHTA 1BBXC 4DXGA 4FP5D 4A3DB 1A8VA 3PCOB 2RA4A 3ND8A 5CBEE 1EOVA 2I5HA 1YNXA 1JT8A 2PO4A 1Q86C 3S17H 3K5OA 4IPGA 4A3IG 1EZ8A 3HKSA 3PF4A 3KOJA 3GTPB 5JEAJ 2F0QA 4A3FH 1E0BA 3M7NA 4FF4A 2D0OA 4U673 4Y52H 4DR4Q 3CMAA 4HMIA 5FO9B 1D5MC 1Q8KA 4X66L 3GTJH 5CV6A 2B2VC 1QB5D 2Q2IA 3AMUA 2F4VL 2JQOA 5A2QL 1M90C 2E2HH 3KBXA 1ENFA 2NBFA 5EGTA 4XQJA 4ODGA 3T51B 5ELNA 2K6AA 3I4LA 4DV3L 5LL6X 1RODA 4A3DH 1N36Q 5TSSA 2WACA 2BDNA 1ASYA 5IWAQ 4PMBA 4CGYB 3C1EA 2UU9Q 3U4VA 3FMCA 3LX0A 5JVG3 2KCMA 4FF2A 1WVLA 5IGBA 4XXEA 1ICFB 1BBWA 4F7XA 5IP7G 2B63G 3PO3G 5DM73 2NVQB 5JPNC 2A74C 4OWWB 2NZ1D 1QZHA 2FMCA 4DUZQ 2RSOA 5KNCA 1H9JA 2B3GA 4NMZA 4BBSG 1G2SA 2NWGA 2A68C 1YJNA 1E1OA 1SYBA 4IPCA 5C4ZA 1DYQA 3M4OH 1EYGA 2JYOA 4PZ8A 1N32Q 3D4RA 1LTGD 4S3SA 1VQ4A 1C0AA 4JI8L 1CSPA 4AYBB 5M3MG 4A3EG 3FPUB 5C4HA 4K6LA 4RG1A 4TQUS 2Q8TA 1VQKA 1L0XB 1KLUD 4N8X1 1XMOL 4R9WA 2NVQH 1F2MA 3KDFB 3GTQB 1SEBD 2CKZB 1MBYA 3IFDA 2FXQA 4P75A 1HR0L 1BDOA 4IPDA 4C3IB 4DR5L 3BU2A 1ONLA 1TWGB 4HN7A 2E2JB 2EY5A 1EFID 4C3JG 2JK8A 4A3KB 1EY4A 1UEAB 3RZDB 2K14A 1HXYD 4UAIA 1YNND 3JC66 1H95A 4LW1A 4P74A 2E2IB 4BA1I 2XWJB 4LF9Q 4GLAC 3VR3A 1STEA 4BY7H 4EQNA 4GNXC 1F9QA 3I4MB 1W6KA 3CPFA 2K50A 1Y1VG 3KJOA 3WOFA 4X65Q 2NVTB 1HTPA 5D3IB 1PYWD 3L0OA 3F2DA 1HPCA 1FGUA 1O7LA 2EZVA 3Q23A 2EYOA 4IURA 3GTQH 2JSOA 1J9OA 4DU9A 3VYRA 1S5BD 3I55A 3HOUH 3J81j 2R92H 1EOTA 4C3IH 2XRSD 4DNTB 1TWGH 5I9PA 2EY1A 2E2JH 1NTGA 3S15B 4KK7A 4A3KH 1CFMA 3RZDH 4GN5A 2E2IH 4HMJA 1HJPA 4B3SL 2LY7A 1N32L 1SBBB 3CD6A 3DEOA 3VYSA 3MC0B 2KCCA 3MHBA 3I4MH 4BA2I 4QGUA 5BN4A 2NVTH 1IL8A 1HA6A 4ABNA 4OGQC 3H09A 1LT4D 2AKWB 4FXGC 1V9PA 4A3BH 3J80i 1HHVA 1F2YA 1K73C 1I4PA 4J1MA 3OW7A 1LT3D 3FHWA 3I73A 2PW7A 1WD1A 1SNQA 4MTNA 2MNAA 3HOVB 3VR5A 3PUYA 3SXHA 1I6HB 3BYYB 5J3BA 3S15H 3S2HB 3EIVA 2P5ZX 4IN3A 4RKLA 3T1HL 1L1OA 1TWCB 1RTOA 1JC7A 1RJTA 4A3JB 5NUCA 2JA5G 1OXUA 2Q8IB 1PRTC 2LXKA 3PMFA 1NJIC 4CJ2C 5FOBB 3NSWA 3MAQA 1IBLL 3EN2A 4JI7L 1NAPA 1KNEA 1TVXA 1X65A 3TP5A 3HOXB 4A93B 4DK1A 3U58A 5C44G 1L1OC 1OXSC 4Q5VA 3RN5A 5CYUA 2CCZA 4OIJA 1U4RA 4JI4L 2B2TA 2RKSA 4X62Q 4K2LA 1SMYD 3I56A 4KY6A 2PYKA 2X69A 3MXNB 1CTMA 3FVQA 3VDYA 1B4OA 1K0SA 2QILA 1X3FA 3HOVH 4UPAA 2ATWA 1I6HH 1EUJA 3KLWA 3S2HH 1V1PB 5CORA 5FLXL 4HIKA 4YWKA 1TS2A 2XWBB 1TWCH 3EFXD 4PMCA 2K52A 4A3JH 1JB7A 4JI2Q 1CI3M 3VA5A 4N9TA 3CCJA 1HNXL 3DUZA 1GVPA 4NDXA 3AQQA 1XNRQ 3ONAB 2XNAC 1JJCB 5CC4A 4DK3C 2G5DA 4B08A 4LAAA 3HOXH 4A93H 5H1SE 4LFAQ 2E5LL 1VDZA 2XRQD 1M8AA 3HKZE 4KN7C 3T1YQ 3UDFA 2KA7A 4HCEA 3KF8A 1PH7A 3AFPA 1LTRD 3V05A 5IYDH 3TN2A 2XTIA 1SSOA 3NELA
chains in the Genus database with same CATH topology
4IFDI 5FO7B 2G9DA 2BE5D 3RZOB 1R4QB 1B53A 2NTSA 3MEHA 4ZAIA 4RCNA 1WTRA 3EROA 3IL8A 4ZK9B 3BVGA 2JP1A 1ZYRC 5EKIA 4K8IA 2ZXOA 1BR9A 1SNMA 3BVZA 5M5WB 4XYQA 3CRKC 4FO2A 1EQVA 1AZPA 2F0TA 2QKIC 1UAPA 3J81E 2B2YC 2K33A 1YNJC 1Z47A 2K04A 3A8KE 1HRJA 4RAUC 1D1IA 2YU9B 1Q8IA 4G7ZC 2B63B 3PO3B 1CQVA 4HR7B 4DK0A 2MP1A 4F88A 2JA7B 1RCVD 1TT2A 1EU4A 4WJWA 1T5EA 3GD7A 3SR1A 2E76C 2KECA 1XWEA 5CV7A 3DEPA 2L5TA 3S1RB 3ITPA 4GZYC 5C5MA 1AP0A 3M7GA 2EPBA 4LMQD 3H91A 4EQOA 1HUNA 1JQYD 4J8QA 4E6IA 1KDAA 3W2DA 4CKCA 1MGSA 1PTOB 2K5DA 4X3UA 1BQQT 1V43A 2EJFC 1U4LA 3JAML 2KQ3A 4C3IG 5J39A 3V96A 4DAYA 2CW0D 1Y1VB 3UI2A 1TY0A 3TSSA 3C46A 4DFAA 5D3DA 1PTOH 2C9OA 5BN3A 1BCPD 4RGNA 4ULLA 3NTHA 1OXVA 5CV4A 4CKEA 4I65A 1H9SA 1HCZA 5C6AA 4HAEA 2C5CA 2JEBI 1JWSD 4BS9A 2AQ1B 1PFBA 3NPPA 3NWTA 2CVRA 3RD4A 3IFTA 2N88A 1EIGA 4C1NI 1ET9A 4PMWA 2NVYB 3K0YA 2BCOA 5M9OA 1SYDA 4K8JA 1ESFA 1A3TA 2M2LA 2VB3X 1A6XA 1S5ED 1BUVT 4QMGA 3K7AB 3PUWA 3HS0C 1RDPD 3BDCA 4DAPA 4PNYA 5HURA 4N9PA 1E2WA 2Z8LA 1T5XD 2XSCA 3EQLC 1S4ZA 4M1UB 2O4XA 3OIQA 1EY0A 5KYIA 2EYJA 2F0NA 4OL7A 1EU3A 4KD3A 1V1OA 4ILWA 3PUZA 5M5XB 1TWAB 1DOMA 2JXMB 1BF4A 3D31A 4RFBA 3J7AF 4XYOA 5CGKA 3D3RA 4A3MB 1CQFA 3EA6A 3S2DB 3Q0AA 4G4KA 1BOSA 2SEBD 2A6EC 1EYCA 1O78A 1VMPA 3VYTA 2F0DA 4FVMA 1QCBD 2IT1A 1WTPA 1QE6A 4IFDH 3VYUA 4FF1A 4H7BA 1QWYA 5T1IA 2X6GA 1GJXA 1SE4A 2BA1A 3G7LA 2PZWA 3DMUA 1CHPD 3E0JA 2EY6A 1B9NA 4EGVA 2JE6I 3I4NB 1F2ZA 3KBGA 3S16B 1KABA 1RHPA 3K6OA 3R93A 3TMEA 2BDOA 2PW5A 2WIIB 1Q1EA 3R2TA 2B2VA 4KY5A 2NVXB 1PTOD 1EZ6A 5C5LA 5LHY1 2R3ZA 1HA5A 5CV9A 5I2YA 4ZUJA 5K5PA 2QCPX 3A54A 1KDCA 3X3MA 4F8MA 3M4OB 4XT1B 1YNNC 5JPMC 5KRUA 3CQZB 1JOQA 4NKLA 5IT9E 4R8NA 3P1HA 3LWEA 1RKNA 2IX1A 5HGTA 3SVMA 2ICEC 3P75A 1CM9A 2L55A 1QILA 2Z4IA 4QF4A 3O13A 3TP7A 3OMGA 4MHEA 1I4XA 1VF5C 1B9MA 2DNEA 2K5QA 1BXTA 1HQMC 3VA7A 4DNRB 2J4XA 4BY7B 3PIO3 1HTLD 1EEFD 4MIUA 2NUCA 1JORA 3M3YB 5ELCA 1B50A 1A3UA 3D4WA 1M4VA 5E4WC 1II3A 4CBVA 3SK8A 1PTOF 4XIGS 4M8AA 4DN4M 3HOUB 2R92B 1EY9A 1NR2A 2YYZA 4C56C 1DCZA 2F0KA 1JR0D 1GUGA 4KD4A 1IYUA 5D14A 3K5NA 3PIP3 1GUWA 1WCMB 2PNRC 3MXGA 3WOEA 5C3XA 2ENBA 1STHA 2ID0A 3S1MB 1KAAA 1ZKOA 5CV8A 2HQEA 1SMYC 4HCSA 3ZYYX 4A3BB 2OT2A 2AQ2B 1XXGA 3HKZB 3NTKA 4J6HA 4H13C 4Z9CB 3TDQA 3P7JA 5JJZA 1X3QA 1JB3A 5JVH3 3KK7A 1WTQA 4EVOA 4DF7A 2IX0A 1ICWA 3T4AC 5KYLA 2NN6I 2DNCA 3SK4A 4TSSA 1FR3A 1L0YB 1STGA 3CKIB 4RGTA 4CKBA 1F9SA 2BE5C 1O7YA 4HSPA 3NHHA 3KLSA 2LMCB 4KJOA 3CHBD 4QB4A 3PO2B 4IUVA 2LFNA 1DZ1A 3OHXC 1ILQA 3J80L 1C8CA 1JOOA 4OIKA 2ICIA 1GHJA 4FXKC 4DA2A 1BCPB 3A8JE 4HTHA 1SYGA 3GP7A 2SOBA 4XDXA 2F3VA 2XVSA 4R8IA 5C3WA 3GV6A 2BA0A 2B2UA 2K05A 5K36H 1EY5A 3QIAA 2KJXA 3HEJA 1LTID 2KHSA 1DM0B 1MI2A 5C3EB 2IX3A 2B2UC 4IFDG 4RA8A 1SE2A 3S1NB 1CZGA 3E6ZX 2PCFB 5DM63 1GXDC 4K5VA 3MFYA 1Y8NB 5C0XI 3OOCA 2D62A 4G57A 1PFMA 2E2DC 1EYDA 5JOBA 2R93B 2Z1CA 2HUGA 2TMPA 1CHQD 3VR4A 3N52A 1H9RA 1SYCA 1GUTA 2RDGA 3GO5A 3BG3A 3FDTA 3K58A 2R7ZB 1RF2D 2KEDA 5A2QE 3V2TA 3NBIA 3MXUA 2NTTA 5I4DA 1ENCA 3I91A 3R3OA 3A55A 2F4IA 4WRDA 2B2YA 1EY7A 4X3KA 1H9MA 4NW2A 1BO0A 1Q1BA 4C3HB 1S5FD 2R61A 3FPPA 5LL6S 4OHJA 3FKIB 3VR2A 1A15A 2F0PA 3D6CA 1SJHD 3IAYA 4V190 2CW0C 2SNMA 1JICA 1O7ZA 3BS1A 1V8QA 1Y1WB 1D1KA 4IUNA 4CJ0B 1H9SB 2RSNA 1STNA 1Z6HA 4H44C 3OPOA 1DOKA 2RBMA 2Y0SB 1C4QA 4ZRZA 2PMZB 4ME5A 1B44D 1TWFB 2JA8B 2FFKB 2FINB 2EYLA 3RLFA 2K32A 1AZQA 2B2WA 1IW7D 5AFWA 1F2LA 4IFDJ 4OO1I 2H1EA 2A69D 2V4DA 5CMDA 3OIPA 4IUPA 3ND9A 2PZUA 2AWOA 2B2WC 2A5HA 2HDMA 2M00A 2J0TD 1EY6A 5CBAE 2F03A 2AUJD 2F0LA 1O80A 3A7LA 1TQOA 1GUOA 5I6YA 3GTKB 1CK1A 1WD0A 4KHVA 5IODA 4XQQA 3E5SA 1PDQA 3TZDA 2I46A 2Q8RE 1NUCA 5KGUA 3GTOB 1PFNA 2EJGC 3D6WA 1VMCA 5IGGA 2B8GA 2DN8A 1SYFA 3SHLA 1TWHB 1JE4A 1YNJD 4EQPA 3NK9A 1KLGD 2QEJC 3MA2B 4KMUC 4TRDA 4G7HC 2F0SA 2FJ2A 4RGOS 1E2VA 5KEEA 2K03A 4HSVA 2JA6B 3L9AX 1DXMA 1LV9A 1OO9B 3L3OC 2WB1B 