5CV6A

Crystal structure of staphylococcal nuclease variant delta+phs v66h/i92e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/I92E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv6A00
1SYEA 4NP5A 2RDFA 2EY1A 5CV5A 5NUCA 1STNA 4IUNA 3V2TA 3DMUA 5HGTA 3QB3A 2EY5A 5EGTA 2PQEA 1JOKA 1EZ6A 1SNDA 3EJIA 3OSOA 4KY7A 5KGUA 4QB4A 4KY5A 1KAAA 1SYGA 2F0MA 4KY6A 1STYA 5IGDA 5IGFA 5IGEA 1EY7A 2EY6A 4WRDA 4S3SA 1STHA 1JOOA 4HMJA 4K8IA 5I6WA 3T13A 4J1MA 3TMEA 3MXPA 1A3UA 1SNPA 4K6DA 5CC4A 5IOCA 4ME5A 5CV4A 4EQPA 3NUCA 2M00A 5E1FA 5KEEA 4KV6A 3EROA 2EYFA 3E5SA 2EYJA 1EYAA 5HURA 4PMBA 5JAVA 3BDLA 3P75A 4OL7A 4QMGA 2F0NA 3MEHA 5DAUA 5E3FA 2EY2A 5JOBA 5DEHA 5F2DA 3NK9A 2OEOA 1SYBA 2PZTA 3SR1A 1JOQA 4TRDA 2F0TA 4NDXA 5C6AA 3QOJA 2QDBA 3MVVA 2F0OA 2F0IA 2OXPA 1TT2A 2HQEA 4KHVA 3T16A 4NKLA 5C3WA 2PW7A 5J22A 1SNQA 2EYMA 3HZXA 2F0UA 2NUCA 5KRUA 2F0JA 1STGA 5C3XA 4ZQ3A 2RKSA 4K14A 2F3WA 4K2LA 4DGZA 5M9OA 5C5LA 1ENCA 4KD4A 4DU9A 5I9PA 3VA5A 1EY4A 4NMZA 4ZUJA 2WACA 1EY6A 2F3VA 1RKNA 5CV8A 4F7XA 5CV9A 4F8MA 4PMCA 1SYFA 1U9RA 2PYKA 4J6HA 2PZUA 3D4DA 5C4ZA 1EQVA 1KDCA 1ENAA 1EY5A 2EYHA 3NHHA 3DHQA 2RBMA 5IODA 4N9TA 4WORA 3TP5A 4R8NA 5K5PA 5KIXA 4RKLA 4K5XA 4DFAA 1TR5A 1TQOA 1KDAA 5J1ZA 1SYCA 4YIJA 3D8GA 2F0DA 4HMIA 2KQ3A 4QF4A 5KYIA 3NXWA 2SNMA 2LKVA 4K5WA 5CR3A 2F0GA 1A2TA 2O4XA 3OMCA 3D4WA 4ODGA 1AEXA 3SK8A 5CGKA 1A3TA 3S9WA 2F0LA 4IZ8A 1STAA 1KABA 4KD3A 3SXHA 2F0PA 3C1EA 5IGCA 3MZ5A 1F2YA 3H6MA 4HTHA 1EY8A 2F0VA 3SK5A 4EVOA 4LAAA 3TP7A 2SOBA 2OF1A 3C1FA 5IGBA 3QOLA 5I6YA 3HEJA 3PMFA 4K2KA 2ENBA 2KHSA 2PZWA 2F0SA 3MHBA 4KJOA 4DF7A 4EQNA 3D6CA 1EY9A 1NSNS 3OWFA 1A3VA 2EYLA 5C4HA 2EYOA 1EYCA 1STBA 3R3OA 5IGGA 3ITPA 1IHZA 3SHLA 4RKBA 2SNSA 3EVQA 2F0QA 3NQTA 4IALA 3U9OA 1EZ8A 5IIFA 1EY0A 3BDCA 1F2MA 4KJNA 5EKKA 2F0EA 4ID6A 5EKLA 3NP8A 1SNCA 4ZUIA 1SYDA 3OMGA 4G57A 4K8JA 3TP6A 1SNMA 2EXZA 1JORA 2F0FA 2F0WA 3ERQA 4KTAA 4B9WA 4E6IA 1SNOA 4B9XA 1F2ZA 3SK4A 1EYDA 5KYLA 3LX0A 1NUCA 5ISRA 2PW5A 4EQOA 5CV6A 4MIUA 4H7BA 2F0KA 4PNYA 3TP8A 5I9OA 5J39A 2F0HA 4K5VA 1KDBA 3SK6A 1II3A 3RUZA 2EYPA 5C5MA 5CV7A 1A2UA 4N9PA 3P1HA 4I65A
chains in the Genus database with same CATH superfamily
4K0KQ 4PZ7A 2C5CA 1STNA 5HGTA 1H9RA 1CA5A 3MXUA 3BVZA 3X3MA 5J3BA 5IE8A 3I56A 1K83B 1HNWL 1JOOA 4LK1C 3TMEA 1EIHA 4PQXA 4QL5A 3A7AB 2CHBD 4Y7NH 1EWCA 2F0NA 3MEHA 4B3TL 5F2DA 4ABNA 3C46A 5DNFA 1JOQA 2KECA 3CD6A 3GTMH 1TS4A 1MGSA 1Y1VG 1EFID 5G3LF 2VB2X 1VQNA 2DY8A 2JA7B 4DR5L 4IJHA 1H9SB 1UUPA 2NUCA 4DV2L 3K5MA 3NTIA 3A5UA 2ZXPA 4AYBG 1ENCA 4L6TB 1TWFB 4BY1G 5BR8L 4JV5L 4YY3Q 1PRTB 1ILPA 1H9KA 4LF8L 3KF8A 4A4IA 4CJ2C 4N8X1 3SGIA 2EDGA 3SDZA 4DAYA 3A8IE 1Y1WB 3MEFA 1GD7A 3J7ZC 3PGZA 1E0BA 4GLVB 5KYIA 1SE3A 3E0JA 2LKVA 3VDYA 1ENFA 1AEXA 2MPMA 1JQYD 4DV4Q 4FF1A 2K04A 3T56B 3M4PA 2F0PA 4YWLA 4G7OC 2JN4A 1JJCB 3PMFA 2ENBA 1K3RA 4A3LG 2K5WA 3GTOH 5CYUA 2JA8H 1YHAA 2EYLA 4C3HB 2SNSA 3MWYW 4LUVA 3HOXG 5GAGC 2VQEL 4HAEA 1YHBA 4DK1A 3I8ZA 4ZUIA 4K8JA 5C4XG 3KFUA 4JI2L 4CGYB 4XT3B 3HOWH 1CUKA 1MSGA 4X3UA 2XSCA 2ZJPA 3BJUA 5CV6A 4PNYA 4JW0A 3HOZH 5AFWA 4B3SQ 3FVQA 4JBJA 4DR5Q 4C3IB 2R93H 2R92B 4DV2Q 4KI0A 1J9OA 3TZUA 3J81L 2NTSA 4QB4A 3IL8A 1CFMA 4MNOA 5KNCA 1EY7A 4JPBW 1YNNC 3I4NH 4LF8Q 5EAYA 5K36G 1VQBA 4DV7L 3CCQA 1MJEA 2WIIB 3SE0A 1W2BA 3Q22A 4L5SA 1AH9A 3BDLA 4OL7A 2NVTH 2KJXA 4X6AH 3SR1A 3NK9A 1A63A 1SYBA 3NSWA 3TS2A 2F0TA 4NDXA 4QUFA 3GTJH 3DWAA 1EWIA 5IWAL 1TWCB 3K57A 1NTGA 3I4MG 2AWOA 2F0JA 2G9HD 3KLSA 4OWXB 1G2TA 2K4KA 1PH4A 1G6PA 1FJGQ 1DOMA 4LFAL 4JI8Q 2JA5G 3W1BA 4A3MB 3KOJA 4L5TA 2UUBQ 3A56A 4AIMA 2BDOA 4GNXC 2A68C 4MN3A 1SE8A 1PV4A 3GDEA 3RZOH 3D0FA 2K32A 4N9TA 4JI2Q 3K8AA 4KLKA 1TR5A 1SYCA 4YIJA 1SEBD 3NEMA 4R4OA 1Q1EA 3FEWX 2K5NA 2KVMA 3S2HB 4IURA 5JPNC 1JJ2A 1X55A 2OF1A 5ELEA 1SAPA 4C2MH 2E75C 2K5DA 4RKBA 2HHHQ 3EVQA 1X3EA 2B29A 4WJWA 4LMQD 1WTHA 2F0EA 3CCEA 1FGUA 1Q1BA 3UI2A 1IW7D 1XPUA 2HUGA 4LF4L 1LACA 2XIWA 3PO3G 3M7NA 3VR6A 1KTKA 2E5LQ 1EU4A 4OX9Q 4QCLA 2F0HA 5LL6S 4GLAC 2FMCA 3K5NA 1Y1VB 5IWAQ 3K7AB 4KKUA 3HOUH 2J7ZA 1GUNA 1JOKA 2OWOA 1CKOA 2TMPA 4PZ8A 1AP0A 3N6RA 1STYA 2NVYH 3GTQH 3D6WA 1QUQA 3L9AX 3X3NA 1WTWA 2LFNA 2K28A 2EVBA 4HMJA 4OEMB 3PIPA 1B3QA 2QEJC 4IUUA 3PQIA 2UU9L 2KENA 5FLXL 1HFNA 3AFPA 3MXNB 3VYTA 5CV4A 4GOPA 1KHIA 2M2LA 3QR8A 2B2UC 5CORA 1LTID 3S1NH 3P75A 1W6JA 4JI0L 3HOYG 2EY2A 5JOBA 5DEHA 5M3FH 2PZTA 5CBAE 2D0PA 1RJTA 1CQVA 2ZTDA 2LY7A 1IKMA 2B63G 5D14A 2F0OA 3PUZA 1QZHA 1TT2A 4ZAIA 3FRPB 2PW7A 1IL8A 3DM3A 5J22A 3AFQA 4JYAL 5C3XA 2DNCA 3NBHB 2QILA 1YEZA 1GUOA 5C3EG 1VQJA 4C1NK 3Q0AA 1HRJA 2L15A 1U9RA 3OW2A 2PZUA 5DM73 1XMOQ 4HCSA 3M4OB 3LWEA 2EYHA 2NN6G 3CCLA 1UAPA 2NTTA 4CBVA 4XTCS 1RF2D 1W3SA 2D62A 3T1HL 2RBMA 5C4XB 1GOZA 2NZOA 1JWMD 3WOFA 1HNZL 2Z6KA 3STBD 4OWTB 1FYCA 3CCSA 4JI6Q 4A3GG 1I4PA 3UDIA 3TSSA 2WB1G 1YNND 4JI7Q 2KBNA 1JE4A 5FLMG 1VMCA 1SROA 1B50A 2JEBI 4ULLA 3CCRA 2H4OA 3U9OA 4RGMA 1L1OA 1MI2A 3H0GH 1EUJA 3NP8A 4LF6L 1L0XB 2KCNA 3H3VI 1RIPA 1F9RA 4PV1C 4C56C 2B2VC 1NCVA 5LHY1 3CCVA 3G6JB 2DJGC 4TVAB 2PI2E 1X65A 1A2UA 1ICWA 1LT6D 1K8MA 1Q82C 2RDFA 2EY1A 3I4MB 3OTOQ 1IBLL 2A68D 1CTMA 3WOEA 2UUAL 2XTIA 3GP7A 1SYGA 4I7ZC 1ASZA 1YZ6A 4S3SA 1UE6A 1B70B 2JP1A 3I73A 2JA5B 1SNPA 1S5FD 4K6DA 3D4RA 5CC4A 4GN4B 4EQ5A 3S1QB 3K58A 3FKIG 2CH4W 1B9NA 3U50C 2RSNA 2JA9A 1K9MC 3UDGA 4FF4A 1JR0D 2VQFL 1GJXA 2HQEA 4XQJA 1TWGH 1EQRA 4A93G 3E6ZX 3HP3A 2L11A 2XGTA 4ZLTF 2A5HA 1AE2A 2WAQG 2F4IA 1PYSB 4POGA 2WKDA 4DK3C 4LF5L 1VF7A 3KF8B 2MP1A 3D4DA 5EBCA 1Z47A 1PTOB 1KDCA 1ENAA 4FDBA 3NTHA 4DK6C 1LTTD 1I6HB 4DAYB 1T5XD 4IOAA 2AWNA 2B2WC 3Q6SA 1E1TA 3PCOB 4G7HC 1I94L 1D1IA 4DFAA 3BDOA 2FJ2A 4YCVA 2Y0SG 2F0GA 1CKNA 4ODGA 1N34L 1GHJA 4ZRZA 2NWGA 1LV9A 1MKHA 1PH7A 4H44C 2NN6I 3S17B 2K7VA 1F2YA 1GKHA 1PA6A 2SOBA 5LMUL 1LABA 2RDHA 3S14B 2NVXH 3S15H 2N3SA 4OIKA 1U4PA 3VR2A 1QNUA 4IALA 1PXUA 3W2DA 1X3PA 3G71A 3M7GA 5EKKA 5M5XH 1B3AA 2R7ZH 4JI5L 2CVRA 3V96A 3A8JE 2I0QA 4H0LC 1A62A 3S1MH 1AFPA 4F87A 4HIKA 5KNBA 3HOYB 5JEAG 3EA6A 1VQHA 1IBKQ 3OYYA 1WTPA 1LO5D 1FVIA 2B63B 3L3OC 1N33L 3RD4A 4IFDH 3P1HA 4BBSH 2E2IH 2WB1E 2P5ZX 3QIAA 2QKIC 3AEVA 4BY7B 1X3FA 2PQEA 3QWNA 5I2XA 5C3EB 1PRTC 2K5HA 1L0WA 2KHJA 1EWHA 3Q24A 1IBML 3LNNA 3AYHB 3I70A 4J1MA 4H13C 3U9SA 1AN8A 4LW1A 1GXDC 1EL0A 3L2PA 4A3EH 1BQQT 2R61A 3E5SA 1CKMA 2ZJRA 1K8OA 5BN5A 3M85A 2F1MA 2KCTA 1SFOH 4GS3A 1HA6A 2MGSA 5C0XI 1XPOA 1O80A 1UE1A 5IYCG 4A3GB 2UXCQ 1A6XA 2WB1B 1SMYC 5IP7G 4OONA 4ZQ3A 1DCZA 2VXWA 4R4TA 3JAMc 1C0AA 5FOBB 1K83H 4KD4A 4KHPL 3VA5A 4XXEA 2YU9H 3MXNA 1OXXK 2Z4HA 2UXDQ 1H95A 1MHWC 3FMCA 1WVLA 3CF5A 5IYBG 1TWHH 4RCOA 3VR3A 4R4CA 4LUOA 1YIJA 1LLRD 3J81j 1J5EL 1XNQQ 4GKKQ 4K0KL 2KQ3A 4OO1G 3U4VA 1EOTA 2DUDA 2F0LA 5JEAJ 3SXHA 3CQZH 1N33Q 3C1EA 3ND9A 4FO2A 1U0LA 1TWFH 4LAAA 3NBIA 2M9VA 3KK7A 4K2KA 3IFTA 5M5WH 3CW2C 1ML0D 4DF7A 2Z9HA 1VQMA 1IL2A 4CKBA 1EYCA 5IYDH 1QE6A 1RD9D 3CCJA 1DJRD 5D3DA 2WAQE 4A76A 2I5MX 4ID6A 4DUYL 4DR1L 1QNKA 3FKIB 2F0WA 4FYDA 4ALPA 3SK4A 1HHVA 2G9DA 2F0KA 3CU7A 4DA2A 2NYZD 5M3MH 2Y0SE 1R4QB 4A3JB 4YY3L 1OTCA 2RF4A 3IKJA 4IUNA 1NR2A 4MZ9A 4DNTB 5KGUA 5C44B 2MFIA 1QUQB 1LTBD 4OWWB 1YNJC 2WAQB 4GOPB 1Q46A 4R8IA 2IX0A 5KEEA 4X3KA 1JCKB 2UXBQ 5E7NA 4DV4L 2L9HA 4WFN3 3NWSA 2OEOA 4UAIA 4JBMA 3BVMA 1WFQA 2VS1A 2X69A 1GUGA 4AQYL 1J5EQ 4FXKC 3EN2A 4J15A 3HKSA 2Y0SB 2MO0A 2EOTA 1WCMH 2EYMA 4RGNA 1TWAH 4PG3A 4GLXA 1BCPB 1Y69U 4BXXH 4IN3A 1BBUA 5FJ8H 3J80c 1ET9A 3TEHB 4M8AA 1SR3A 2ZT9C 4B3RQ 1D7QA 1I4QA 2MQHA 1I4HA 4X62Q 4A3DH 5M5YB 1ESFA 1EQVA 2JA8G 4CKEA 3BZKA 3G48A 4DR7Q 1WTVA 4DUYQ 3EFXD 2MNAA 3QG1A 4DR1Q 4FNFA 3FHWA 5K5PA 2ZXOA 4EGVA 4RKLA 4B3SL 3G6EA 2PI2A 3CHBD 1IW7C 3BYYB 2F0DA 1PRTD 2B2YA 5CGKA 3GQBA 3R2IA 1TVXA 3SK8A 1M4VA 4O42A 1VQFA 3HOWG 4JOIA 4K6LA 4OGQC 3DXJC 3BYTB 5IGCA 3S1RH 4P72A 2ALYB 3H6MA 4DV0Q 2F0VA 2I46A 3TP7A 3HOZG 5I6YA 2I5LX 1PYBA 2A19A 1SE2A 4RA8A 4EQNA 4A3MH 1PYWD 3RLOA 3KBXA 1DGSA 3ER0A 2RCNA 2R93G 1BDOA 1L1OB 1HZ9A 3MTSA 3HGBA 4DR2Q 3OPOA 2RHQB 1CI3M 2EXZA 3I2ZA 1SMYD 4KTAA 2BE5D 3I4NG 5I4DA 2ZTEA 1WD1A 3TREA 4HJ7A 2D9UA 3S2HH 1KDBA 4AQYQ 2ES2A 4O1NA 3J81E 1LT5D 4U673 2H5XA 4HJ9A 1XWEA 1FJGL 4DUZL 4JI8L 2E74C 1VQCA 2R3ZA 4FF3A 2BCOA 2UUBL 5KNDA 3EJIA 2NB0A 4KY5A 2YTYA 3RZDB 3IFDA 1EOVA 1YNXA 4LUZA 3HKZG 3MXPA 1NJIC 1JJGA 1VQKA 2KCMA 2EYFA 3CCUA 3AMUA 2JQOA 1JWSD 3CRLC 3T51B 1I50H 2E2JH 1PH3A 3CC7A 3ONAB 5GROA 2C9OA 2D2CC 2B2TC 1KRSA 1SNQA 3STBC 4JBWA 1WTOA 4FXDA 3BG3A 4DGZA 5C4JH 1RHPA 5TSSA 2HHHL 2WKCA 1XMQQ 2ZTCA 1EYGA 3ICEA 