5CV6A

Crystal structure of staphylococcal nuclease variant delta+phs v66h/i92e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/I92E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv6A00
1AEXA 2WACA 4YIJA 5EGTA 4KHVA 4KTAA 4IALA 4K5WA 1EY6A 1EY7A 1TQOA 4S3SA 1EY4A 4ZUIA 1SYBA 4QMGA 2F0WA 1KDBA 3TMEA 1STBA 4DFAA 3MVVA 3MHBA 4KY7A 1SYEA 2PW5A 5JAVA 5I6WA 4MIUA 3D4DA 4EQNA 4NDXA 4ME5A 1RKNA 5F2DA 2F0DA 3D4WA 4R8NA 5IGBA 2SOBA 3E5SA 5CV5A 4ZUJA 5KYLA 5CV8A 2O4XA 2EY2A 4K5XA 5IGEA 2EYLA 3QOJA 4KJOA 4NMZA 5CR3A 5DAUA 3SK6A 3D6CA 1SYFA 1ENCA 5E3FA 5KIXA 2PW7A 5J1ZA 5KRUA 1EQVA 2F0LA 5CC4A 3EVQA 4N9TA 4LAAA 3ITPA 4K5VA 4EQPA 5CV7A 2RBMA 5CV9A 2HQEA 4K8JA 2RDFA 3S9WA 3PMFA 3OWFA 4IUNA 3SK8A 2PYKA 3BDLA 3MZ5A 5I9OA 1SYCA 1SYGA 4K6DA 4F8MA 5EKKA 5I9PA 5IGDA 3QOLA 4RKBA 2F0IA 3SR1A 4ODGA 3MEHA 3TP8A 1KDAA 3NQTA 4K2LA 2F0JA 1EY0A 1KABA 2F0NA 4G57A 4QF4A 1JOOA 5IGFA 2F0MA 3D8GA 3NHHA 4KV6A 4PMCA 5CV4A 2EYFA 1EYAA 5CV6A 4B9XA 5C3WA 2SNMA 2F0VA 4WORA 3DMUA 4PMBA 3SHLA 4TRDA 1IHZA 3BDCA 5DEHA 5NUCA 3OMCA 2OF1A 2F0GA 3LX0A 1U9RA 1STGA 4J1MA 2EYMA 3T13A 2EYHA 5J22A 1F2ZA 3VA5A 3NXWA 1ENAA 1A2TA 2OXPA 3P75A 4K8IA 3C1EA 1JORA 2ENBA 3TP5A 2PZUA 1SNDA 1STYA 2F3WA 3V2TA 4PNYA 4J6HA 2EY5A 2RKSA 4WRDA 4DU9A 4HMJA 1A3TA 3TP7A 3DHQA 1F2MA 4IZ8A 1SNQA 1TT2A 4K2KA 4ZQ3A 4K14A 3TP6A 5IOCA 5I6YA 1KDCA 3QB3A 4E6IA 2EY1A 1KAAA 3OSOA 1A2UA 4H7BA 5EKLA 1NUCA 4KJNA 2KQ3A 4KY5A 4F7XA 2F0UA 2PQEA 3EROA 3NP8A 5IGCA 1A3UA 1JOKA 1STNA 4EVOA 5C5LA 1EYDA 3SK4A 1STHA 3HEJA 4I65A 5KEEA 5KGUA 2QDBA 2F0EA 3EJIA 5C3XA 5J39A 5JOBA 3RUZA 5CGKA 5ISRA 4ID6A 2F0SA 1SNOA 1SYDA 5K5PA 2NUCA 1TR5A 1SNMA 3U9OA 2M00A 2PZWA 1EZ8A 4RKLA 5E1FA 5C4ZA 5C4HA 4N9PA 2F0TA 5IIFA 3R3OA 1EY9A 4KY6A 3HZXA 3P1HA 4OL7A 2EYJA 4EQOA 4NKLA 2EYOA 4KD3A 4DGZA 4B9WA 3NUCA 3OMGA 3SXHA 3H6MA 1EYCA 1EY5A 4NP5A 5C6AA 1II3A 5KYIA 4DF7A 2OEOA 1SNPA 4HTHA 5HGTA 2SNSA 1SNCA 2PZTA 5IODA 2EY6A 2KHSA 3NK9A 4HMIA 4KD4A 1F2YA 2F0KA 5M9OA 1NSNS 1EY8A 2F0PA 3MXPA 3C1FA 2F0HA 2EYPA 4QB4A 5C5MA 5HURA 1JOQA 2F0QA 5IGGA 3ERQA 2F0OA 2F3VA 1EZ6A 3SK5A 1A3VA 2F0FA 1STAA 3T16A 2LKVA 2EXZA
chains in the Genus database with same CATH superfamily
3GTKH 1ZXTA 4DNIA 2CW0C 4DK1A 4DUYL 4BY7B 1JWUD 5KNDA 5C4XG 3F2UA 3TMEA 4HN7A 3GTGB 4LF5Q 3H0GG 2RQXA 2KJXA 4R8IA 1K8GA 4IUUA 1A8VA 1BCPF 2K05A 4JI7Q 1BKBA 2RCNA 4A3LH 1EQTA 1NBWA 3H0GH 5C44B 2RHSB 2EY2A 2VW9A 3GTPH 1SJHD 4B3ML 5D14A 2IX3A 5J1ZA 3A5UA 2B2TC 1PH5A 4A76A 1A15A 3EVQA 4IPCA 2K5NA 2K28A 2Z4HA 4A3DB 3C2PA 4GLXA 4A3KB 4I7AA 1KC8C 3DEOA 1EY0A 1KABA 2FJ2A 2BDNA 1XXGA 4IOAA 4YCUA 4B9XA 4P2CB 2Y0SE 2D5DA 4KN7C 5IT9L 3RZDB 2YU9B 2IX0A 4MN3A 4UDUC 1UUPA 1R4QB 1K8OA 4JYAL 1HUNA 2H1EA 1K73C 1SRUA 2EQSA 1VQ7A 2JA5H 2EY5A 4U673 2N8NA 4IJLA 3X3NA 1QUQA 1TS4A 3QB3A 4A4IA 2FMMA 1H9SA 1L0XB 5EKLA 1E24A 1FGBD 3OW7A 3FPUB 1ICFB 1AW7A 3S2DB 1BCPD 4DAPA 1V1QA 1J5EL 2D62A 1LM0A 4YHHQ 2L5TA 3HOVB 2X69A 1X32A 5JOBA 3K5OA 1CKNA 2YYZA 3SGIA 3ZJYC 4JYAQ 4C3IH 4V0BA 1FR3A 2OQKA 3P1HA 3M4OB 3GTMB 2Z4IA 4BBSH 4TKOB 1BBXC 4B9WA 3CPFA 1EYCA 3EA6A 2R92H 1ASZA 1NSNS 1CUKA 4YWKA 1HJPA 4KKSA 1STEA 5IY0A 1C7YA 4WFN3 3FKIH 2ES2A 1K8AC 2AUJD 3NTHA 3OYYA 2NTSA 3K5NA 3T16A 1KD1C 2WB1B 1HZBA 1AEXA 2JA6H 5EGTA 5EJWA 3V05A 1PRTB 3H09A 1JCKB 5BN4A 2R93G 4CJ1B 1ESFA 4JI6Q 1VQPA 3MVVA 1R4PB 3G6EA 1GUNA 1PH9A 1DYQA 2JA5G 4PQXA 3CCEA 1CHPD 3D4WA 1CKNB 4EGVA 1AH9A 3VA7A 1HFGA 4QCLA 4C3HG 4L8JA 3TSSA 4A3EB 2K6AA 1K83H 4A3MG 3AYHB 1QVFA 1E7ZA 1SROA 3GO5A 3CCVA 4DR4Q 1SE8A 2CH4W 1YNJC 5GAHC 1B53A 4ZCKA 3MXNA 4C1NK 2XWJB 1HZCA 3OIQA 3D8GA 1LTSD 2SNMA 2VZAA 1ILPA 4C2MH 1HQMC 3S1QH 3PUYA 4DNRB 2XN9C 5E7NA 3HOZG 2PNHA 2WIIB 2F52A 3D3RA 1A2TA 2EDGA 4BY1B 4PNYA 4K0KQ 4H44C 4MHEA 1IZ6A 2LXKA 3S15B 2AUKA 1I4XA 2N49A 4KKUA 3L2PA 5M5YH 5IYBG 2M2LA 4H7BA 1K0SA 2XWBB 4A3CH 1PA6A 4L5TA 2UUBL 4X65L 1TU2B 1U4PA 1E1TA 3PIO3 3R3OA 5IYDG 4OL7A 2K5WA 4DR5Q 4KD3A 1F9QA 4DGZA 1FNVA 1SR3A 2KCCA 3PIPA 5JVG3 1II3A 2CW0D 4ZK9B 3M4PA 4IURA 1LT3D 4KD4A 3NK9A 3QJYA 3S1NB 3STBC 1SEBD 2AWOA 3PF5A 4IQZA 3PO3G 3J80L 1IKLA 1PZID 1VDZA 1YIJA 2GN5A 2WACA 2UXDL 1ET6A 3I4OA 1XMQQ 1X9NA 1SLJA 1AE2A 3FDTA 1HNXL 2F0WA 1EEFD 2E2DC 3STBD 4XT1B 1X3EA 2DUDA 1ML0D 1SSOA 3S1NH 3CMEA 2HHHQ 1CQFA 1PRTC 4JPBW 1TWAH 2LSSA 4UP9A 4K5XA 1DZ1A 2QW7A 3MEFA 2CCZA 2AQ3B 5FLMG 2WAQE 2QF7A 4LF4L 4OO1H 4JBKA 4HJ7A 5AJ3Q 3HKZG 1Z6HA 5C0XJ 2Q2IA 1Y1WH 3I4MG 4XQNA 2QILA 2NZOA 5M3MB 1IBKQ 1L0YB 4IUNA 2KEDA 3F2CA 4LUZA 5KNCA 4F8MA 3GTJH 4DV1Q 3GDEA 1JE4A 3SR1A 4ZLTF 1PFNA 5EPJA 2F0JA 2F0NA 3HOWH 5IGFA 3I2ZA 2A6EC 2C5CA 3RLNA 1XNQL 4A3FG 3BVGA 1I3QB 3KYHC 2F0GA 3G4SA 2WINB 2EYMA 4IUTA 5LL6S 3T13A 4IJHA 1NE3A 1YJ9A 4LFBL 1HXYD 2EJFC 5CBAE 4LF6L 4AYBE 1QZGA 4K6LA 2M9VA 4DR5L 1PDQA 1PRTD 3PQIA 2HCCA 2O5IC 2BDOA 1I6HB 1YJWA 4E6IA 1KAAA 1PVOA 3FHWA 2MQHA 4KN4C 1DCZA 4KY5A 2L11A 3Q23A 1I94L 5IGCA 1YI2A 4EVOA 5C5LA 4A3DG 3HEJA 5KGUA 1S3OA 2JJQA 4CDCC 3S14B 5FO9B 2FFKB 3TREA 2L15A 3OPOA 2K5VA 3KUPA 3G48A 2EYJA 4X6AH 4NKLA 4MTNA 4FYDA 3KBXA 2B63B 2UXBQ 5C6AA 4RCNA 4BBSG 1JICA 3D31A 3J7AF 1O7ZA 2RF4A 1DJRD 3JC66 5HURA 5IYCH 3S2HB 1TWHB 2XGTA 3AFQA 4X62L 3JAME 3M85A 3OTOQ 4JI0Q 4CJ2C 3TQYA 5M3FG 2Z6KA 1ZYRC 1OXVA 1EFID 3VYSA 4ZUIA 1HNWQ 1SYBA 5K36H 4A3BB 3HOYH 3DWQA 1PLFA 2QCPX 1YHAA 5LHY1 2R3ZA 1WTXA 1WI5A 2AQ1B 3S1RH 4C3JG 3VYRA 1B70B 1ONLA 4RCOA 4XT3B 5C0XG 1XPOA 1VQHA 3S2HH 2HIVA 1TY2A 3QOJA 3SE0A 4DV6Q 3JAMi 2CFMA 1QVCA 3SK6A 1GUGA 2L0CA 4KLKA 3VYTA 4N9TA 1LT5D 4K5VA 4UHVA 4EQPA 4HIDA 2N78A 1V1PB 1L0WA 5FOBB 1ZKOA 1SYCA 1SYGA 3K6OA 4RMFA 3S15H 1T5XD 2JA8G 3MEHA 2KECA 1HZ9A 2DY7A 2WB1G 5CV6A 4DV7L 4DK0A 2I5MX 1R9TH 4QY7A 1DOKA 2OF1A 3MFGA 1EWHA 1JT8A 4HEDA 1VQDA 3C3LA 2JA5B 3ND8A 3H15A 1SNDA 4GNXA 3J7A5 4A3DH 2JP1A 3FVQA 4DU9A 1IBKL 4P71A 1QZHA 3WOFA 1J9OA 3MXGA 4JV5L 1EIFA 4IFDJ 4C1NI 1I50H 5BN5A 2MHVA 1UE7A 