1LTAD 1OXTA 3K5MA 3BYTB 2EXZA 4CJ1B 5CV5A 2OXPA 1PXUA 1X3PA 3NP8A 1TIID 2A6HD 1WTXA 2F0OA 5EBCA 2NN6H 4Y7NB 3PUXA 1D2BA 4ZKBB 4QUCA 5EQ0A 1Y69U 5FLXE 1HUMA 1BNZA 4IUUA 2Z4HA 3U9OA 1FYCA 2ZT9C 2XIWA 3HG9A 3GTMB 5K36G 4QIWB 4HEDA 2WAQB 1TU2B 4DAVA 3M85A 1TS5A 5JEAG 1A2UA 4G7OC 1BCPF 3HOZB 1EY8A 3QOLA 1LLRD 3AU7A 1STYA 1LTTD 3I70A 3QO2A 4A3GB 2ZXPA 3NTIA 2KEEA 3CU7A 1PTOC 3GTLB 1QNUA 3KLSX 4L8JA 1OXXK 3H3VC 1NR4A 3SE0A 3LNNA 4RCOA 1UNSA 4KN4C 5IGEA 5M3FB 4UDUC 1B2TA 3D8GA 1UUPA 4F87A 1CA6A 2F1MA 1F9PA 3GQBA 5D65A 5C0XH 4KKSA 2IPKD 3EVQA 5IGFA 2EOTA 1JWMD 4K14A 2D2CC 1TS4A 3PV0A 4FYDA 1LO5D 1STBA 2KOLA 1GUNA 1ZXTA 3S1QB 2RDHA 4KKTA 3I72A 2WP8J 4DXFA 1AEXA 3DWAA 4YIJA 1IHZA 3NBHA 2KCNA 1U9RA 1C48A 3BZDB 1EWCA 2O2LD 2RVLA 1DD2A 2FMMA 1PMRA 3Q22A 4K5XA 1G8ZD 1RD9D 4C3HG 3MXPA 2F0UA 4RWSC 1I50B 1XYIA 3QG1A 4KI0A 5KNDA 1LACA 3K57A 1XTCD 2O5JC 4K6DA 4I7ZC 2EYPA 1KNAA 1R4PB 4BBRB 2BOSA 1SNOA 3NQTA 2WINB 3X3NA 5C4XB 4KKUA 4CHTB 3J7YW 1B1ZA 4FXDA 4RHRA 2A6ED 4P2CB 3W3AA 3JAME 4XTCS 5ELFA 5E3FA 1I4GA 3C2PA 4OO1H 3DXJC 5JAVA 3J81L 1SFOB 2O5IC 2PQEA 3LWUA 2MHVA 2EYHA 1PRTB 5EBDA 1FD7D 2HCIA 2LS01 1TKWB 1R9TB 1PZJD 3A7AB 2K7VA 1LTSD 1B3AA 1I4RA 5J22A 2NYZD 2VUMB 2M9VA 5A35A 1U4MA 2KUMA 3OSOA 3OWFA 4RHSA 3A8IE 3IKJA 1RTNA 4NP5A 1D5ZC 1K8OA 5I6WA 4RKBA 1G6ZA 4BWGB 2NN6G 2NB0A 4XT3B 3T53B 2F0VA 4XQNA 3HP3A 3K5LA 1AW7A 1SNDA 2DY7A 1IKLA 5EPLA 2A68D 1JOKA 4X3SA 3NE5B 2N55A 5EPJA 2I07B 5ELDA 1I6VC 1S5DD 5FKAC 1Y8PB 1HFGA 4KTAA 2XN9C 1STAA 3VR6A 1FNVA 4L63B 3SK5A 1MD2D 1ML0D 1AFPA 2F0JA 1SDFA 2LKVA 5BN5A 5EKKA 1WTOA 1IKMA 4Q0FA 2RDFA 1WTWA 3MFGA 4LJZC 3I8ZA 5CR3A 3A56A 1F77A 1LT6D 4TKOB 3T16A 2MJ8A 3EJIA 3RUZA 2D9UA 5C0XG 3I3CA 2F0EA 2A73B 3BVMA 5F2DA 1EEID 5FK9C 1LT5D 3NWSA 5DEHA 1Q12A 2DY8A 1Q3LA 1ENAA 3U9SA 2IWHA 5JEAH 4X3TA 1LABA 4FNFA 2KVMA 2VXWA 2B2TC 3H0GB 2L12A 3GTGB 3TBIB 2L9HA 4IALA 2F3WA 1QOHA 1TY2A 2G9HD 2JEAI 3KUPA 2X6LA 5IGDA 2L11A 1FNUA 3FRPB 2K01A 3CRLC 2EY2A 1SYEA 1IYVA 1PLFA 1IW7C 4H0LC 2A69C 4ZLTF 1G291 2B39A 2QF7A 4K5WA 1SE3A 1I4QA 3J7AV 1ET6A 4PV1C 2L1BA 2PPBC 4K2KA 3BDLA 4QCLA 1X32A 5IGCA 5ELEA 1PRTD 5KNBA 1K83B 1ILPA 4O42A 1LTBD 4IUQA 1U4PA 2MGSA 4A3IB 4WORA 2F0MA 3DWPA 2J7ZA 2TSSA 2SNSA 2WKCA 1SXTA 3MXNA 4QUFA 4OO1G 3D4DA 1CT1D 1E2ZA 5E4XA 4B9XA 1MSGA 3H94A 2EYMA 5C0XJ 2QDBA 1SNCA 3HOWB 1BCPC 1V1PA 5IOCA 1SNPA 1I4HA 3R8BA 3MTSA 3T13A 1FNWA 3MVVA 2F0FA 4RH6A 4BBSB 3S14B 5M5YB 4ZUIA 3S9WA 3QOJA 2L0CA 4IUTA 3HOYB 5DNFA 4KY7A 1PRTF 1GUSA 1ZEQX 3HZXA 1KTKA 3I90A 2IW3A 5J1ZA 1PZID 1ZYRD 3NUCA 2A6HC 5I9OA 1A2TA 1DOLA 4B9WA 5M3MB 1CA5A 1FGBD 3T56B 4A3EB 5E1FA 3Q24A 2F0HA 4IZ8A 5IT9L 4ZYSA 3QJYA 1F9RA 4KHZA 3TP8A 4ZKCB 4ID6A 1KDBA 1EL0A 3K59A 1SAPA 1WTVA 4JK1C 2WKDA 1HFNA 3OWEB 2K5WA 1EYAA 3DM1A 4C2MB 1QJOA 3ERQA 3FEWX 2E74C 2CQAA 4U68A 3SDZA 5EKLA 4C3JB 3KLRA 5COYA 3DHQA 4IQZA 1Y8OB 5ELBA 1GOZA 1TR5A 2CHBD 1XX8A 5ISRA 4DGZA 2AUKA 4JBWA 1J8IA 5T1GA 5KIXA 3C1FA 1QG7A 2R6GA 3PUVA 3M4YA 3J80E 1ESRA 2OF1A 5G3LD 1D6EC 2K28A 1Z7TA 4V0BA 1EQTA 1NCVA 5EJWA 1PZKD 3AB9A 4LK1C 3NQIA 2PZTA 3N6RA 4PQXA 4RGMA 1G91A 4BY1B 1G2TA 2H4OA 4O1NA 3QB3A 3R2IA 3RMHA 2HCCA 2AWNA 1EWHA 1I3QB 5DAUA 1TS3A 2MUYA 1CZWA 1A3VA 2D5DA 4MN3A 2JA5B 2VB2X 2IL8A 4KV6A 2SDFA 2IJ0A 3C3LA 2F0WA 5C44B 4FF3A 2K1BA 4WFN3 2EDGA 3BDOA 3MZ5A 3TP6A 1Q90A 3QWNA 1DJRD 2L4NA 3TZUA 2B8FA 2F0GA 1GHKA 1K8MA 1D5XC 2GA4B 1HQRD 1JCKB 5FO8B 3Q6SA 1EIHA 2EE1A 2E75C 1AN8A 5I2XA 5G3LF 2WV6D 3SEBA 2HDLA 2EJMA 3SK6A 1VCIA 1QNKA 3HRZC 3NXWA 3G6JB 3H6MA 5C4JB 1MSHA 1SJED 1W6JA 3F2UA 3DWQA 3OMCA 3URYA 2F0IA 4KJNA 3HGBA 3S17B 3MWYW 1DONA 3P20A 3GV3A 2AQ3B 1H9KA 4A3FB 4ZQ3A 2ZXRA 2RQXA 1NSNS 5IIFA 3L7ZC 3WDNA 1JWUD 2EVBA 3GTJB 2MPMA 4C1NK 2OEOA 1S5CD 1VF7A 2VNUD 5EPKA 2E2HB 4L6TB 2EYFA 2FHTA 1BBXC 4DXGA 4FP5D 4A3DB 5CBEE 2RA4A 3ND8A 2PO4A 3K5OA 1EZ8A 3GTPB 5JEAJ 2F0QA 1E0BA 3M7NA 4FF4A 4U673 4HMIA 5FO9B 1D5MC 5CV6A 2B2VC 1QB5D 3AMUA 5A2QL 3KBXA 1ENFA 2NBFA 5EGTA 4XQJA 4ODGA 3T51B 2K6AA 3I4LA 5LL6X 1RODA 5TSSA 2WACA 2BDNA 4PMBA 4CGYB 3C1EA 3FMCA 3LX0A 5JVG3 4FF2A 1WVLA 5IGBA 4XXEA 4F7XA 5DM73 2NVQB 5JPNC 2A74C 2NZ1D 2FMCA 2RSOA 5KNCA 1H9JA 4NMZA 1G2SA 2NWGA 2A68C 1SYBA 5C4ZA 1DYQA 2JYOA 3D4RA 1LTGD 4S3SA 4AYBB 3FPUB 5C4HA 4K6LA 4TQUS 2Q8TA 1L0XB 1KLUD 4R9WA 1F2MA 3GTQB 1SEBD 1MBYA 3IFDA 1BDOA 4C3IB 1ONLA 1TWGB 4HN7A 2E2JB 2EY5A 1EFID 4C3JG 4A3KB 1EY4A 1UEAB 3RZDB 1HXYD 4UAIA 1YNND 2E2IB 4BA1I 2XWJB 3VR3A 1STEA 4EQNA 1F9QA 3I4MB 1W6KA 3WOFA 2NVTB 1HTPA 5D3IB 1PYWD 1HPCA 1O7LA 2EZVA 3Q23A 2EYOA 4IURA 2JSOA 1J9OA 4DU9A 3VYRA 1S5BD 1EOTA 2XRSD 4DNTB 5I9PA 2EY1A 3S15B 4KK7A 1CFMA 4HMJA 2LY7A 1SBBB 3DEOA 3VYSA 3MC0B 2KCCA 3MHBA 4BA2I 5BN4A 1IL8A 1HA6A 4ABNA 4OGQC 3H09A 1LT4D 4FXGC 1HHVA 1F2YA 1I4PA 4J1MA 1LT3D 3OW7A 3I73A 2PW7A 1WD1A 1SNQA 3HOVB 3VR5A 3PUYA 3SXHA 1I6HB 3BYYB 3S2HB 4IN3A 4RKLA 1TWCB 1RTOA 1JC7A 1RJTA 4A3JB 5NUCA 1OXUA 2Q8IB 1PRTC 3PMFA 4CJ2C 5FOBB 3NSWA 3MAQA 1NAPA 1KNEA 1TVXA 3TP5A 3HOXB 4A93B 4DK1A 1OXSC 4Q5VA 5CYUA 4OIJA 1U4RA 2B2TA 2RKSA 4K2LA 1SMYD 4KY6A 2PYKA 2X69A 1CTMA 3FVQA 1B4OA 2QILA 1V1PB 5CORA 5FLXL 1TS2A 2XWBB 3EFXD 4PMCA 1CI3M 3VA5A 4N9TA 3DUZA 4NDXA 3ONAB 2XNAC 5CC4A 4B08A 4LAAA 1VDZA 2XRQD 1M8AA 4KN7C 2KA7A 4HCEA 3KF8A 3V05A 1LTRD 3TN2A 1SSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQO A;  5HUR A;  1EY5 A;  2WAC A;  2RBM A;  4PMB A;  2LKV A;  1TR5 A;  4KY5 A;  4ME5 A;  3C1E A;  3HEJ A;  4N9P A;  4WOR A;  2KHS A;  5C3X A;  5ISR A;  3LX0 A;  4E6I A;  1KDA A;  4HMJ A;  5EKK A;  1STB A;  2EXZ A;  2ENB A;  1STH A;  5IGB A;  2EYL A;  1KAA A;  1EZ6 A;  5CV5 A;  5C5L A;  2OXP A;  2F0M A;  4DGZ A;  2RDF A;  5J22 A;  3MEH A;  3NP8 A;  2HQE A;  5CV8 A;  4F7X A;  2F0O A;  3SK6 A;  3MHB A;  4K5V A;  3ERO A;  5CV9 A;  3NXW A;  4ZUJ A;  2SNS A;  5CR3 A;  5K5P A;  1KDC A;  4F8M A;  4G57 A;  2O4X A;  3H6M A;  5KIX A;  3C1F A;  3T16 A;  1EYD A;  1EY0 A;  4K8I A;  5JOB A;  3EJI A;  1AEX A;  4J6H A;  4NMZ A;  3RUZ A;  5KYI A;  5KRU A;  3OSO A;  4YIJ A;  1IHZ A;  2EYJ A;  2PZU A;  3D4D A;  3OWF A;  1JOQ A;  4NKL A;  2F0E A;  1F2Y A;  2F0N A;  3OMC A;  1SNM A;  1SYB A;  4OL7 A;  4R8N A;  4J1M A;  4B9X A;  5C4Z A;  1U9R A;  2M00 A;  4KD3 A;  2KQ3 A;  1EY6 A;  3P1H A;  2EYM A;  2PW7 A;  5F2D A;  5J39 A;  1SYC A;  1SNQ A;  3U9O A;  2QDB A;  4NP5 A;  1RKN A;  1SNC A;  2F0I A;  2OF1 A;  4KJN A;  5DEH A;  3SXH A;  4EVO A;  4S3S A;  2F0L A;  5IOC A;  1EQV A;  1SNP A;  1ENA A;  4DF7 A;  2F0T A;  1TQO A;  3T13 A;  5HGT A;  5I6Y A;  4RKL A;  4K5X A;  3P75 A;  5C4H