2JSOA 1KL9A 4ZKCB 2O5IC 3K81C 1TY0A 2E5LL 4HEDA 4OX9L 1PZJD 2ATWA 1M90C 2WFWA 1G8ZD 3PUXA 3TP5A 1TQOA 4QGUA 1KDAA 2ZM6Q 3F2BA 3RN5A 3GO5A 1CKNB 4DR3Q 4Y7NB 2IJ0A 1G2SA 2VUMH 4IZ8A 1CM9A 1I4RA 2E2HB 1O78A 1YNJD 2WV6D 4JI1Q 3E0EA 3I90A 2F4VL 4APVA 2VZAA 4DUZQ 3QOLA 3GTMB 1B2TA 3MHBA 3OWFA 4AH6A 3HOUG 3SHLA 5DM63 1K8AC 1QWYA 4I7AA 3GTLB 2A69C 3PUVA 1IYUA 1Q81C 4CDEC 3NQIA 4TKOB 2K14A 3J81c 4HSVA 5C5MA 4A3CH 3CAMA 3FPUB 1X32A 2EPBA 5M3FG 4AYBE 5NUCA 3S16H 4JVZA 1WYDA 2L5TA 3H3VC 4DAPA 1XMOL 1X6OA 2K52A 4TSSA 4DV5Q 2JJQA 2EE1A 2L55A 1JWUD 1K8GA 3TZDA 1FR3A 3MFYA 4C3JH 5JJIA 1PTOC 2Q2HA 5A2QL 3ZYYX 3SEBA 1V1PA 1PVOA 3BZDB 1WI5A 2X6LA 1SMXA 1Q8KA 1N9WA 3KF6B 3GTOB 4BA2I 2WINB 2JA8B 3DEPA 3QO2A 4JI6L 4PMBA 4IPGA 2B3GA 2IW3A 4JI7L 2K5QA 3AU7A 3G4SA 4P71A 4NKLA 4PZ6A 4AYBB 2F0UA 1VQLA 2B8GA 1STGA 4BY1B 4K14A 4KMUC 2AHOB 2F4VQ 4DU9A 1IKLA 2JE6I 1EY6A 1LTGD 1Q8IA 1BNZA 2YTXA 2IT1A 2R93B 2AUJD 3S1QH 4DV6Q 5C4ZA 1QG7A 2Q2IA 5COYA 5FO7B 1R9TH 2XWBB 1PFSA 2BA0A 1H9JA 4DAVA 4LF7Q 1WTXA 3I91A 4K5XA 2L12A 1S5CD 3H0GG 2DJFC 2V4DA 3OTOL 3NXWA 2HD3A 2O4XA 1FNUA 5EJWA 1KRTA 2HDLA 2NVTB 1BBWA 2GVAA 1TS2A 3WDNA 4EVOA 4MTNA 4A3FH 3H3VH 5IGBA 1VQ7A 4OIJA 3GTJB 4KJOA 3HOXB 1AZQA 3KBGA 2HQLA 2X6GA 3HOVH 1CHQD 2KHIA 3OWEB 1F2MA 2BOSA 4KJNA 4DXFA 3GTKH 4X3SA 3OMGA 2CQOA 3TP6A 1SNMA 5HGQA 1IZ6A 3IAYA 5FO9B 1C8CA 2HCCA 1SNOA 1SRUA 2KOLA 1HUNA 2IX1A 5ISRA 5J39A 4MTKA 4NXNQ 1UE5A 3BS1A 3S2DB 3S17H 3RZOB 4QIWE 2K5VA 4DR6Q 5FLXc 3PIO3 5CV5A 3GTPH 2OTJA 1GUTA 1CT1D 2KCCA 4QQBX 2YV5A 4BA1I 2F0MA 4XYOA 2HDMA 3NE5B 5IT9L 2JYOA 3JC66 3E9IA 1K0SA 4ME5A 5A35A 4LF9Q 1DD2A 2AQ3B 2E76C 4QMGA 4A3BH 3GTGH 2Q8IB 1PH8A 4NXMQ 1C48A 1RTOA 1GUWA 1Y14B 4QIWB 4P75A 4Q0FA 4BY7H 2WP8J 1JMCA 5GAEC 4OELB 3T1YQ 4HR7B 4R9WA 2A69D 5E4WC 2ASBA 2NVQB 5DLQE 5ELBA 1PH6A 1EY4A 1D1KA 1NMFA 2VY3A 4F7XA 4PMCA 2PPBC 2LXJA 5GAHC 4KKTA 3UDFA 4QJFA 1XX8A 1P16A 3KJPA 1EY5A 3K7UC 3NHHA 1N32L 3A54A 1IBKL 1VQ9A 2VNUD 5JJLA 3GTQB 1OXTA 1HUMA 2RHSB 2PCFB 5IODA 1PH9A 1ASYA 3E3XA 2DGYA 4LFBQ 1KLGD 3J7AF 4CDFC 3D8GA 4GNXB 2R7ZG 1CSPA 1TS3A 4QF4A 3GV3A 4K5WA 1C4QA 1Z9FA 4X65Q 1MD2D 1D2BA 3S1NB 1PTOD 1Y8NB 3M4YA 3JAME 2RA4A 3K5LA 2KUMA 5CBEE 4LNQA 4IFDG 2JA6H 4BBSG 2L0CA 4RWSC 4RGTA 1XTDA 1B4OA 2PMZE 1G91A 1IXRA 4GOPC 1PRTF 2Z4IA 1EZ8A 1ZKOA 1F77A 1MIUA 2CCZA 3PO3B 1EIGA 5LMNL 1W6KA 4RH6A 2UXCL 1EYDA 5ELOA 3KJOA 5I9OA 2MHVA 4A3EG 4BBRG 1VS0A 1BF4A 2N78A 4C1NI 2G5DA 1PDQA 1QVGA 4A3IH 1BO0A 4N9PA 4X66L 2UXDL 3DMUA 3U4ZA 2VW9A 1XNRL 1HPCA 3MA2B 2K33A 4DNIA 4GKJL 2PMZB 5C0XH 3A5ZB 4K8IA 2XNAC 3PF5A 5E4XA 3ULPA 1HZBA 3PO2H 2A74C 1XNQL 1KC8C 4GKKL 4EX5A 1N32Q 2Z6KC 4ZCKA 4A3KH 4L5QA 1LTLA 4JI3L 3SK6A 3RLFA 3A7LA 2F03A 4B08A 4A3JH 2I5HA 4XIGS 1LYLA 2RCFA 3TN2A 2NZHA 1X54A 3CMEA 3HRZC 5C44H 1Q90A 2PNHA 1ZXTA 1N8RC 3H91A 4KN4C 1I3QH 4DPGA 1L1OC 1F9PA 3KF6A 4BBRH 3M4QA 4DXGA 4IFDJ 2AQ2B 1Q3LA 1PH5A 4JCVE 4CJ0B 5IYDG 1BVSA 5LMNQ 1I4XA 2QEXA 1OXUA 5J1ZA 4XYQA 4R4IA 2BE5C 3D4WA 1O7ZA 1STAA 1PZID 2DN8A 2OT2A 3UE0A 3J80E 4X66Q 1BR9A 3HEJA 5M3MG 4O2DA 1XNRQ 2CWPA 4GKJQ 1TWGB 3D3RA 1LTRD 1S5BD 3ITPA 5M5YH 2UXBL 2OQKA 4XT1B 2OQ0A 3KUPA 1NNXA 2XRQD 4UY8C 2YYZA 1SYDA 3KYHC 2JA7H 1PFBA 4R4QA 4JI3Q 1LM0A 3LX0A 4ME3A 4EQOA 1FL0A 3J81i 2LMCB 4K5VA 4L63B 2UUCL 1I5FA 1II3A 3RUZA 1TIID 2IL8A 5JVG3 2PQAB 1EFWA 1QOHA 1Y8OB 2EJFC 3ND8A 4B3RL 1SLJA 4G7ZC 1PFMA 1B1ZA 4POFA 1B9MA 4X62L 3ZJYC 3EIVA 2R92G 5IGEA 1PMRA 1WCMG 5IGFA 1YJWA 4DR7L 4WRDA 5LL6X 1Y1WH 4BXXG 1E22A 1V1PB 3T53B 5FJ8G 4V190 1QZGA 2Z8LA 1S5ED 2BH8A 2NVXB 4L8JA 3CMAA 1D8LA 4XQQA 1SBBB 4BWGB 5DAUA 1U5KA 4A3DG 1KIXA 4TRDA 4DV0L 1E24A 1QB5D 5FK9C 5M5XB 1YBYA 3VYSA 4FF2A 2R7ZB 4KN7C 1E1OA 4DV1L 5ELCA 1S4ZA 4C3HH 3C2PA 3S1MB 4A93B 5M9OA 2F3WA 1SSOA 3RZDH 1SXTA 1PLFA 1HNXQ 1LT3D 5T1GA 2NBFA 3B6YA 4NMZA 4ZUJA 4DR2L 1E2WA 2ZXRA 4G4KA 1Z7TA 3NPPA 4GN5A 2GN5A 3J7AV 2E2IB 4IOCA 5FO8B 1JB7A 3A74A 1RDPD 4LWCA 2N88A 1KLUD 2FINB 2J4XA 4A3MG 1SE4A 4JI4Q 3VR4A 5KIXA 1BKBA 2K50A 4R8NA 4JG2A 3VYRA 1AZPA 4ZYSA 3CC4A 4C3IH 2R92H 2R7DA 2SNMA 1KNEA 1YHQA 4A3EB 3W5OA 3S9WA 3U58A 2UUCQ 4IUQA 3M9BA 2TSSA 1PH1A 1SFOB 2JK8A 1CZWA 1ILQA 1CHPD 3OIPA 1YVCA 5GADC 1ET6A 4DR4L 2XWJB 4UP8A 2EJMA 1TWCH 4GNXA 2YU9B 1SN8A 2F0FA 2FMMA 1FGBD 2MUYA 2HIVA 1F2ZA 4UHVA 3PIP3 4A75A 1BUVT 1NUCA 2OCEA 3TP8A 3PF4A 2F3IA 3AQQA 2E2HH 1EU3A 2CFMA 1XMQL 2NZ1D 1QJOA 1TWHB 4I65A 4DV1Q 4XQNA 2JEAI 4OO1I 3P20A 3K0XA 1EZ6A 3VR5A 5IP9H 3PUWA 4P73A 3N52A 3R8BA 2HIXA 1RCVD 2Q8RE 3CQZB 5JVH3 3GTLH 2K1BA 4RFBA 3DUZA 4CDCC 3IRBA 4EQPA 2ZM6L 1I4GA 3T4AC 5M5WB 5AJ3Q 4DR3L 2Q2TA 3R2TA 5LMNW 1HA5A 4LFCL 1F9QA 4JI1L 1EIFA 5C6AA 1F9SA 2OXPA 3T16A 2JXMB 4IJLA 1VQGA 4HJ8A 3M3YB 4NW2A 2QDLA 1L0YB 2RKSA 3DM1A 2PO4A 3O13A 1LUZA 3W1GA 4CHTB 2VUMG 5M3MB 2F3VA 2IX3A 1VDZA 2K03A 3DLLA 1G291 1KD1C 1UE7A 3FPPA 3TS0A 2GVBA 3H09A 1HZCA 2IY5B 2DNEA 2BDNA 2EIFA 1JT8A 3TDQA 4DAMA 4DR4Q 3DHQA 3H94A 1Y1VH 1WTQA 1HNWQ 2AMCB 1JICA 3BZCA 1K73C 3F2UA 2B2UA 3K7AH 5H1SE 1QCBD 1ZYRD 4JBKA 2LSSA 4HMIA 1B7YB 1E3PA 4DV5L 4BY1H 4RAUC 5ELNA 4B3TQ 2O5JC 4P74A 3KDFB 2XVSA 1D5ZC 4DNRB 1S3OA 4A3CG 1B53A 1NSNS 3P7JA 1HTLD 1WCMB 1TWAB 5EBDA 1MJCA 3NQTA 5IIFA 4O0AA 3MAQA 1EY0A 4RHRA 5BR8Q 4JV5Q 3L0OA 2ICEC 1PTOF 4G57A 2BA1A 5JJZA 4C3JG 2A73B 4B9WA 4E6IA 2CW0D 2IHFA 5IY0A 2F52A 4LFCQ 4A3DB 4MIUA 1YITA 1K0RA 3PV0A 3OOCA 1BBXC 4DK0A 1Q86C 1S5DD 1ICFB 3FDTA 5CV7A 4A3LH 3RMHA 1SYEA 1VCIA 4V0BA 1GO3E 2D0OA 5EGTA 3M4OH 1CA6A 3HOXH 5A2QE 1HCZA 1SNDA 4DV6L 1K3BC 4KHZA 5EKIA 1KAAA 2B39A 2EY6A 2GA4B 3F2DA 5C4XH 3S1RB 5I6WA 1EQTA 4LF7L 1A3UA 4B3ML 4WJ4A 4PMWA 2Q8TA 5EPKA 2HT1A 1OXVA 5BN4A 2A6HD 5CMDA 1GHKA 1NY4A 1PFNA 2B2YC 2FHTA 2VQEQ 2PQAA 1SJHD 3S2DH 2K05A 1HJPA 3QJYA 4JOIC 4LJZC 2FXQA 2QDBA 3MVVA 1OXSC 2F0IA 1WJJA 3R93A 1RTNA 2B2VA 1UEAB 5FLXE 1J8IA 1JE5A 4HIDA 3Q23A 4K2LA 1LT4D 3H15A 1WTRA 4GN3B 5K36H 1NAPA 1RODA 4JC0A 2OTLA 1RKNA 3CPFA 5CV8A 4J8QA 4A3FG 1HR0L 3K59A 5I2YA 1U4MA 3A8KE 1G6ZA 2CWAA 4RG1A 1EIYB 4NXNL 3HOVG 1B44D 4YCUA 3I4MH 3CP0A 4WJ3M 4IO9A 4DR6L 1C9OA 4DV7Q 3HOWB 4HIMA 2V1CC 2A6EC 2Z6BA 4U68A 3JAMi 1KABA 3K6OA 4XDXA 3HOZB 3MZ5A 1L2FA 4HSPA 2NVQH 2R6GA 3SK5A 1I50B 2I07B 2JA5H 2E2JB 1BOSA 3I4LA 2A8VA 3J7A5 2RSOA 1FD7D 3HKZE 2KEDA 5C4HA 2EYOA 4LF9L 3R3OA 1FNVA 2N8NA 1T5EA 5C4JB 1ESRA 2MJ8A 3BDCA 4B3MQ 2O2LD 1UWVA 1D5MC 1SNCA 3I4NB 4MHEA 4NXML 5BN3A 4LFAQ 2B2WA 2IPKD 1U4RA 4Y52H 2XRSD 3T1YL 4UP9A 4TQUS 3F2CA 2CQAA 5FKAC 4A3BG 2EQSA 1DOLA 5IT9E 1CK1A 2K6AA 1M1KC 3QB3A 3FP9A 3RR5A 1PTOH 3URYA 3OSOA 4KY7A 1I6HH 1LTAD 3K5OA 4NPSA 3AB9A 5IGDA 3HKZB 4BY7G 2VUMB 3BU2A 3EQLC 3RNUA 5G3LD 1EQQA 3T13A 1QVFA 4RHSA 5JJKA 3PO3H 1S72A 1HR0Q 3DEOA 2IHEA 1NMGA 3LWUA 4N8FA 5IOCA 4LFBL 2J0TD 1Q7YC 2D5DA 1RL2A 3NENA 4KV6A 3EROA 1XJVA 1VQPA 1KQSA 3I55A 4X65L 3I7FA 3PSIA 3I3CA 3V05A 2YTVA 3I72A 3S14H 2AUKA 1NR4A 5C3WA 4YWKA 4LF4Q 5GQOA 1H9SA 4H02A 3ULLA 1X3QA 2QF7A 4FXGC 1H9MA 4HJAA 4X64L 2WACA 4C2MB 2H1EA 3NELA 4F8MA 1SYFA 1STEA 1EEID 3S16B 1OO9B 3HOYH 4Z9CB 1HQRD 2CKZB 3GV6A 2JA6G 1HTPA 4JK1C 5ELFA 4FP5D 1HQMC 2Q2UA 2B63H 1TS5A 2R7FA 4WORA 2K01A 4C3JB 2UU9Q 1O7IA 2QGQA 3OIQA 1VF5C 3CCMA 3ERSX 2CH4A 1V9PA 1GUSA 1CZGA 5C3EH 3CC2A 1E2VA 1X56A 4KK7A 1Y8PB 1TKWB 4JI0Q 1JB3A 1NE3A 1QILA 3J80i 1V8QA 1PZKD 1EY8A 1V1QA 1XYIA 1BCPF 1FNWA 2Z0SA 3PUYA 4DV3L 3W3AA 3HOUB 1VQ5A 1ONLA 4A3IG 4HJ5A 1DM0B 2E2DC 3D6CA 2NN6H 3F1ZA 4JYAQ 1BXTA 3RLNA 5L37A 2NVYB 1YJ9A 1AW7A 3L7ZC 1TXYA 3TRZA 1DONA 5T1IA 3OHXC 5C0XG 4A3GH 1JORA 3CPWA 4ILWA 2XN9C 3A0JA 1KNAA 1DOKA 3PO2G 1E2ZA 5FLMH 3KDFA 1KAWA 1R9TB 4YWMA 5M3FB 3T1HQ 4A3KG 5IT9c 4OHJA 1HNZQ 2QCPX 1SDFA 3K0YA 3V2TA 1HZAA 2EY5A 4A3JG 4RMFA 4RGOS 3C3LA 1X9NA 1VMPA 4X3TA 4X64Q 1HXYD 4RCNA 2HCIA 1UNSA 3MC0B 1PH2A 1A8VA 1STHA 5C44G 1XXGA 4A3FB 1AE3A 2A6ED 4UPAA 2N55A 1IYVA 2C35B 5D3IB 1EYAA 5HURA 5JAVA 3VA7A 3HOVB 1WOCA 3MXGA 3LGJA 1VQAA 1BCPC 1O7YA 1K28A 3DWQA 1A0IA 3NWTA 4LF6Q 3GTKB 1IYJB 3QOJA 1EEFD 4KHVA 4IUTA 3I4OA 2K75A 2Z1CA 3SVMA 1D6EC 5ELDA 5C5LA 4CKCA 4DV3Q 3UE1A 5JPMC 1HFGA 4P2CB 1UEBA 3FKIH 2L1BA 1IBLQ 3GTPB 4J6HA 2ZJQA 2KEEA 3BVGA 4IPHA 3CKIB 2UUAQ 1DYQA 3JAML 5EQ0A 3KLSX 3H0GB 2ICIA 3RN2A 1Q12A 4ZK9B 1VQOA 5C0XJ 1A15A 4HN7A 1DXMA 5CR3A 2JA7G 2EZVA 4A93H 4CJ1B 4KD3A 4YCWA 2EXDA 2RQXA 5EPLA 4HIOA 2BH2A 1DZ1A 4HTHA 4A3BB 3GTGB 2VQFQ 3GD7A 4UP7A 1NBWA 2KHSA 2PZWA 2F0SA 2LXKA 1EY9A 2QW7A 2RDGA 1JC7A 4KKSA 4YHHL 2F0QA 4NB3A 1P8LA 1T9HA 1VQ6A 1HR0W 5EKLA 2PNRC 3UDXA 3TQYA 3KLRA 1Y1WG 4LF5Q 2AKWB 4UDUC 4L5RC 1KXLA 2PW5A 1VQIA 1CQFA 4IPDA 4Q5VA 1XPRA 1HNXL 4M1UB 3EBEA 1C7YA 1I94Q 3MFGA 4FVMA 2L4NA 4NP5A 4GZYC 1R4PB 4CDDC 3OW7A 4IUPA 4QUCA 1N34Q 4C3HG 4KY6A 4JI4L 2A1AA 1X3GA 3G7LA 3WWVA 1N36L 5LMUQ 1VQ8A 3S24A 1TU2B 5JEAH 3NUCA 4IFDI 3NTKA 1ZEQX 2M00A 5E1FA 2JA6B 2EYJA 5E3FA 1SJED 1M8AA 3PIOA 1U4LA 3CRKC 2ID0A 3CXCA 4JI5Q 1QVCA 1XTCD 1LTSD 2E8GA 1ZYRC 4HCEA 2VB3X 3HZXA 4C3IG 1I6VC 1PHJA 3E9HA 5KRUA 1TY2A 1J6QA 5D65A 3NBHA 3HG9A 1GM5A 1D5XC 3F8TA 5I9PA 1S40A 1MBYA 3DWPA 4A3IB 4IQZA 3TBIB 1B8AA 5CV9A 3S15B 3HS0C 1V43A 2PYKA 4DKAC 2VL6A 2EJGC 4YHHQ 4OXPA 4DN4M 1V1OA 3J80L 3Q8DA 1IBMQ 2RVLA 2DY7A 4R1JA 4F88A 5IYCH 4BS9A 2MO1A 5IP7H 3PO2B 2AQ1B 2CW0C 1A2TA 3OMCA 1G51A 3M3YH 1A3TA 4A3KB 3D31A 1VQ4A 1VQDA 2B2TA 2N49A 2SEBD 2QA4A 3C1FA 4BBSB 4IUVA 1WD0A 3A55A 4QY7A 2KA7A 1A3VA 5AJ3L 1O7LA 1STBA 5HY6A 1HH2P 4ZKBB 5IGGA 3J7YW 1BCPD 1GVPA 1IHZA 2LS01 5IYBH 1N36Q 1VQEA 4KHPQ 2SDFA 5IP9G 3KLWA 4IPCA 4OO1H 1I3QB 1Z6HA 3HFZB 1MSHA 3ERQA 2FFKB 1CSQA 3VYUA 3K80C 4B9XA 4BBRB 2A6HC 5KYLA 2B8FA 4H7BA 3ULJA 1E7ZA 2IWHA 5EPJA 1YJNA 1F2LA 1YI2A 2EYPA