3HOZH 4KHPL 1JB7A 1UNSA 2F4VL 4A3MB 1NMGA 2RSNA 1J5EQ 1HNZL 3U9SA 4ID6A 1TS5A 4QJFA 5K5PA 2UXCQ 1VQKA 1SN8A 2WAQB 3E9HA 4WJWA 4N9PA 2K5HA 4HAEA 4JI8Q 2B2VC 3HOZB 2BCOA 1W2BA 2EY6A 3P20A 4KKTA 3A0JA 2D0PA 1JB3A 2DY8A 4IFDH 4LFAQ 3CU7A 3M4YA 1Y1WG 3QIAA 1Q90A 2PI2A 4A3JB 4K5WA 2ZTDA 2NN6G 1A62A 1PYWD 1L1OC 1TS3A 2A6HD 1M8AA 3DWAA 1ENFA 1STBA 4KY7A 1EUJA 3RR5A 1LACA 1Q3LA 3HOUG 5CV5A 3PF4A 3PO2G 4B3MQ 4J15A 3RZOB 3I56A 3MXNB 5FJ8G 3FKIB 1PZJD 4CDEC 3M9BA 4XYOA 1FD7D 2K14A 4L6TB 1K83B 1GD7A 1DM0B 1N33L 5EPKA 3J81i 2B3GA 1C9OA 1PYBA 4X3UA 3AFPA 2UXCL 4DR7L 3ITPA 2PMZE 2O5JC 2RBMA 1E0BA 2NVQH 3CCJA 1G2SA 2IY5B 5CV4A 3U4ZA 1EYAA 3PSIA 1VQAA 2YTYA 4WORA 3W3AA 1IHZA 5GROA 4HJ5A 5FKAC 4X3TA 3R93A 4FDBA 3GTOH 1N33Q 3CCUA 1KNAA 1KRTA 3KF8B 1W6JA 1CQVA 5CBEE 2A6ED 2OWOA 4A3BH 1A6XA 3A8KE 2QDLA 3V2TA 4CBVA 5DLQE 1RHPA 3ULLA 2DJFC 1F2MA 3BVZA 4K2KA 2AKWB 3C46A 2PI2E 3NTIA 3HOYG 2E2HB 1RIPA 2J7ZA 2FXQA 3DXJC 1VQ4A 5M3MG 2NN6H 5M3FH 2OCEA 4FNFA 2ZM6Q 1LT6D 2EJGC 3T51B 4A3KH 1S5DD 1U4MA 1YZ6A 1XNRQ 1D5XC 1O7IA 2HIXA 1FJGL 4BY7G 1TWCH 1SFOH 3OWEB 3DM3A 2B63H 5C4XB 1Z47A 5IYDH 3C1FA 3H0GB 1HTLD 2F0HA 4R4OA 4GZYC 1KXLA 1U4LA 2ZJPA 2F3VA 4X66Q 3SK5A 4QGUA 4DV3Q 2G9DA 2NZ1D 3RLOA 4X62Q 2LXJA 1G2TA 5M5XH 5JPMC 1SYEA 2NBFA 3M4QA 3WDNA 1KIXA 1YHQA 5F2DA 4R8NA 3L7ZC 1RTOA 3KJPA 2YU9H 4JI3Q 5CMDA 2R93H 2VUMH 1TWFH 4NW2A 2X6GA 2EIFA 2IWHA 4ULLA 4DR3L 4GKKQ 5DM73 2NVYH 1VQGA 4ZKBB 1HNZQ 1JMCA 4BBSB 1GXDC 5CV9A 4LF9L 1IYUA 1GO3E 2K32A 4RGOS 4A3FH 5EQ0A 3NENA 2HUGA 4TVAB 4OEMB 4AH6A 1JJCB 1KL9A 1TS2A 3NQTA 1XMOQ 3NBHB 4NXML 1VCIA 4KHPQ 4KV6A 2KCNA 4DV0Q 3BVMA 5DEHA 1U0LA 5JEAH 1M1KC 2FHTA 3MWYW 1Y8OB 5C4JB 4DAMA 2VQEQ 3NXWA 4OIKA 5C3EG 1IBLQ 4TSSA 2F3WA 2ZT9C 1GUOA 3MA2B 4OONA 3K57A 5D3DA 1MIUA 2EPBA 3CW2C 2YTXA 3M4OH 2E74C 1QVGA 4K14A 3T1YL 5I6YA 3CCMA 1QCBD 4JI5Q 2JA7G 2B2YA 4Y52H 4XQQA 4F7XA 1D7QA 1X56A 3NP8A 5FK9C 1EOVA 1IW7D 1G6PA 1NMFA 2G5DA 2EOTA 1JQYD 4AQYQ 3AU7A 1EIYB 5GQOA 1GKHA 2PCFB 1SNOA 4L63B 1PH2A 2J4XA 3OHXC 4N8X1 1LTGD 1BNZA 1DONA 4FVMA 1VQCA 1UE1A 1MGSA 3CQZB 3T56B 2OEOA 5IODA 1XYIA 2E76C 2NZHA 4Z9CB 3FP9A 1J8IA 3F2BA 1GHJA 4OXPA 1QWYA 3TZDA 5T1GA 1B50A 1EEID 3LGJA 2A1AA 2JN4A 4RGMA 2YV5A 3WWVA 4IALA 1JJ2A 5ELCA 1B8AA 5JPNC 4DV5Q 5EBCA 3J81j 2ZXRA 3K8AA 4ZYSA 2B8GA 3PV0A 2Z6BA 2VXWA 3K7AH 4R4TA 1EWIA 2MP1A 5IGBA 4JOIC 3D6WA 2WAQG 2H5XA 5CR3A 3NEMA 1GOZA 4CKBA 5KRUA 1D1KA 2F03A 2F0LA 2HDMA 2TSSA 3L0OA 2Z8LA 1RF2D 1F2LA 3IFDA 4JC0A 3BDLA 3F8TA 4K6DA 1CT1D 3P7JA 3GTGH 4RKBA 1TWCB 3ZYYX 3I8ZA 1H9JA 1NY4A 4M1UB 1X3PA 3I7FA 1L1OA 1EQRA 3DMUA 4OHJA 1D6EC 4JG2A 4B3SL 1G8ZD 1HZAA 3BDCA 4A93B 5NUCA 4KMUC 5EBDA 2QEXA 1M90C 2C35B 4LFCQ 4LFBQ 1ENAA 1PFMA 3P75A 1LO5D 3C1EA 5HGQA 2ICIA 2PZUA 4QL5A 1LTAD 1AN8A 3CC4A 2NB0A 1CKOA 2WP8J 1CA5A 3KF6B 1LTLA 1N34L 2B2VA 4DAVA 2HDLA 1A2UA 1NUCA 3A7LA 3EROA 1R9TB 4UPAA 5BN3A 3HOXG 5LMUQ 1EQQA 3SK4A 2JK8A 3NBIA 2K52A 3GD7A 5KEEA 2E2IH 4DV4Q 4WJ3M 2R92G 2FMCA 2K75A 4LF4Q 2NUCA 2K5DA 1PV4A 5T1IA 5FLXE 5C4ZA 3GTJB 5FO7B 2LMCB 2ID0A 1AFPA 1OO9B 1X6OA 4G7ZC 2O2LD 3M7GA 5E4XA 1PRTF 5CORA 4DXGA 2SNSA 3UI2A 1N32L 3I55A 2Q8IB 3M7NA 2MO0A 5LMUL 2EYPA 1C8CA 2F0OA 3RZDH 1B44D 1HR0W 2WFWA 5L37A 2EXZA 1WD1A 2K1BA 3HOXH 1EY4A 1MI2A 1VQOA 1SE4A 1FGUA 5I6WA 4NDXA 3I4MB 1QE6A 1K28A 2F0DA 2D0OA 5IWAQ 1CA6A 4FXGC 4B3SQ 1PH4A 4MZ9A 4RHSA 2Q2UA 5KIXA 3A74A 2QGQA 4HJAA 2L12A 2F3IA 4GN5A 3DEPA 1BCPC 1YBYA 3BYYB 2JEAI 2I46A 5D65A 2F0IA 1N36L 4OWTB 1OXTA 4G57A 4ALPA 3NHHA 4QUCA 5IP9G 1B1ZA 5A2QE 3HOWB 3NQIA 3TS0A 1A0IA 1H9MA 1CM9A 2KOLA 4GOPB 3I90A 1Y8PB 2IJ0A 2ASBA 2BE5D 2A74C 3K5LA 1E2ZA 1AZPA 5FLXc 3S14H 2MNAA 2K03A 3E3XA 3CPWA 1DXMA 4C3HH 4DAYB 1SJED 1VQLA 1LLRD 1CI3M 1IL8A 4ZQ3A 3TP6A 4OX9L 2YTVA 1NCVA 3NWSA 1KAWA 3GTLB 1RTNA 3GTQB 1B3QA 1JOKA 3G7LA 4LWCA 4C2MB 1BQQT 1EYDA 2XIWA 1C0AA 3I72A 4DUYQ 4I65A 2B63G 3GTOB 1YNND 3E9IA 4R4CA 3U9OA 3PO3H 2A69D 5IP7H 3K5MA 3RD4A 1HRJA 3G71A 1HUMA 1EY9A 1TY0A 3HFZB 3OW2A 2HT1A 1DD2A 4XXEA 4GS3A 3NUCA 3OMGA 5M5WH 1LV9A 1EOTA 1QB5D 2Z6KC 4FO2A 2ALYB 3S1RB 2ZM6L 1G91A 3K81C 3KLSX 3CCRA 4L5QA 5C5MA 2A69C 5I2XA 2A5HA 3EQLC 5BR8L 2KUMA 4C3JB 4U68A 2F0FA 1STAA 1TWHH 4FXDA 3U4VA 2JA7B 3W2DA 2KHJA 1B7YB 2CHBD 1VQ8A 1YITA 1KLUD 4HJ9A 4QMGA 2R7ZG 1Y8NB 1KTKA 4P74A 4DR7Q 4DFAA 5IT9c 1YNNC 4OWXB 2F4IA 2VUMG 2AQ2B 4MTKA 4IUQA 3J81c 3CMAA 1ET9A 2R7ZH 4KJOA 3BS1A 4NMZA 4CDFC 1YJNA 1EIGA 1PYSB 3KDFB 4C3JH 1ENCA 1K0RA 5ELNA 1EQVA 1JE5A 1KRSA 4FXKC 1HPCA 5CV7A 3ULJA 2E75C 1S5BD 3PMFA 1ILQA 2VQFQ 1WTPA 4JBMA 4PZ6A 2UU9L 3L9AX 1HFNA 1YHBA 1VQIA 1S5CD 1O7LA 2B2UC 3V96A 4HCEA 1PZKD 2EYFA 4YCVA 5C44H 3GP7A 1XTCD 2G9HD 1BCPB 3CF5A 3CRLC 2R7DA 4F88A 4A3MH 1SE3A 3S2DH 5C4JH 4YY3Q 4RH6A 1U9RA 4I7ZC 4J1MA 3HRZC 4NXNQ 3VA5A 2VNUD 1PXUA 2ENBA 2EE1A 2K01A 1WTRA 3VR3A 5JJKA 2E5LL 2EVBA 1PH8A 4GOPC 1WJJA 3FMCA 3DHQA 3E0EA 4AYBG 1PTOC 1SNQA 2NN6I 1JWMD 4LF5L 2QKIC 3URYA 1LABA 2MO1A 4Q5VA 1CFMA 3Q8DA 2RDHA 1MBYA 1PFBA 2PQEA 1WTOA 4BS9A 2F4VQ 1E2WA 4YWMA 3FEWX 1X65A 1VMPA 2F0SA 1PTOD 1I4QA 1YVCA 3SDZA 2JA6B 4ABNA 4DR6L 4POFA 3BZCA 4JI8L 4R4QA 1Y1WB 1MSGA 4N8FA 2PMZB 5ELDA 4A93G 2Q8RE 3HKZE 5GADC 2CKZB 3KOJA 1GUWA 4JI7L 1SNCA 2PZTA 3HG9A 2HD3A 2KHSA 4HMIA 3J7AV 1XWEA 1IL2A 1MSHA 3X3MA 4HIMA 4IPHA 3VR4A 1LTTD 1I3QH 2ZTCA 5IT9E 1WTHA 4LFCL 2L4NA 2PZWA 3HOUB 3PO2B 1B3AA 1U5KA 4EX5A 4X3KA 2MUYA 4DNTB 1VQ9A 1VQMA 4JV5Q 3FKIG 4GKJL 5DNFA 4IN3A 3HOXB 1EIHA 3J7ZC 5C0XH 3K7AB 2PQAB 3CRKC 1RKNA 2R92B 4CGYB 4JI4L 1SMXA 3TN2A 4BBRH 3CQZH 5KYLA 4OO1I 3M3YH 4PV1C 3Q0AA 4JI2Q 1BBWA 5ELBA 1M4VA 4KK7A 1AP0A 4NB3A 1F9SA 2EXDA 3KF8A 3QO2A 5GAGC 4FP5D 1VQNA 1DGSA 1JR0D 2OTLA 4DN4M 3I70A 5BR8Q 2MPMA 4JK1C 5AFWA 3S9WA 5H1SE 1HNWL 3OWFA 3W5OA 3BU2A 2R7FA 5G3LF 5IGDA 5EKKA 1I6VC 1E1OA 2B2UA 2ICEC 3O13A 1JC7A 3W1GA 1O7YA 4OO1G 4LFAL 1WYDA 4LF8Q 1C4QA 3NTKA 2VY3A 3I91A 1U4RA 2JA7H 2IHEA 