A;  5I6W A;  5NUC A;  4KHV A;  5IOD A;  3MXP A;  4QF4 A;  3TP7 A;  3PMF A;  3OMG A;  4ZQ3 A;  3MVV A;  5KYL A;  2F0U A;  2F0F A;  1NSN S;  2PZT A;  4DFA A;  5IIF A;  4RKB A;  1A2U A;  3SK4 A;  3E5S A;  3V2T A;  5CGK A;  4IAL A;  3TP5 A;  2F3W A;  1F2M A;  1NUC A;  1STG A;  5KGU A;  1EY8 A;  2OEO A;  3QOL A;  3QB3 A;  5CV4 A;  4ZUI A;  1STY A;  1ENC A;  3S9W A;  3QOJ A;  4I65 A;  5IGD A;  2F0V A;  2EYF A;  2RKS A;  5IGG A;  3R3O A;  4K2L A;  1EYC A;  5C6A A;  5DAU A;  4KY6 A;  2PYK A;  4KY7 A;  3NHH A;  4K6D A;  3HZX A;  4WRD A;  2EY5 A;  2EY2 A;  1SYE A;  1SYF A;  3SHL A;  1EY7 A;  4KJO A;  5J1Z A;  3NUC A;  1EY4 A;  2EYP A;  2F0D A;  5I9O A;  1A2T A;  1A3V A;  1SND A;  4MIU A;  2NUC A;  1SNO A;  3NQT A;  4B9W A;  1JOR A;  5E1F A;  2F0H A;  4IZ8 A;  4QB4 A;  1A3U A;  1JOK A;  3D4W A;  4K5W A;  4KV6 A;  4EQP A;  3TP8 A;  4EQN A;  4H7B A;  3NK9 A;  4ID6 A;  5IGE A;  1EZ8 A;  1II3 A;  1KDB A;  4PMC A;  1TT2 A;  3VA5 A;  3D8G A;  1SYD A;  5M9O A;  3SK8 A;  2F0Q A;  4N9T A;  1JOO A;  4K8J A;  2F0W A;  2PZW A;  3DMU A;  4NDX A;  1A3T A;  4K2K A;  5E3F A;  2F0P A;  2EY6 A;  3BDL A;  3D6C A;  1EY9 A;  3SR1 A;  4HMI A;  5CC4 A;  2EYO A;  1SYG A;  4HTH A;  4LAA A;  2SOB A;  4TRD A;  4QMG A;  5IGC A;  2F0S A;  3MZ5 A;  4KTA A;  5CV6 A;  4DU9 A;  3TP6 A;  1STA A;  2F3V A;  2SNM A;  5JAV A;  2F0K A;  1EYA A;  5CV7 A;  1F2Z A;  4KD4 A;  3ERQ A;  5C3W A;  1KAB A;  2PQE A;  5KEE A;  5EKL A;  3EVQ A;  5EGT A;  3SK5 A;  2F0G A;  3ITP A;  4IUN A;  4ODG A;  2EYH A;  3TME A;  5I9P A;  2EY1 A;  3BDC A;  5C5M A;  3DHQ A;  5IGF A;  4K14 A;  1STN A;  2PW5 A;  2F0J A;  4PNY A; 
#chains in the Genus database with same CATH topology
 4IFD I;  5FO7 B;  2G9D A;  4YCV A;  2BE5 D;  3RZO B;  1R4Q B;  2ZJR A;  1B53 A;  2NTS A;  3MEH A;  1X9N A;  4ZAI A;  4RCN A;  1WTR A;  1PH3 A;  3ERO A;  4A3F G;  5C3E H;  3IL8 A;  2Q2T A;  4ZK9 B;  3S1N H;  3BVG A;  2JP1 A;  1ZYR C;  4K0K L;  5EKI A;  4K8I A;  2ZXO A;  1PA6 A;  1BR9 A;  1SNM A;  2HHH Q;  3BVZ A;  2KBN A;  2MQH A;  5M5W B;  4XYQ A;  3CRK C;  4IOA A;  4FO2 A;  1VQO A;  4A3D G;  1EQV A;  1AZP A;  2F0T A;  3E9I A;  2QKI C;  2UXB Q;  1KQS A;  1UAP A;  3RZO H;  1WTH A;  5IT9 c;  1PV4 A;  1FJG Q;  2VQF Q;  3J81 E;  1SE8 A;  3AEV A;  2KCT A;  4JV5 L;  1A62 A;  2K5N A;  2B2Y C;  2R7Z H;  4JBM A;  2K33 A;  1YNJ C;  1Z47 A;  2K04 A;  3A8K E;  4JYA Q;  3W1B A;  1HRJ A;  4RAU C;  4CDE C;  1MJE A;  4EQ5 A;  1D1I A;  5M5W H;  4DUY L;  1Q81 C;  2YU9 B;  2OCE A;  1Q8I A;  4G7Z C;  1VQ8 A;  2B63 B;  3PO3 B;  1CQV A;  3RNU A;  4OWX B;  4R4C A;  4HR7 B;  4DK0 A;  4H02 A;  2MP1 A;  1W3S A;  4F88 A;  4MNO A;  2JA7 B;  1RCV D;  1TT2 A;  1EU4 A;  1XMQ Q;  4WJW A;  1T5E A;  3GD7 A;  3SR1 A;  2E76 C;  5IYC G;  2KEC A;  2KHI A;  3I4O A;  4GKJ L;  1XWE A;  5CV7 A;  3DEP A;  2L5T A;  1BBU A;  3S1R B;  3ITP A;  2CH4 W;  4JW0 A;  3CME A;  2YV5 A;  5C5M A;  4GZY C;  3M7G A;  1AP0 A;  2PQA B;  2EPB A;  4LMQ D;  4DR6 Q;  3GDE A;  3H91 A;  4EQO A;  2YU9 H;  1HUN A;  2ZM6 Q;  1QUQ A;  1JQY D;  4J8Q A;  1LYL A;  2PNH A;  4E6I A;  1PH1 A;  1KDA A;  1FVI A;  1VQM A;  4DV1 L;  4BY7 G;  3W2D A;  2JA7 H;  1CSQ A;  4CKC A;  1MGS A;  1PTO B;  5LMU L;  1I5F A;  2K5D A;  4X3U A;  1BQQ T;  1V43 A;  3A0J A;  2EJF C;  1U4L A;  3JAM L;  2K75 A;  3HOU G;  2R92 G;  2KQ3 A;  2ES2 A;  4C3I G;  5J39 A;  3S1R H;  3V96 A;  2QGQ A;  4DAY A;  2CW0 D;  4JYA L;  2KHJ A;  3SGI A;  1Y1V B;  4A3K G;  3UI2 A;  2UUA Q;  1TY0 A;  3TSS A;  4NXN Q;  3C46 A;  1X56 A;  4DFA A;  5D3D A;  4QY7 A;  1JMC A;  1PTO H;  2C9O A;  5BN3 A;  1BCP D;  1CKN A;  4RGN A;  4ULL A;  4IOC A;  3NTH A;  1OXV A;  5CV4 A;  4CKE A;  3WWV A;  4I65 A;  1H9S A;  1HCZ A;  5C6A A;  4HAE A;  4A3B G;  2C5C A;  2JEB I;  4PZ7 A;  3GTO H;  1JWS D;  4BS9 A;  2AQ1 B;  1PFB A;  3NPP A;  3HKZ G;  3K7U C;  3NWT A;  2KEN A;  4TVA B;  2CVR A;  3ZJY C;  1MKH A;  3RD4 A;  4FDB A;  2Y0S E;  3IFT A;  2N88 A;  1EIG A;  2PMZ E;  1ET9 A;  4C1N I;  4PMW A;  4LF5 L;  2NVY B;  3K0Y A;  2BCO A;  5M9O A;  1SYD A;  2A8V A;  4K8J A;  1L0W A;  3ULP A;  3F1Z A;  1ESF A;  1A3T A;  2M2L A;  2VB3 X;  2OQ0 A;  3B6Y A;  1G6P A;  1PFS A;  1A6X A;  1XTD A;  1S5E D;  1BUV T;  4QMG A;  2CQO A;  4DV6 Q;  3K7A B;  5IE8 A;  3PUW A;  3HS0 C;  3ER0 A;  1RDP D;  3BDC A;  2CFM A;  5GQO A;  4DAP A;  4PNY A;  5HUR A;  4JI6 L;  3HOV G;  4JPB W;  4N9P A;  2JA6 H;  1E2W A;  2Z8L A;  1T5X D;  2XSC A;  3M4Q A;  2L15 A;  4A3J G;  2NVY H;  5JJL A;  4IJL A;  3EQL C;  2F52 A;  1S4Z A;  2IHE A;  3PO2 G;  1XNQ Q;  4YY3 L;  4M1U B;  2O4X A;  3OIQ A;  3G48 A;  1EY0 A;  1DGS A;  3HOX G;  5KYI A;  2EYJ A;  1X55 A;  3K7A H;  2F0N A;  4OL7 A;  1EU3 A;  4KD3 A;  1EQQ A;  1V1O A;  4ILW A;  1VQ6 A;  5IYD G;  3PUZ A;  5M5X B;  1TWA B;  4GLV B;  2EIF A;  4CDF C;  4X66 Q;  2DUD A;  1LTL A;  1DOM A;  4R4I A;  2F4V Q;  2JXM B;  1BF4 A;  2VS1 A;  3GTM H;  4RMF A;  3D31 A;  4RFB A;  3J7A F;  4DV3 Q;  4XYO A;  3OTO Q;  5CGK A;  3D3R A;  4A3M B;  2OWO A;  2HQL A;  5C3E G;  4APV A;  2K4K A;  1CQF A;  3EA6 A;  3S2D B;  3Q0A A;  4G4K A;  1BOS A;  2SEB D;  2A6E C;  4MTK A;  1EYC A;  4JG2 A;  3L2P A;  1O78 A;  4A4I A;  1VMP A;  3VYT A;  3OW2 A;  2F0D A;  5M5X H;  1TWA H;  4FVM A;  1QCB D;  2IT1 A;  1WTP A;  2WB1 E;  1QE6 A;  4IFD H;  3VYU A;  4FF1 A;  4H7B A;  1QWY A;  1KRS A;  5T1I A;  2X6G A;  1GJX A;  1SE4 A;  2BA1 A;  3G7L A;  1UE1 A;  2PZW A;  1VQA A;  3DMU A;  1CHP D;  3CAM A;  3E0J A;  2EY6 A;  4A3M H;  4JI8 Q;  1B9N A;  2HIV A;  3G6E A;  2R7Z G;  4EGV A;  2JE6 I;  3I4N B;  3S2D H;  1F2Z A;  3KBG A;  4OEL B;  4NB3 A;  3S16 B;  4WJ3 M;  1KAB A;  1RHP A;  3K6O A;  1XNQ L;  1XMO Q;  3R93 A;  5BR8 L;  3TME A;  2BDO A;  2PW5 A;  2WII B;  1Q1E A;  3R2T A;  4BXX H;  4R4T A;  2B2V A;  3E3X A;  4KY5 A;  1HR0 Q;  2NVX B;  1HNW L;  4DR5 Q;  4QIW E;  3PQI A;  1PTO D;  1EZ6 A;  5C5L A;  2WAQ E;  5LHY 1;  1C7Y A;  2R3Z A;  1X3E A;  2AMC B;  4KHP L;  1HA5 A;  5CV9 A;  5I2Y A;  4ZUJ A;  5K5P A;  2QCP X;  3A54 A;  1KDC A;  3X3M A;  4F8M A;  3M4O B;  4A75 A;  4XT1 B;  1YNN C;  5JPM C;  5KRU A;  3CQZ B;  3OTO L;  3I4N H;  1JOQ A;  4NKL A;  5IT9 E;  4R8N A;  3FKI G;  1K8A C;  1K28 A;  3S16 H;  3P1H A;  3LWE A;  4YHH L;  1RKN A;  5JJK A;  5JJI A;  2IX1 A;  3I2Z A;  2NZO A;  4IO9 A;  5HGT A;  3SVM A;  3J81 i;  2MO0 A;  2ICE C;  3P75 A;  2NVX H;  1CM9 A;  2L55 A;  1YVC A;  4WJ4 A;  1QIL A;  2Z4I A;  4QF4 A;  3O13 A;  3TP7 A;  3OMG A;  1VQB A;  4HIM A;  2JA7 G;  1XPR