chains in the Genus database with same CATH topology
2C5CA 1STNA 5HGTA 1H9RA 1CA5A 3MXUA 3BVZA 3X3MA 1K83B 1JOOA 4LK1C 3TMEA 1EIHA 4PQXA 3A7AB 2CHBD 1EWCA 2F0NA 3MEHA 5F2DA 4ABNA 3C46A 5DNFA 1JOQA 2KECA 1TS4A 1MGSA 1EFID 5G3LF 2VB2X 2DY8A 2JA7B 1H9SB 1UUPA 2NUCA 3K5MA 3NTIA 2ZXPA 1ENCA 4L6TB 1TWFB 1PRTB 1ILPA 1H9KA 3KF8A 4CJ2C 2EDGA 3SDZA 4DAYA 3A8IE 1Y1WB 1E0BA 5KYIA 1SE3A 3E0JA 2LKVA 1ENFA 1AEXA 2MPMA 1JQYD 4FF1A 2K04A 3T56B 2F0PA 4G7OC 3PMFA 2ENBA 2K5WA 5CYUA 2EYLA 4C3HB 2SNSA 3MWYW 4HAEA 4DK1A 3I8ZA 4ZUIA 4K8JA 4CGYB 4XT3B 1MSGA 4X3UA 2XSCA 5CV6A 4PNYA 5AFWA 3FVQA 4C3IB 2R92B 4KI0A 1J9OA 3TZUA 3J81L 4QB4A 2NTSA 3IL8A 1CFMA 5KNCA 1EY7A 1YNNC 5K36G 2WIIB 3SE0A 3Q22A 3BDLA 4OL7A 2KJXA 3SR1A 3NK9A 1SYBA 3NSWA 2F0TA 4NDXA 4QUFA 3DWAA 3K57A 1TWCB 2AWOA 2F0JA 2G9HD 3KLSA 1G2TA 1DOMA 4A3MB 3A56A 2BDOA 2A68C 4MN3A 2K32A 4N9TA 1TR5A 1SYCA 4YIJA 1SEBD 1Q1EA 3FEWX 2KVMA 3S2HB 4IURA 5JPNC 5ELEA 2OF1A 1SAPA 2E75C 2K5DA 4RKBA 3EVQA 4WJWA 4LMQD 2F0EA 3UI2A 1Q1BA 1IW7D 2HUGA 1LACA 2XIWA 3M7NA 3VR6A 1KTKA 1EU4A 4QCLA 2F0HA 5LL6S 2FMCA 3K5NA 1Y1VB 3K7AB 4KKUA 2J7ZA 1GUNA 1JOKA 2TMPA 1AP0A 3N6RA 1STYA 3D6WA 3L9AX 3X3NA 1WTWA 2LFNA 2K28A 2EVBA 4HMJA 2QEJC 4IUUA 5FLXL 1HFNA 3VYTA 5CV4A 2M2LA 2B2UC 5CORA 1LTID 3P75A 1W6JA 2EY2A 5JOBA 5DEHA 2PZTA 5CBAE 1RJTA 1CQVA 1IKMA 2LY7A 5D14A 2F0OA 3PUZA 1TT2A 4ZAIA 3FRPB 2PW7A 1IL8A 5J22A 5C3XA 2DNCA 2QILA 1GUOA 4C1NK 3Q0AA 1HRJA 1U9RA 2PZUA 5DM73 4HCSA 3M4OB 3LWEA 2EYHA 2NN6G 1UAPA 2NTTA 4CBVA 4XTCS 1RF2D 2D62A 2RBMA 5C4XB 1GOZA 1JWMD 3WOFA 1FYCA 1I4PA 3TSSA 1YNND 1JE4A 1VMCA 1B50A 2JEBI 4ULLA 2H4OA 3U9OA 4RGMA 1MI2A 3NP8A 1L0XB 2KCNA 1F9RA 4PV1C 4C56C 2B2VC 1NCVA 5LHY1 3G6JB 1A2UA 1ICWA 1LT6D 1K8MA 2RDFA 2EY1A 3I4MB 2A68D 1CTMA 3WOEA 3GP7A 1SYGA 4I7ZC 4S3SA 2JP1A 3I73A 2JA5B 1SNPA 1S5FD 4K6DA 3D4RA 5CC4A 3S1QB 3K58A 1B9NA 2RSNA 4FF4A 1JR0D 1GJXA 2HQEA 4XQJA 3E6ZX 3HP3A 2L11A 4ZLTF 2A5HA 2F4IA 2WKDA 1VF7A 3D4DA 2MP1A 5EBCA 1Z47A 1PTOB 1KDCA 1ENAA 3NTHA 1I6HB 1LTTD 1T5XD 2AWNA 2B2WC 3Q6SA 4G7HC 1D1IA 4DFAA 3BDOA 2FJ2A 2F0GA 4ODGA 1GHJA 4ZRZA 2NWGA 1LV9A 4H44C 2NN6I 3S17B 2K7VA 1F2YA 2SOBA 1LABA 2RDHA 3S14B 4OIKA 1U4PA 3VR2A 1QNUA 4IALA 1PXUA 3W2DA 1X3PA 3M7GA 5EKKA 1B3AA 2CVRA 3V96A 3A8JE 4H0LC 1AFPA 4F87A 5KNBA 3HOYB 5JEAG 3EA6A 1WTPA 1LO5D 2B63B 3L3OC 3RD4A 4IFDH 3P1HA 3QIAA 2QKIC 4BY7B 2PQEA 3QWNA 5I2XA 5C3EB 1PRTC 1EWHA 3Q24A 3LNNA 3I70A 4J1MA 4H13C 3U9SA 1AN8A 1GXDC 1EL0A 1BQQT 2R61A 3E5SA 1K8OA 5BN5A 3M85A 2F1MA 1HA6A 2MGSA 5C0XI 1O80A 4A3GB 1A6XA 2WB1B 1SMYC 4ZQ3A 1DCZA 2VXWA 5FOBB 4KD4A 3VA5A 4XXEA 3MXNA 1OXXK 2Z4HA 3FMCA 1WVLA 4RCOA 3VR3A 1LLRD 2KQ3A 4OO1G 1EOTA 2F0LA 5JEAJ 3SXHA 3C1EA 3ND9A 4FO2A 4LAAA 3NBIA 2M9VA 3KK7A 4K2KA 3IFTA 1ML0D 4DF7A 4CKBA 1EYCA 1QE6A 1RD9D 1DJRD 5D3DA 4ID6A 1QNKA 3FKIB 2F0WA 4FYDA 3SK4A 1HHVA 2G9DA 2F0KA 3CU7A 4DA2A 2NYZD 1R4QB 4A3JB 3IKJA 4IUNA 1NR2A 4DNTB 5KGUA 5C44B 1LTBD 1YNJC 2WAQB 4R8IA 2IX0A 5KEEA 4X3KA 1JCKB 2L9HA 4WFN3 3NWSA 2OEOA 4UAIA 3BVMA 2X69A 1GUGA 4FXKC 2Y0SB 2EOTA 2EYMA 4RGNA 1BCPB 1Y69U 4IN3A 1ET9A 4M8AA 2ZT9C 1I4QA 1I4HA 5M5YB 1ESFA 1EQVA 4CKEA 1WTVA 3EFXD 3QG1A 4FNFA 5K5PA 2ZXOA 4EGVA 4RKLA 3CHBD 1IW7C 3BYYB 2F0DA 1PRTD 2B2YA 5CGKA 3GQBA 3SK8A 3R2IA 1TVXA 1M4VA 4O42A 4K6LA 4OGQC 3DXJC 3BYTB 5IGCA 3H6MA 2F0VA 2I46A 3TP7A 5I6YA 1SE2A 4RA8A 4EQNA 1PYWD 3KBXA 1BDOA 3MTSA 3HGBA 3OPOA 1CI3M 2EXZA 1SMYD 4KTAA 2BE5D 5I4DA 1WD1A 2D9UA 1KDBA 4O1NA 3J81E 1LT5D 4U673 1XWEA 2E74C 2R3ZA 4FF3A 2BCOA 5KNDA 3EJIA 2NB0A 4KY5A 3RZDB 3IFDA 3MXPA 2EYFA 3AMUA 3CRLC 1JWSD 3T51B 3ONAB 2C9OA 2D2CC 2B2TC 1SNQA 4JBWA 1WTOA 4FXDA 3BG3A 4DGZA 1RHPA 5TSSA 2WKCA 2JSOA 4ZKCB 2O5IC 1TY0A 4HEDA 1PZJD 1G8ZD 3PUXA 3TP5A 1TQOA 1KDAA 3GO5A 4Y7NB 2IJ0A 1G2SA 4IZ8A 1CM9A 1I4RA 2E2HB 1O78A 1YNJD 2WV6D 3I90A 3QOLA 3GTMB 1B2TA 3MHBA 3OWFA 3SHLA 5DM63 1QWYA 3GTLB 2A69C 3PUVA 1IYUA 3NQIA 4TKOB 4HSVA 5C5MA 3FPUB 1X32A 2EPBA 5NUCA 2L5TA 3H3VC 4DAPA 4TSSA 2EE1A 2L55A 1JWUD 3TZDA 1FR3A 3MFYA 1PTOC 5A2QL 3ZYYX 3SEBA 1V1PA 3BZDB 2X6LA 3GTOB 4BA2I 2WINB 2JA8B 3DEPA 3QO2A 4PMBA 2IW3A 2K5QA 3AU7A 4NKLA 4AYBB 2F0UA 2B8GA 1STGA 4BY1B 4K14A 4KMUC 4DU9A 1IKLA 2JE6I 1EY6A 1LTGD 1Q8IA 1BNZA 2IT1A 2R93B 2AUJD 5C4ZA 1QG7A 5COYA 5FO7B 2XWBB 2BA0A 1H9JA 4DAVA 1WTXA 3I91A 4K5XA 2L12A 1S5CD 2V4DA 3NXWA 2O4XA 1FNUA 5EJWA 2HDLA 2NVTB 3WDNA 1TS2A 4EVOA 5IGBA 4OIJA 3GTJB 4KJOA 3HOXB 1AZQA 3KBGA 2X6GA 1CHQD 3OWEB 1F2MA 2BOSA 4KJNA 4DXFA 4X3SA 3OMGA 3TP6A 1SNMA 3IAYA 5FO9B 1C8CA 2HCCA 1SNOA 2KOLA 1HUNA 2IX1A 5ISRA 5J39A 3BS1A 3S2DB 3RZOB 3PIO3 5CV5A 1GUTA 1CT1D 2KCCA 4BA1I 2F0MA 4XYOA 2HDMA 3NE5B 5IT9L 2JYOA 4ME5A 5A35A 1DD2A 2AQ3B 2E76C 4QMGA 2Q8IB 1C48A 1RTOA 1GUWA 4QIWB 4Q0FA 2WP8J 4HR7B 4R9WA 2A69D 5E4WC 2NVQB 5ELBA 1EY4A 1D1KA 4F7XA 4PMCA 2PPBC 4KKTA 1XX8A 2VNUD 1EY5A 3NHHA 3A54A 3GTQB 1OXTA 1HUMA 5IODA 2PCFB 1KLGD 3J7AF 3D8GA 1TS3A 4QF4A 3GV3A 4K5WA 1C4QA 1D2BA 1MD2D 3S1NB 1PTOD 1Y8NB 3M4YA 3JAME 2RA4A 3K5LA 2KUMA 5CBEE 4IFDG 2L0CA 4RWSC 4RGTA 1B4OA 1G91A 1PRTF 2Z4IA 1EZ8A 1ZKOA 1F77A 3PO3B 1EIGA 1W6KA 4RH6A 1EYDA 5I9OA 2MHVA 1BF4A 4C1NI 1PDQA 1BO0A 4N9PA 3DMUA 1HPCA 3MA2B 2K33A 2PMZB 5C0XH 4K8IA 2XNAC 5E4XA 2A74C 3SK6A 3RLFA 3A7LA 2F03A 4B08A 4XIGS 3TN2A 3HRZC 1Q90A 1ZXTA 3H91A 4KN4C 1F9PA 4DXGA 4IFDJ 2AQ2B 1Q3LA 4CJ0B 1I4XA 1OXUA 5J1ZA 4XYQA 2BE5C 3D4WA 1STAA 1O7ZA 1PZID 2DN8A 2OT2A 3J80E 1BR9A 3HEJA 1TWGB 3D3RA 1LTRD 1S5BD 3ITPA 4XT1B 3KUPA 2XRQD 2YYZA 1SYDA 1PFBA 3LX0A 4EQOA 2LMCB 4K5VA 4L63B 1II3A 3RUZA 1TIID 2IL8A 5JVG3 1QOHA 1Y8OB 2EJFC 3ND8A 4G7ZC 1PFMA 1B1ZA 1B9MA 5IGEA 1PMRA 5IGFA 4WRDA 5LL6X 1V1PB 3T53B 4V190 2Z8LA 1S5ED 2NVXB 4L8JA 4XQQA 1SBBB 4BWGB 5DAUA 4TRDA 1QB5D 5FK9C 5M5XB 3VYSA 4FF2A 2R7ZB 4KN7C 5ELCA 1S4ZA 3C2PA 3S1MB 4A93B 5M9OA 2F3WA 1SSOA 1SXTA 1PLFA 1LT3D 5T1GA 2NBFA 4NMZA 4ZUJA 1E2WA 2ZXRA 4G4KA 1Z7TA 3NPPA 3J7AV 2E2IB 5FO8B 1RDPD 2N88A 1KLUD 2FINB 2J4XA 1SE4A 3VR4A 5KIXA 4R8NA 3VYRA 1AZPA 4ZYSA 2SNMA 1KNEA 4A3EB 3S9WA 4IUQA 2TSSA 1SFOB 1CZWA 1ILQA 1CHPD 3OIPA 1ET6A 2XWJB 2EJMA 2YU9B 2F0FA 2FMMA 1FGBD 2MUYA 1F2ZA 3PIP3 1BUVT 1NUCA 3TP8A 1EU3A 2NZ1D 1QJOA 1TWHB 4I65A 4XQNA 2JEAI 4OO1I 3P20A 1EZ6A 3VR5A 3PUWA 3N52A 3R8BA 1RCVD 2Q8RE 3CQZB 5JVH3 2K1BA 4RFBA 3DUZA 4EQPA 1I4GA 3T4AC 5M5WB 3R2TA 1HA5A 1F9QA 5C6AA 1F9SA 2OXPA 3T16A 2JXMB 3M3YB 4NW2A 1L0YB 2RKSA 3DM1A 2PO4A 3O13A 4CHTB 5M3MB 2F3VA 2IX3A 1VDZA 2K03A 1G291 3FPPA 3H09A 2DNEA 2BDNA 3TDQA 3DHQA 3H94A 1WTQA 1JICA 3F2UA 2B2UA 1QCBD 1ZYRD 4HMIA 4RAUC 2O5JC 2XVSA 1D5ZC 4DNRB 1B53A 1NSNS 3P7JA 1HTLD 1WCMB 1TWAB 5EBDA 3NQTA 5IIFA 3MAQA 1EY0A 4RHRA 2ICEC 1PTOF 4G57A 2BA1A 5JJZA 4C3JG 2A73B 4B9WA 4E6IA 2CW0D 4A3DB 4MIUA 3PV0A 3OOCA 1BBXC 4DK0A 1S5DD 3FDTA 5CV7A 3RMHA 1SYEA 1VCIA 4V0BA 5EGTA 1CA6A 5A2QE 1HCZA 1SNDA 4KHZA 5EKIA 1KAAA 2B39A 2EY6A 2GA4B 3S1RB 5I6WA 1EQTA 1A3UA 4PMWA 2Q8TA 5EPKA 1OXVA 5BN4A 2A6HD 5CMDA 1GHKA 1PFNA 2B2YC 2FHTA 1SJHD 2K05A 3QJYA 4LJZC 2QDBA 3MVVA 1OXSC 2F0IA 3R93A 1RTNA 2B2VA 1UEAB 5FLXE 1J8IA 3Q23A 4K2LA 1LT4D 1WTRA 5K36H 1NAPA 1RODA 1RKNA 5CV8A 4J8QA 3K59A 5I2YA 1U4MA 3A8KE 1G6ZA 1B44D 3HOWB 2A6EC 4U68A 1KABA 3K6OA 4XDXA 3HOZB 3MZ5A 4HSPA 2R6GA 3SK5A 1I50B 2I07B 2E2JB 1BOSA 3I4LA 2RSOA 1FD7D 2KEDA 5C4HA 2EYOA 3R3OA 1FNVA 1T5EA 5C4JB 1ESRA 2MJ8A 3BDCA 2O2LD 1D5MC 1SNCA 3I4NB 4MHEA 5BN3A 2B2WA 2IPKD 1U4RA 2XRSD 4TQUS 2CQAA 5FKAC 1DOLA 5IT9E 1CK1A 2K6AA 3QB3A 1PTOH 3URYA 3OSOA 