2PQAA 4RG1A 1O80A 1H9SB 5J22A 2EYHA 3PGZA 1BOSA 5LL6X 4K8IA 4PMWA 3TP5A 1Y1VB 1J6QA 3NWTA 1S72A 1GJXA 1NR4A 2Y0SB 1MHWC 1WD0A 3S1MH 1XPRA 4LF7L 1GVPA 5G3LD 3HKSA 4XTCS 3VR2A 1I94Q 2KCTA 3CKIB 3S1QB 1Q81C 5IYBH 4LMQD 1MJCA 1RD9D 2DNEA 2F0EA 3EJIA 4NXNL 2JQOA 3F2DA 4M8AA 5ISRA 1Z9FA 2JEBI 3S17H 1SNMA 1BVSA 3HGBA 1F9PA 4F87A 2NWGA 4EQOA 1KQSA 2L55A 4BXXG 2BH2A 2NVTB 2NYZD 2OQ0A 5CYUA 1N36Q 3LNNA 1GM5A 1IXRA 2GVBA 3MXPA 1TWFB 1L2FA 3ERQA 3D4RA 3Q22A 2KHIA 2VQEL 4KHVA 5EKIA 1B2TA 1XTDA 4DK6C 4UAIA 1EY6A 2E2JH 1EY7A 2HCIA 4IPDA 1Q8KA 2CVRA 2BA0A 1T5EA 2PW5A 4DV0L 4LF6Q 1LYLA 1UE5A 4EQNA 1S5ED 4NXMQ 4XQJA 5IE8A 4DV6L 2SOBA 2B8FA 3A54A 1CTMA 3VYUA 1PH1A 1W6KA 2HQLA 5IGEA 5JJZA 1K8MA 3MTSA 4GN3B 3J80c 1OXUA 1E22A 3H91A 1V9PA 2B2TA 3FRPB 4QQBX 2IHFA 1CHQD 1WCMG 3BDOA 4DR3Q 1TWGB 1VQ5A 3LWEA 3EN2A 3GTMH 2KVMA 2V1CC 2HQEA 3SVMA 2LS01 2PYKA 2VS1A 3PUXA 4A3IB 1CKMA 1N32Q 3MXUA 1N34Q 2E8GA 5C3EB 2F0MA 4CKCA 4FF1A 4LJZC 1TWAB 1N9WA 2A6HC 4L5SA 1MKHA 3CP0A 1D5MC 1QNUA 1X3FA 1YEZA 4DV3L 1STGA 4HR7B 2NVXH 3ONAB 3J80E 1TIID 1S40A 2I5LX 2KCMA 5ELEA 2Z1CA 1YNXA 5JJIA 3E6ZX 4A3CG 2VB2X 3RMHA 4OX9Q 3L3OC 3GV6A 1RJTA 3H3VI 3A8IE 4XDXA 3T1HL 4B3RQ 4YY3L 5K36G 1DOLA 2UUBQ 1X54A 4A3GH 2N3SA 1QILA 3ND9A 2IW3A 3U58A 1STHA 4B08A 1BR9A 3NE5B 4PZ7A 2QDBA 4B3TQ 4UP8A 1AE3A 2AWNA 1XPUA 2M00A 3HOVH 2NTTA 1HR0L 1WVLA 5IIFA 4LW1A 2VQFL 2CQAA 4PZ8A 2WB1E 1CZGA 4Q0FA 1SDFA 4C3IG 2NVQB 3A8JE 5TSSA 1I6HH 2KA7A 5HY6A 1HA6A 1IKMA 1ZYRD 4GLVB 1F2YA 5M9OA 4JI2L 2F0PA 3B6YA 1F77A 1E2VA 2F0QA 1PH3A 2KENA 4QIWE 1IYJB 1QNKA 1UAPA 4AYBB 1G51A 1JWSD 4K8JA 5A2QL 3UE1A 4G7HC 4O0AA 3PIOA 5EAYA 5AJ3L 5M5YB 1UEAB 1RDPD 1GHKA 3U50C 3CXCA 2UUAQ 2LY7A 1VMCA 1HH2P 3Q24A 2K04A 1V43A 4V190 4TQUS 5E4WC 5CV8A 1TKWB 4A93H 2PNRC 4BBRB 1E3PA 2E2HH 3GTLH 4DA2A 1EU3A 3IFTA 3IKJA 3CC7A 2XSCA 2B39A 4AQYL 5IP9H 4JVZA 5GAEC 4KHZA 2JA8H 4O2DA 3JAMc 1XMQL 1RCVD 2Z0SA 3SK8A 1V8QA 5C44G 1LTBD 4DR4L 2UXDQ 3ULPA 3I4NH 3T1YQ 4GKJQ 1HHVA 4QF4A 2B29A 1JOOA 1CK1A 5C0XI 1Q8IA 1JJGA 2F0VA 1BDOA 4PMBA 1SFOB 4DPGA 4DXFA 3MC0B 3S16B 4IPGA 4P73A 3OOCA 5COYA 3RLFA 2IX1A 1JORA 3AB9A 2OTJA 3K0XA 3JAML 1Q7YC 2E5LQ 2RKSA 4WRDA 4BWGB 4A3GG 4JI6L 1HNXQ 1B9MA 2Q8TA 3R2IA 1A3TA 4CHTB 1TXYA 3PIP3 2MGSA 4IZ8A 4LUOA 1KDCA 2NVTH 2EY1A 1OXXK 3OSOA 4OWWB 2A19A 1VQ6A 2ZTEA 1STNA 1BUVT 2A68D 1Q1BA 4ZAIA 5C3XA 5JVH3 5JEAJ 1TR5A 2E2IB 3EIVA 4K0KL 2F0TA 2A73B 1PTOF 3K7UC 2RVLA 3A5ZB 3WOEA 5C3EH 1N8RC 1LTRD 1CSQA 5HGTA 1PTOH 4G7OC 4R1JA 1FL0A 2F0KA 2XNAC 3UE0A 1I4PA 5J3BA 5ELFA 1NJIC 1Y1VG 1G6ZA 4X65Q 3RZOH 2R6GA 2QA4A 4X66L 4DK3C 2Y0SG 4GKKL 4YIJA 3CCSA 4IOCA 4S3SA 3I4LA 5FJ8H 1FVIA 2SDFA 2B2YC 3TBIB 1NNXA 1C48A 4OELB 5ELOA 4DV7Q 4X64Q 1VQEA 3CAMA 3EFXD 5JJLA 4GOPA 1B9NA 1K3BC 1EU4A 1FNUA 1Q1EA 1CSPA 5JEAG 4IUPA 3DM1A 3HS0C 2I0QA 1XX8A 2NVXB 5IP7G 2PW7A 1QOHA 4J8QA 4POGA 3HOWG 1QG7A 3Q6SA 2DGYA 2SEBD 2D2CC 4XYQA 2JXMB 4IFDG 4C3HB 3R8BA 3UDGA 3CHBD 2ZXPA 3TP8A 1SBBB 1FJGQ 4DV2Q 1XNRL 3LWUA 4XIGS 3SHLA 4RA8A 3OMCA 3LX0A 3GTKB 3IRBA 4A3EH 2RDGA 3UDIA 1LTID 3VR6A 5D3IB 1STYA 3I73A 1I5FA 2I5HA 4HMJA 3KLRA 1PFSA 1IW7C 4ZRZA 2EZVA 4GN4B 2V4DA 4JI5L 3UDFA 3NPPA 4DV2L 2UXBL 1BO0A 3MAQA 3QWNA 1O78A 4BY1G 1QUQB 1Y14B 5C4XH 1A3UA 3KLWA 4NPSA 1F9RA 3S17B 2KBNA 4A3IG 1TVXA 3RUZA 1EL0A 4BY7H 2ZXOA 4OIJA 3NSWA 1MD2D 4O1NA 4LUVA 5E1FA 2RSOA 4JI1Q 1L1OB 1Y1VH 3K0YA 3HZXA 4DR2L 3EBEA 1QJOA 4YCWA 4C56C 4DAYA 1P8LA 4HSVA 1XMOL 2XVSA 3SEBA 4ZKCB 4DF7A 3S1MB 4BA1I 2MFIA 3BZKA 4X64L 4YHHL 3RN2A 2R7ZB 1ESRA 2FINB 1LT4D 4R9WA 1GUSA 5IGGA 3DLLA 3T53B 2VUMB 4ODGA 5KYIA 2P5ZX 1RL2A 1NAPA 2K50A 4IFDI 4RFBA 2J0TD 2VL6A 5LMNW 1A63A 1I4HA 3CC2A 4BY1H 2MJ8A 2N88A 2IT1A 4DV5L 2GVAA 1RODA 1SXTA 4DR6Q 2LFNA 3GV3A 5JAVA 1XNQQ 4MIUA 4GNXC 2ATWA 4ME5A 3K58A 2AHOB 3E5SA 2Z9HA 5DM63 2OT2A 2O4XA 2Q2HA 4FF3A 1PH7A 1OXSC 2BH8A 3HP3A 4P72A 3R2TA 5E3FA 1HR0Q 1VS0A 4C3IB 5CC4A 1VQBA 4LAAA 4DR1L 1X55A 4BA2I 4A3IH 2E2JB 1IYVA 1PHJA 5IYCG 3MFYA 5I9OA 3A55A 1PTOB 1BF4A 3BZDB 1KDAA 4K2LA 3A7AB 3K80C 1P16A 3T1HQ 4B3RL 4AIMA 4PMCA 3I4NG 1UE6A 4LNQA 3HKZB 3IAYA 1Q82C 4GLAC 3H94A 2ZJRA 1CZWA 3OIPA 4A3JH 4JOIA 4A3LG 1F2ZA 4UP7A 2NVYB 1X3GA 3ERSX 4L5RC 2UU9Q 1MJEA 2KEEA 2CWAA 1B4OA 4J6HA 4A3FB 2JA9A 1ICWA 1VQFA 3TP7A 5FO8B 4UY8C 4BBRG 1IBLL 5I4DA 1WOCA 1EFWA 5IOCA 2UUAL 3AMUA 2JA6G 3GTQH 1K3RA 4ILWA 4DV4L 2F0UA 4DKAC 4RGTA 4R4IA 2IL8A 4CDDC 2K33A 3KFUA 3D0FA 3G6JB 1FYCA 1SE2A 3KF6A 2QEJC 1OTCA 2R61A 2K5QA 3TZUA 5C4HA 5LMNQ 2Q2TA 4RAUC 2RCFA 2EYOA 3H3VC 1FNWA 3SXHA 3N6RA 2RA4A 4NP5A 1SNPA 3KK7A 2CWPA 4QIWB 1VF5C 3PUZA 1Q12A 4A3KG 3M3YB 4QB4A 1D5ZC 4FF4A 1JOQA 1D8LA 4A3GB 4JCVE 1EZ6A 2DJGC 4B3TL 1KNEA 1S5FD 3BJUA 3AQQA 4KTAA 1D1IA 2BE5C 1KDBA 4WJ4A 3MHBA 2XRQD 4FF2A 1Y69U 3D4DA 3GQBA 1D2BA 4P75A 1WTVA 1EYGA 4ZUJA 4APVA 5M3FB 4CJ0B 1HQRD 3NELA 1Z7TA 4A3BG 3NBHA 2TMPA 3A56A 1SYFA 4RGNA 4GNXB 1I4RA 4JI0L 4HJ8A 1WTQA 2UUCL 2UUCQ 4YWLA 3RN5A 4HSPA 3HOVG 2K4KA 3W1BA 4HIKA 1UWVA 3KBGA 1WTWA 5C3WA 2GA4B 2VB3X 2PO4A 1PMRA 3CCQA 3K59A 4A75A 1IBMQ 4EQ5A 4RWSC 2JA8B 1VF7A 3F1ZA 1BXTA 5EPLA 1ASYA 5I2YA 3H3VH 3S24A 4QUFA 5KNBA 1XJVA 1EWCA 2JE6I 1Q86C 1TT2A 1V1PA 4RHRA 2K7VA 4LF8L 2B2WA 2WKDA 1V1OA 3QR8A 3PUVA 3T4AC 2R93B 3J80i 1HCZA 4KJNA 3E0JA 3N52A 4CKEA 4Y7NB 3KJOA 5IWAL 3KLSA 4JBWA 3GTPB 5CGKA 1X3QA 5J39A 1SYDA 2IPKD 1EZ8A 4G4KA 1AZQA 5M5XB 2ZJQA 2B2WC 1H9RA 4A3EG 1WCMH 2L9HA 1I50B 2RHQB 4OGQC 4Y7NH 1S4ZA 1SMYC 3J81E 4IO9A 4JI3L 4O42A 2WKCA 2PPBC 3ER0A 2D9UA 3HOUH 3PO2H 4H02A 1UEBA 1BBUA 1TWGH 3TRZA 1EY8A 1GUTA 2JYOA 3I3CA 5M3MH 2DNCA 1TQOA 1T9HA 3VR5A 4DR1Q 4ME3A 2JSOA 1VQJA 1WCMB 2HHHL 4LF9Q 2A68C 2XRSD 1H95A 1I4GA 5FLXL 4A3JG 1KHIA 1IBML 2EYLA 4MNOA 5DAUA 1K9MC 3D6CA 1HTPA 3PUWA 3RNUA 3TS2A 3CCLA 4BXXH 1W3SA 3OTOL 3TEHB 2CH4A 2XTIA 1NTGA 3FPPA 2RDFA 3MZ5A 5I9PA 2X6LA 3QOLA 1KLGD 4X3SA 2A8VA 3I4MH 1LUZA 3KDFA 4LF7Q 3CD6A 3DWPA 5FLMH 4TRDA 4H13C 1HA5A 2BA1A 1H9KA 2BOSA 2L1BA 3BG3A 1NR2A 1ZEQX 2OXPA 5A35A 5LMNL 3PO3B 2WV6D 3VDYA 4LK1C 4JI4Q 4JW0A 2DN8A 1Q46A 3DUZA 1PH6A 3BYTB 4DUZQ 1WFQA 3AEVA 5M5WB 1SAPA 1YNJD 2KQ3A 2N55A 3QG1A 3IL8A 3UDXA 2C9OA 4HCSA 4KI0A 4IUVA 4H0LC 4RKLA 3PCOB 3I4NB 3HOYB 4KY6A 2F1MA 4DR2Q 4JBJA 1G291 2H4OA 4JI1L 3J7YW 3H6MA 1EY5A 4DUZL 2EJMA 4HTHA 3ICEA 2CQOA 4DV1L 3J81L 3TDQA 3S16H 4HIOA 1DOMA 2I07B 4PG3A 1A3VA 2AMCB 1SMYD 2LKVA