A;  4MHE A;  1I4X A;  1VF5 C;  1B9M A;  2DNE A;  2K5Q A;  1I50 H;  1BXT A;  1HQM C;  4B3S Q;  4B3R L;  3MEF A;  1WI5 A;  3CQZ H;  3VA7 A;  4DNR B;  2J4X A;  4BY7 B;  1QVG A;  4HID A;  3PIO 3;  1HTL D;  1EEF D;  4MIU A;  2XGT A;  2NUC A;  1LM0 A;  4YWM A;  1JOR A;  3M3Y B;  1MHW C;  5ELC A;  1B50 A;  1A3U A;  3D4W A;  1M4V A;  1HZB A;  3DLL A;  5E4W C;  1YBY A;  1II3 A;  5IYC H;  4CBV A;  1L1O B;  3SK8 A;  1PTO F;  4XIG S;  5GAD C;  4M8A A;  4DN4 M;  3HOU B;  2R92 B;  1EY9 A;  1NR2 A;  2YYZ A;  3T1H Q;  4C56 C;  1DCZ A;  1VQF A;  4JC0 A;  4GNX A;  1VQC A;  2F0K A;  1JR0 D;  1GUG A;  4KD4 A;  4DK6 C;  4PZ6 A;  1HZC A;  4LF4 L;  3K0X A;  1IBL Q;  2DJG C;  4JI7 Q;  1IYU A;  3CCR A;  5D14 A;  3K5N A;  3PIP 3;  1GUW A;  1WCM B;  2PNR C;  4JI4 Q;  3MXG A;  3WOE A;  5C3X A;  3M3Y H;  1VQ5 A;  4GN4 B;  2ENB A;  1STH A;  2ID0 A;  4A76 A;  3S1M B;  1KAA A;  3K8A A;  1ZKO A;  5CV8 A;  2HQE A;  1SMY C;  4HCS A;  3ZYY X;  4A3B B;  2OT2 A;  2AQ2 B;  2JJQ A;  2LSS A;  1XXG A;  3J80 c;  1NE3 A;  3HKZ B;  3NTK A;  4J6H A;  1BVS A;  1GO3 E;  4H13 C;  2CWA A;  4Z9C B;  3TDQ A;  3P7J A;  5JJZ A;  3STB C;  1X3Q A;  1HNX Q;  1JB3 A;  3F2C A;  5JVH 3;  3KK7 A;  2NZH A;  4A3L H;  1WTQ A;  4EVO A;  4DF7 A;  2E5L Q;  2IX0 A;  2Z9H A;  3CW2 C;  1ICW A;  1S72 A;  1WCM H;  3UE1 A;  2JA6 G;  3T4A C;  4DPG A;  5FLX c;  1M1K C;  3S1M H;  5KYL A;  2NN6 I;  2DNC A;  3SK4 A;  4TSS A;  4B3M L;  1C9O A;  1FR3 A;  1L0Y B;  1STG A;  3CKI B;  4RGT A;  4CKB A;  4LFC L;  1F9S A;  4DR7 L;  4DR3 L;  2BE5 C;  1O7Y A;  4HSP A;  3NHH A;  1B8A A;  3KLS A;  2LMC B;  2RCF A;  4KJO A;  4ZCK A;  3CHB D;  4K0K Q;  4JI3 Q;  1YJ9 A;  4QB4 A;  3PO2 B;  4IUV A;  1PH4 A;  2LFN A;  1DZ1 A;  3OHX C;  1ILQ A;  3IRB A;  3J80 L;  1C8C A;  1JOO A;  4OIK A;  4P72 A;  2ICI A;  2R7D A;  1GHJ A;  1NMF A;  4FXK C;  4DA2 A;  2VW9 A;  1BCP B;  3A8J E;  4HTH A;  1SYG A;  3GP7 A;  2SOB A;  4XDX A;  2F3V A;  2XVS A;  4R8I A;  4AH6 A;  3FP9 A;  5C3W A;  4LUZ A;  3GV6 A;  1X54 A;  2BA0 A;  4JI1 L;  2B2U A;  1P8L A;  1WYD A;  4JV5 Q;  2K05 A;  5K36 H;  5GAH C;  1B70 B;  4DV4 L;  1EY5 A;  3QIA A;  2KJX A;  3HEJ A;  1YHQ A;  1LTI D;  2KHS A;  1DM0 B;  1MI2 A;  3PO2 H;  5C3E B;  2IX3 A;  2B2U C;  4IFD G;  1GD7 A;  4RA8 A;  1SE2 A;  3U50 C;  3S1N B;  1CZG A;  3E6Z X;  2PCF B;  5DM6 3;  1GXD C;  4DUY Q;  1SN8 A;  4K5V A;  3MFY A;  1Y8N B;  5C0X I;  4DKA C;  3OOC A;  2D62 A;  4G57 A;  1PFM A;  2E2D C;  4A3M G;  1EYD A;  5IY0 A;  5JOB A;  2R93 B;  2Z1C A;  2HUG A;  2TMP A;  5AJ3 L;  1PH8 A;  1CHQ D;  2EQS A;  4OX9 L;  3VR4 A;  1IYJ B;  3N52 A;  1H9R A;  1KAW A;  1SYC A;  4KLK A;  3CPW A;  1GUT A;  2RDG A;  3GO5 A;  2Q2H A;  1YIT A;  4X64 L;  4BXX G;  3W1G A;  3BG3 A;  1WOC A;  3FDT A;  4GKJ Q;  3K58 A;  2R7Z B;  1K8G A;  1QUQ B;  1RF2 D;  3KYH C;  2KED A;  1S40 A;  1UE6 A;  4JI3 L;  5A2Q E;  3V2T A;  3NBI A;  3MXU A;  5LMN W;  2NTT A;  5I4D A;  3CF5 A;  3H0G H;  1ENC A;  4IPH A;  3I7F A;  2R93 H;  4DV1 Q;  3I91 A;  4GN3 B;  3R3O A;  3A55 A;  3I4N G;  2F4I A;  4WRD A;  2B2Y A;  4R1J A;  5LMU Q;  1EY7 A;  4X3K A;  1H9M A;  3PIO A;  4NW2 A;  4GOP B;  1BO0 A;  1Q1B A;  4DR2 L;  4C3H B;  4DAY B;  1S5F D;  3CCE A;  5GRO A;  2R61 A;  3FPP A;  5LL6 S;  4POG A;  4OHJ A;  1E1T A;  3FKI B;  4DV0 Q;  3VR2 A;  1A15 A;  5IYB H;  2F0P A;  3D6C A;  4CDC C;  1SJH D;  3IAY A;  1AH9 A;  4V19 0;  3ULL A;  2CW0 C;  2SNM A;  3M9B A;  1JIC A;  1O7Z A;  2Q2U A;  3BS1 A;  1V8Q A;  1Y1W B;  1D1K A;  3JAM c;  4IUN A;  4CJ0 B;  1H9S B;  3LGJ A;  2RSN A;  1STN A;  1Z6H A;  4H44 C;  3OPO A;  1DOK A;  2RBM A;  2Y0S B;  1QZG A;  3D0F A;  1C4Q A;  4ZRZ A;  3PIP A;  1VS0 A;  2PMZ B;  4ME5 A;  1B44 D;  1TWF B;  2QA4 A;  4C3H H;  2JA8 B;  2FFK B;  1MJC A;  2FIN B;  2EYL A;  3RLF A;  2K32 A;  1AZQ A;  3G4S A;  2B2W A;  1IW7 D;  5AFW A;  1F2L A;  4IFD J;  4OO1 I;  2H1E A;  3FKI H;  2A69 D;  2V4D A;  5CMD A;  1K3R A;  4DNI A;  4NXM L;  2OQK A;  3OIP A;  4IUP A;  3ND9 A;  2PZU A;  4LF5 Q;  2AWO A;  2B2W C;  2A5H A;  2HDM A;  2M00 A;  2J0T D;  1EY6 A;  5CBA E;  1Y1W H;  2F03 A;  2AUJ D;  2F0L A;  1O80 A;  1UWV A;  2Z6K A;  3A7L A;  4L5R C;  1TQO A;  4L5T A;  1GUO A;  5I6Y A;  3GTK B;  1TWF H;  1CK1 A;  3HOW H;  1WD0 A;  4KHV A;  5IOD A;  2JA8 H;  3J7Z C;  1SMX A;  2EXD A;  4XQQ A;  2Z6K C;  3E5S A;  1PDQ A;  3TZD A;  2I46 A;  4JI6 Q;  4LF7 L;  2Q8R E;  1NUC A;  2CH4 A;  5KGU A;  1TXY A;  3GTO B;  5ELO A;  1PFN A;  2EJG C;  3D6W A;  1VMC A;  5IGG A;  4JOI C;  4DV0 L;  1T9H A;  2B8G A;  2DN8 A;  3S14 H;  1SYF A;  3SHL A;  1TWH B;  1VQP A;  3EBE A;  4YY3 Q;  4A3L G;  3HOY H;  1JE4 A;  4DR1 L;  1YNJ D;  4JI5 L;  3NEN A;  4EQP A;  4DV2 L;  3GTK H;  1WCM G;  3NK9 A;  1KLG D;  2QEJ C;  3MA2 B;  4KMU C;  1EFW A;  1S3O A;  4TRD A;  4G7H C;  2F0S A;  2FJ2 A;  4RGO S;  3E9H A;  1E2V A;  5KEE A;  2K03 A;  1Q46 A;  4HSV A;  2JA6 B;  3L9A X;  1DXM A;  1LV9 A;  1OO9 B;  2HT1 A;  3L3O C;  1TWH H;  4IJH A;  5GAG C;  2WB1 B;  4LFB L;  1LTA D;  4HJA A;  2ZJQ A;  1OXT A;  4UHV A;  1NMG A;  3K5M A;  4QQB X;  3BYT B;  2UXD Q;  2EXZ A;  4CJ1 B;  5CV5 A;  2OXP A;  1PXU A;  1X3P A;  3NP8 A;  1TII D;  2A6H D;  1WTX A;  2F0O A;  5EBC A;  2NN6 H;  4Y7N B;  3PUX A;  1D2B A;  5FLM H;  4ZKB B;  1MIU A;  1IZ6 A;  4QUC A;  5EQ0 A;  1Y69 U;  5FLX E;  1HUM A;  1BNZ A;  2K5H A;  4IUU A;  2Z4H A;  3U9O A;  1FYC A;  4GKK L;  2ZT9 C;  2QEX A;  2XIW A;  5EAY A;  1LUZ A;  3HG9 A;  3GTM B;  2PI2 A;  5K36 G;  4QIW B;  1NNX A;  4HED A;  5HGQ A;  2WAQ B;  1TU2 B;  4DAV A;  3M85 A;  4X6A H;  1E24 A;  1TS5 A;  5HY6 A;  5FJ8 H;  5BR8 Q;  4DV7 L;  1NY4 A;  5JEA G;  4B3T Q;  1A2U A;  2I5L X;  4G7O C;  1BCP F;  3HOZ B;  4Y7N H;  1EY8 A;  4HJ9 A;  1HNW Q;  3QOL A;  1HZA A;  1LLR D;  1X3G A;  3AU7 A;  1STY A;  1LTT D;  3I70 A;  3QO2 A;  1HZ9 A;  2MO1 A;  4OWT B;  4A3G B;  2ZXP A;  3NTI A;  2KEE A;  3CU7 A;  4KHP Q;  1PTO C;  3GTL B;  1QNU A;  4AQY L;  3KLS X;  4L8J A;  4LF8 L;  2QDL A;  1OXX K;  4YCW A;  3H3V C;  1VQL A;  1NR4 A;  3SE0 A;  3LNN A;  4RCO A;  1UNS A;  4KN4 C;  5IGE A;  5M3F B;  1VQJ A;  3KF6 A;  4UDU C;  1UE5 A;  4YHH Q;  1B2T A;  3D8G A;  1UUP A;  4F87 A;  3AFQ A;  4HJ8 A;  1CA6 A;  2F1M A;  1F9P A;  2UXD L;  1V1Q A;  3GQB A;  5D65 A;  4DV5 L;  1I94 L;  3HOZ H;  5C0X H;  4KKS A;  3H0G G;  2IPK D;  4UP8 A;  2R93 G;  1CKO A;  3EVQ A;  4A3G H;  5IGF A;  2EOT A;  3GTL H;  1JWM D;  4K14 A;  2D2C C;  1TS4 A;  3PV0 A;  2RHS B;  1KC8 C;  4FYD A;  1EQR A;  3CCM