4KY7A 1LTAD 3K5OA 3AB9A 5IGDA 3HKZB 2VUMB 3EQLC 5G3LD 3T13A 4RHSA 3DEOA 3LWUA 5IOCA 2J0TD 2D5DA 4KV6A 3EROA 3I3CA 3V05A 3I72A 2AUKA 1NR4A 5C3WA 1H9SA 1X3QA 2QF7A 4FXGC 1H9MA 2WACA 4C2MB 2H1EA 4F8MA 1SYFA 1STEA 1EEID 3S16B 1OO9B 4Z9CB 1HQRD 3GV6A 1HTPA 4JK1C 5ELFA 4FP5D 1HQMC 1TS5A 4WORA 2K01A 4C3JB 3OIQA 1VF5C 1GUSA 1CZGA 1E2VA 4KK7A 1Y8PB 1TKWB 1JB3A 1QILA 1V8QA 1PZKD 1EY8A 1XYIA 1BCPF 1FNWA 3PUYA 3W3AA 3HOUB 1ONLA 1DM0B 2E2DC 3D6CA 2NN6H 1BXTA 2NVYB 1AW7A 3L7ZC 1DONA 5T1IA 3OHXC 5C0XG 1JORA 4ILWA 2XN9C 1KNAA 1DOKA 1E2ZA 1R9TB 5M3FB 4OHJA 2QCPX 1SDFA 3K0YA 3V2TA 2EY5A 4RGOS 3C3LA 1VMPA 4X3TA 1HXYD 4RCNA 2HCIA 1UNSA 3MC0B 1STHA 1XXGA 4A3FB 2A6ED 2N55A 1IYVA 5D3IB 1EYAA 5HURA 5JAVA 3VA7A 3HOVB 3MXGA 1BCPC 1O7YA 3DWQA 3NWTA 3GTKB 3QOJA 1EEFD 4KHVA 4IUTA 2Z1CA 3SVMA 1D6EC 5ELDA 5C5LA 4CKCA 5JPMC 1HFGA 4P2CB 2L1BA 3GTPB 4J6HA 2KEEA 3BVGA 3CKIB 1DYQA 3JAML 5EQ0A 3KLSX 3H0GB 2ICIA 1Q12A 4ZK9B 5C0XJ 1A15A 4HN7A 1DXMA 5CR3A 2EZVA 4CJ1B 4KD3A 2RQXA 1DZ1A 5EPLA 4HTHA 4A3BB 3GTGB 3GD7A 2KHSA 2PZWA 2F0SA 1EY9A 2RDGA 1JC7A 4KKSA 2F0QA 5EKLA 2PNRC 3KLRA 4UDUC 2PW5A 1CQFA 4Q5VA 4M1UB 3MFGA 4FVMA 2L4NA 4NP5A 4GZYC 1R4PB 3OW7A 4IUPA 4QUCA 4C3HG 4KY6A 3G7LA 1TU2B 5JEAH 3NUCA 4IFDI 3NTKA 1ZEQX 2M00A 5E1FA 2JA6B 2EYJA 5E3FA 1SJED 1M8AA 1U4LA 3CRKC 2ID0A 1XTCD 1LTSD 1ZYRC 4HCEA 2VB3X 3HZXA 4C3IG 1I6VC 5KRUA 1TY2A 5D65A 3NBHA 3HG9A 1D5XC 5I9PA 1MBYA 3DWPA 4A3IB 4IQZA 3TBIB 5CV9A 3S15B 2PYKA 1V43A 3HS0C 2EJGC 4DN4M 1V1OA 3J80L 2RVLA 2DY7A 4F88A 4BS9A 3PO2B 2AQ1B 2CW0C 1A2TA 3OMCA 1A3TA 4A3KB 3D31A 2B2TA 2SEBD 3C1FA 4BBSB 4IUVA 1WD0A 3A55A 2KA7A 1A3VA 1O7LA 1STBA 4ZKBB 5IGGA 3J7YW 1BCPD 1IHZA 2LS01 2SDFA 4OO1H 1I3QB 1Z6HA 1MSHA 3ERQA 2FFKB 3VYUA 4B9XA 4BBRB 2A6HC 5KYLA 2B8FA 4H7BA 2IWHA 5EPJA 1F2LA 2EYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYE A;  4NP5 A;  2RDF A;  2EY1 A;  5CV5 A;  5NUC A;  1STN A;  4IUN A;  3V2T A;  3DMU A;  5HGT A;  3QB3 A;  2EY5 A;  5EGT A;  2PQE A;  1JOK A;  1EZ6 A;  1SND A;  3EJI A;  3OSO A;  4KY7 A;  5KGU A;  4QB4 A;  4KY5 A;  1KAA A;  1SYG A;  2F0M A;  4KY6 A;  1STY A;  5IGD A;  5IGF A;  5IGE A;  1EY7 A;  2EY6 A;  4WRD A;  4S3S A;  1STH A;  1JOO A;  4HMJ A;  4K8I A;  5I6W A;  3T13 A;  4J1M A;  3TME A;  3MXP A;  1A3U A;  1SNP A;  4K6D A;  5CC4 A;  5IOC A;  4ME5 A;  5CV4 A;  4EQP A;  3NUC A;  2M00 A;  5E1F A;  5KEE A;  4KV6 A;  3ERO A;  2EYF A;  3E5S A;  2EYJ A;  1EYA A;  5HUR A;  4PMB A;  5JAV A;  3BDL A;  3P75 A;  4OL7 A;  4QMG A;  2F0N A;  3MEH A;  5DAU A;  5E3F A;  2EY2 A;  5JOB A;  5DEH A;  5F2D A;  3NK9 A;  2OEO A;  1SYB A;  2PZT A;  3SR1 A;  1JOQ A;  4TRD A;  2F0T A;  4NDX A;  5C6A A;  3QOJ A;  2QDB A;  3MVV A;  2F0O A;  2F0I A;  2OXP A;  1TT2 A;  2HQE A;  4KHV A;  3T16 A;  4NKL A;  5C3W A;  2PW7 A;  5J22 A;  1SNQ A;  2EYM A;  3HZX A;  2F0U A;  2NUC A;  5KRU A;  2F0J A;  1STG A;  5C3X A;  4ZQ3 A;  2RKS A;  4K14 A;  2F3W A;  4K2L A;  4DGZ A;  5M9O A;  5C5L A;  1ENC A;  4KD4 A;  4DU9 A;  5I9P A;  3VA5 A;  1EY4 A;  4NMZ A;  4ZUJ A;  2WAC A;  1EY6 A;  2F3V A;  1RKN A;  5CV8 A;  4F7X A;  5CV9 A;  4F8M A;  4PMC A;  1SYF A;  1U9R A;  2PYK A;  4J6H A;  2PZU A;  3D4D A;  5C4Z A;  1EQV A;  1KDC A;  1ENA A;  1EY5 A;  2EYH A;  3NHH A;  3DHQ A;  2RBM A;  5IOD A;  4N9T A;  4WOR A;  3TP5 A;  4R8N A;  5K5P A;  5KIX A;  4RKL A;  4K5X A;  4DFA A;  1TR5 A;  1TQO A;  1KDA A;  5J1Z A;  1SYC A;  4YIJ A;  3D8G A;  2F0D A;  4HMI A;  2KQ3 A;  4QF4 A;  5KYI A;  3NXW A;  2SNM A;  2LKV A;  4K5W A;  5CR3 A;  2F0G A;  1A2T A;  2O4X A;  3OMC A;  3D4W A;  4ODG A;  1AEX A;  3SK8 A;  5CGK A;  1A3T A;  3S9W A;  2F0L A;  4IZ8 A;  1STA A;  1KAB A;  4KD3 A;  3SXH A;  2F0P A;  3C1E A;  5IGC A;  3MZ5 A;  1F2Y A;  3H6M A;  4HTH A;  1EY8 A;  2F0V A;  3SK5 A;  4EVO A;  4LAA A;  3TP7 A;  2SOB A;  2OF1 A;  3C1F A;  5IGB A;  3QOL A;  5I6Y A;  3HEJ A;  3PMF A;  4K2K A;  2ENB A;  2KHS A;  2PZW A;  2F0S A;  3MHB A;  4KJO A;  4DF7 A;  4EQN A;  3D6C A;  1EY9 A;  1NSN S;  3OWF A;  1A3V A;  2EYL A;  5C4H A;  2EYO A;  1EYC A;  1STB A;  3R3O A;  5IGG A;  3ITP A;  1IHZ A;  3SHL A;  4RKB A;  2SNS A;  3EVQ A;  2F0Q A;  3NQT A;  4IAL A;  3U9O A;  1EZ8 A;  5IIF A;  1EY0 A;  3BDC A;  1F2M A;  4KJN A;  5EKK A;  2F0E A;  4ID6 A;  5EKL A;  3NP8 A;  1SNC A;  4ZUI A;  1SYD A;  3OMG A;  4G57 A;  4K8J A;  3TP6 A;  1SNM A;  2EXZ A;  1JOR A;  2F0F A;  2F0W A;  3ERQ A;  4KTA A;  4B9W A;  4E6I A;  1SNO A;  4B9X A;  1F2Z A;  3SK4 A;  1EYD A;  5KYL A;  3LX0 A;  1NUC A;  5ISR A;  2PW5 A;  4EQO A;  5CV6 A;  4MIU A;  4H7B A;  2F0K A;  4PNY A;  3TP8 A;  5I9O A;  5J39 A;  2F0H A;  4K5V A;  1KDB A;  3SK6 A;  1II3 A;  3RUZ A;  2EYP A;  5C5M A;  5CV7 A;  1A2U A;  4N9P A;  3P1H A;  4I65 A; 
#chains in the Genus database with same CATH topology
 4K0K Q;  4PZ7 A;  2C5C A;  1STN A;  5HGT A;  1H9R A;  1CA5 A;  3MXU A;  3BVZ A;  3X3M A;  5J3B A;  5IE8 A;  3I56 A;  1K83 B;  1HNW L;  1JOO A;  4LK1 C;  3TME A;  1EIH A;  4PQX A;  4QL5 A;  3A7A B;  2CHB D;  4Y7N H;  1EWC A;  2F0N A;  3MEH A;  4B3T L;  5F2D A;  4ABN A;  3C46 A;  5DNF A;  1JOQ A;  2KEC A;  3CD6 A;  3GTM H;  1TS4 A;  1MGS A;  1Y1V G;  1EFI D;  5G3L F;  2VB2 X;  1VQN A;  2DY8 A;  2JA7 B;  4DR5 L;  4IJH A;  1H9S B;  1UUP A;  2NUC A;  4DV2 L;  3K5M A;  3NTI A;  3A5U A;  2ZXP A;  4AYB G;  1ENC A;  4L6T B;  1TWF B;  4BY1 G;  5BR8 L;  4JV5 L;  4YY3 Q;  1PRT B;  1ILP A;  1H9K A;  4LF8 L;  3KF8 A;  4A4I A;  4CJ2 C;  4N8X 1;  3SGI A;  2EDG A;  3SDZ A;  4DAY A;  3A8I E;  1Y1W B;  3MEF A;  1GD7 A;  3J7Z C;  3PGZ A;  1E0B A;  4GLV B;  5KYI A;  1SE3 A;  3E0J A;  2LKV A;  3VDY A;  1ENF A;  1AEX A;  2MPM A;  1JQY D;  4DV4 Q;  4FF1 A;  2K04 A;  3T56 B;  3M4P A;  2F0P A;  4YWL A;  4G7O C;  2JN4 A;  1JJC B;  3PMF A;  2ENB A;  1K3R A;  4A3L G;  2K5W A;  3GTO H;  5CYU A;  2JA8 H;  1YHA A;  2EYL A;  4C3H B;  2SNS A;  3MWY W;  4LUV A;  3HOX G;  5GAG C;  2VQE L;  4HAE A;  1YHB A;  4DK1 A;  3I8Z A;  4ZUI A;  4K8J A;  5C4X G;  3KFU A;  4JI2 L;  4CGY B;  4XT3 B;  3HOW H;  1CUK A;  1MSG A;  4X3U A;  2XSC A;  2ZJP A;  3BJU A;  5CV6 A;  4PNY A;  4JW0 A;  3HOZ H;  5AFW A;  4B3S Q;  3FVQ A;  4JBJ A;  4DR5 Q;  4C3I B;  2R93 H;  2R92 B;  4DV2 Q;  4KI0 A;  1J9O A;  3TZU A;  3J81 L;  2NTS A;  4QB4 A;  3IL8 A;  1CFM A;  4MNO A;  5KNC A;  1EY7 A;  4JPB W;  1YNN C;  3I4N H;  4LF8 Q;  5EAY A;  5K36 G;  1VQB A;  4DV7 L;  3CCQ A;  1MJE A;  2WII B;  3SE0 A;  1W2B A;  3Q22 A;  4L5S A;  1AH9 A;  3BDL A;  4OL7 A;  2NVT H;  2KJX A;  4X6A H;  3SR1 A;  3NK9 A;  1A63 A;  1SYB A;  3NSW A;  3TS2 A;  2F0T A;  4NDX A;  4QUF A;  3GTJ H;  3DWA A;  1EWI A;  5IWA L;  1TWC B;  3K57 A;  1NTG A;  3I4M G;  2AWO A;  2F0J A;  2G9H D;  3KLS A;  4OWX B;  1G2T A;  2K4K A;  1PH4 A;  1G6P A;  1FJG Q;  1DOM A;  4LFA L;  4JI8 Q;  2JA5 G;  3W1B A;  4A3M B;  3KOJ A;  4L5T A;  2UUB Q;  3A56 A;  4AIM A;  2BDO A;  4GNX C;  2A68 C;  4MN3 A;  1SE8 A;  1PV4 A;  3GDE A;  3RZO H;  3D0F A;  2K32 A;  4N9T A;  4JI2 Q;  3K8A A;  4KLK A;  1TR5 A;  1SYC A;  4YIJ A;  1SEB D;  3NEM A;  4R4O A;  1Q1E A;  3FEW X;  2K5N A;  2KVM A;  3S2H B;  4IUR A;  5JPN C;  1JJ2 A;  1X55 A;  2OF1 A;  5ELE A;  1SAP A;  4C2M H;  2E75 C;  2K5D A;  4RKB A;  2HHH Q;  3EVQ A;  1X3E A;  2B29 A;  4WJW A;  4LMQ D;  1WTH A;  2F0E A;  3CCE A;  1FGU A;  1Q1B A;  3UI2 A;  1IW7 D;  1XPU A;  2HUG A;  4LF4 L;  1LAC A;  2XIW A;  3PO3 G;  3M7N A;  3VR6 A;  1KTK A;  2E5L Q;  1EU4 A;  4OX9 Q;  4QCL A;  2F0H A;  5LL6 S;  4GLA C;  2FMC A;  3K5N A;  1Y1V B;  5IWA Q;  3K7A B;  4KKU A;  3HOU H;  2J7Z A;  1GUN A;  1JOK A;  2OWO A;  1CKO A;  2TMP A;  4PZ8 A;  1AP0 A;  3N6R A;  1STY A;  2NVY H;  3GTQ H;  3D6W A;  1QUQ A;  3L9A X;  3X3N A;  1WTW A;  2LFN A;  2K28 A;  2EVB A;  4HMJ A;  4OEM B;  3PIP A;  1B3Q A;  2QEJ C;  4IUU A;  3PQI A;  2UU9 L;  2KEN A;  5FLX L;  1HFN A;  3AFP A;  3MXN B;  3VYT A;  5CV4 A;  4GOP A;  1KHI A;  2M2L A;  3QR8 A;  2B2U C;  5COR A;  1LTI D;  3S1N H;  3P75 A;  1W6J A;  4JI0 L;  3HOY G;  2EY2 A;  5JOB A;  5DEH A;  5M3F H;  2PZT A;  5CBA E;  2D0P A;  1RJT A;  1CQV A;  2ZTD A;  2LY7 A;  1IKM A;  2B63 G;  5D14 A;  2F0O A;  3PUZ A;  1QZH A;  1TT2 A;  4ZAI A;  3FRP B;  2PW7 A;  1IL8 A;  3DM3 A;  5J22 A;  3AFQ A;  4JYA L;  5C3X A;  2DNC A;  3NBH B;  2QIL A;  1YEZ A;  1GUO A;  5C3E G;  1VQJ A;  4C1N K;  3Q0A A;  1HRJ A;  2L15 A;  1U9R A;  3OW2 A;  2PZU A;  5DM7 3;  1XMO Q;  4HCS A;  3M4O B;  3LWE A;  2EYH A;  