chains in the Genus database with same CATH topology
1ZXTA 2CW0C 4DK1A 4BY7B 1JWUD 5KNDA 3F2UA 3TMEA 4HN7A 3GTGB 2RQXA 2KJXA 4R8IA 4IUUA 1BCPF 2K05A 1EQTA 5C44B 2EY2A 1SJHD 5D14A 2IX3A 5J1ZA 2B2TC 1A15A 3EVQA 2K28A 2Z4HA 4A3DB 3C2PA 4A3KB 3DEOA 1EY0A 1KABA 2FJ2A 2BDNA 1XXGA 4B9XA 4P2CB 2D5DA 4KN7C 5IT9L 3RZDB 2YU9B 2IX0A 4MN3A 4UDUC 1UUPA 1R4QB 1K8OA 1HUNA 2H1EA 2EY5A 4U673 3X3NA 1TS4A 3QB3A 2FMMA 5EKLA 1H9SA 1L0XB 1FGBD 3FPUB 3OW7A 1AW7A 3S2DB 1BCPD 4DAPA 2D62A 2L5TA 3HOVB 2X69A 1X32A 5JOBA 3K5OA 2YYZA 4V0BA 1FR3A 3P1HA 3M4OB 3GTMB 2Z4IA 4TKOB 1BBXC 4B9WA 1EYCA 3EA6A 1NSNS 4KKSA 1STEA 4WFN3 2AUJD 3NTHA 2NTSA 3K5NA 3T16A 2WB1B 1AEXA 5EGTA 5EJWA 3V05A 1PRTB 3H09A 1JCKB 5BN4A 4CJ1B 1ESFA 3MVVA 1R4PB 1GUNA 1DYQA 4PQXA 1CHPD 3D4WA 4EGVA 3VA7A 1HFGA 4QCLA 4C3HG 4L8JA 3TSSA 4A3EB 2K6AA 3GO5A 1YNJC 1B53A 4C1NK 3MXNA 2XWJB 3OIQA 3D8GA 1LTSD 2SNMA 1ILPA 1HQMC 3PUYA 4DNRB 2XN9C 2WIIB 3D3RA 1A2TA 2EDGA 4BY1B 4PNYA 4H44C 4MHEA 3S15B 2AUKA 1I4XA 4KKUA 2M2LA 4H7BA 2XWBB 1TU2B 1U4PA 3PIO3 3R3OA 4OL7A 2K5WA 4KD3A 1F9QA 4DGZA 1FNVA 2KCCA 5JVG3 1II3A 2CW0D 4ZK9B 4IURA 1LT3D 4KD4A 3NK9A 3QJYA 3S1NB 1SEBD 2AWOA 4IQZA 3J80L 1IKLA 1PZID 1VDZA 2WACA 1ET6A 3FDTA 2F0WA 1EEFD 2E2DC 4XT1B 1ML0D 1SSOA 1CQFA 1PRTC 4K5XA 1DZ1A 2AQ3B 2QF7A 4OO1H 1Z6HA 5C0XJ 4XQNA 2QILA 5M3MB 1L0YB 4IUNA 2KEDA 5KNCA 4F8MA 3SR1A 1JE4A 4ZLTF 1PFNA 5EPJA 2F0JA 2F0NA 5IGFA 2A6EC 2C5CA 3BVGA 1I3QB 2F0GA 2WINB 2EYMA 4IUTA 5LL6S 3T13A 1HXYD 2EJFC 5CBAE 4K6LA 2M9VA 1PDQA 1PRTD 2HCCA 2O5IC 2BDOA 1I6HB 4E6IA 1KAAA 4KN4C 1DCZA 4KY5A 2L11A 3Q23A 5IGCA 4EVOA 5C5LA 3HEJA 5KGUA 3S14B 5FO9B 2FFKB 3OPOA 3KUPA 2EYJA 4NKLA 4FYDA 3KBXA 2B63B 5C6AA 4RCNA 1JICA 3D31A 3J7AF 1O7ZA 1DJRD 5HURA 3S2HB 1TWHB 3JAME 3M85A 4CJ2C 1ZYRC 1OXVA 1EFID 3VYSA 4ZUIA 1SYBA 5K36H 4A3BB 3DWQA 1PLFA 2QCPX 5LHY1 2R3ZA 1WTXA 2AQ1B 4C3JG 3VYRA 1ONLA 4RCOA 4XT3B 5C0XG 1TY2A 3QOJA 3SE0A 3SK6A 1GUGA 2L0CA 3VYTA 4N9TA 1LT5D 4K5VA 4EQPA 1V1PB 5FOBB 1ZKOA 1SYCA 1SYGA 3K6OA 1T5XD 3MEHA 2KECA 2DY7A 5CV6A 4DK0A 1DOKA 2OF1A 3MFGA 1EWHA 4HEDA 3C3LA 2JA5B 3ND8A 1SNDA 2JP1A 3FVQA 4DU9A 3WOFA 1J9OA 3MXGA 4IFDJ 4C1NI 5BN5A 2MHVA 1UNSA 4A3MB 2RSNA 3U9SA 4ID6A 1TS5A 5K5PA 2WAQB 4WJWA 4N9PA 4HAEA 2B2VC 3HOZB 2BCOA 2EY6A 3P20A 4KKTA 1JB3A 2DY8A 4IFDH 3CU7A 3M4YA 3QIAA 1Q90A 4A3JB 4K5WA 2NN6G 1PYWD 1TS3A 2A6HD 1M8AA 3DWAA 1ENFA 1STBA 4KY7A 1LACA 1Q3LA 5CV5A 3RZOB 3FKIB 1PZJD 4XYOA 1FD7D 4L6TB 1K83B 1DM0B 5EPKA 4X3UA 3ITPA 2O5JC 2RBMA 1E0BA 1G2SA 5CV4A 1EYAA 4WORA 3W3AA 1IHZA 5FKAC 4X3TA 3R93A 1KNAA 1W6JA 1CQVA 5CBEE 2A6ED 1A6XA 3A8KE 3V2TA 4CBVA 1RHPA 1F2MA 3BVZA 4K2KA 3C46A 3NTIA 2E2HB 2J7ZA 3DXJC 2NN6H 4FNFA 1LT6D 2EJGC 3T51B 1S5DD 1U4MA 1D5XC 3OWEB 5C4XB 1Z47A 3C1FA 3H0GB 1HTLD 2F0HA 4GZYC 1U4LA 2F3VA 3SK5A 2G9DA 2NZ1D 1G2TA 5JPMC 1SYEA 2NBFA 3WDNA 5F2DA 4R8NA 3L7ZC 1RTOA 5CMDA 4NW2A 2X6GA 2IWHA 4ULLA 5DM73 4ZKBB 4BBSB 1GXDC 5CV9A 1IYUA 2K32A 4RGOS 5EQ0A 2HUGA 1TS2A 3NQTA 1VCIA 4KV6A 2KCNA 3BVMA 5DEHA 5JEAH 2FHTA 3MWYW 1Y8OB 5C4JB 3NXWA 4OIKA 4TSSA 2F3WA 2ZT9C 1GUOA 3MA2B 3K57A 5D3DA 2EPBA 2E74C 4K14A 5I6YA 1QCBD 2B2YA 4XQQA 4F7XA 3NP8A 5FK9C 1IW7D 2EOTA 1JQYD 3AU7A 2PCFB 1SNOA 4L63B 2J4XA 3OHXC 1LTGD 1BNZA 1DONA 4FVMA 1MGSA 3CQZB 3T56B 2OEOA 5IODA 1XYIA 2E76C 4Z9CB 1J8IA 1GHJA 1QWYA 3TZDA 5T1GA 1B50A 1EEID 4RGMA 4IALA 5ELCA 5JPNC 5EBCA 2ZXRA 4ZYSA 2B8GA 3PV0A 2VXWA 5IGBA 2MP1A 3D6WA 5CR3A 5KRUA 1GOZA 4CKBA 1D1KA 2F03A 2F0LA 2HDMA 2TSSA 2Z8LA 1RF2D 1F2LA 3IFDA 3BDLA 4K6DA 1CT1D 3P7JA 4RKBA 1TWCB 3ZYYX 3I8ZA 1H9JA 4M1UB 1X3PA 3DMUA 4OHJA 1D6EC 1G8ZD 3BDCA 4A93B 5NUCA 4KMUC 5EBDA 1ENAA 1PFMA 3P75A 1LO5D 3C1EA 2ICIA 2PZUA 1LTAD 1AN8A 2NB0A 2WP8J 1CA5A 2B2VA 4DAVA 2HDLA 1A2UA 1NUCA 3A7LA 3EROA 1R9TB 5BN3A 3SK4A 3NBIA 3GD7A 5KEEA 2FMCA 2NUCA 2K5DA 5T1IA 5FLXE 5C4ZA 3GTJB 5FO7B 2LMCB 2ID0A 1AFPA 1OO9B 4G7ZC 2O2LD 3M7GA 5E4XA 1PRTF 5CORA 4DXGA 2SNSA 3UI2A 2Q8IB 3M7NA 2EYPA 1C8CA 2F0OA 1B44D 2EXZA 1WD1A 2K1BA 1EY4A 1MI2A 1SE4A 5I6WA 4NDXA 3I4MB 1QE6A 2F0DA 1CA6A 4FXGC 4RHSA 5KIXA 2L12A 3DEPA 1BCPC 3BYYB 2JEAI 2I46A 5D65A 2F0IA 1OXTA 4G57A 3NHHA 4QUCA 1B1ZA 5A2QE 3HOWB 3NQIA 1H9MA 1CM9A 2KOLA 3I90A 1Y8PB 2IJ0A 2BE5D 2A74C 3K5LA 1E2ZA 1AZPA 2K03A 1DXMA 1SJED 1LLRD 1CI3M 1IL8A 4ZQ3A 3TP6A 1NCVA 3NWSA 3GTLB 1RTNA 3GTQB 3G7LA 1JOKA 4C2MB 1BQQT 1EYDA 2XIWA 3I72A 4I65A 3GTOB 1YNND 3U9OA 2A69D 3K5MA 3RD4A 1HRJA 1HUMA 1EY9A 1TY0A 1DD2A 4XXEA 3NUCA 3OMGA 1LV9A 1EOTA 1QB5D 4FO2A 3S1RB 1G91A 3KLSX 5C5MA 2A69C 5I2XA 2A5HA 3EQLC 2KUMA 4C3JB 4U68A 2F0FA 1STAA 4FXDA 2JA7B 3W2DA 2CHBD 1KLUD 4QMGA 1Y8NB 1KTKA 4DFAA 1YNNC 2F4IA 2AQ2B 4IUQA 1ET9A 4KJOA 3BS1A 4NMZA 1EIGA 1ENCA 1EQVA 4FXKC 1HPCA 5CV7A 2E75C 1S5BD 3PMFA 1ILQA 1WTPA 3L9AX 1HFNA 1S5CD 1O7LA 2B2UC 3V96A 4HCEA 1PZKD 2EYFA 3GP7A 1XTCD 2G9HD 1BCPB 3CRLC 4F88A 1SE3A 4RH6A 1U9RA 4I7ZC 4J1MA 3HRZC 3VA5A 2VNUD 1PXUA 2ENBA 2EE1A 2K01A 1WTRA 3VR3A 2EVBA 3FMCA 3DHQA 1PTOC 1SNQA 2NN6I 1JWMD 2QKIC 3URYA 1LABA 4Q5VA 1CFMA 2RDHA 1MBYA 1PFBA 2PQEA 1WTOA 4BS9A 1E2WA 3FEWX 1VMPA 2F0SA 1PTOD 1I4QA 3SDZA 2JA6B 4ABNA 1Y1WB 1MSGA 2PMZB 5ELDA 2Q8RE 1GUWA 1SNCA 2PZTA 3HG9A 2KHSA 4HMIA 3J7AV 1XWEA 1MSHA 3X3MA 3VR4A 1LTTD 5IT9E 2L4NA 2PZWA 3HOUB 3PO2B 1B3AA 4X3KA 2MUYA 4DNTB 5DNFA 4IN3A 3HOXB 1EIHA 5C0XH 3K7AB 3CRKC 1RKNA 2R92B 4CGYB 3TN2A 5KYLA 4OO1I 4PV1C 3Q0AA 5ELBA 1M4VA 4KK7A 1AP0A 1F9SA 3KF8A 3QO2A 4FP5D 1JR0D 4DN4M 