A;  1D8L A;  1LO5 D;  2YTV A;  4B3R Q;  1STB A;  4POF A;  2KOL A;  1GUN A;  1ZXT A;  5M3F H;  1FL0 A;  1RL2 A;  3S1Q B;  2UUB L;  4LF6 L;  2RDH A;  2UXC L;  2C35 B;  5IYB G;  4KKT A;  1VQ9 A;  3I72 A;  2WP8 J;  4DXF A;  1AEX A;  3DWA A;  4YIJ A;  1IHZ A;  3NBH A;  4B3T L;  3NEM A;  1VQE A;  2KCN A;  1U5K A;  4HIO A;  1U9R A;  4GNX B;  1C48 A;  3BZD B;  3RLN A;  1EWC A;  2O2L D;  3J81 c;  2RVL A;  1AE2 A;  1IBM L;  1DD2 A;  2FMM A;  4NPS A;  1PYS B;  1PMR A;  3TQY A;  3Q22 A;  4K5X A;  2IY5 B;  1G8Z D;  1RD9 D;  4C3H G;  3MXP A;  4LF4 Q;  1Q7Y C;  2F0U A;  4RWS C;  1I50 B;  1XYI A;  2RCN A;  3S1Q H;  3QG1 A;  1K9M C;  4KI0 A;  1WFQ A;  5KND A;  1LAC A;  3K57 A;  2CWP A;  1XTC D;  5DLQ E;  2O5J C;  3S24 A;  4ME3 A;  4K6D A;  2I0Q A;  4I7Z C;  2V1C C;  1VQG A;  2EYP A;  1Y1W G;  1KNA A;  1R4P B;  3RLO A;  3U4Z A;  2BOS A;  4BBR B;  3KFU A;  1SNO A;  3NQT A;  2WIN B;  3X3N A;  5C4X B;  4ALP A;  4KKU A;  4CHT B;  2UUC L;  3CC4 A;  3J7Y W;  2Y0S G;  1N9W A;  1B1Z A;  4FXD A;  4RHR A;  4UP9 A;  3HOW G;  2A6E D;  4P2C B;  2JA8 G;  3W3A A;  3JAM E;  4XTC S;  5ELF A;  1OTC A;  5E3F A;  1X6O A;  1I4G A;  4YWL A;  5LMN L;  2F3I A;  3ICE A;  3C2P A;  2RHQ B;  3KJP A;  2GVA A;  3GTP H;  4OO1 H;  4JVZ A;  3DXJ C;  5JAV A;  1KXL A;  3J81 L;  1A63 A;  3AYH B;  1SFO B;  2O5I C;  2PQE A;  1YZ6 A;  5GAE C;  3LWU A;  1UE7 A;  2MHV A;  2EYH A;  1PRT B;  2HIX A;  1K3B C;  4B3M Q;  5EBD A;  2IHF A;  1FD7 D;  2HCI A;  1A0I A;  4LFC Q;  4BBR H;  3HOY G;  5C4X H;  4DR7 Q;  4DR3 Q;  2LS0 1;  1IBK L;  1TKW B;  1R9T B;  1PZJ D;  3A7A B;  2K7V A;  4I7A A;  1LTS D;  1B3A A;  1I4R A;  5J22 A;  1PH6 A;  4L5S A;  2NYZ D;  2VUM B;  3CCV A;  3E0E A;  2M9V A;  5A35 A;  3UDX A;  1U4M A;  2KUM A;  3OSO A;  3OWF A;  4RHS A;  3A8I E;  3IKJ A;  1SFO H;  2VY3 A;  1RTN A;  2JA9 A;  4NP5 A;  1D5Z C;  3K81 C;  4DR4 L;  1JE5 A;  1VQD A;  1K8O A;  5I6W A;  2Z6B A;  2Z0S A;  4JI1 Q;  1R9T H;  2GVB A;  1YHA A;  4RKB A;  1PYB A;  4DV4 Q;  1G6Z A;  2VUM H;  4BWG B;  2VL6 A;  2AHO B;  2NN6 G;  1N36 L;  5IWA L;  1YEZ A;  2NB0 A;  4XT3 B;  5FLM G;  2UU9 L;  3T53 B;  2F0V A;  4XQN A;  3HP3 A;  3KF8 B;  2RF4 A;  2DGY A;  3H3V I;  3K5L A;  1CUK A;  3CCQ A;  1AW7 A;  1SND A;  3TEH B;  2DY7 A;  2ZTD A;  1IKL A;  1VQI A;  5EPL A;  2A68 D;  1JOK A;  2N78 A;  4LUO A;  5AJ3 Q;  4DUZ L;  2WB1 G;  4X3S A;  2H5X A;  4OX9 Q;  3NE5 B;  2N55 A;  5EPJ A;  1WJJ A;  1N33 Q;  2I07 B;  5ELD A;  1I6V C;  5FJ8 G;  1S5D D;  5FKA C;  1Y8P B;  4X64 Q;  1YIJ A;  3A74 A;  1HFG A;  4KTA A;  2XN9 C;  1STA A;  1P16 A;  1Z9F A;  3VR6 A;  1FNV A;  4L63 B;  1J5E Q;  4BY1 G;  3SK5 A;  1MD2 D;  4HJ7 A;  1ML0 D;  1AFP A;  2BH2 A;  2F0J A;  1SDF A;  2LKV A;  3ULJ A;  5BN5 A;  5EKK A;  4AYB E;  2N49 A;  1JJG A;  1WTO A;  1IKM A;  4Q0F A;  2RDF A;  2WAQ G;  1WTW A;  3MFG A;  3KDF A;  4LJZ C;  3I8Z A;  4P71 A;  5CR3 A;  3A56 A;  1F77 A;  1LT6 D;  1U0L A;  4DR2 Q;  4TKO B;  3T16 A;  2R7F A;  2MJ8 A;  3EJI A;  3RUZ A;  2N3S A;  2D9U A;  3HOZ G;  5C0X G;  3I3C A;  2F0E A;  4LF9 L;  2A73 B;  3BVM A;  5F2D A;  1EEI D;  5FK9 C;  1LT5 D;  4A3G G;  3NWS A;  5DEH A;  4LUV A;  4X65 L;  1Q12 A;  2DY8 A;  1Q3L A;  1ENA A;  3U9S A;  2IWH A;  5JEA H;  4X3T A;  3UDG A;  1LAB A;  4FNF A;  5L37 A;  2ASB A;  2KVM A;  2VXW A;  2B2T C;  4JI0 Q;  3H0G B;  1CKM A;  2L12 A;  3GTG B;  3TBI B;  5M3F G;  4EX5 A;  2L9H A;  3STB D;  4IAL A;  2F3W A;  1QOH A;  1TY2 A;  2G9H D;  1SLJ A;  2JEA I;  3KUP A;  3F2B A;  1N33 L;  2X6L A;  5IGD A;  1Y14 B;  1N8R C;  2L11 A;  3TS0 A;  1FNU A;  3FRP B;  2K01 A;  3CRL C;  2EY2 A;  1SYE A;  4LWC A;  5IP9 H;  1IYV A;  1PLF A;  1EIY B;  1IW7 C;  4H0L C;  3CXC A;  4NXM Q;  1J5E L;  2A69 C;  2ALY B;  4ZLT F;  1G29 1;  2A1A A;  2B39 A;  2QF7 A;  4K5W A;  4OON A;  1SE3 A;  3OYY A;  1I4Q A;  3J7A V;  1ET6 A;  4PV1 C;  2L1B A;  4AIM A;  2OTL A;  3GTG H;  2PPB C;  3PSI A;  4K2K A;  3BDL A;  4QJF A;  3J7A 5;  1EWI A;  1QVC A;  4QCL A;  1X32 A;  5IGC A;  3M4P A;  5ELE A;  1N34 Q;  1PRT D;  5KNB A;  4P73 A;  1K83 B;  1ILP A;  3CCS A;  3HFZ B;  4O0A A;  4O42 A;  3UE0 A;  1J6Q A;  1LTB D;  4YCU A;  4LF7 Q;  4A3C H;  4IUQ A;  1HH2 P;  1U4P A;  2MGS A;  4A3I B;  4WOR A;  2A19 A;  3BZK A;  1PH5 A;  2MFI A;  4X62 L;  4J15 A;  2F0M A;  3CCL A;  3DWP A;  2J7Z A;  1GKH A;  2TSS A;  4CDD C;  2SNS A;  1CKN B;  2WKC A;  1VQH A;  4DR1 Q;  1SXT A;  1NBW A;  1HR0 W;  4JI5 Q;  3MXN A;  4QUF A;  4JI0 L;  4DV2 Q;  4OO1 G;  3D4D A;  1CT1 D;  1E2Z A;  5E4X A;  1KD1 C;  1O7I A;  4B9X A;  1MSG A;  1K83 H;  3H94 A;  2EYM A;  2HD3 A;  4JI2 L;  5C0X J;  2QDB A;  1B3Q A;  1SNC A;  3HOW B;  1BCP C;  1V1P A;  1XNR L;  5IOC A;  1SNP A;  1I4H A;  3R8B A;  3MTS A;  4BBR G;  3T13 A;  3BJU A;  2VQE Q;  4LFA L;  4A3I H;  1FNW A;  3UDI A;  5C4X G;  3MVV A;  2N8N A;  3T1Y L;  2F0F A;  1XPU A;  4RH6 A;  1PH9 A;  3F8T A;  2BH8 A;  1JJ2 A;  4LFB Q;  4BBS B;  3DM3 A;  2B29 A;  3S14 B;  5M5Y B;  4ZUI A;  3S9W A;  3QOJ A;  2L0C A;  4IUT A;  2K5V A;  2LXJ A;  3HOY B;  5DNF A;  1GM5 A;  4KY7 A;  1PRT F;  1GUS A;  3CP0 A;  1ZEQ X;  3W5O A;  3HZX A;  1KTK A;  3I90 A;  1RIP A;  2IW3 A;  1K0R A;  4R4O A;  3ERS X;  1PZI D;  5J1Z A;  1ZYR D;  3NUC A;  2A6H C;  5I9O A;  1A2T A;  1DOL A;  4GS3 A;  4PG3 A;  4B9W A;  5M3M B;  1N34 L;  1CA5 A;  1FGB D;  3T56 B;  4A3E B;  5E1F A;  3Q24 A;  4R4Q A;  3TRZ A;  1B7Y B;  2F0H A;  4IZ8 A;  5IT9 L;  3CC2 A;  4ZYS A;  4JBK A;  3QJY A;  4JOI A;  1F9R A;  4KHZ A;  3JAM i;  3TP8 A;  4ZKC B;  4ID6 A;  1KDB A;  4LNQ A;  5IP7 H;  2B63 H;  3PO3 H;  2HHH L;  1EL0 A;  3K59 A;  4GKK Q;  1SAP A;  1WTV A;  4AYB G;  4JK1 C;  2WKD A;  4DAM A;  2D0P A;  2VUM G;  3CCU A;  4BBS H;  1HFN A;  3OWE B;  2K5W A;  5M5Y H;  2UXB L;  1EYA A;  3DM1 A;  4C2M B;  1QJO A;  3ERQ A;  3FEW X;  2E74 C;  2CQA A;  4U68 A;  4DV7 Q;  3SDZ A;  5EKL A;  4C3J B;  1FJG L;  2VQF L;  3KLR A;  5COY A;  3DHQ A;  1EIF A;  3RR5 A;  2VZA A;  4IQZ A;  1Y8O B;  5ELB A;  1QVF A;  3PGZ A;  1GOZ A;  5M3M H;  4GOP A;  1TR5 A;  2CHB D;  1XX8 A;  4A3E H;  5ISR A;  4DGZ A;  4AQY Q;  2AUK A;  1E3P A;  4LF8 Q;  4JBW A;  3KF6 B;  1J8I A;  4GOP C;  2VQE L;  5T1G A;  5KIX A;  3C1F A;  1QG7 A;  1KHI A;  2R6G A;  3I4M G;  4OXP A;  3PUV A;  4C2M H;  4JBJ A;  3M4Y A;  4C3J H;  3J80 E;  1ESR A;  2OF1 A;  1XMQ L;  1BKB A;  3H3V H;  1E22 A;  4DV5 Q;  1I94 Q;  5G3L D;  1HNZ Q;  1VQN A;  4N8F A;  1D6E C;  2K28 A;  1Z7T A;  4V0B A;  1EQT A;  1NCV A;  5EJW A;  1PZK D;  4UY8 