2NN6 G;  3CCL A;  1UAP A;  2NTT A;  4CBV A;  4XTC S;  1RF2 D;  1W3S A;  2D62 A;  3T1H L;  2RBM A;  5C4X B;  1GOZ A;  2NZO A;  1JWM D;  3WOF A;  1HNZ L;  2Z6K A;  3STB D;  4OWT B;  1FYC A;  3CCS A;  4JI6 Q;  4A3G G;  1I4P A;  3UDI A;  3TSS A;  2WB1 G;  1YNN D;  4JI7 Q;  2KBN A;  1JE4 A;  5FLM G;  1VMC A;  1SRO A;  1B50 A;  2JEB I;  4ULL A;  3CCR A;  2H4O A;  3U9O A;  4RGM A;  1L1O A;  1MI2 A;  3H0G H;  1EUJ A;  3NP8 A;  4LF6 L;  1L0X B;  2KCN A;  3H3V I;  1RIP A;  1F9R A;  4PV1 C;  4C56 C;  2B2V C;  1NCV A;  5LHY 1;  3CCV A;  3G6J B;  2DJG C;  4TVA B;  2PI2 E;  1X65 A;  1A2U A;  1ICW A;  1LT6 D;  1K8M A;  1Q82 C;  2RDF A;  2EY1 A;  3I4M B;  3OTO Q;  1IBL L;  2A68 D;  1CTM A;  3WOE A;  2UUA L;  2XTI A;  3GP7 A;  1SYG A;  4I7Z C;  1ASZ A;  1YZ6 A;  4S3S A;  1UE6 A;  1B70 B;  2JP1 A;  3I73 A;  2JA5 B;  1SNP A;  1S5F D;  4K6D A;  3D4R A;  5CC4 A;  4GN4 B;  4EQ5 A;  3S1Q B;  3K58 A;  3FKI G;  2CH4 W;  1B9N A;  3U50 C;  2RSN A;  2JA9 A;  1K9M C;  3UDG A;  4FF4 A;  1JR0 D;  2VQF L;  1GJX A;  2HQE A;  4XQJ A;  1TWG H;  1EQR A;  4A93 G;  3E6Z X;  3HP3 A;  2L11 A;  2XGT A;  4ZLT F;  2A5H A;  1AE2 A;  2WAQ G;  2F4I A;  1PYS B;  4POG A;  2WKD A;  4DK3 C;  4LF5 L;  1VF7 A;  3KF8 B;  2MP1 A;  3D4D A;  5EBC A;  1Z47 A;  1PTO B;  1KDC A;  1ENA A;  4FDB A;  3NTH A;  4DK6 C;  1LTT D;  1I6H B;  4DAY B;  1T5X D;  4IOA A;  2AWN A;  2B2W C;  3Q6S A;  1E1T A;  3PCO B;  4G7H C;  1I94 L;  1D1I A;  4DFA A;  3BDO A;  2FJ2 A;  4YCV A;  2Y0S G;  2F0G A;  1CKN A;  4ODG A;  1N34 L;  1GHJ A;  4ZRZ A;  2NWG A;  1LV9 A;  1MKH A;  1PH7 A;  4H44 C;  2NN6 I;  3S17 B;  2K7V A;  1F2Y A;  1GKH A;  1PA6 A;  2SOB A;  5LMU L;  1LAB A;  2RDH A;  3S14 B;  2NVX H;  3S15 H;  2N3S A;  4OIK A;  1U4P A;  3VR2 A;  1QNU A;  4IAL A;  1PXU A;  3W2D A;  1X3P A;  3G71 A;  3M7G A;  5EKK A;  5M5X H;  1B3A A;  2R7Z H;  4JI5 L;  2CVR A;  3V96 A;  3A8J E;  2I0Q A;  4H0L C;  1A62 A;  3S1M H;  1AFP A;  4F87 A;  4HIK A;  5KNB A;  3HOY B;  5JEA G;  3EA6 A;  1VQH A;  1IBK Q;  3OYY A;  1WTP A;  1LO5 D;  1FVI A;  2B63 B;  3L3O C;  1N33 L;  3RD4 A;  4IFD H;  3P1H A;  4BBS H;  2E2I H;  2WB1 E;  2P5Z X;  3QIA A;  2QKI C;  3AEV A;  4BY7 B;  1X3F A;  2PQE A;  3QWN A;  5I2X A;  5C3E B;  1PRT C;  2K5H A;  1L0W A;  2KHJ A;  1EWH A;  3Q24 A;  1IBM L;  3LNN A;  3AYH B;  3I70 A;  4J1M A;  4H13 C;  3U9S A;  1AN8 A;  4LW1 A;  1GXD C;  1EL0 A;  3L2P A;  4A3E H;  1BQQ T;  2R61 A;  3E5S A;  1CKM A;  2ZJR A;  1K8O A;  5BN5 A;  3M85 A;  2F1M A;  2KCT A;  1SFO H;  4GS3 A;  1HA6 A;  2MGS A;  5C0X I;  1XPO A;  1O80 A;  1UE1 A;  5IYC G;  4A3G B;  2UXC Q;  1A6X A;  2WB1 B;  1SMY C;  5IP7 G;  4OON A;  4ZQ3 A;  1DCZ A;  2VXW A;  4R4T A;  3JAM c;  1C0A A;  5FOB B;  1K83 H;  4KD4 A;  4KHP L;  3VA5 A;  4XXE A;  2YU9 H;  3MXN A;  1OXX K;  2Z4H A;  2UXD Q;  1H95 A;  1MHW C;  3FMC A;  1WVL A;  3CF5 A;  5IYB G;  1TWH H;  4RCO A;  3VR3 A;  4R4C A;  4LUO A;  1YIJ A;  1LLR D;  3J81 j;  1J5E L;  1XNQ Q;  4GKK Q;  4K0K L;  2KQ3 A;  4OO1 G;  3U4V A;  1EOT A;  2DUD A;  2F0L A;  5JEA J;  3SXH A;  3CQZ H;  1N33 Q;  3C1E A;  3ND9 A;  4FO2 A;  1U0L A;  1TWF H;  4LAA A;  3NBI A;  2M9V A;  3KK7 A;  4K2K A;  3IFT A;  5M5W H;  3CW2 C;  1ML0 D;  4DF7 A;  2Z9H A;  1VQM A;  1IL2 A;  4CKB A;  1EYC A;  5IYD H;  1QE6 A;  1RD9 D;  3CCJ A;  1DJR D;  5D3D A;  2WAQ E;  4A76 A;  2I5M X;  4ID6 A;  4DUY L;  4DR1 L;  1QNK A;  3FKI B;  2F0W A;  4FYD A;  4ALP A;  3SK4 A;  1HHV A;  2G9D A;  2F0K A;  3CU7 A;  4DA2 A;  2NYZ D;  5M3M H;  2Y0S E;  1R4Q B;  4A3J B;  4YY3 L;  1OTC A;  2RF4 A;  3IKJ A;  4IUN A;  1NR2 A;  4MZ9 A;  4DNT B;  5KGU A;  5C44 B;  2MFI A;  1QUQ B;  1LTB D;  4OWW B;  1YNJ C;  2WAQ B;  4GOP B;  1Q46 A;  4R8I A;  2IX0 A;  5KEE A;  4X3K A;  1JCK B;  2UXB Q;  5E7N A;  4DV4 L;  2L9H A;  4WFN 3;  3NWS A;  2OEO A;  4UAI A;  4JBM A;  3BVM A;  1WFQ A;  2VS1 A;  2X69 A;  1GUG A;  4AQY L;  1J5E Q;  4FXK C;  3EN2 A;  4J15 A;  3HKS A;  2Y0S B;  2MO0 A;  2EOT A;  1WCM H;  2EYM A;  4RGN A;  1TWA H;  4PG3 A;  4GLX A;  1BCP B;  1Y69 U;  4BXX H;  4IN3 A;  1BBU A;  5FJ8 H;  3J80 c;  1ET9 A;  3TEH B;  4M8A A;  1SR3 A;  2ZT9 C;  4B3R Q;  1D7Q A;  1I4Q A;  2MQH A;  1I4H A;  4X62 Q;  4A3D H;  5M5Y B;  1ESF A;  1EQV A;  2JA8 G;  4CKE A;  3BZK A;  3G48 A;  4DR7 Q;  1WTV A;  4DUY Q;  3EFX D;  2MNA A;  3QG1 A;  4DR1 Q;  4FNF A;  3FHW A;  5K5P A;  2ZXO A;  4EGV A;  4RKL A;  4B3S L;  3G6E A;  2PI2 A;  3CHB D;  1IW7 C;  3BYY B;  2F0D A;  1PRT D;  2B2Y A;  5CGK A;  3GQB A;  3R2I A;  1TVX A;  3SK8 A;  1M4V A;  4O42 A;  1VQF A;  3HOW G;  4JOI A;  4K6L A;  4OGQ C;  3DXJ C;  3BYT B;  5IGC A;  3S1R H;  4P72 A;  2ALY B;  3H6M A;  4DV0 Q;  2F0V A;  2I46 A;  3TP7 A;  3HOZ G;  5I6Y A;  2I5L X;  1PYB A;  2A19 A;  1SE2 A;  4RA8 A;  4EQN A;  4A3M H;  1PYW D;  3RLO A;  3KBX A;  1DGS A;  3ER0 A;  2RCN A;  2R93 G;  1BDO A;  1L1O B;  1HZ9 A;  3MTS A;  3HGB A;  4DR2 Q;  3OPO A;  2RHQ B;  1CI3 M;  2EXZ A;  3I2Z A;  1SMY D;  4KTA A;  2BE5 D;  3I4N G;  5I4D A;  2ZTE A;  1WD1 A;  3TRE A;  4HJ7 A;  2D9U A;  3S2H H;  1KDB A;  4AQY Q;  2ES2 A;  4O1N A;  3J81 E;  1LT5 D;  4U67 3;  2H5X A;  4HJ9 A;  1XWE A;  1FJG L;  4DUZ L;  4JI8 L;  2E74 C;  1VQC A;  2R3Z A;  4FF3 A;  2BCO A;  2UUB L;  5KND A;  3EJI A;  2NB0 A;  4KY5 A;  2YTY A;  3RZD B;  3IFD A;  1EOV A;  1YNX A;  4LUZ A;  3HKZ G;  3MXP A;  1NJI C;  1JJG A;  1VQK A;  2KCM A;  2EYF A;  3CCU A;  3AMU A;  2JQO A;  1JWS D;  3CRL C;  3T51 B;  1I50 H;  2E2J H;  1PH3 A;  3CC7 A;  3ONA B;  5GRO A;  2C9O A;  2D2C C;  2B2T C;  1KRS A;  1SNQ A;  3STB C;  4JBW A;  1WTO A;  4FXD A;  3BG3 A;  4DGZ A;  5C4J H;  1RHP A;  5TSS A;  2HHH L;  2WKC A;  1XMQ Q;  2ZTC A;  1EYG A;  3ICE A;  2JSO A;  1KL9 A;  4ZKC B;  2O5I C;  3K81 C;  1TY0 A;  2E5L L;  4HED A;  4OX9 L;  1PZJ D;  2ATW A;  1M90 C;  2WFW A;  1G8Z D;  3PUX A;  3TP5 A;  1TQO A;  4QGU A;  1KDA A;  2ZM6 Q;  3F2B A;  3RN5 A;  3GO5 A;  1CKN B;  4DR3 Q;  4Y7N B;  2IJ0 A;  1G2S A;  2VUM H;  4IZ8 A;  1CM9 A;  1I4R A;  2E2H B;  1O78 A;  1YNJ D;  2WV6 D;  4JI1 Q;  3E0E A;  3I90 A;  2F4V L;  4APV A;  2VZA A;  4DUZ Q;  3QOL A;  3GTM B;  1B2T A;  3MHB A;  3OWF A;  4AH6 A;  3HOU G;  3SHL A;  5DM6 3;  1K8A C;  1QWY A;  4I7A A;  3GTL B;  2A69 C;  3PUV A;  1IYU A;  1Q81 C;  4CDE C;  3NQI A;  4TKO B;  2K14 A;  3J81 c;  4HSV A;  5C5M A;  4A3C H;  3CAM A;  3FPU B;  1X32 A;  2EPB A;  5M3F G;  4AYB E;  5NUC A;  3S16 H;  4JVZ A;  1WYD A;  2L5T A;  3H3V C;  4DAP A;  1XMO L;  1X6O A;  2K52 A;  4TSS A;  4DV5 Q;  2JJQ A;  2EE1 A;  2L55 A;  1JWU D;  1K8G A;  3TZD A;  1FR3 A;  3MFY A;  4C3J H;  5JJI A;  1PTO C;  2Q2H A;  5A2Q L;  3ZYY X;  3SEB A;  1V1P A;  1PVO A;  3BZD B;  1WI5 A;  2X6L A;  1SMX A;  1Q8K A;  1N9W A;  3KF6 B;  3GTO B;  4BA2 I;  2WIN B;  2JA8 B;  3DEP A;  3QO2 A;  4JI6 L;  4PMB A;  4IPG A;  2B3G A;  2IW3 A;  4JI7 L;  2K5Q A;  3AU7 A;  3G4S A;  4P71 A;  4NKL A;  4PZ6 A;  4AYB B;  2F0U A;  1VQL A;  2B8G A;  1STG A;  4BY1 B;  4K14 A;  4KMU C;  2AHO B;  2F4V Q;  4DU9 A;  1IKL A;  2JE6 I;  1EY6 A;  1LTG D;  1Q8I A;  1BNZ A;  2YTX A;  2IT1 A;  2R93 B;  2AUJ D;  3S1Q H;  4DV6 Q;  5C4Z A;  1QG7 A;  2Q2I A;  5COY A;  5FO7 B;  1R9T H;  2XWB B;  1PFS A;  2BA0 A;  1H9J A;  4DAV A;  4LF7 Q;  1WTX A;  3I91 A;  4K5X A;  2L12 A;  1S5C D;  3H0G G;  2DJF C;  2V4D A;  3OTO L;  3NXW A;  2HD3 A;  2O4X A;  1FNU A;  5EJW A;  1KRT A;  2HDL A;  2NVT B;  1BBW A;  2GVA A;  1TS2 A;  3WDN A;  4EVO A;  4MTN A;  4A3F H;  3H3V H;  5IGB A;  1VQ7 A;  4OIJ A;  3GTJ B;  4KJO A;  3HOX B;  1AZQ A;  3KBG A;  2HQL A;  2X6G A;  3HOV H;  1CHQ D;  2KHI A;  3OWE B;  1F2M A;  2BOS A;  4KJN A;  4DXF A;  3GTK H;  4X3S A;  3OMG A;  2CQO A;  3TP6 A;  1SNM A;  5HGQ A;  1IZ6 A;  3IAY A;  5FO9 B;  1C8C A;  2HCC A;  1SNO A;  1SRU A;  2KOL A;  1HUN A;  2IX1 A;  5ISR A;  5J39 A;  4MTK A;  4NXN Q;  1UE5 A;  3BS1 A;  3S2D B;  3S17 H;  3RZO B;  4QIW E;  2K5V A;  4DR6 Q;  5FLX c;  3PIO 3;  5CV5 A;  3GTP H;  2OTJ A;  1GUT A;  1CT1 D;  2KCC A;  4QQB X;  2YV5 A;  4BA1 I;  2F0M A;  4XYO A;  2HDM A;  3NE5 B;  5IT9 L;  2JYO A;  3JC6 6;  3E9I A;  1K0S A;  4ME5 A;  5A35 A;  4LF9 Q;  1DD2 A;  2AQ3 B;  2E76 C;  4QMG A;  4A3B H;  3GTG H;  2Q8I B;  1PH8 A;  4NXM Q;  1C48 A;  1RTO A;  1GUW A;  1Y14 B;  4QIW B;  4P75 A;  4Q0F A;  4BY7 H;  2WP8 J;  1JMC A;  5GAE C;  4OEL B;  3T1Y Q;  4HR7 B;  4R9W A;  2A69 D;  5E4W C;  2ASB A;  2NVQ B;  5DLQ E;  