3I70A 2MPMA 4JK1C 5AFWA 3S9WA 3OWFA 5G3LF 5IGDA 5EKKA 1I6VC 2B2UA 2ICEC 3O13A 1JC7A 1O7YA 4OO1G 1C4QA 3NTKA 3I91A 1U4RA 1O80A 1H9SB 5J22A 2EYHA 1BOSA 5LL6X 4K8IA 4PMWA 3TP5A 1Y1VB 3NWTA 1GJXA 1NR4A 2Y0SB 1WD0A 5G3LD 4XTCS 3VR2A 3CKIB 3S1QB 4LMQD 1RD9D 2DNEA 2F0EA 3EJIA 4M8AA 5ISRA 2JEBI 1SNMA 3HGBA 1F9PA 4F87A 2NWGA 4EQOA 2L55A 2NVTB 2NYZD 5CYUA 3LNNA 3MXPA 1TWFB 3ERQA 3D4RA 3Q22A 4KHVA 5EKIA 1B2TA 4UAIA 1EY6A 1EY7A 2HCIA 2CVRA 2BA0A 1T5EA 2PW5A 4EQNA 1S5ED 4XQJA 2SOBA 2B8FA 3A54A 1CTMA 3VYUA 1W6KA 5IGEA 5JJZA 1K8MA 3MTSA 1OXUA 3H91A 2B2TA 3FRPB 1CHQD 3BDOA 1TWGB 3LWEA 2KVMA 2HQEA 3SVMA 2LS01 2PYKA 3PUXA 4A3IB 3MXUA 5C3EB 2F0MA 4CKCA 4FF1A 4LJZC 1TWAB 2A6HC 1D5MC 1QNUA 1STGA 4HR7B 3ONAB 3J80E 1TIID 5ELEA 2Z1CA 3E6ZX 2VB2X 3RMHA 3L3OC 3GV6A 1RJTA 3A8IE 4XDXA 5K36G 1DOLA 3ND9A 1QILA 2IW3A 1STHA 4B08A 1BR9A 3NE5B 2QDBA 2AWNA 2M00A 2NTTA 1WVLA 5IIFA 2CQAA 1CZGA 4Q0FA 1SDFA 4C3IG 2NVQB 3A8JE 5TSSA 2KA7A 1HA6A 1IKMA 1ZYRD 1F2YA 5M9OA 2F0PA 1F77A 1E2VA 2F0QA 1QNKA 1UAPA 4AYBB 4K8JA 1JWSD 5A2QL 4G7HC 5M5YB 1UEAB 1RDPD 1GHKA 2LY7A 1VMCA 3Q24A 2K04A 1V43A 4V190 4TQUS 5E4WC 5CV8A 1TKWB 2PNRC 4BBRB 4DA2A 1EU3A 3IFTA 3IKJA 2XSCA 2B39A 4KHZA 1RCVD 3SK8A 1V8QA 1LTBD 1HHVA 4QF4A 1JOOA 1CK1A 5C0XI 1Q8IA 2F0VA 1BDOA 4PMBA 1SFOB 4DXFA 3MC0B 3S16B 3OOCA 5COYA 3RLFA 2IX1A 1JORA 3AB9A 3JAML 2RKSA 4WRDA 4BWGB 1B9MA 2Q8TA 3R2IA 1A3TA 4CHTB 3PIP3 2MGSA 4IZ8A 1KDCA 2EY1A 1OXXK 3OSOA 1STNA 1BUVT 2A68D 1Q1BA 4ZAIA 5C3XA 5JVH3 5JEAJ 1TR5A 2E2IB 2F0TA 2A73B 1PTOF 2RVLA 3WOEA 1LTRD 5HGTA 1PTOH 4G7OC 2XNAC 2F0KA 1I4PA 1G6ZA 5ELFA 2R6GA 4YIJA 4S3SA 3I4LA 2SDFA 2B2YC 3TBIB 1C48A 3EFXD 1B9NA 1EU4A 1FNUA 1Q1EA 5JEAG 4IUPA 3DM1A 3HS0C 1XX8A 2NVXB 2PW7A 1QOHA 4J8QA 1QG7A 3Q6SA 2SEBD 2D2CC 4XYQA 2JXMB 4IFDG 4C3HB 3R8BA 3CHBD 2ZXPA 3TP8A 1SBBB 3LWUA 4XIGS 3SHLA 4RA8A 3OMCA 3LX0A 3GTKB 2RDGA 1LTID 3VR6A 5D3IB 1STYA 3I73A 4HMJA 3KLRA 4ZRZA 1IW7C 2EZVA 2V4DA 3NPPA 1BO0A 3MAQA 3QWNA 1O78A 1A3UA 1F9RA 3S17B 1TVXA 3RUZA 1EL0A 2ZXOA 4OIJA 3NSWA 1MD2D 4O1NA 5E1FA 2RSOA 3K0YA 3HZXA 1QJOA 4C56C 4DAYA 4HSVA 2XVSA 3SEBA 4ZKCB 4DF7A 3S1MB 4BA1I 2R7ZB 1ESRA 2FINB 1LT4D 4R9WA 1GUSA 5IGGA 3T53B 2VUMB 4ODGA 5KYIA 1NAPA 4IFDI 4RFBA 2J0TD 1I4HA 2MJ8A 2N88A 2IT1A 1RODA 1SXTA 2LFNA 3GV3A 5JAVA 4MIUA 4ME5A 3K58A 3E5SA 5DM63 2OT2A 2O4XA 4FF3A 1OXSC 3HP3A 3R2TA 5E3FA 4C3IB 5CC4A 4LAAA 4BA2I 2E2JB 1IYVA 3MFYA 5I9OA 3A55A 1PTOB 1BF4A 3BZDB 1KDAA 4K2LA 3A7AB 4PMCA 3HKZB 3IAYA 3H94A 1CZWA 3OIPA 1F2ZA 2NVYB 2KEEA 1B4OA 4J6HA 4A3FB 1ICWA 3TP7A 5FO8B 5I4DA 5IOCA 3AMUA 4ILWA 2F0UA 4RGTA 2IL8A 2K33A 3G6JB 1FYCA 1SE2A 2QEJC 2R61A 2K5QA 3TZUA 5C4HA 4RAUC 2EYOA 3H3VC 1FNWA 3SXHA 3N6RA 2RA4A 4NP5A 1SNPA 3KK7A 4QIWB 1VF5C 3PUZA 1Q12A 3M3YB 4QB4A 1D5ZC 4FF4A 1JOQA 4A3GB 1EZ6A 1KNEA 1S5FD 4KTAA 1D1IA 2BE5C 1KDBA 3MHBA 2XRQD 4FF2A 1Y69U 3D4DA 3GQBA 1D2BA 1WTVA 4ZUJA 5M3FB 4CJ0B 1HQRD 1Z7TA 3NBHA 2TMPA 3A56A 1SYFA 4RGNA 1I4RA 1WTQA 4HSPA 3KBGA 1WTWA 5C3WA 2GA4B 2VB3X 2PO4A 1PMRA 3K59A 4RWSC 2JA8B 1VF7A 1BXTA 5EPLA 5I2YA 4QUFA 5KNBA 1EWCA 2JE6I 1TT2A 1V1PA 4RHRA 2K7VA 2B2WA 2WKDA 1V1OA 3PUVA 3T4AC 2R93B 1HCZA 4KJNA 3E0JA 3N52A 4CKEA 4Y7NB 3KLSA 4JBWA 3GTPB 5CGKA 1X3QA 5J39A 1SYDA 2IPKD 1EZ8A 4G4KA 1AZQA 5M5XB 2B2WC 1H9RA 2L9HA 1I50B 4OGQC 1S4ZA 1SMYC 3J81E 2WKCA 4O42A 2PPBC 2D9UA 1EY8A 1GUTA 2JYOA 3I3CA 2DNCA 1TQOA 3VR5A 2JSOA 1WCMB 2A68C 2XRSD 1I4GA 5FLXL 2EYLA 5DAUA 3D6CA 1HTPA 3PUWA 3FPPA 2RDFA 3MZ5A 5I9PA 2X6LA 3QOLA 1KLGD 4X3SA 3DWPA 4TRDA 4H13C 1HA5A 2BA1A 1H9KA 2BOSA 2L1BA 3BG3A 1NR2A 1ZEQX 2OXPA 5A35A 3PO3B 2WV6D 4LK1C 2DN8A 3DUZA 3BYTB 5M5WB 1SAPA 1YNJD 2KQ3A 2N55A 3QG1A 3IL8A 2C9OA 4HCSA 4KI0A 4IUVA 4H0LC 4RKLA 3I4NB 3HOYB 4KY6A 2F1MA 1G291 2H4OA 3J7YW 3H6MA 1EY5A 2EJMA 4HTHA 3J81L 3TDQA 1DOMA 2I07B 1A3VA 1SMYD 2LKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEX A;  2WAC A;  4YIJ A;  5EGT A;  4KHV A;  4KTA A;  4IAL A;  4K5W A;  1EY6 A;  1EY7 A;  1TQO A;  4S3S A;  1EY4 A;  4ZUI A;  1SYB A;  4QMG A;  2F0W A;  1KDB A;  3TME A;  1STB A;  4DFA A;  3MVV A;  3MHB A;  4KY7 A;  1SYE A;  2PW5 A;  5JAV A;  5I6W A;  4MIU A;  3D4D A;  4EQN A;  4NDX A;  4ME5 A;  1RKN A;  5F2D A;  2F0D A;  3D4W A;  4R8N A;  5IGB A;  2SOB A;  3E5S A;  5CV5 A;  4ZUJ A;  5KYL A;  5CV8 A;  2O4X A;  2EY2 A;  4K5X A;  5IGE A;  2EYL A;  3QOJ A;  4KJO A;  4NMZ A;  5CR3 A;  5DAU A;  3SK6 A;  3D6C A;  1SYF A;  1ENC A;  5E3F A;  5KIX A;  2PW7 A;  5J1Z A;  5KRU A;  1EQV A;  2F0L A;  5CC4 A;  3EVQ A;  4N9T A;  4LAA A;  3ITP A;  4K5V A;  4EQP A;  5CV7 A;  2RBM A;  5CV9 A;  2HQE A;  4K8J A;  2RDF A;  3S9W A;  3PMF A;  3OWF A;  4IUN A;  3SK8 A;  2PYK A;  3BDL A;  3MZ5 A;  5I9O A;  1SYC A;  1SYG A;  4K6D A;  4F8M A;  5EKK A;  5I9P A;  5IGD A;  3QOL A;  4RKB A;  2F0I A;  3SR1 A;  4ODG A;  3MEH A;  3TP8 A;  1KDA A;  3NQT A;  4K2L A;  2F0J A;  1EY0 A;  1KAB A;  2F0N A;  4G57 A;  4QF4 A;  1JOO A;  5IGF A;  2F0M A;  3D8G A;  3NHH A;  4KV6 A;  4PMC A;  5CV4 A;  2EYF A;  1EYA A;  5CV6 A;  4B9X A;  5C3W A;  2SNM A;  2F0V A;  4WOR A;  3DMU A;  4PMB A;  3SHL A;  4TRD A;  1IHZ A;  3BDC A;  5DEH A;  5NUC A;  3OMC A;  2OF1 A;  2F0G A;  3LX0 A;  1U9R A;  1STG A;  4J1M A;  2EYM A;  3T13 A;  2EYH A;  5J22 A;  1F2Z A;  3VA5 A;  3NXW A;  1ENA A;  1A2T A;  2OXP A;  3P75 A;  4K8I A;  3C1E A;  1JOR A;  2ENB A;  3TP5 A;  2PZU A;  1SND A;  1STY A;  2F3W A;  3V2T A;  4PNY A;  4J6H A;  2EY5 A;  2RKS A;  4WRD A;  4DU9 A;  4HMJ A;  1A3T A;  3TP7 A;  3DHQ A;  1F2M A;  4IZ8 A;  1SNQ A;  1TT2 A;  4K2K A;  4ZQ3 A;  4K14 A;  3TP6 A;  5IOC A;  5I6Y A;  1KDC A;  3QB3 A;  4E6I A;  2EY1 A;  1KAA A;  3OSO A;  1A2U A;  4H7B A;  5EKL A;  1NUC A;  4KJN A;  2KQ3 A;  4KY5 A;  4F7X A;  2F0U A;  2PQE A;  3ERO A;  3NP8 A;  5IGC A;  1A3U A;  1JOK A;  1STN A;  4EVO A;  5C5L A;  1EYD A;  3SK4 A;  1STH A;  