C;  3AB9 A;  4LK1 C;  1Y1V H;  3NQI A;  2PZT A;  3N6R A;  4PQX A;  4RGM A;  1G91 A;  3CC7 A;  1SRU A;  1PH2 A;  3G71 A;  4BY1 B;  4OEM B;  1YJW A;  4DR6 L;  3PF5 A;  2E8G A;  1G2T A;  1XPO A;  1IXR A;  3K80 C;  2ZM6 L;  2H4O A;  4O1N A;  3H15 A;  3QB3 A;  3TS2 A;  3R2I A;  3RMH A;  1E7Z A;  1ASZ A;  2HCC A;  2AWN A;  1EWH A;  1I3Q B;  2PQA A;  5DAU A;  1TS3 A;  2MUY A;  2OTJ A;  1CZW A;  2UUB Q;  4LF6 Q;  3NBH B;  4MZ9 A;  2JN4 A;  2UXC Q;  1A3V A;  2D5D A;  2PI2 E;  4MN3 A;  2JA5 B;  2VB2 X;  1YHB A;  2IL8 A;  4KV6 A;  1UEB A;  4L5Q A;  2SDF A;  2IJ0 A;  3C3L A;  2F0W A;  5C44 B;  4FF3 A;  2K1B A;  4WFN 3;  2I5M X;  3QR8 A;  1YI2 A;  2EDG A;  4BY1 H;  1PHJ A;  1IBM Q;  3BDO A;  1KRT A;  2QW7 A;  3MZ5 A;  3A5Z B;  3TP6 A;  1Q90 A;  2UUA L;  3QWN A;  1DJR D;  2L4N A;  4NXN L;  3TZU A;  2WFW A;  2B8F A;  1D7Q A;  1I3Q H;  2F0G A;  1GHK A;  4A93 G;  1K8M A;  1D5X C;  2GA4 B;  4O2D A;  1HQR D;  1JCK B;  5FO8 B;  5IP9 G;  3Q6S A;  1EIH A;  2EE1 A;  2YTY A;  2E75 C;  1AE3 A;  1AN8 A;  5I2X A;  4GLX A;  3TRE A;  2JA5 H;  5G3L F;  1SR3 A;  2YTX A;  1G51 A;  4JCV E;  2ZJP A;  5E7N A;  2WV6 D;  3SEB A;  2HDL A;  4HJ5 A;  2EJM A;  1Q82 C;  3SK6 A;  1VCI A;  1QNK A;  2ZTC A;  3HRZ C;  1HNZ L;  3NXW A;  3G6J B;  5C44 H;  3H6M A;  2UUC Q;  5C4J B;  1KL9 A;  1MSH A;  1SJE D;  1W6J A;  3F2U A;  3DWQ A;  3OMC A;  1IL2 A;  1VQ7 A;  3URY A;  2ZTE A;  2F0I A;  4KJN A;  3HGB A;  1W2B A;  1XJV A;  3S17 B;  5LMN Q;  4A3C G;  1L2F A;  1SRO A;  3MWY W;  3RN2 A;  1DON A;  4DV6 L;  3P20 A;  3GV3 A;  2AQ3 B;  1H9K A;  4QL5 A;  4ZQ3 A;  4A3F B;  2ZXR A;  2RQX A;  1NSN S;  2DJF C;  5IIF A;  3L7Z C;  3WDN A;  3BZC A;  1JWU D;  2EVB A;  3GTJ B;  2MPM A;  1PVO A;  4C1N K;  2OEO A;  4UP7 A;  1S5C D;  1VF7 A;  1IBK Q;  2VNU D;  5EPK A;  3Q8D A;  5C4J H;  1KIX A;  4L6T B;  2E2H B;  2EYF A;  2GN5 A;  3A5U A;  2FHT A;  1BBX C;  4DXG A;  4FP5 D;  4A3D B;  1A8V A;  3PCO B;  2RA4 A;  3ND8 A;  5CBE E;  1EOV A;  2I5H A;  1YNX A;  1JT8 A;  2PO4 A;  1Q86 C;  3S17 H;  3K5O A;  4IPG A;  4A3I G;  1EZ8 A;  3HKS A;  3PF4 A;  3KOJ A;  3GTP B;  5JEA J;  2F0Q A;  4A3F H;  1E0B A;  3M7N A;  4FF4 A;  2D0O A;  4U67 3;  4Y52 H;  4DR4 Q;  3CMA A;  4HMI A;  5FO9 B;  1D5M C;  1Q8K A;  4X66 L;  3GTJ H;  5CV6 A;  2B2V C;  1QB5 D;  2Q2I A;  3AMU A;  2F4V L;  2JQO A;  5A2Q L;  1M90 C;  2E2H H;  3KBX A;  1ENF A;  2NBF A;  5EGT A;  4XQJ A;  4ODG A;  3T51 B;  5ELN A;  2K6A A;  3I4L A;  4DV3 L;  5LL6 X;  1ROD A;  4A3D H;  1N36 Q;  5TSS A;  2WAC A;  2BDN A;  1ASY A;  5IWA Q;  4PMB A;  4CGY B;  3C1E A;  2UU9 Q;  3U4V A;  3FMC A;  3LX0 A;  5JVG 3;  2KCM A;  4FF2 A;  1WVL A;  5IGB A;  4XXE A;  1ICF B;  1BBW A;  4F7X A;  5IP7 G;  2B63 G;  3PO3 G;  5DM7 3;  2NVQ B;  5JPN C;  2A74 C;  4OWW B;  2NZ1 D;  1QZH A;  2FMC A;  4DUZ Q;  2RSO A;  5KNC A;  1H9J A;  2B3G A;  4NMZ A;  4BBS G;  1G2S A;  2NWG A;  2A68 C;  1YJN A;  1E1O A;  1SYB A;  4IPC A;  5C4Z A;  1DYQ A;  3M4O H;  1EYG A;  2JYO A;  4PZ8 A;  1N32 Q;  3D4R A;  1LTG D;  4S3S A;  1VQ4 A;  1C0A A;  4JI8 L;  1CSP A;  4AYB B;  5M3M G;  4A3E G;  3FPU B;  5C4H A;  4K6L A;  4RG1 A;  4TQU S;  2Q8T A;  1VQK A;  1L0X B;  1KLU D;  4N8X 1;  1XMO L;  4R9W A;  2NVQ H;  1F2M A;  3KDF B;  3GTQ B;  1SEB D;  2CKZ B;  1MBY A;  3IFD A;  2FXQ A;  4P75 A;  1HR0 L;  1BDO A;  4IPD A;  4C3I B;  4DR5 L;  3BU2 A;  1ONL A;  1TWG B;  4HN7 A;  2E2J B;  2EY5 A;  1EFI D;  4C3J G;  2JK8 A;  4A3K B;  1EY4 A;  1UEA B;  3RZD B;  2K14 A;  1HXY D;  4UAI A;  1YNN D;  3JC6 6;  1H95 A;  4LW1 A;  4P74 A;  2E2I B;  4BA1 I;  2XWJ B;  4LF9 Q;  4GLA C;  3VR3 A;  1STE A;  4BY7 H;  4EQN A;  4GNX C;  1F9Q A;  3I4M B;  1W6K A;  3CPF A;  2K50 A;  1Y1V G;  3KJO A;  3WOF A;  4X65 Q;  2NVT B;  1HTP A;  5D3I B;  1PYW D;  3L0O A;  3F2D A;  1HPC A;  1FGU A;  1O7L A;  2EZV A;  3Q23 A;  2EYO A;  4IUR A;  3GTQ H;  2JSO A;  1J9O A;  4DU9 A;  3VYR A;  1S5B D;  3I55 A;  3HOU H;  3J81 j;  2R92 H;  1EOT A;  4C3I H;  2XRS D;  4DNT B;  1TWG H;  5I9P A;  2EY1 A;  2E2J H;  1NTG A;  3S15 B;  4KK7 A;  4A3K H;  1CFM A;  3RZD H;  4GN5 A;  2E2I H;  4HMJ A;  1HJP A;  4B3S L;  2LY7 A;  1N32 L;  1SBB B;  3CD6 A;  3DEO A;  3VYS A;  3MC0 B;  2KCC A;  3MHB A;  3I4M H;  4BA2 I;  4QGU A;  5BN4 A;  2NVT H;  1IL8 A;  1HA6 A;  4ABN A;  4OGQ C;  3H09 A;  1LT4 D;  2AKW B;  4FXG C;  1V9P A;  4A3B H;  3J80 i;  1HHV A;  1F2Y A;  1K73 C;  1I4P A;  4J1M A;  3OW7 A;  1LT3 D;  3FHW A;  3I73 A;  2PW7 A;  1WD1 A;  1SNQ A;  4MTN A;  2MNA A;  3HOV B;  3VR5 A;  3PUY A;  3SXH A;  1I6H B;  3BYY B;  5J3B A;  3S15 H;  3S2H B;  3EIV A;  2P5Z X;  4IN3 A;  4RKL A;  3T1H L;  1L1O A;  1TWC B;  1RTO A;  1JC7 A;  1RJT A;  4A3J B;  5NUC A;  2JA5 G;  1OXU A;  2Q8I B;  1PRT C;  2LXK A;  3PMF A;  1NJI C;  4CJ2 C;  5FOB B;  3NSW A;  3MAQ A;  1IBL L;  3EN2 A;  4JI7 L;  1NAP A;  1KNE A;  1TVX A;  1X65 A;  3TP5 A;  3HOX B;  4A93 B;  4DK1 A;  3U58 A;  5C44 G;  1L1O C;  1OXS C;  4Q5V A;  3RN5 A;  5CYU A;  2CCZ A;  4OIJ A;  1U4R A;  4JI4 L;  2B2T A;  2RKS A;  4X62 Q;  4K2L A;  1SMY D;  3I56 A;  4KY6 A;  2PYK A;  2X69 A;  3MXN B;  1CTM A;  3FVQ A;  3VDY A;  1B4O A;  1K0S A;  2QIL A;  1X3F A;  3HOV H;  4UPA A;  2ATW A;  1I6H H;  1EUJ A;  3KLW A;  3S2H H;  1V1P B;  5COR A;  5FLX L;  4HIK A;  4YWK A;  1TS2 A;  2XWB B;  1TWC H;  3EFX D;  4PMC A;  2K52 A;  4A3J H;  1JB7 A;  4JI2 Q;  1CI3 M;  3VA5 A;  4N9T A;  3CCJ A;  1HNX L;  3DUZ A;  1GVP A;  4NDX A;  3AQQ A;  1XNR Q;  3ONA B;  2XNA C;  1JJC B;  5CC4 A;  4DK3 C;  2G5D A;  4B08 A;  4LAA A;  3HOX H;  4A93 H;  5H1S E;  4LFA Q;  2E5L L;  1VDZ A;  2XRQ D;  1M8A A;  3HKZ E;  4KN7 C;  3T1Y Q;  3UDF A;  2KA7 A;  4HCE A;  3KF8 A;  1PH7 A;  3AFP A;  1LTR D;  3V05 A;  5IYD H;  3TN2 A;  2XTI A;  1SSO A;  3NEL A; 
#chains in the Genus database with same CATH homology