5ELB A;  1PH6 A;  1EY4 A;  1D1K A;  1NMF A;  2VY3 A;  4F7X A;  4PMC A;  2PPB C;  2LXJ A;  5GAH C;  4KKT A;  3UDF A;  4QJF A;  1XX8 A;  1P16 A;  3KJP A;  1EY5 A;  3K7U C;  3NHH A;  1N32 L;  3A54 A;  1IBK L;  1VQ9 A;  2VNU D;  5JJL A;  3GTQ B;  1OXT A;  1HUM A;  2RHS B;  2PCF B;  5IOD A;  1PH9 A;  1ASY A;  3E3X A;  2DGY A;  4LFB Q;  1KLG D;  3J7A F;  4CDF C;  3D8G A;  4GNX B;  2R7Z G;  1CSP A;  1TS3 A;  4QF4 A;  3GV3 A;  4K5W A;  1C4Q A;  1Z9F A;  4X65 Q;  1MD2 D;  1D2B A;  3S1N B;  1PTO D;  1Y8N B;  3M4Y A;  3JAM E;  2RA4 A;  3K5L A;  2KUM A;  5CBE E;  4LNQ A;  4IFD G;  2JA6 H;  4BBS G;  2L0C A;  4RWS C;  4RGT A;  1XTD A;  1B4O A;  2PMZ E;  1G91 A;  1IXR A;  4GOP C;  1PRT F;  2Z4I A;  1EZ8 A;  1ZKO A;  1F77 A;  1MIU A;  2CCZ A;  3PO3 B;  1EIG A;  5LMN L;  1W6K A;  4RH6 A;  2UXC L;  1EYD A;  5ELO A;  3KJO A;  5I9O A;  2MHV A;  4A3E G;  4BBR G;  1VS0 A;  1BF4 A;  2N78 A;  4C1N I;  2G5D A;  1PDQ A;  1QVG A;  4A3I H;  1BO0 A;  4N9P A;  4X66 L;  2UXD L;  3DMU A;  3U4Z A;  2VW9 A;  1XNR L;  1HPC A;  3MA2 B;  2K33 A;  4DNI A;  4GKJ L;  2PMZ B;  5C0X H;  3A5Z B;  4K8I A;  2XNA C;  3PF5 A;  5E4X A;  3ULP A;  1HZB A;  3PO2 H;  2A74 C;  1XNQ L;  1KC8 C;  4GKK L;  4EX5 A;  1N32 Q;  2Z6K C;  4ZCK A;  4A3K H;  4L5Q A;  1LTL A;  4JI3 L;  3SK6 A;  3RLF A;  3A7L A;  2F03 A;  4B08 A;  4A3J H;  2I5H A;  4XIG S;  1LYL A;  2RCF A;  3TN2 A;  2NZH A;  1X54 A;  3CME A;  3HRZ C;  5C44 H;  1Q90 A;  2PNH A;  1ZXT A;  1N8R C;  3H91 A;  4KN4 C;  1I3Q H;  4DPG A;  1L1O C;  1F9P A;  3KF6 A;  4BBR H;  3M4Q A;  4DXG A;  4IFD J;  2AQ2 B;  1Q3L A;  1PH5 A;  4JCV E;  4CJ0 B;  5IYD G;  1BVS A;  5LMN Q;  1I4X A;  2QEX A;  1OXU A;  5J1Z A;  4XYQ A;  4R4I A;  2BE5 C;  3D4W A;  1O7Z A;  1STA A;  1PZI D;  2DN8 A;  2OT2 A;  3UE0 A;  3J80 E;  4X66 Q;  1BR9 A;  3HEJ A;  5M3M G;  4O2D A;  1XNR Q;  2CWP A;  4GKJ Q;  1TWG B;  3D3R A;  1LTR D;  1S5B D;  3ITP A;  5M5Y H;  2UXB L;  2OQK A;  4XT1 B;  2OQ0 A;  3KUP A;  1NNX A;  2XRQ D;  4UY8 C;  2YYZ A;  1SYD A;  3KYH C;  2JA7 H;  1PFB A;  4R4Q A;  4JI3 Q;  1LM0 A;  3LX0 A;  4ME3 A;  4EQO A;  1FL0 A;  3J81 i;  2LMC B;  4K5V A;  4L63 B;  2UUC L;  1I5F A;  1II3 A;  3RUZ A;  1TII D;  2IL8 A;  5JVG 3;  2PQA B;  1EFW A;  1QOH A;  1Y8O B;  2EJF C;  3ND8 A;  4B3R L;  1SLJ A;  4G7Z C;  1PFM A;  1B1Z A;  4POF A;  1B9M A;  4X62 L;  3ZJY C;  3EIV A;  2R92 G;  5IGE A;  1PMR A;  1WCM G;  5IGF A;  1YJW A;  4DR7 L;  4WRD A;  5LL6 X;  1Y1W H;  4BXX G;  1E22 A;  1V1P B;  3T53 B;  5FJ8 G;  4V19 0;  1QZG A;  2Z8L A;  1S5E D;  2BH8 A;  2NVX B;  4L8J A;  3CMA A;  1D8L A;  4XQQ A;  1SBB B;  4BWG B;  5DAU A;  1U5K A;  4A3D G;  1KIX A;  4TRD A;  4DV0 L;  1E24 A;  1QB5 D;  5FK9 C;  5M5X B;  1YBY A;  3VYS A;  4FF2 A;  2R7Z B;  4KN7 C;  1E1O A;  4DV1 L;  5ELC A;  1S4Z A;  4C3H H;  3C2P A;  3S1M B;  4A93 B;  5M9O A;  2F3W A;  1SSO A;  3RZD H;  1SXT A;  1PLF A;  1HNX Q;  1LT3 D;  5T1G A;  2NBF A;  3B6Y A;  4NMZ A;  4ZUJ A;  4DR2 L;  1E2W A;  2ZXR A;  4G4K A;  1Z7T A;  3NPP A;  4GN5 A;  2GN5 A;  3J7A V;  2E2I B;  4IOC A;  5FO8 B;  1JB7 A;  3A74 A;  1RDP D;  4LWC A;  2N88 A;  1KLU D;  2FIN B;  2J4X A;  4A3M G;  1SE4 A;  4JI4 Q;  3VR4 A;  5KIX A;  1BKB A;  2K50 A;  4R8N A;  4JG2 A;  3VYR A;  1AZP A;  4ZYS A;  3CC4 A;  4C3I H;  2R92 H;  2R7D A;  2SNM A;  1KNE A;  1YHQ A;  4A3E B;  3W5O A;  3S9W A;  3U58 A;  2UUC Q;  4IUQ A;  3M9B A;  2TSS A;  1PH1 A;  1SFO B;  2JK8 A;  1CZW A;  1ILQ A;  1CHP D;  3OIP A;  1YVC A;  5GAD C;  1ET6 A;  4DR4 L;  2XWJ B;  4UP8 A;  2EJM A;  1TWC H;  4GNX A;  2YU9 B;  1SN8 A;  2F0F A;  2FMM A;  1FGB D;  2MUY A;  2HIV A;  1F2Z A;  4UHV A;  3PIP 3;  4A75 A;  1BUV T;  1NUC A;  2OCE A;  3TP8 A;  3PF4 A;  2F3I A;  3AQQ A;  2E2H H;  1EU3 A;  2CFM A;  1XMQ L;  2NZ1 D;  1QJO A;  1TWH B;  4I65 A;  4DV1 Q;  4XQN A;  2JEA I;  4OO1 I;  3P20 A;  3K0X A;  1EZ6 A;  3VR5 A;  5IP9 H;  3PUW A;  4P73 A;  3N52 A;  3R8B A;  2HIX A;  1RCV D;  2Q8R E;  3CQZ B;  5JVH 3;  3GTL H;  2K1B A;  4RFB A;  3DUZ A;  4CDC C;  3IRB A;  4EQP A;  2ZM6 L;  1I4G A;  3T4A C;  5M5W B;  5AJ3 Q;  4DR3 L;  2Q2T A;  3R2T A;  5LMN W;  1HA5 A;  4LFC L;  1F9Q A;  4JI1 L;  1EIF A;  5C6A A;  1F9S A;  2OXP A;  3T16 A;  2JXM B;  4IJL A;  1VQG A;  4HJ8 A;  3M3Y B;  4NW2 A;  2QDL A;  1L0Y B;  2RKS A;  3DM1 A;  2PO4 A;  3O13 A;  1LUZ A;  3W1G A;  4CHT B;  2VUM G;  5M3M B;  2F3V A;  2IX3 A;  1VDZ A;  2K03 A;  3DLL A;  1G29 1;  1KD1 C;  1UE7 A;  3FPP A;  3TS0 A;  2GVB A;  3H09 A;  1HZC A;  2IY5 B;  2DNE A;  2BDN A;  2EIF A;  1JT8 A;  3TDQ A;  4DAM A;  4DR4 Q;  3DHQ A;  3H94 A;  1Y1V H;  1WTQ A;  1HNW Q;  2AMC B;  1JIC A;  3BZC A;  1K73 C;  3F2U A;  2B2U A;  3K7A H;  5H1S E;  1QCB D;  1ZYR D;  4JBK A;  2LSS A;  4HMI A;  1B7Y B;  1E3P A;  4DV5 L;  4BY1 H;  4RAU C;  5ELN A;  4B3T Q;  2O5J C;  4P74 A;  3KDF B;  2XVS A;  1D5Z C;  4DNR B;  1S3O A;  4A3C G;  1B53 A;  1NSN S;  3P7J A;  1HTL D;  1WCM B;  1TWA B;  5EBD A;  1MJC A;  3NQT A;  5IIF A;  4O0A A;  3MAQ A;  1EY0 A;  4RHR A;  5BR8 Q;  4JV5 Q;  3L0O A;  2ICE C;  1PTO F;  4G57 A;  2BA1 A;  5JJZ A;  4C3J G;  2A73 B;  4B9W A;  4E6I A;  2CW0 D;  2IHF A;  5IY0 A;  2F52 A;  4LFC Q;  4A3D B;  4MIU A;  1YIT A;  1K0R A;  3PV0 A;  3OOC A;  1BBX C;  4DK0 A;  1Q86 C;  1S5D D;  1ICF B;  3FDT A;  5CV7 A;  4A3L H;  3RMH A;  1SYE A;  1VCI A;  4V0B A;  1GO3 E;  2D0O A;  5EGT A;  3M4O H;  1CA6 A;  3HOX H;  5A2Q E;  1HCZ A;  1SND A;  4DV6 L;  1K3B C;  4KHZ A;  5EKI A;  1KAA A;  2B39 A;  2EY6 A;  2GA4 B;  3F2D A;  5C4X H;  3S1R B;  5I6W A;  1EQT A;  4LF7 L;  1A3U A;  4B3M L;  4WJ4 A;  4PMW A;  2Q8T A;  5EPK A;  2HT1 A;  1OXV A;  5BN4 A;  2A6H D;  5CMD A;  1GHK A;  1NY4 A;  1PFN A;  2B2Y C;  2FHT A;  2VQE Q;  2PQA A;  1SJH D;  3S2D H;  2K05 A;  1HJP A;  3QJY A;  4JOI C;  4LJZ C;  2FXQ A;  2QDB A;  3MVV A;  1OXS C;  2F0I A;  1WJJ A;  3R93 A;  1RTN A;  2B2V A;  1UEA B;  5FLX E;  1J8I A;  1JE5 A;  4HID A;  3Q23 A;  4K2L A;  1LT4 D;  3H15 A;  1WTR A;  4GN3 B;  5K36 H;  1NAP A;  1ROD A;  4JC0 A;  2OTL A;  1RKN A;  3CPF A;  5CV8 A;  4J8Q A;  4A3F G;  1HR0 L;  3K59 A;  5I2Y A;  1U4M A;  3A8K E;  1G6Z A;  2CWA A;  4RG1 A;  1EIY B;  4NXN L;  3HOV G;  1B44 D;  4YCU A;  3I4M H;  3CP0 A;  4WJ3 M;  4IO9 A;  4DR6 L;  1C9O A;  4DV7 Q;  3HOW B;  4HIM A;  2V1C C;  2A6E C;  2Z6B A;  4U68 A;  3JAM i;  1KAB A;  3K6O A;  4XDX A;  3HOZ B;  3MZ5 A;  1L2F A;  4HSP A;  2NVQ H;  2R6G A;  3SK5 A;  1I50 B;  2I07 B;  2JA5 H;  2E2J B;  1BOS A;  3I4L A;  2A8V A;  3J7A 5;  2RSO A;  1FD7 D;  3HKZ E;  2KED A;  5C4H A;  2EYO A;  4LF9 L;  3R3O A;  1FNV A;  2N8N A;  1T5E A;  5C4J B;  1ESR A;  2MJ8 A;  3BDC A;  4B3M Q;  2O2L D;  1UWV A;  1D5M C;  1SNC A;  3I4N B;  4MHE A;  4NXM L;  5BN3 A;  4LFA Q;  2B2W A;  2IPK D;  1U4R A;  4Y52 H;  2XRS D;  3T1Y L;  4UP9 A;  4TQU S;  3F2C A;  2CQA A;  5FKA C;  4A3B G;  2EQS A;  1DOL A;  5IT9 E;  1CK1 A;  2K6A A;  1M1K C;  3QB3 A;  3FP9 A;  3RR5 A;  1PTO H;  3URY A;  3OSO A;  4KY7 A;  1I6H H;  1LTA D;  3K5O A;  4NPS A;  3AB9 A;  5IGD A;  3HKZ B;  4BY7 G;  2VUM B;  3BU2 A;  3EQL C;  3RNU A;  5G3L D;  1EQQ A;  3T13 A;  1QVF A;  4RHS A;  5JJK A;  3PO3 H;  1S72 A;  1HR0 Q;  3DEO A;  2IHE A;  1NMG A;  3LWU A;  4N8F A;  5IOC A;  4LFB L;  2J0T D;  1Q7Y C;  2D5D A;  1RL2 A;  3NEN A;  4KV6 A;  3ERO A;  1XJV A;  1VQP A;  1KQS A;  3I55 A;  4X65 L;  3I7F A;  3PSI A;  3I3C A;  3V05 A;  2YTV A;  3I72 A;  3S14 H;  2AUK A;  1NR4 A;  5C3W A;  4YWK A;  4LF4 Q;  5GQO A;  1H9S A;  4H02 A;  3ULL A;  1X3Q A;  2QF7 A;  4FXG C;  1H9M A;  4HJA A;  4X64 L;  2WAC A;  4C2M B;  2H1E A;  3NEL A;  4F8M A;  1SYF A;  1STE A;  1EEI D;  3S16 B;  1OO9 B;  3HOY H;  4Z9C B;  1HQR D;  2CKZ B;  3GV6 A;  2JA6 G;  1HTP A;  4JK1 C;  5ELF A;  4FP5 D;  1HQM C;  2Q2U A;  2B63 H;  1TS5 A;  2R7F A;  4WOR A;  2K01 A;  4C3J B;  2UU9 Q;  1O7I A;  2QGQ A;  3OIQ A;  1VF5 C;  3CCM A;  3ERS X;  2CH4 A;  1V9P A;  1GUS A;  1CZG A;  5C3E H;  3CC2 A;  1E2V A;  1X56 A;  4KK7 A;  1Y8P B;  1TKW B;  4JI0 Q;  1JB3 A;  1NE3 A;  1QIL A;  3J80 i;  1V8Q A;  1PZK D;  1EY8 A;  1V1Q A;  1XYI A;  1BCP F;  1FNW A;  2Z0S A;  3PUY A;  4DV3 L;  3W3A A;  3HOU B;  1VQ5 A;  1ONL A;  4A3I G;  4HJ5 A;  1DM0 B;  2E2D C;  3D6C A;  2NN6 H;  3F1Z A;  4JYA Q;  1BXT A;  3RLN A;  5L37 A;  2NVY B;  1YJ9 A;  1AW7 A;  3L7Z C;  1TXY A;  3TRZ A;  1DON A;  5T1I A;  3OHX C;  5C0X G;  4A3G H;  1JOR A;  3CPW A;  4ILW A;  2XN9 