3HEJ A;  4I65 A;  5KEE A;  5KGU A;  2QDB A;  2F0E A;  3EJI A;  5C3X A;  5J39 A;  5JOB A;  3RUZ A;  5CGK A;  5ISR A;  4ID6 A;  2F0S A;  1SNO A;  1SYD A;  5K5P A;  2NUC A;  1TR5 A;  1SNM A;  3U9O A;  2M00 A;  2PZW A;  1EZ8 A;  4RKL A;  5E1F A;  5C4Z A;  5C4H A;  4N9P A;  2F0T A;  5IIF A;  3R3O A;  1EY9 A;  4KY6 A;  3HZX A;  3P1H A;  4OL7 A;  2EYJ A;  4EQO A;  4NKL A;  2EYO A;  4KD3 A;  4DGZ A;  4B9W A;  3NUC A;  3OMG A;  3SXH A;  3H6M A;  1EYC A;  1EY5 A;  4NP5 A;  5C6A A;  1II3 A;  5KYI A;  4DF7 A;  2OEO A;  1SNP A;  4HTH A;  5HGT A;  2SNS A;  1SNC A;  2PZT A;  5IOD A;  2EY6 A;  2KHS A;  3NK9 A;  4HMI A;  4KD4 A;  1F2Y A;  2F0K A;  5M9O A;  1NSN S;  1EY8 A;  2F0P A;  3MXP A;  3C1F A;  2F0H A;  2EYP A;  4QB4 A;  5C5M A;  5HUR A;  1JOQ A;  2F0Q A;  5IGG A;  3ERQ A;  2F0O A;  2F3V A;  1EZ6 A;  3SK5 A;  1A3V A;  2F0F A;  1STA A;  3T16 A;  2LKV A;  2EXZ A; 
#chains in the Genus database with same CATH topology
 3GTK H;  1ZXT A;  4DNI A;  2CW0 C;  4DK1 A;  4DUY L;  4BY7 B;  1JWU D;  5KND A;  5C4X G;  3F2U A;  3TME A;  4HN7 A;  3GTG B;  4LF5 Q;  3H0G G;  2RQX A;  2KJX A;  4R8I A;  1K8G A;  4IUU A;  1A8V A;  1BCP F;  2K05 A;  4JI7 Q;  1BKB A;  2RCN A;  4A3L H;  1EQT A;  1NBW A;  3H0G H;  5C44 B;  2RHS B;  2EY2 A;  2VW9 A;  3GTP H;  1SJH D;  4B3M L;  5D14 A;  2IX3 A;  5J1Z A;  3A5U A;  2B2T C;  1PH5 A;  4A76 A;  1A15 A;  3EVQ A;  4IPC A;  2K5N A;  2K28 A;  2Z4H A;  4A3D B;  3C2P A;  4GLX A;  4A3K B;  4I7A A;  1KC8 C;  3DEO A;  1EY0 A;  1KAB A;  2FJ2 A;  2BDN A;  1XXG A;  4IOA A;  4YCU A;  4B9X A;  4P2C B;  2Y0S E;  2D5D A;  4KN7 C;  5IT9 L;  3RZD B;  2YU9 B;  2IX0 A;  4MN3 A;  4UDU C;  1UUP A;  1R4Q B;  1K8O A;  4JYA L;  1HUN A;  2H1E A;  1K73 C;  1SRU A;  2EQS A;  1VQ7 A;  2JA5 H;  2EY5 A;  4U67 3;  2N8N A;  4IJL A;  3X3N A;  1QUQ A;  1TS4 A;  3QB3 A;  4A4I A;  2FMM A;  1H9S A;  1L0X B;  5EKL A;  1E24 A;  1FGB D;  3OW7 A;  3FPU B;  1ICF B;  1AW7 A;  3S2D B;  1BCP D;  4DAP A;  1V1Q A;  1J5E L;  2D62 A;  1LM0 A;  4YHH Q;  2L5T A;  3HOV B;  2X69 A;  1X32 A;  5JOB A;  3K5O A;  1CKN A;  2YYZ A;  3SGI A;  3ZJY C;  4JYA Q;  4C3I H;  4V0B A;  1FR3 A;  2OQK A;  3P1H A;  3M4O B;  3GTM B;  2Z4I A;  4BBS H;  4TKO B;  1BBX C;  4B9W A;  3CPF A;  1EYC A;  3EA6 A;  2R92 H;  1ASZ A;  1NSN S;  1CUK A;  4YWK A;  1HJP A;  4KKS A;  1STE A;  5IY0 A;  1C7Y A;  4WFN 3;  3FKI H;  2ES2 A;  1K8A C;  2AUJ D;  3NTH A;  3OYY A;  2NTS A;  3K5N A;  3T16 A;  1KD1 C;  2WB1 B;  1HZB A;  1AEX A;  2JA6 H;  5EGT A;  5EJW A;  3V05 A;  1PRT B;  3H09 A;  1JCK B;  5BN4 A;  2R93 G;  4CJ1 B;  1ESF A;  4JI6 Q;  1VQP A;  3MVV A;  1R4P B;  3G6E A;  1GUN A;  1PH9 A;  1DYQ A;  2JA5 G;  4PQX A;  3CCE A;  1CHP D;  3D4W A;  1CKN B;  4EGV A;  1AH9 A;  3VA7 A;  1HFG A;  4QCL A;  4C3H G;  4L8J A;  3TSS A;  4A3E B;  2K6A A;  1K83 H;  4A3M G;  3AYH B;  1QVF A;  1E7Z A;  1SRO A;  3GO5 A;  3CCV A;  4DR4 Q;  1SE8 A;  2CH4 W;  1YNJ C;  5GAH C;  1B53 A;  4ZCK A;  3MXN A;  4C1N K;  2XWJ B;  1HZC A;  3OIQ A;  3D8G A;  1LTS D;  2SNM A;  2VZA A;  1ILP A;  4C2M H;  1HQM C;  3S1Q H;  3PUY A;  4DNR B;  2XN9 C;  5E7N A;  3HOZ G;  2PNH A;  2WII B;  2F52 A;  3D3R A;  1A2T A;  2EDG A;  4BY1 B;  4PNY A;  4K0K Q;  4H44 C;  4MHE A;  1IZ6 A;  2LXK A;  3S15 B;  2AUK A;  1I4X A;  2N49 A;  4KKU A;  3L2P A;  5M5Y H;  5IYB G;  2M2L A;  4H7B A;  1K0S A;  2XWB B;  4A3C H;  1PA6 A;  4L5T A;  2UUB L;  4X65 L;  1TU2 B;  1U4P A;  1E1T A;  3PIO 3;  3R3O A;  5IYD G;  4OL7 A;  2K5W A;  4DR5 Q;  4KD3 A;  1F9Q A;  4DGZ A;  1FNV A;  1SR3 A;  2KCC A;  3PIP A;  5JVG 3;  1II3 A;  2CW0 D;  4ZK9 B;  3M4P A;  4IUR A;  1LT3 D;  4KD4 A;  3NK9 A;  3QJY A;  3S1N B;  3STB C;  1SEB D;  2AWO A;  3PF5 A;  4IQZ A;  3PO3 G;  3J80 L;  1IKL A;  1PZI D;  1VDZ A;  1YIJ A;  2GN5 A;  2WAC A;  2UXD L;  1ET6 A;  3I4O A;  1XMQ Q;  1X9N A;  1SLJ A;  1AE2 A;  3FDT A;  1HNX L;  2F0W A;  1EEF D;  2E2D C;  3STB D;  4XT1 B;  1X3E A;  2DUD A;  1ML0 D;  1SSO A;  3S1N H;  3CME A;  2HHH Q;  1CQF A;  1PRT C;  4JPB W;  1TWA H;  2LSS A;  4UP9 A;  4K5X A;  1DZ1 A;  2QW7 A;  3MEF A;  2CCZ A;  2AQ3 B;  5FLM G;  2WAQ E;  2QF7 A;  4LF4 L;  4OO1 H;  4JBK A;  4HJ7 A;  5AJ3 Q;  3HKZ G;  1Z6H A;  5C0X J;  2Q2I A;  1Y1W H;  3I4M G;  4XQN A;  2QIL A;  2NZO A;  5M3M B;  1IBK Q;  1L0Y B;  4IUN A;  2KED A;  3F2C A;  4LUZ A;  5KNC A;  4F8M A;  3GTJ H;  4DV1 Q;  3GDE A;  1JE4 A;  3SR1 A;  4ZLT F;  1PFN A;  5EPJ A;  2F0J A;  2F0N A;  3HOW H;  5IGF A;  3I2Z A;  2A6E C;  2C5C A;  3RLN A;  1XNQ L;  4A3F G;  3BVG A;  1I3Q B;  3KYH C;  2F0G A;  3G4S A;  2WIN B;  2EYM A;  4IUT A;  5LL6 S;  3T13 A;  4IJH A;  1NE3 A;  1YJ9 A;  4LFB L;  1HXY D;  2EJF C;  5CBA E;  4LF6 L;  4AYB E;  1QZG A;  4K6L A;  2M9V A;  4DR5 L;  1PDQ A;  1PRT D;  3PQI A;  2HCC A;  2O5I C;  2BDO A;  1I6H B;  1YJW A;  4E6I A;  1KAA A;  1PVO A;  3FHW A;  2MQH A;  4KN4 C;  1DCZ A;  4KY5 A;  2L11 A;  3Q23 A;  1I94 L;  5IGC A;  1YI2 A;  4EVO A;  5C5L A;  4A3D G;  3HEJ A;  5KGU A;  1S3O A;  2JJQ A;  4CDC C;  3S14 B;  5FO9 B;  2FFK B;  3TRE A;  2L15 A;  3OPO A;  2K5V A;  3KUP A;  3G48 A;  2EYJ A;  4X6A H;  4NKL A;  4MTN A;  4FYD A;  3KBX A;  2B63 B;  2UXB Q;  5C6A A;  4RCN A;  4BBS G;  1JIC A;  3D31 A;  3J7A F;  1O7Z A;  2RF4 A;  1DJR D;  3JC6 6;  5HUR A;  5IYC H;  3S2H B;  1TWH B;  2XGT A;  3AFQ A;  4X62 L;  3JAM E;  3M85 A;  3OTO Q;  4JI0 Q;  4CJ2 C;  3TQY A;  5M3F G;  2Z6K A;  1ZYR C;  1OXV A;  1EFI D;  3VYS A;  4ZUI A;  1HNW Q;  1SYB A;  5K36 H;  4A3B B;  3HOY H;  3DWQ A;  1PLF A;  2QCP X;  1YHA A;  5LHY 1;  2R3Z A;  1WTX A;  1WI5 A;  2AQ1 B;  3S1R H;  4C3J G;  3VYR A;  1B70 B;  1ONL A;  4RCO A;  4XT3 B;  5C0X G;  1XPO A;  1VQH A;  3S2H H;  2HIV A;  1TY2 A;  3QOJ A;  3SE0 A;  4DV6 Q;  3JAM i;  2CFM A;  1QVC A;  3SK6 A;  1GUG A;  2L0C A;  4KLK A;  