 4IFD I;  5FO7 B;  2G9D A;  2BE5 D;  3RZO B;  1R4Q B;  1B53 A;  2NTS A;  3MEH A;  4ZAI A;  4RCN A;  1WTR A;  3ERO A;  3IL8 A;  4ZK9 B;  3BVG A;  2JP1 A;  1ZYR C;  5EKI A;  4K8I A;  2ZXO A;  1BR9 A;  1SNM A;  3BVZ A;  5M5W B;  4XYQ A;  3CRK C;  4FO2 A;  1EQV A;  1AZP A;  2F0T A;  2QKI C;  1UAP A;  3J81 E;  2B2Y C;  2K33 A;  1YNJ C;  1Z47 A;  2K04 A;  3A8K E;  1HRJ A;  4RAU C;  1D1I A;  2YU9 B;  1Q8I A;  4G7Z C;  2B63 B;  3PO3 B;  1CQV A;  4HR7 B;  4DK0 A;  2MP1 A;  4F88 A;  2JA7 B;  1RCV D;  1TT2 A;  1EU4 A;  4WJW A;  1T5E A;  3GD7 A;  3SR1 A;  2E76 C;  2KEC A;  1XWE A;  5CV7 A;  3DEP A;  2L5T A;  3S1R B;  3ITP A;  4GZY C;  5C5M A;  1AP0 A;  3M7G A;  2EPB A;  4LMQ D;  3H91 A;  4EQO A;  1HUN A;  1JQY D;  4J8Q A;  4E6I A;  1KDA A;  3W2D A;  4CKC A;  1MGS A;  1PTO B;  2K5D A;  4X3U A;  1BQQ T;  1V43 A;  2EJF C;  1U4L A;  3JAM L;  2KQ3 A;  4C3I G;  5J39 A;  3V96 A;  4DAY A;  2CW0 D;  1Y1V B;  3UI2 A;  1TY0 A;  3TSS A;  3C46 A;  4DFA A;  5D3D A;  1PTO H;  2C9O A;  5BN3 A;  1BCP D;  4RGN A;  4ULL A;  3NTH A;  1OXV A;  5CV4 A;  4CKE A;  4I65 A;  1H9S A;  1HCZ A;  5C6A A;  4HAE A;  2C5C A;  2JEB I;  1JWS D;  4BS9 A;  2AQ1 B;  1PFB A;  3NPP A;  3NWT A;  2CVR A;  3RD4 A;  3IFT A;  2N88 A;  1EIG A;  4C1N I;  1ET9 A;  4PMW A;  2NVY B;  3K0Y A;  2BCO A;  5M9O A;  1SYD A;  4K8J A;  1ESF A;  1A3T A;  2M2L A;  2VB3 X;  1A6X A;  1S5E D;  1BUV T;  4QMG A;  3K7A B;  3PUW A;  3HS0 C;  1RDP D;  3BDC A;  4DAP A;  4PNY A;  5HUR A;  4N9P A;  1E2W A;  2Z8L A;  1T5X D;  2XSC A;  3EQL C;  1S4Z A;  4M1U B;  2O4X A;  3OIQ A;  1EY0 A;  5KYI A;  2EYJ A;  2F0N A;  4OL7 A;  1EU3 A;  4KD3 A;  1V1O A;  4ILW A;  3PUZ A;  5M5X B;  1TWA B;  1DOM A;  2JXM B;  1BF4 A;  3D31 A;  4RFB A;  3J7A F;  4XYO A;  5CGK A;  3D3R A;  4A3M B;  1CQF A;  3EA6 A;  3S2D B;  3Q0A A;  4G4K A;  1BOS A;  2SEB D;  2A6E C;  1EYC A;  1O78 A;  1VMP A;  3VYT A;  2F0D A;  4FVM A;  1QCB D;  2IT1 A;  1WTP A;  1QE6 A;  4IFD H;  3VYU A;  4FF1 A;  4H7B A;  1QWY A;  5T1I A;  2X6G A;  1GJX A;  1SE4 A;  2BA1 A;  3G7L A;  2PZW A;  3DMU A;  1CHP D;  3E0J A;  2EY6 A;  1B9N A;  4EGV A;  2JE6 I;  3I4N B;  1F2Z A;  3KBG A;  3S16 B;  1KAB A;  1RHP A;  3K6O A;  3R93 A;  3TME A;  2BDO A;  2PW5 A;  2WII B;  1Q1E A;  3R2T A;  2B2V A;  4KY5 A;  2NVX B;  1PTO D;  1EZ6 A;  5C5L A;  5LHY 1;  2R3Z A;  1HA5 A;  5CV9 A;  5I2Y A;  4ZUJ A;  5K5P A;  2QCP X;  3A54 A;  1KDC A;  3X3M A;  4F8M A;  3M4O B;  4XT1 B;  1YNN C;  5JPM C;  5KRU A;  3CQZ B;  1JOQ A;  4NKL A;  5IT9 E;  4R8N A;  3P1H A;  3LWE A;  1RKN A;  2IX1 A;  5HGT A;  3SVM A;  2ICE C;  3P75 A;  1CM9 A;  2L55 A;  1QIL A;  2Z4I A;  4QF4 A;  3O13 A;  3TP7 A;  3OMG A;  4MHE A;  1I4X A;  1VF5 C;  1B9M A;  2DNE A;  2K5Q A;  1BXT A;  1HQM C;  3VA7 A;  4DNR B;  2J4X A;  4BY7 B;  3PIO 3;  1HTL D;  1EEF D;  4MIU A;  2NUC A;  1JOR A;  3M3Y B;  5ELC A;  1B50 A;  1A3U A;  3D4W A;  1M4V A;  5E4W C;  1II3 A;  4CBV A;  3SK8 A;  1PTO F;  4XIG S;  4M8A A;  4DN4 M;  3HOU B;  2R92 B;  1EY9 A;  1NR2 A;  2YYZ A;  4C56 C;  1DCZ A;  2F0K A;  1JR0 D;  1GUG A;  4KD4 A;  1IYU A;  5D14 A;  3K5N A;  3PIP 3;  1GUW A;  1WCM B;  2PNR C;  3MXG A;  3WOE A;  5C3X A;  2ENB A;  1STH A;  2ID0 A;  3S1M B;  1KAA A;  1ZKO A;  5CV8 A;  2HQE A;  1SMY C;  4HCS A;  3ZYY X;  4A3B B;  2OT2 A;  2AQ2 B;  1XXG A;  3HKZ B;  3NTK A;  4J6H A;  4H13 C;  4Z9C B;  3TDQ A;  3P7J A;  5JJZ A;  1X3Q A;  1JB3 A;  5JVH 3;  3KK7 A;  1WTQ A;  4EVO A;  4DF7 A;  2IX0 A;  1ICW A;  3T4A C;  5KYL A;  2NN6 I;  2DNC A;  3SK4 A;  4TSS A;  1FR3 A;  1L0Y B;  1STG A;  3CKI B;  4RGT A;  4CKB A;  1F9S A;  2BE5 C;  1O7Y A;  4HSP A;  3NHH A;  3KLS A;  2LMC B;  4KJO A;  3CHB D;  4QB4 A;  3PO2 B;  4IUV A;  2LFN A;  1DZ1 A;  3OHX C;  1ILQ A;  3J80 L;  1C8C A;  1JOO A;  4OIK A;  2ICI A;  1GHJ A;  4FXK C;  4DA2 A;  1BCP B;  3A8J E;  4HTH A;  1SYG A;  3GP7 A;  2SOB A;  4XDX A;  2F3V A;  2XVS A;  4R8I A;  5C3W A;  3GV6 A;  2BA0 A;  2B2U A;  2K05 A;  5K36 H;  1EY5 A;  3QIA A;  2KJX A;  3HEJ A;  1LTI D;  2KHS A;  1DM0 B;  1MI2 A;  5C3E B;  2IX3 A;  2B2U C;  4IFD G;  4RA8 A;  1SE2 A;  3S1N B;  1CZG A;  3E6Z X;  2PCF B;  5DM6 3;  1GXD C;  4K5V A;  3MFY A;  1Y8N B;  5C0X I;  3OOC A;  2D62 A;  4G57 A;  1PFM A;  2E2D C;  1EYD A;  5JOB A;  2R93 B;  2Z1C A;  2HUG A;  2TMP A;  1CHQ D;  3VR4 A;  3N52 A;  1H9R A;  1SYC A;  1GUT A;  2RDG A;  3GO5 A;  3BG3 A;  3FDT A;  3K58 A;  2R7Z B;  1RF2 D;  2KED A;  5A2Q E;  3V2T A;  3NBI A;  3MXU A;  2NTT A;  5I4D A;  1ENC A;  3I91 A;  3R3O A;  3A55 A;  2F4I A;  4WRD A;  2B2Y A;  1EY7 A;  4X3K A;  1H9M A;  4NW2 A;  1BO0 A;  1Q1B A;  4C3H B;  1S5F D;  2R61 A;  3FPP A;  5LL6 S;  4OHJ A;  3FKI B;  3VR2 A;  1A15 A;  2F0P A;  3D6C A;  1SJH D;  3IAY A;  4V19 0;  2CW0 C;  2SNM A;  1JIC A;  1O7Z A;  3BS1 A;  1V8Q A;  1Y1W B;  1D1K A;  4IUN A;  4CJ0 B;  1H9S B;  2RSN A;  1STN A;  1Z6H A;  4H44 C;  3OPO A;  1DOK A;  2RBM A;  2Y0S B;  1C4Q A;  4ZRZ A;  2PMZ B;  4ME5 A;  1B44 D;  1TWF B;  2JA8 B;  2FFK B;  2FIN B;  2EYL A;  3RLF A;  2K32 A;  1AZQ A;  2B2W A;  1IW7 D;  5AFW A;  1F2L A;  4IFD J;  4OO1 I;  2H1E A;  2A69 D;  2V4D A;  5CMD A;  3OIP A;  4IUP A;  3ND9 A;  2PZU A;  2AWO A;  2B2W C;  2A5H A;  2HDM A;  2M00 A;  2J0T D;  1EY6 A;  5CBA E;  2F03 A;  2AUJ D;  2F0L A;  1O80 A;  3A7L A;  1TQO A;  1GUO A;  5I6Y A;  3GTK B;  1CK1 A;  1WD0 A;  4KHV A;  5IOD A;  4XQQ A;  3E5S A;  1PDQ A;  3TZD A;  2I46 A;  2Q8R E;  1NUC A;  5KGU A;  3GTO B;  1PFN A;  2EJG C;  3D6W A;  1VMC A;  5IGG A;  2B8G A;  2DN8 A;  1SYF A;  3SHL A;  1TWH B;  1JE4 A;  1YNJ D;  4EQP A;  3NK9 A;  1KLG D;  2QEJ C;  3MA2 B;  4KMU C;  4TRD A;  4G7H C;  2F0S A;  2FJ2 A;  4RGO S;  1E2V A;  5KEE A;  2K03 A;  4HSV A;  2JA6 B;  3L9A X;  1DXM A;  1LV9 A;  1OO9 B;  3L3O C;  2WB1 B;  1LTA D;  1OXT A;  3K5M A;  3BYT B;  2EXZ A;  4CJ1 B;  5CV5 A;  2OXP A;  1PXU A;  1X3P A;  3NP8 A;  1TII D;  2A6H D;  1WTX A;  2F0O A;  5EBC A;  2NN6 H;  4Y7N B;  3PUX A;  1D2B A;  4ZKB B;  4QUC A;  5EQ0 A;  1Y69 U;  5FLX E;  1HUM A;  1BNZ A;  4IUU A;  2Z4H A;  3U9O A;  1FYC A;  2ZT9 C;  2XIW A;  3HG9 A;  3GTM B;  5K36 G;  4QIW B;  4HED A;  2WAQ B;  1TU2 B;  4DAV A;  3M85 A;  1TS5 A;  5JEA G;  1A2U A;  4G7O C;  1BCP F;  3HOZ B;  1EY8 A;  3QOL A;  1LLR D;  3AU7 A;  1STY A;  1LTT D;  3I70 A;  3QO2 A;  4A3G B;  2ZXP A;  3NTI A;  2KEE A;  3CU7 A;  1PTO C;  3GTL B;  1QNU A;  3KLS X;  4L8J A;  1OXX K;  3H3V C;  1NR4 A;  3SE0 A;  3LNN A;  4RCO A;  1UNS A;  4KN4 C;  5IGE A;  5M3F B;  4UDU C;  1B2T A;  3D8G A;  1UUP A;  4F87 A;  1CA6 A;  2F1M A;  1F9P A;  3GQB A;  5D65 A;  5C0X H;  4KKS A;  2IPK D;  3EVQ A;  5IGF A;  2EOT A;  1JWM D;  4K14 A;  2D2C C;  1TS4 A;  3PV0 A;  4FYD A;  1LO5 D;  1STB A;  2KOL A;  1GUN A;  1ZXT A;  3S1Q B;  2RDH A;  4KKT A;  3I72 A;  2WP8 J;  4DXF A;  1AEX A;  3DWA A;  4YIJ A;  1IHZ A;  3NBH A;  2KCN A;  1U9R A;  1C48 A;  3BZD B;  1EWC A;  2O2L D;  2RVL A;  1DD2 A;  2FMM A;  1PMR A;  3Q22 A;  4K5X A;  1G8Z D;  1RD9 D;  4C3H G;  3MXP A;  2F0U A;  4RWS C;  1I50 B;  1XYI A;  3QG1 A;  4KI0 A;  5KND A;  1LAC A;  3K57 A;  1XTC D;  2O5J C;  4K6D A;  4I7Z C;  2EYP A;  1KNA A;  1R4P B;  4BBR