C;  3A0J A;  1KNA A;  1DOK A;  3PO2 G;  1E2Z A;  5FLM H;  3KDF A;  1KAW A;  1R9T B;  4YWM A;  5M3F B;  3T1H Q;  4A3K G;  5IT9 c;  4OHJ A;  1HNZ Q;  2QCP X;  1SDF A;  3K0Y A;  3V2T A;  1HZA A;  2EY5 A;  4A3J G;  4RMF A;  4RGO S;  3C3L A;  1X9N A;  1VMP A;  4X3T A;  4X64 Q;  1HXY D;  4RCN A;  2HCI A;  1UNS A;  3MC0 B;  1PH2 A;  1A8V A;  1STH A;  5C44 G;  1XXG A;  4A3F B;  1AE3 A;  2A6E D;  4UPA A;  2N55 A;  1IYV A;  2C35 B;  5D3I B;  1EYA A;  5HUR A;  5JAV A;  3VA7 A;  3HOV B;  1WOC A;  3MXG A;  3LGJ A;  1VQA A;  1BCP C;  1O7Y A;  1K28 A;  3DWQ A;  1A0I A;  3NWT A;  4LF6 Q;  3GTK B;  1IYJ B;  3QOJ A;  1EEF D;  4KHV A;  4IUT A;  3I4O A;  2K75 A;  2Z1C A;  3SVM A;  1D6E C;  5ELD A;  5C5L A;  4CKC A;  4DV3 Q;  3UE1 A;  5JPM C;  1HFG A;  4P2C B;  1UEB A;  3FKI H;  2L1B A;  1IBL Q;  3GTP B;  4J6H A;  2ZJQ A;  2KEE A;  3BVG A;  4IPH A;  3CKI B;  2UUA Q;  1DYQ A;  3JAM L;  5EQ0 A;  3KLS X;  3H0G B;  2ICI A;  3RN2 A;  1Q12 A;  4ZK9 B;  1VQO A;  5C0X J;  1A15 A;  4HN7 A;  1DXM A;  5CR3 A;  2JA7 G;  2EZV A;  4A93 H;  4CJ1 B;  4KD3 A;  4YCW A;  2EXD A;  2RQX A;  5EPL A;  4HIO A;  2BH2 A;  1DZ1 A;  4HTH A;  4A3B B;  3GTG B;  2VQF Q;  3GD7 A;  4UP7 A;  1NBW A;  2KHS A;  2PZW A;  2F0S A;  2LXK A;  1EY9 A;  2QW7 A;  2RDG A;  1JC7 A;  4KKS A;  4YHH L;  2F0Q A;  4NB3 A;  1P8L A;  1T9H A;  1VQ6 A;  1HR0 W;  5EKL A;  2PNR C;  3UDX A;  3TQY A;  3KLR A;  1Y1W G;  4LF5 Q;  2AKW B;  4UDU C;  4L5R C;  1KXL A;  2PW5 A;  1VQI A;  1CQF A;  4IPD A;  4Q5V A;  1XPR A;  1HNX L;  4M1U B;  3EBE A;  1C7Y A;  1I94 Q;  3MFG A;  4FVM A;  2L4N A;  4NP5 A;  4GZY C;  1R4P B;  4CDD C;  3OW7 A;  4IUP A;  4QUC A;  1N34 Q;  4C3H G;  4KY6 A;  4JI4 L;  2A1A A;  1X3G A;  3G7L A;  3WWV A;  1N36 L;  5LMU Q;  1VQ8 A;  3S24 A;  1TU2 B;  5JEA H;  3NUC A;  4IFD I;  3NTK A;  1ZEQ X;  2M00 A;  5E1F A;  2JA6 B;  2EYJ A;  5E3F A;  1SJE D;  1M8A A;  3PIO A;  1U4L A;  3CRK C;  2ID0 A;  3CXC A;  4JI5 Q;  1QVC A;  1XTC D;  1LTS D;  2E8G A;  1ZYR C;  4HCE A;  2VB3 X;  3HZX A;  4C3I G;  1I6V C;  1PHJ A;  3E9H A;  5KRU A;  1TY2 A;  1J6Q A;  5D65 A;  3NBH A;  3HG9 A;  1GM5 A;  1D5X C;  3F8T A;  5I9P A;  1S40 A;  1MBY A;  3DWP A;  4A3I B;  4IQZ A;  3TBI B;  1B8A A;  5CV9 A;  3S15 B;  3HS0 C;  1V43 A;  2PYK A;  4DKA C;  2VL6 A;  2EJG C;  4YHH Q;  4OXP A;  4DN4 M;  1V1O A;  3J80 L;  3Q8D A;  1IBM Q;  2RVL A;  2DY7 A;  4R1J A;  4F88 A;  5IYC H;  4BS9 A;  2MO1 A;  5IP7 H;  3PO2 B;  2AQ1 B;  2CW0 C;  1A2T A;  3OMC A;  1G51 A;  3M3Y H;  1A3T A;  4A3K B;  3D31 A;  1VQ4 A;  1VQD A;  2B2T A;  2N49 A;  2SEB D;  2QA4 A;  3C1F A;  4BBS B;  4IUV A;  1WD0 A;  3A55 A;  4QY7 A;  2KA7 A;  1A3V A;  5AJ3 L;  1O7L A;  1STB A;  5HY6 A;  1HH2 P;  4ZKB B;  5IGG A;  3J7Y W;  1BCP D;  1GVP A;  1IHZ A;  2LS0 1;  5IYB H;  1N36 Q;  1VQE A;  4KHP Q;  2SDF A;  5IP9 G;  3KLW A;  4IPC A;  4OO1 H;  1I3Q B;  1Z6H A;  3HFZ B;  1MSH A;  3ERQ A;  2FFK B;  1CSQ A;  3VYU A;  3K80 C;  4B9X A;  4BBR B;  2A6H C;  5KYL A;  2B8F A;  4H7B A;  3ULJ A;  1E7Z A;  2IWH A;  5EPJ A;  1YJN A;  1F2L A;  1YI2 A;  2EYP A; 
#chains in the Genus database with same CATH homology
 2C5C A;  1STN A;  5HGT A;  1H9R A;  1CA5 A;  3MXU A;  3BVZ A;  3X3M A;  1K83 B;  1JOO A;  4LK1 C;  3TME A;  1EIH A;  4PQX A;  3A7A B;  2CHB D;  1EWC A;  2F0N A;  3MEH A;  5F2D A;  4ABN A;  3C46 A;  5DNF A;  1JOQ A;  2KEC A;  1TS4 A;  1MGS A;  1EFI D;  5G3L F;  2VB2 X;  2DY8 A;  2JA7 B;  1H9S B;  1UUP A;  2NUC A;  3K5M A;  3NTI A;  2ZXP A;  1ENC A;  4L6T B;  1TWF B;  1PRT B;  1ILP A;  1H9K A;  3KF8 A;  4CJ2 C;  2EDG A;  3SDZ A;  4DAY A;  3A8I E;  1Y1W B;  1E0B A;  5KYI A;  1SE3 A;  3E0J A;  2LKV A;  1ENF A;  1AEX A;  2MPM A;  1JQY D;  4FF1 A;  2K04 A;  3T56 B;  2F0P A;  4G7O C;  3PMF A;  2ENB A;  2K5W A;  5CYU A;  2EYL A;  4C3H B;  2SNS A;  3MWY W;  4HAE A;  4DK1 A;  3I8Z A;  4ZUI A;  4K8J A;  4CGY B;  4XT3 B;  1MSG A;  4X3U A;  2XSC A;  5CV6 A;  4PNY A;  5AFW A;  3FVQ A;  4C3I B;  2R92 B;  4KI0 A;  1J9O A;  3TZU A;  3J81 L;  4QB4 A;  2NTS A;  3IL8 A;  1CFM A;  5KNC A;  1EY7 A;  1YNN C;  5K36 G;  2WII B;  3SE0 A;  3Q22 A;  3BDL A;  4OL7 A;  2KJX A;  3SR1 A;  3NK9 A;  1SYB A;  3NSW A;  2F0T A;  4NDX A;  4QUF A;  3DWA A;  3K57 A;  1TWC B;  2AWO A;  2F0J A;  2G9H D;  3KLS A;  1G2T A;  1DOM A;  4A3M B;  3A56 A;  2BDO A;  2A68 C;  4MN3 A;  2K32 A;  4N9T A;  1TR5 A;  1SYC A;  4YIJ A;  1SEB D;  1Q1E A;  3FEW X;  2KVM A;  3S2H B;  4IUR A;  5JPN C;  5ELE A;  2OF1 A;  1SAP A;  2E75 C;  2K5D A;  4RKB A;  3EVQ A;  4WJW A;  4LMQ D;  2F0E A;  3UI2 A;  1Q1B A;  1IW7 D;  2HUG A;  1LAC A;  2XIW A;  3M7N A;  3VR6 A;  1KTK A;  1EU4 A;  4QCL A;  2F0H A;  5LL6 S;  2FMC A;  3K5N A;  1Y1V B;  3K7A B;  4KKU A;  2J7Z A;  1GUN A;  1JOK A;  2TMP A;  1AP0 A;  3N6R A;  1STY A;  3D6W A;  3L9A X;  3X3N A;  1WTW A;  2LFN A;  2K28 A;  2EVB A;  4HMJ A;  2QEJ C;  4IUU A;  5FLX L;  1HFN A;  3VYT A;  5CV4 A;  2M2L A;  2B2U C;  5COR A;  1LTI D;  3P75 A;  1W6J A;  2EY2 A;  5JOB A;  5DEH A;  2PZT A;  5CBA E;  1RJT A;  1CQV A;  1IKM A;  2LY7 A;  5D14 A;  2F0O A;  3PUZ A;  1TT2 A;  4ZAI A;  3FRP B;  2PW7 A;  1IL8 A;  5J22 A;  5C3X A;  2DNC A;  2QIL A;  1GUO A;  4C1N K;  3Q0A A;  1HRJ A;  1U9R A;  2PZU A;  5DM7 3;  4HCS A;  3M4O B;  3LWE A;  2EYH A;  2NN6 G;  1UAP A;  2NTT A;  4CBV A;  4XTC S;  1RF2 D;  2D62 A;  2RBM A;  5C4X B;  1GOZ A;  1JWM D;  3WOF A;  1FYC A;  1I4P A;  3TSS A;  1YNN D;  1JE4 A;  1VMC A;  1B50 A;  2JEB I;  4ULL A;  2H4O A;  3U9O A;  4RGM A;  1MI2 A;  3NP8 A;  1L0X B;  2KCN A;  1F9R A;  4PV1 C;  4C56 C;  2B2V C;  1NCV A;  5LHY 1;  3G6J B;  1A2U A;  1ICW A;  1LT6 D;  1K8M A;  2RDF A;  2EY1 A;  3I4M B;  2A68 D;  1CTM A;  3WOE A;  3GP7 A;  1SYG A;  4I7Z C;  4S3S A;  2JP1 A;  3I73 A;  2JA5 B;  1SNP A;  1S5F D;  4K6D A;  3D4R A;  5CC4 A;  3S1Q B;  3K58 A;  1B9N A;  2RSN A;  4FF4 A;  1JR0 D;  1GJX A;  2HQE A;  4XQJ A;  3E6Z X;  3HP3 A;  2L11 A;  4ZLT F;  2A5H A;  2F4I A;  2WKD A;  1VF7 A;  3D4D A;  2MP1 A;  5EBC A;  1Z47 A;  1PTO B;  1KDC A;  1ENA A;  3NTH A;  1I6H B;  1LTT D;  1T5X D;  2AWN A;  2B2W C;  3Q6S A;  4G7H C;  1D1I A;  4DFA A;  3BDO A;  2FJ2 A;  2F0G A;  4ODG A;  1GHJ A;  4ZRZ A;  2NWG A;  1LV9 A;  4H44 C;  2NN6 I;  3S17 B;  2K7V A;  1F2Y A;  2SOB A;  1LAB A;  2RDH A;  3S14 B;  4OIK A;  1U4P A;  3VR2 A;  1QNU A;  4IAL A;  1PXU A;  3W2D A;  1X3P A;  3M7G A;  5EKK A;  1B3A A;  2CVR A;  3V96 A;  3A8J E;  4H0L C;  1AFP A;  4F87 A;  5KNB A;  3HOY B;  5JEA G;  3EA6 A;  1WTP A;  1LO5 D;  2B63 B;  3L3O C;  3RD4 A;  4IFD H;  3P1H A;  3QIA A;  2QKI C;  4BY7 B;  2PQE A;  3QWN A;  5I2X A;  5C3E B;  1PRT C;  1EWH A;  3Q24 A;  3LNN A;  3I70 A;  4J1M A;  4H13 C;  3U9S A;  1AN8 A;  1GXD C;  1EL0 A;  1BQQ T;  2R61 A;  3E5S A;  1K8O A;  5BN5 A;  3M85 A;  2F1M A;  1HA6 A;  2MGS A;  5C0X I;  1O80 A;  4A3G B;  1A6X A;  2WB1 B;  1SMY C;  4ZQ3 A;  1DCZ A;  2VXW A;  5FOB B;  4KD4 A;  3VA5 A;  4XXE A;  3MXN A;  1OXX K;  2Z4H A;  3FMC A;  1WVL A;  4RCO A;  3VR3 A;  1LLR D;  2KQ3 A;  4OO1 G;  1EOT A;  2F0L A;  5JEA J;  3SXH A;  3C1E A;  3ND9 A;  4FO2 A;  4LAA A;  3NBI A;  2M9V A;  3KK7 A;  4K2K A;  3IFT A;  1ML0 D;  4DF7 A;  4CKB A;  1EYC A;  1QE6 A;  1RD9 D;  1DJR D;  5D3D A;  4ID6 A;  1QNK A;  3FKI B;  2F0W A;  4FYD A;  3SK4 A;  1HHV A;  2G9D A;  2F0K A;  3CU7 A;  4DA2 A;  2NYZ D;  1R4Q B;  4A3J B;  3IKJ A;  4IUN A;  1NR2 A;  4DNT B;  5KGU A;  5C44 B;  1LTB D;  1YNJ C;  2WAQ B;  4R8I A;  2IX0 A;  5KEE A;  4X3K A;  1JCK B;  2L9H A;  4WFN 3;  3NWS A;  2OEO A;  4UAI A;  3BVM A;  2X69 A;  1GUG A;  4FXK C;  2Y0S B;  2EOT A;  2EYM A;  4RGN A;  1BCP B;  1Y69 U;  4IN3 A;  1ET9 A;  4M8A A;  2ZT9 C;  1I4Q A;  1I4H A;  5M5Y B;  1ESF A;  1EQV A;  4CKE A;  1WTV A;  3EFX D;  3QG1 A;  4FNF A;  5K5P A;  2ZXO A;  4EGV A;  4RKL A;  3CHB D;  1IW7 C;  3BYY B;  2F0D A;  1PRT D;  2B2Y A;  5CGK A;  3GQB A;  3SK8 A;  3R2I A;  1TVX A;  1M4V A;  4O42 A;  4K6L A;  4OGQ C;  3DXJ C;  3BYT B;  5IGC A;  3H6M A;  2F0V A;  2I46 A;  3TP7 A;  5I6Y A;  1SE2 A;  4RA8 A;  4EQN A;  1PYW D;  3KBX A;  1BDO A;  3MTS A;  3HGB A;  3OPO A;  1CI3 M;  2EXZ A;  1SMY D;  4KTA A;  2BE5 D;  5I4D A;  1WD1 A;  2D9U A;  1KDB A;  4O1N A;  3J81 E;  1LT5 D;  4U67 3;  1XWE A;  2E74 C;  2R3Z A;  4FF3 A;  2BCO A;  5KND A;  3EJI A;  2NB0 A;  4KY5 A;  3RZD B;  3IFD A;  3MXP A;  2EYF A;  3AMU A;  3CRL C;  1JWS D;  3T51 B;  3ONA B;  2C9O