3VYT A;  4N9T A;  1LT5 D;  4K5V A;  4UHV A;  4EQP A;  4HID A;  2N78 A;  1V1P B;  1L0W A;  5FOB B;  1ZKO A;  1SYC A;  1SYG A;  3K6O A;  4RMF A;  3S15 H;  1T5X D;  2JA8 G;  3MEH A;  2KEC A;  1HZ9 A;  2DY7 A;  2WB1 G;  5CV6 A;  4DV7 L;  4DK0 A;  2I5M X;  1R9T H;  4QY7 A;  1DOK A;  2OF1 A;  3MFG A;  1EWH A;  1JT8 A;  4HED A;  1VQD A;  3C3L A;  2JA5 B;  3ND8 A;  3H15 A;  1SND A;  4GNX A;  3J7A 5;  4A3D H;  2JP1 A;  3FVQ A;  4DU9 A;  1IBK L;  4P71 A;  1QZH A;  3WOF A;  1J9O A;  3MXG A;  4JV5 L;  1EIF A;  4IFD J;  4C1N I;  1I50 H;  5BN5 A;  2MHV A;  1UE7 A;  3HOZ H;  4KHP L;  1JB7 A;  1UNS A;  2F4V L;  4A3M B;  1NMG A;  2RSN A;  1J5E Q;  1HNZ L;  3U9S A;  4ID6 A;  1TS5 A;  4QJF A;  5K5P A;  2UXC Q;  1VQK A;  1SN8 A;  2WAQ B;  3E9H A;  4WJW A;  4N9P A;  2K5H A;  4HAE A;  4JI8 Q;  2B2V C;  3HOZ B;  2BCO A;  1W2B A;  2EY6 A;  3P20 A;  4KKT A;  3A0J A;  2D0P A;  1JB3 A;  2DY8 A;  4IFD H;  4LFA Q;  3CU7 A;  3M4Y A;  1Y1W G;  3QIA A;  1Q90 A;  2PI2 A;  4A3J B;  4K5W A;  2ZTD A;  2NN6 G;  1A62 A;  1PYW D;  1L1O C;  1TS3 A;  2A6H D;  1M8A A;  3DWA A;  1ENF A;  1STB A;  4KY7 A;  1EUJ A;  3RR5 A;  1LAC A;  1Q3L A;  3HOU G;  5CV5 A;  3PF4 A;  3PO2 G;  4B3M Q;  4J15 A;  3RZO B;  3I56 A;  3MXN B;  5FJ8 G;  3FKI B;  1PZJ D;  4CDE C;  3M9B A;  4XYO A;  1FD7 D;  2K14 A;  4L6T B;  1K83 B;  1GD7 A;  1DM0 B;  1N33 L;  5EPK A;  3J81 i;  2B3G A;  1C9O A;  1PYB A;  4X3U A;  3AFP A;  2UXC L;  4DR7 L;  3ITP A;  2PMZ E;  2O5J C;  2RBM A;  1E0B A;  2NVQ H;  3CCJ A;  1G2S A;  2IY5 B;  5CV4 A;  3U4Z A;  1EYA A;  3PSI A;  1VQA A;  2YTY A;  4WOR A;  3W3A A;  1IHZ A;  5GRO A;  4HJ5 A;  5FKA C;  4X3T A;  3R93 A;  4FDB A;  3GTO H;  1N33 Q;  3CCU A;  1KNA A;  1KRT A;  3KF8 B;  1W6J A;  1CQV A;  5CBE E;  2A6E D;  2OWO A;  4A3B H;  1A6X A;  3A8K E;  2QDL A;  3V2T A;  4CBV A;  5DLQ E;  1RHP A;  3ULL A;  2DJF C;  1F2M A;  3BVZ A;  4K2K A;  2AKW B;  3C46 A;  2PI2 E;  3NTI A;  3HOY G;  2E2H B;  1RIP A;  2J7Z A;  2FXQ A;  3DXJ C;  1VQ4 A;  5M3M G;  2NN6 H;  5M3F H;  2OCE A;  4FNF A;  2ZM6 Q;  1LT6 D;  2EJG C;  3T51 B;  4A3K H;  1S5D D;  1U4M A;  1YZ6 A;  1XNR Q;  1D5X C;  1O7I A;  2HIX A;  1FJG L;  4BY7 G;  1TWC H;  1SFO H;  3OWE B;  3DM3 A;  2B63 H;  5C4X B;  1Z47 A;  5IYD H;  3C1F A;  3H0G B;  1HTL D;  2F0H A;  4R4O A;  4GZY C;  1KXL A;  1U4L A;  2ZJP A;  2F3V A;  4X66 Q;  3SK5 A;  4QGU A;  4DV3 Q;  2G9D A;  2NZ1 D;  3RLO A;  4X62 Q;  2LXJ A;  1G2T A;  5M5X H;  5JPM C;  1SYE A;  2NBF A;  3M4Q A;  3WDN A;  1KIX A;  1YHQ A;  5F2D A;  4R8N A;  3L7Z C;  1RTO A;  3KJP A;  2YU9 H;  4JI3 Q;  5CMD A;  2R93 H;  2VUM H;  1TWF H;  4NW2 A;  2X6G A;  2EIF A;  2IWH A;  4ULL A;  4DR3 L;  4GKK Q;  5DM7 3;  2NVY H;  1VQG A;  4ZKB B;  1HNZ Q;  1JMC A;  4BBS B;  1GXD C;  5CV9 A;  4LF9 L;  1IYU A;  1GO3 E;  2K32 A;  4RGO S;  4A3F H;  5EQ0 A;  3NEN A;  2HUG A;  4TVA B;  4OEM B;  4AH6 A;  1JJC B;  1KL9 A;  1TS2 A;  3NQT A;  1XMO Q;  3NBH B;  4NXM L;  1VCI A;  4KHP Q;  4KV6 A;  2KCN A;  4DV0 Q;  3BVM A;  5DEH A;  1U0L A;  5JEA H;  1M1K C;  2FHT A;  3MWY W;  1Y8O B;  5C4J B;  4DAM A;  2VQE Q;  3NXW A;  4OIK A;  5C3E G;  1IBL Q;  4TSS A;  2F3W A;  2ZT9 C;  1GUO A;  3MA2 B;  4OON A;  3K57 A;  5D3D A;  1MIU A;  2EPB A;  3CW2 C;  2YTX A;  3M4O H;  2E74 C;  1QVG A;  4K14 A;  3T1Y L;  5I6Y A;  3CCM A;  1QCB D;  4JI5 Q;  2JA7 G;  2B2Y A;  4Y52 H;  4XQQ A;  4F7X A;  1D7Q A;  1X56 A;  3NP8 A;  5FK9 C;  1EOV A;  1IW7 D;  1G6P A;  1NMF A;  2G5D A;  2EOT A;  1JQY D;  4AQY Q;  3AU7 A;  1EIY B;  5GQO A;  1GKH A;  2PCF B;  1SNO A;  4L63 B;  1PH2 A;  2J4X A;  3OHX C;  4N8X 1;  1LTG D;  1BNZ A;  1DON A;  4FVM A;  1VQC A;  1UE1 A;  1MGS A;  3CQZ B;  3T56 B;  2OEO A;  5IOD A;  1XYI A;  2E76 C;  2NZH A;  4Z9C B;  3FP9 A;  1J8I A;  3F2B A;  1GHJ A;  4OXP A;  1QWY A;  3TZD A;  5T1G A;  1B50 A;  1EEI D;  3LGJ A;  2A1A A;  2JN4 A;  4RGM A;  2YV5 A;  3WWV A;  4IAL A;  1JJ2 A;  5ELC A;  1B8A A;  5JPN C;  4DV5 Q;  5EBC A;  3J81 j;  2ZXR A;  3K8A A;  4ZYS A;  2B8G A;  3PV0 A;  2Z6B A;  2VXW A;  3K7A H;  4R4T A;  1EWI A;  2MP1 A;  5IGB A;  4JOI C;  3D6W A;  2WAQ G;  2H5X A;  5CR3 A;  3NEM A;  1GOZ A;  4CKB A;  5KRU A;  1D1K A;  2F03 A;  2F0L A;  2HDM A;  2TSS A;  3L0O A;  2Z8L A;  1RF2 D;  1F2L A;  3IFD A;  4JC0 A;  3BDL A;  3F8T A;  4K6D A;  1CT1 D;  3P7J A;  3GTG H;  4RKB A;  1TWC B;  3ZYY X;  3I8Z A;  1H9J A;  1NY4 A;  4M1U B;  1X3P A;  3I7F A;  1L1O A;  1EQR A;  3DMU A;  4OHJ A;  1D6E C;  4JG2 A;  4B3S L;  1G8Z D;  1HZA A;  3BDC A;  4A93 B;  5NUC A;  4KMU C;  5EBD A;  2QEX A;  1M90 C;  2C35 B;  4LFC Q;  4LFB Q;  1ENA A;  1PFM A;  3P75 A;  1LO5 D;  3C1E A;  5HGQ A;  2ICI A;  2PZU A;  4QL5 A;  1LTA D;  1AN8 A;  3CC4 A;  2NB0 A;  1CKO A;  2WP8 J;  1CA5 A;  3KF6 B;  1LTL A;  1N34 L;  2B2V A;  4DAV A;  2HDL A;  1A2U A;  1NUC A;  3A7L A;  3ERO A;  1R9T B;  4UPA A;  5BN3 A;  3HOX G;  5LMU Q;  1EQQ A;  3SK4 A;  2JK8 A;  3NBI A;  2K52 A;  3GD7 A;  5KEE A;  2E2I H;  4DV4 Q;  4WJ3 M;  2R92 G;  2FMC A;  2K75 A;  4LF4 Q;  2NUC A;  2K5D A;  1PV4 A;  5T1I A;  5FLX E;  5C4Z A;  3GTJ B;  5FO7 B;  2LMC B;  2ID0 A;  1AFP A;  1OO9 B;  1X6O A;  4G7Z C;  2O2L D;  3M7G A;  5E4X A;  1PRT F;  5COR A;  4DXG A;  2SNS A;  3UI2 A;  1N32 L;  3I55 A;  2Q8I B;  3M7N A;  2MO0 A;  5LMU L;  2EYP A;  1C8C A;  2F0O A;  3RZD H;  1B44 D;  1HR0 W;  2WFW A;  5L37 A;  2EXZ A;  1WD1 A;  2K1B A;  3HOX H;  1EY4 A;  1MI2 A;  1VQO A;  1SE4 A;  1FGU A;  5I6W A;  4NDX A;  3I4M B;  1QE6 A;  1K28 A;  2F0D A;  2D0O A;  5IWA Q;  1CA6 A;  4FXG C;  4B3S Q;  1PH4 A;  4MZ9 A;  4RHS A;  2Q2U A;  5KIX A;  3A74 A;  2QGQ A;  4HJA A;  2L12 A;  2F3I A;  4GN5 A;  3DEP A;  1BCP C;  1YBY A;  3BYY B;  2JEA I;  2I46 A;  5D65 A;  2F0I A;  1N36 L;  4OWT B;  1OXT A;  4G57 A;  4ALP A;  3NHH A;  4QUC A;  5IP9 