B;  2BOS A;  1SNO A;  3NQT A;  2WIN B;  3X3N A;  5C4X B;  4KKU A;  4CHT B;  3J7Y W;  1B1Z A;  4FXD A;  4RHR A;  2A6E D;  4P2C B;  3W3A A;  3JAM E;  4XTC S;  5ELF A;  5E3F A;  1I4G A;  3C2P A;  4OO1 H;  3DXJ C;  5JAV A;  3J81 L;  1SFO B;  2O5I C;  2PQE A;  3LWU A;  2MHV A;  2EYH A;  1PRT B;  5EBD A;  1FD7 D;  2HCI A;  2LS0 1;  1TKW B;  1R9T B;  1PZJ D;  3A7A B;  2K7V A;  1LTS D;  1B3A A;  1I4R A;  5J22 A;  2NYZ D;  2VUM B;  2M9V A;  5A35 A;  1U4M A;  2KUM A;  3OSO A;  3OWF A;  4RHS A;  3A8I E;  3IKJ A;  1RTN A;  4NP5 A;  1D5Z C;  1K8O A;  5I6W A;  4RKB A;  1G6Z A;  4BWG B;  2NN6 G;  2NB0 A;  4XT3 B;  3T53 B;  2F0V A;  4XQN A;  3HP3 A;  3K5L A;  1AW7 A;  1SND A;  2DY7 A;  1IKL A;  5EPL A;  2A68 D;  1JOK A;  4X3S A;  3NE5 B;  2N55 A;  5EPJ A;  2I07 B;  5ELD A;  1I6V C;  1S5D D;  5FKA C;  1Y8P B;  1HFG A;  4KTA A;  2XN9 C;  1STA A;  3VR6 A;  1FNV A;  4L63 B;  3SK5 A;  1MD2 D;  1ML0 D;  1AFP A;  2F0J A;  1SDF A;  2LKV A;  5BN5 A;  5EKK A;  1WTO A;  1IKM A;  4Q0F A;  2RDF A;  1WTW A;  3MFG A;  4LJZ C;  3I8Z A;  5CR3 A;  3A56 A;  1F77 A;  1LT6 D;  4TKO B;  3T16 A;  2MJ8 A;  3EJI A;  3RUZ A;  2D9U A;  5C0X G;  3I3C A;  2F0E A;  2A73 B;  3BVM A;  5F2D A;  1EEI D;  5FK9 C;  1LT5 D;  3NWS A;  5DEH A;  1Q12 A;  2DY8 A;  1Q3L A;  1ENA A;  3U9S A;  2IWH A;  5JEA H;  4X3T A;  1LAB A;  4FNF A;  2KVM A;  2VXW A;  2B2T C;  3H0G B;  2L12 A;  3GTG B;  3TBI B;  2L9H A;  4IAL A;  2F3W A;  1QOH A;  1TY2 A;  2G9H D;  2JEA I;  3KUP A;  2X6L A;  5IGD A;  2L11 A;  1FNU A;  3FRP B;  2K01 A;  3CRL C;  2EY2 A;  1SYE A;  1IYV A;  1PLF A;  1IW7 C;  4H0L C;  2A69 C;  4ZLT F;  1G29 1;  2B39 A;  2QF7 A;  4K5W A;  1SE3 A;  1I4Q A;  3J7A V;  1ET6 A;  4PV1 C;  2L1B A;  2PPB C;  4K2K A;  3BDL A;  4QCL A;  1X32 A;  5IGC A;  5ELE A;  1PRT D;  5KNB A;  1K83 B;  1ILP A;  4O42 A;  1LTB D;  4IUQ A;  1U4P A;  2MGS A;  4A3I B;  4WOR A;  2F0M A;  3DWP A;  2J7Z A;  2TSS A;  2SNS A;  2WKC A;  1SXT A;  3MXN A;  4QUF A;  4OO1 G;  3D4D A;  1CT1 D;  1E2Z A;  5E4X A;  4B9X A;  1MSG A;  3H94 A;  2EYM A;  5C0X J;  2QDB A;  1SNC A;  3HOW B;  1BCP C;  1V1P A;  5IOC A;  1SNP A;  1I4H A;  3R8B A;  3MTS A;  3T13 A;  1FNW A;  3MVV A;  2F0F A;  4RH6 A;  4BBS B;  3S14 B;  5M5Y B;  4ZUI A;  3S9W A;  3QOJ A;  2L0C A;  4IUT A;  3HOY B;  5DNF A;  4KY7 A;  1PRT F;  1GUS A;  1ZEQ X;  3HZX A;  1KTK A;  3I90 A;  2IW3 A;  5J1Z A;  1PZI D;  1ZYR D;  3NUC A;  2A6H C;  5I9O A;  1A2T A;  1DOL A;  4B9W A;  5M3M B;  1CA5 A;  1FGB D;  3T56 B;  4A3E B;  5E1F A;  3Q24 A;  2F0H A;  4IZ8 A;  5IT9 L;  4ZYS A;  3QJY A;  1F9R A;  4KHZ A;  3TP8 A;  4ZKC B;  4ID6 A;  1KDB A;  1EL0 A;  3K59 A;  1SAP A;  1WTV A;  4JK1 C;  2WKD A;  1HFN A;  3OWE B;  2K5W A;  1EYA A;  3DM1 A;  4C2M B;  1QJO A;  3ERQ A;  3FEW X;  2E74 C;  2CQA A;  4U68 A;  3SDZ A;  5EKL A;  4C3J B;  3KLR A;  5COY A;  3DHQ A;  4IQZ A;  1Y8O B;  5ELB A;  1GOZ A;  1TR5 A;  2CHB D;  1XX8 A;  5ISR A;  4DGZ A;  2AUK A;  4JBW A;  1J8I A;  5T1G A;  5KIX A;  3C1F A;  1QG7 A;  2R6G A;  3PUV A;  3M4Y A;  3J80 E;  1ESR A;  2OF1 A;  5G3L D;  1D6E C;  2K28 A;  1Z7T A;  4V0B A;  1EQT A;  1NCV A;  5EJW A;  1PZK D;  3AB9 A;  4LK1 C;  3NQI A;  2PZT A;  3N6R A;  4PQX A;  4RGM A;  1G91 A;  4BY1 B;  1G2T A;  2H4O A;  4O1N A;  3QB3 A;  3R2I A;  3RMH A;  2HCC A;  2AWN A;  1EWH A;  1I3Q B;  5DAU A;  1TS3 A;  2MUY A;  1CZW A;  1A3V A;  2D5D A;  4MN3 A;  2JA5 B;  2VB2 X;  2IL8 A;  4KV6 A;  2SDF A;  2IJ0 A;  3C3L A;  2F0W A;  5C44 B;  4FF3 A;  2K1B A;  4WFN 3;  2EDG A;  3BDO A;  3MZ5 A;  3TP6 A;  1Q90 A;  3QWN A;  1DJR D;  2L4N A;  3TZU A;  2B8F A;  2F0G A;  1GHK A;  1K8M A;  1D5X C;  2GA4 B;  1HQR D;  1JCK B;  5FO8 B;  3Q6S A;  1EIH A;  2EE1 A;  2E75 C;  1AN8 A;  5I2X A;  5G3L F;  2WV6 D;  3SEB A;  2HDL A;  2EJM A;  3SK6 A;  1VCI A;  1QNK A;  3HRZ C;  3NXW A;  3G6J B;  3H6M A;  5C4J B;  1MSH A;  1SJE D;  1W6J A;  3F2U A;  3DWQ A;  3OMC A;  3URY A;  2F0I A;  4KJN A;  3HGB A;  3S17 B;  3MWY W;  1DON A;  3P20 A;  3GV3 A;  2AQ3 B;  1H9K A;  4A3F B;  4ZQ3 A;  2ZXR A;  2RQX A;  1NSN S;  5IIF A;  3L7Z C;  3WDN A;  1JWU D;  2EVB A;  3GTJ B;  2MPM A;  4C1N K;  2OEO A;  1S5C D;  1VF7 A;  2VNU D;  5EPK A;  2E2H B;  4L6T B;  2EYF A;  2FHT A;  1BBX C;  4DXG A;  4FP5 D;  4A3D B;  5CBE E;  2RA4 A;  3ND8 A;  2PO4 A;  3K5O A;  1EZ8 A;  3GTP B;  5JEA J;  2F0Q A;  1E0B A;  3M7N A;  4FF4 A;  4U67 3;  4HMI A;  5FO9 B;  1D5M C;  5CV6 A;  2B2V C;  1QB5 D;  3AMU A;  5A2Q L;  3KBX A;  1ENF A;  2NBF A;  5EGT A;  4XQJ A;  4ODG A;  3T51 B;  2K6A A;  3I4L A;  5LL6 X;  1ROD A;  5TSS A;  2WAC A;  2BDN A;  4PMB A;  4CGY B;  3C1E A;  3FMC A;  3LX0 A;  5JVG 3;  4FF2 A;  1WVL A;  5IGB A;  4XXE A;  4F7X A;  5DM7 3;  2NVQ B;  5JPN C;  2A74 C;  2NZ1 D;  2FMC A;  2RSO A;  5KNC A;  1H9J A;  4NMZ A;  1G2S A;  2NWG A;  2A68 C;  1SYB A;  5C4Z A;  1DYQ A;  2JYO A;  3D4R A;  1LTG D;  4S3S A;  4AYB B;  3FPU B;  5C4H A;  4K6L A;  4TQU S;  2Q8T A;  1L0X B;  1KLU D;  4R9W A;  1F2M A;  3GTQ B;  1SEB D;  1MBY A;  3IFD A;  1BDO A;  4C3I B;  1ONL A;  1TWG B;  4HN7 A;  2E2J B;  2EY5 A;  1EFI D;  4C3J G;  4A3K B;  1EY4 A;  1UEA B;  3RZD B;  1HXY D;  4UAI A;  1YNN D;  2E2I B;  4BA1 I;  2XWJ B;  3VR3 A;  1STE A;  4EQN A;  1F9Q A;  3I4M B;  1W6K A;  3WOF A;  2NVT B;  1HTP A;  5D3I B;  1PYW D;  1HPC A;  1O7L A;  2EZV A;  3Q23 A;  2EYO A;  4IUR A;  2JSO A;  1J9O A;  4DU9 A;  3VYR A;  1S5B D;  1EOT A;  2XRS D;  4DNT B;  5I9P A;  2EY1 A;  3S15 B;  4KK7 A;  1CFM A;  4HMJ A;  2LY7 A;  1SBB B;  3DEO A;  3VYS A;  3MC0 B;  2KCC A;  3MHB A;  4BA2 I;  5BN4 A;  1IL8 A;  1HA6 A;  4ABN A;  4OGQ C;  3H09 A;  1LT4 D;  4FXG C;  1HHV A;  1F2Y A;  1I4P A;  4J1M A;  1LT3 D;  3OW7 A;  3I73 A;  2PW7 A;  1WD1 A;  1SNQ A;  3HOV B;  3VR5 A;  3PUY A;  3SXH A;  1I6H B;  3BYY B;  3S2H B;  4IN3 A;  4RKL A;  1TWC B;  1RTO A;  1JC7 A;  1RJT A;  4A3J B;  5NUC A;  1OXU A;  2Q8I B;  1PRT C;  3PMF A;  4CJ2 C;  5FOB B;  3NSW A;  3MAQ A;  1NAP A;  1KNE A;  1TVX A;  3TP5 A;  3HOX B;  4A93 B;  4DK1 A;  1OXS C;  4Q5V A;  5CYU A;  4OIJ A;  1U4R A;  2B2T A;  2RKS A;  4K2L A;  1SMY D;  4KY6 A;  2PYK A;  2X69 A;  1CTM A;  3FVQ A;  1B4O A;  2QIL A;  1V1P B;  5COR A;  5FLX L;  1TS2 A;  2XWB B;  3EFX D;  4PMC A;  1CI3 M;  3VA5 A;  4N9T A;  3DUZ A;  4NDX A;  3ONA B;  2XNA C;  5CC4 A;  4B08 A;  4LAA A;  1VDZ A;  2XRQ D;  1M8A A;  4KN7 C;  2KA7 A;  4HCE A;  3KF8 A;  3V05 A;  1LTR D;  3TN2 A;  1SSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...