A;  2D2C C;  2B2T C;  1SNQ A;  4JBW A;  1WTO A;  4FXD A;  3BG3 A;  4DGZ A;  1RHP A;  5TSS A;  2WKC A;  2JSO A;  4ZKC B;  2O5I C;  1TY0 A;  4HED A;  1PZJ D;  1G8Z D;  3PUX A;  3TP5 A;  1TQO A;  1KDA A;  3GO5 A;  4Y7N B;  2IJ0 A;  1G2S A;  4IZ8 A;  1CM9 A;  1I4R A;  2E2H B;  1O78 A;  1YNJ D;  2WV6 D;  3I90 A;  3QOL A;  3GTM B;  1B2T A;  3MHB A;  3OWF A;  3SHL A;  5DM6 3;  1QWY A;  3GTL B;  2A69 C;  3PUV A;  1IYU A;  3NQI A;  4TKO B;  4HSV A;  5C5M A;  3FPU B;  1X32 A;  2EPB A;  5NUC A;  2L5T A;  3H3V C;  4DAP A;  4TSS A;  2EE1 A;  2L55 A;  1JWU D;  3TZD A;  1FR3 A;  3MFY A;  1PTO C;  5A2Q L;  3ZYY X;  3SEB A;  1V1P A;  3BZD B;  2X6L A;  3GTO B;  4BA2 I;  2WIN B;  2JA8 B;  3DEP A;  3QO2 A;  4PMB A;  2IW3 A;  2K5Q A;  3AU7 A;  4NKL A;  4AYB B;  2F0U A;  2B8G A;  1STG A;  4BY1 B;  4K14 A;  4KMU C;  4DU9 A;  1IKL A;  2JE6 I;  1EY6 A;  1LTG D;  1Q8I A;  1BNZ A;  2IT1 A;  2R93 B;  2AUJ D;  5C4Z A;  1QG7 A;  5COY A;  5FO7 B;  2XWB B;  2BA0 A;  1H9J A;  4DAV A;  1WTX A;  3I91 A;  4K5X A;  2L12 A;  1S5C D;  2V4D A;  3NXW A;  2O4X A;  1FNU A;  5EJW A;  2HDL A;  2NVT B;  3WDN A;  1TS2 A;  4EVO A;  5IGB A;  4OIJ A;  3GTJ B;  4KJO A;  3HOX B;  1AZQ A;  3KBG A;  2X6G A;  1CHQ D;  3OWE B;  1F2M A;  2BOS A;  4KJN A;  4DXF A;  4X3S A;  3OMG A;  3TP6 A;  1SNM A;  3IAY A;  5FO9 B;  1C8C A;  2HCC A;  1SNO A;  2KOL A;  1HUN A;  2IX1 A;  5ISR A;  5J39 A;  3BS1 A;  3S2D B;  3RZO B;  3PIO 3;  5CV5 A;  1GUT A;  1CT1 D;  2KCC A;  4BA1 I;  2F0M A;  4XYO A;  2HDM A;  3NE5 B;  5IT9 L;  2JYO A;  4ME5 A;  5A35 A;  1DD2 A;  2AQ3 B;  2E76 C;  4QMG A;  2Q8I B;  1C48 A;  1RTO A;  1GUW A;  4QIW B;  4Q0F A;  2WP8 J;  4HR7 B;  4R9W A;  2A69 D;  5E4W C;  2NVQ B;  5ELB A;  1EY4 A;  1D1K A;  4F7X A;  4PMC A;  2PPB C;  4KKT A;  1XX8 A;  2VNU D;  1EY5 A;  3NHH A;  3A54 A;  3GTQ B;  1OXT A;  1HUM A;  5IOD A;  2PCF B;  1KLG D;  3J7A F;  3D8G A;  1TS3 A;  4QF4 A;  3GV3 A;  4K5W A;  1C4Q A;  1D2B A;  1MD2 D;  3S1N B;  1PTO D;  1Y8N B;  3M4Y A;  3JAM E;  2RA4 A;  3K5L A;  2KUM A;  5CBE E;  4IFD G;  2L0C A;  4RWS C;  4RGT A;  1B4O A;  1G91 A;  1PRT F;  2Z4I A;  1EZ8 A;  1ZKO A;  1F77 A;  3PO3 B;  1EIG A;  1W6K A;  4RH6 A;  1EYD A;  5I9O A;  2MHV A;  1BF4 A;  4C1N I;  1PDQ A;  1BO0 A;  4N9P A;  3DMU A;  1HPC A;  3MA2 B;  2K33 A;  2PMZ B;  5C0X H;  4K8I A;  2XNA C;  5E4X A;  2A74 C;  3SK6 A;  3RLF A;  3A7L A;  2F03 A;  4B08 A;  4XIG S;  3TN2 A;  3HRZ C;  1Q90 A;  1ZXT A;  3H91 A;  4KN4 C;  1F9P A;  4DXG A;  4IFD J;  2AQ2 B;  1Q3L A;  4CJ0 B;  1I4X A;  1OXU A;  5J1Z A;  4XYQ A;  2BE5 C;  3D4W A;  1STA A;  1O7Z A;  1PZI D;  2DN8 A;  2OT2 A;  3J80 E;  1BR9 A;  3HEJ A;  1TWG B;  3D3R A;  1LTR D;  1S5B D;  3ITP A;  4XT1 B;  3KUP A;  2XRQ D;  2YYZ A;  1SYD A;  1PFB A;  3LX0 A;  4EQO A;  2LMC B;  4K5V A;  4L63 B;  1II3 A;  3RUZ A;  1TII D;  2IL8 A;  5JVG 3;  1QOH A;  1Y8O B;  2EJF C;  3ND8 A;  4G7Z C;  1PFM A;  1B1Z A;  1B9M A;  5IGE A;  1PMR A;  5IGF A;  4WRD A;  5LL6 X;  1V1P B;  3T53 B;  4V19 0;  2Z8L A;  1S5E D;  2NVX B;  4L8J A;  4XQQ A;  1SBB B;  4BWG B;  5DAU A;  4TRD A;  1QB5 D;  5FK9 C;  5M5X B;  3VYS A;  4FF2 A;  2R7Z B;  4KN7 C;  5ELC A;  1S4Z A;  3C2P A;  3S1M B;  4A93 B;  5M9O A;  2F3W A;  1SSO A;  1SXT A;  1PLF A;  1LT3 D;  5T1G A;  2NBF A;  4NMZ A;  4ZUJ A;  1E2W A;  2ZXR A;  4G4K A;  1Z7T A;  3NPP A;  3J7A V;  2E2I B;  5FO8 B;  1RDP D;  2N88 A;  1KLU D;  2FIN B;  2J4X A;  1SE4 A;  3VR4 A;  5KIX A;  4R8N A;  3VYR A;  1AZP A;  4ZYS A;  2SNM A;  1KNE A;  4A3E B;  3S9W A;  4IUQ A;  2TSS A;  1SFO B;  1CZW A;  1ILQ A;  1CHP D;  3OIP A;  1ET6 A;  2XWJ B;  2EJM A;  2YU9 B;  2F0F A;  2FMM A;  1FGB D;  2MUY A;  1F2Z A;  3PIP 3;  1BUV T;  1NUC A;  3TP8 A;  1EU3 A;  2NZ1 D;  1QJO A;  1TWH B;  4I65 A;  4XQN A;  2JEA I;  4OO1 I;  3P20 A;  1EZ6 A;  3VR5 A;  3PUW A;  3N52 A;  3R8B A;  1RCV D;  2Q8R E;  3CQZ B;  5JVH 3;  2K1B A;  4RFB A;  3DUZ A;  4EQP A;  1I4G A;  3T4A C;  5M5W B;  3R2T A;  1HA5 A;  1F9Q A;  5C6A A;  1F9S A;  2OXP A;  3T16 A;  2JXM B;  3M3Y B;  4NW2 A;  1L0Y B;  2RKS A;  3DM1 A;  2PO4 A;  3O13 A;  4CHT B;  5M3M B;  2F3V A;  2IX3 A;  1VDZ A;  2K03 A;  1G29 1;  3FPP A;  3H09 A;  2DNE A;  2BDN A;  3TDQ A;  3DHQ A;  3H94 A;  1WTQ A;  1JIC A;  3F2U A;  2B2U A;  1QCB D;  1ZYR D;  4HMI A;  4RAU C;  2O5J C;  2XVS A;  1D5Z C;  4DNR B;  1B53 A;  1NSN S;  3P7J A;  1HTL D;  1WCM B;  1TWA B;  5EBD A;  3NQT A;  5IIF A;  3MAQ A;  1EY0 A;  4RHR A;  2ICE C;  1PTO F;  4G57 A;  2BA1 A;  5JJZ A;  4C3J G;  2A73 B;  4B9W A;  4E6I A;  2CW0 D;  4A3D B;  4MIU A;  3PV0 A;  3OOC A;  1BBX C;  4DK0 A;  1S5D D;  3FDT A;  5CV7 A;  3RMH A;  1SYE A;  1VCI A;  4V0B A;  5EGT A;  1CA6 A;  5A2Q E;  1HCZ A;  1SND A;  4KHZ A;  5EKI A;  1KAA A;  2B39 A;  2EY6 A;  2GA4 B;  3S1R B;  5I6W A;  1EQT A;  1A3U A;  4PMW A;  2Q8T A;  5EPK A;  1OXV A;  5BN4 A;  2A6H D;  5CMD A;  1GHK A;  1PFN A;  2B2Y C;  2FHT A;  1SJH D;  2K05 A;  3QJY A;  4LJZ C;  2QDB A;  3MVV A;  1OXS C;  2F0I A;  3R93 A;  1RTN A;  2B2V A;  1UEA B;  5FLX E;  1J8I A;  3Q23 A;  4K2L A;  1LT4 D;  1WTR A;  5K36 H;  1NAP A;  1ROD A;  1RKN A;  5CV8 A;  4J8Q A;  3K59 A;  5I2Y A;  1U4M A;  3A8K E;  1G6Z A;  1B44 D;  3HOW B;  2A6E C;  4U68 A;  1KAB A;  3K6O A;  4XDX A;  3HOZ B;  3MZ5 A;  4HSP A;  2R6G A;  3SK5 A;  1I50 B;  2I07 B;  2E2J B;  1BOS A;  3I4L A;  2RSO A;  1FD7 D;  2KED A;  5C4H A;  2EYO A;  3R3O A;  1FNV A;  1T5E A;  5C4J B;  1ESR A;  2MJ8 A;  3BDC A;  2O2L D;  1D5M C;  1SNC A;  3I4N B;  4MHE A;  5BN3 A;  2B2W A;  2IPK D;  1U4R A;  2XRS D;  4TQU S;  2CQA A;  5FKA C;  1DOL A;  5IT9 E;  1CK1 A;  2K6A A;  3QB3 A;  1PTO H;  3URY A;  3OSO A;  4KY7 A;  1LTA D;  3K5O A;  3AB9 A;  5IGD A;  3HKZ B;  2VUM B;  3EQL C;  5G3L D;  3T13 A;  4RHS A;  3DEO A;  3LWU A;  5IOC A;  2J0T D;  2D5D A;  4KV6 A;  3ERO A;  3I3C A;  3V05 A;  3I72 A;  2AUK A;  1NR4 A;  5C3W A;  1H9S A;  1X3Q A;  2QF7 A;  4FXG C;  1H9M A;  2WAC A;  4C2M B;  2H1E A;  4F8M A;  1SYF A;  1STE A;  1EEI D;  3S16 B;  1OO9 B;  4Z9C B;  1HQR D;  3GV6 A;  1HTP A;  4JK1 C;  5ELF A;  4FP5 D;  1HQM C;  1TS5 A;  4WOR A;  2K01 A;  4C3J B;  3OIQ A;  1VF5 C;  1GUS A;  1CZG A;  1E2V A;  4KK7 A;  1Y8P B;  1TKW B;  1JB3 A;  1QIL A;  1V8Q A;  1PZK D;  1EY8 A;  1XYI A;  1BCP F;  1FNW A;  3PUY A;  3W3A A;  3HOU B;  1ONL A;  1DM0 B;  2E2D C;  3D6C A;  2NN6 H;  1BXT A;  2NVY B;  1AW7 A;  3L7Z C;  1DON A;  5T1I A;  3OHX C;  5C0X G;  1JOR A;  4ILW A;  2XN9 C;  1KNA A;  1DOK A;  1E2Z A;  1R9T B;  5M3F B;  4OHJ A;  2QCP X;  1SDF A;  3K0Y A;  3V2T A;  2EY5 A;  4RGO S;  3C3L A;  1VMP A;  4X3T A;  1HXY D;  4RCN A;  2HCI A;  1UNS A;  3MC0 B;  1STH A;  1XXG A;  4A3F B;  2A6E D;  2N55 A;  1IYV A;  5D3I B;  1EYA A;  5HUR A;  5JAV A;  3VA7 A;  3HOV B;  3MXG A;  1BCP C;  1O7Y A;  3DWQ A;  3NWT A;  3GTK B;  3QOJ A;  1EEF D;  4KHV A;  4IUT A;  2Z1C A;  3SVM A;  1D6E C;  5ELD A;  5C5L A;  4CKC A;  5JPM C;  1HFG A;  4P2C B;  2L1B A;  3GTP B;  4J6H A;  2KEE A;  3BVG A;  3CKI B;  1DYQ A;  3JAM L;  5EQ0 A;  3KLS X;  3H0G B;  2ICI A;  1Q12 A;  4ZK9 B;  5C0X J;  1A15 A;  4HN7 A;  1DXM A;  5CR3 A;  2EZV A;  4CJ1 B;  4KD3 A;  2RQX A;  1DZ1 A;  5EPL A;  4HTH A;  4A3B B;  3GTG B;  3GD7 A;  2KHS A;  2PZW A;  2F0S A;  1EY9 A;  2RDG A;  1JC7 A;  4KKS A;  2F0Q A;  5EKL A;  2PNR C;  3KLR A;  4UDU C;  2PW5 A;  1CQF A;  4Q5V A;  4M1U B;  3MFG A;  4FVM A;  2L4N A;  4NP5 A;  4GZY C;  1R4P B;  3OW7 A;  4IUP A;  4QUC A;  4C3H G;  4KY6 A;  3G7L A;  1TU2 B;  5JEA H;  3NUC A;  4IFD I;  3NTK A;  1ZEQ X;  2M00 A;  5E1F A;  2JA6 B;  2EYJ A;  5E3F A;  1SJE D;  1M8A A;  1U4L A;  3CRK C;  2ID0 A;  1XTC D;  1LTS D;  1ZYR C;  4HCE A;  2VB3 X;  3HZX A;  4C3I G;  1I6V C;  5KRU A;  1TY2 A;  5D65 A;  3NBH A;  3HG9 A;  1D5X C;  5I9P A;  1MBY A;  3DWP A;  4A3I B;  4IQZ A;  3TBI B;  5CV9 A;  3S15 B;  2PYK A;  1V43 A;  3HS0 C;  2EJG C;  4DN4 M;  1V1O A;  3J80 L;  2RVL A;  2DY7 A;  4F88 A;  4BS9 A;  3PO2 B;  2AQ1 B;  2CW0 C;  1A2T A;  3OMC A;  1A3T A;  4A3K B;  3D31 A;  2B2T A;  2SEB D;  3C1F A;  4BBS B;  4IUV A;  1WD0 A;  3A55 A;  2KA7 A;  1A3V A;  1O7L A;  1STB A;  4ZKB B;  5IGG A;  3J7Y W;  1BCP D;  1IHZ A;  2LS0 1;  2SDF A;  4OO1 H;  1I3Q B;  1Z6H A;  1MSH A;  3ERQ A;  2FFK B;  3VYU A;  4B9X A;  4BBR B;  2A6H C;  5KYL A;  2B8F A;  4H7B A;  2IWH A;  5EPJ A;  1F2L A;  2EYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...