G;  1B1Z A;  5A2Q E;  3HOW B;  3NQI A;  3TS0 A;  1A0I A;  1H9M A;  1CM9 A;  2KOL A;  4GOP B;  3I90 A;  1Y8P B;  2IJ0 A;  2ASB A;  2BE5 D;  2A74 C;  3K5L A;  1E2Z A;  1AZP A;  5FLX c;  3S14 H;  2MNA A;  2K03 A;  3E3X A;  3CPW A;  1DXM A;  4C3H H;  4DAY B;  1SJE D;  1VQL A;  1LLR D;  1CI3 M;  1IL8 A;  4ZQ3 A;  3TP6 A;  4OX9 L;  2YTV A;  1NCV A;  3NWS A;  1KAW A;  3GTL B;  1RTN A;  3GTQ B;  1B3Q A;  1JOK A;  3G7L A;  4LWC A;  4C2M B;  1BQQ T;  1EYD A;  2XIW A;  1C0A A;  3I72 A;  4DUY Q;  4I65 A;  2B63 G;  3GTO B;  1YNN D;  3E9I A;  4R4C A;  3U9O A;  3PO3 H;  2A69 D;  5IP7 H;  3K5M A;  3RD4 A;  1HRJ A;  3G71 A;  1HUM A;  1EY9 A;  1TY0 A;  3HFZ B;  3OW2 A;  2HT1 A;  1DD2 A;  4XXE A;  4GS3 A;  3NUC A;  3OMG A;  5M5W H;  1LV9 A;  1EOT A;  1QB5 D;  2Z6K C;  4FO2 A;  2ALY B;  3S1R B;  2ZM6 L;  1G91 A;  3K81 C;  3KLS X;  3CCR A;  4L5Q A;  5C5M A;  2A69 C;  5I2X A;  2A5H A;  3EQL C;  5BR8 L;  2KUM A;  4C3J B;  4U68 A;  2F0F A;  1STA A;  1TWH H;  4FXD A;  3U4V A;  2JA7 B;  3W2D A;  2KHJ A;  1B7Y B;  2CHB D;  1VQ8 A;  1YIT A;  1KLU D;  4HJ9 A;  4QMG A;  2R7Z G;  1Y8N B;  1KTK A;  4P74 A;  4DR7 Q;  4DFA A;  5IT9 c;  1YNN C;  4OWX B;  2F4I A;  2VUM G;  2AQ2 B;  4MTK A;  4IUQ A;  3J81 c;  3CMA A;  1ET9 A;  2R7Z H;  4KJO A;  3BS1 A;  4NMZ A;  4CDF C;  1YJN A;  1EIG A;  1PYS B;  3KDF B;  4C3J H;  1ENC A;  1K0R A;  5ELN A;  1EQV A;  1JE5 A;  1KRS A;  4FXK C;  1HPC A;  5CV7 A;  3ULJ A;  2E75 C;  1S5B D;  3PMF A;  1ILQ A;  2VQF Q;  1WTP A;  4JBM A;  4PZ6 A;  2UU9 L;  3L9A X;  1HFN A;  1YHB A;  1VQI A;  1S5C D;  1O7L A;  2B2U C;  3V96 A;  4HCE A;  1PZK D;  2EYF A;  4YCV A;  5C44 H;  3GP7 A;  1XTC D;  2G9H D;  1BCP B;  3CF5 A;  3CRL C;  2R7D A;  4F88 A;  4A3M H;  1SE3 A;  3S2D H;  5C4J H;  4YY3 Q;  4RH6 A;  1U9R A;  4I7Z C;  4J1M A;  3HRZ C;  4NXN Q;  3VA5 A;  2VNU D;  1PXU A;  2ENB A;  2EE1 A;  2K01 A;  1WTR A;  3VR3 A;  5JJK A;  2E5L L;  2EVB A;  1PH8 A;  4GOP C;  1WJJ A;  3FMC A;  3DHQ A;  3E0E A;  4AYB G;  1PTO C;  1SNQ A;  2NN6 I;  1JWM D;  4LF5 L;  2QKI C;  3URY A;  1LAB A;  2MO1 A;  4Q5V A;  1CFM A;  3Q8D A;  2RDH A;  1MBY A;  1PFB A;  2PQE A;  1WTO A;  4BS9 A;  2F4V Q;  1E2W A;  4YWM A;  3FEW X;  1X65 A;  1VMP A;  2F0S A;  1PTO D;  1I4Q A;  1YVC A;  3SDZ A;  2JA6 B;  4ABN A;  4DR6 L;  4POF A;  3BZC A;  4JI8 L;  4R4Q A;  1Y1W B;  1MSG A;  4N8F A;  2PMZ B;  5ELD A;  4A93 G;  2Q8R E;  3HKZ E;  5GAD C;  2CKZ B;  3KOJ A;  1GUW A;  4JI7 L;  1SNC A;  2PZT A;  3HG9 A;  2HD3 A;  2KHS A;  4HMI A;  3J7A V;  1XWE A;  1IL2 A;  1MSH A;  3X3M A;  4HIM A;  4IPH A;  3VR4 A;  1LTT D;  1I3Q H;  2ZTC A;  5IT9 E;  1WTH A;  4LFC L;  2L4N A;  2PZW A;  3HOU B;  3PO2 B;  1B3A A;  1U5K A;  4EX5 A;  4X3K A;  2MUY A;  4DNT B;  1VQ9 A;  1VQM A;  4JV5 Q;  3FKI G;  4GKJ L;  5DNF A;  4IN3 A;  3HOX B;  1EIH A;  3J7Z C;  5C0X H;  3K7A B;  2PQA B;  3CRK C;  1RKN A;  2R92 B;  4CGY B;  4JI4 L;  1SMX A;  3TN2 A;  4BBR H;  3CQZ H;  5KYL A;  4OO1 I;  3M3Y H;  4PV1 C;  3Q0A A;  4JI2 Q;  1BBW A;  5ELB A;  1M4V A;  4KK7 A;  1AP0 A;  4NB3 A;  1F9S A;  2EXD A;  3KF8 A;  3QO2 A;  5GAG C;  4FP5 D;  1VQN A;  1DGS A;  1JR0 D;  2OTL A;  4DN4 M;  3I70 A;  5BR8 Q;  2MPM A;  4JK1 C;  5AFW A;  3S9W A;  5H1S E;  1HNW L;  3OWF A;  3W5O A;  3BU2 A;  2R7F A;  5G3L F;  5IGD A;  5EKK A;  1I6V C;  1E1O A;  2B2U A;  2ICE C;  3O13 A;  1JC7 A;  3W1G A;  1O7Y A;  4OO1 G;  4LFA L;  1WYD A;  4LF8 Q;  1C4Q A;  3NTK A;  2VY3 A;  3I91 A;  1U4R A;  2JA7 H;  2IHE A;  2PQA A;  4RG1 A;  1O80 A;  1H9S B;  5J22 A;  2EYH A;  3PGZ A;  1BOS A;  5LL6 X;  4K8I A;  4PMW A;  3TP5 A;  1Y1V B;  1J6Q A;  3NWT A;  1S72 A;  1GJX A;  1NR4 A;  2Y0S B;  1MHW C;  1WD0 A;  3S1M H;  1XPR A;  4LF7 L;  1GVP A;  5G3L D;  3HKS A;  4XTC S;  3VR2 A;  1I94 Q;  2KCT A;  3CKI B;  3S1Q B;  1Q81 C;  5IYB H;  4LMQ D;  1MJC A;  1RD9 D;  2DNE A;  2F0E A;  3EJI A;  4NXN L;  2JQO A;  3F2D A;  4M8A A;  5ISR A;  1Z9F A;  2JEB I;  3S17 H;  1SNM A;  1BVS A;  3HGB A;  1F9P A;  4F87 A;  2NWG A;  4EQO A;  1KQS A;  2L55 A;  4BXX G;  2BH2 A;  2NVT B;  2NYZ D;  2OQ0 A;  5CYU A;  1N36 Q;  3LNN A;  1GM5 A;  1IXR A;  2GVB A;  3MXP A;  1TWF B;  1L2F A;  3ERQ A;  3D4R A;  3Q22 A;  2KHI A;  2VQE L;  4KHV A;  5EKI A;  1B2T A;  1XTD A;  4DK6 C;  4UAI A;  1EY6 A;  2E2J H;  1EY7 A;  2HCI A;  4IPD A;  1Q8K A;  2CVR A;  2BA0 A;  1T5E A;  2PW5 A;  4DV0 L;  4LF6 Q;  1LYL A;  1UE5 A;  4EQN A;  1S5E D;  4NXM Q;  4XQJ A;  5IE8 A;  4DV6 L;  2SOB A;  2B8F A;  3A54 A;  1CTM A;  3VYU A;  1PH1 A;  1W6K A;  2HQL A;  5IGE A;  5JJZ A;  1K8M A;  3MTS A;  4GN3 B;  3J80 c;  1OXU A;  1E22 A;  3H91 A;  1V9P A;  2B2T A;  3FRP B;  4QQB X;  2IHF A;  1CHQ D;  1WCM G;  3BDO A;  4DR3 Q;  1TWG B;  1VQ5 A;  3LWE A;  3EN2 A;  3GTM H;  2KVM A;  2V1C C;  2HQE A;  3SVM A;  2LS0 1;  2PYK A;  2VS1 A;  3PUX A;  4A3I B;  1CKM A;  1N32 Q;  3MXU A;  1N34 Q;  2E8G A;  5C3E B;  2F0M A;  4CKC A;  4FF1 A;  4LJZ C;  1TWA B;  1N9W A;  2A6H C;  4L5S A;  1MKH A;  3CP0 A;  1D5M C;  1QNU A;  1X3F A;  1YEZ A;  4DV3 L;  1STG A;  4HR7 B;  2NVX H;  3ONA B;  3J80 E;  1TII D;  1S40 A;  2I5L X;  2KCM A;  5ELE A;  2Z1C A;  1YNX A;  5JJI A;  3E6Z X;  4A3C G;  2VB2 X;  3RMH A;  4OX9 Q;  3L3O C;  3GV6 A;  1RJT A;  3H3V I;  3A8I E;  4XDX A;  3T1H L;  4B3R Q;  4YY3 L;  5K36 G;  1DOL A;  2UUB Q;  1X54 A;  4A3G H;  2N3S A;  1QIL A;  3ND9 A;  2IW3 A;  3U58 A;  1STH A;  4B08 A;  1BR9 A;  3NE5 B;  4PZ7 A;  2QDB A;  4B3T Q;  4UP8 A;  1AE3 A;  2AWN A;  1XPU A;  2M00 A;  3HOV H;  2NTT A;  1HR0 L;  1WVL A;  5IIF A;  4LW1 A;  2VQF L;  2CQA A;  4PZ8 A;  2WB1 E;  1CZG A;  4Q0F A;  1SDF A;  4C3I G;  2NVQ B;  3A8J E;  5TSS A;  1I6H H;  2KA7 A;  5HY6 A;  1HA6 A;  1IKM A;  1ZYR D;  4GLV B;  1F2Y A;  5M9O A;  4JI2 L;  2F0P A;  3B6Y A;  1F77 A;  1E2V A;  2F0Q A;  1PH3 A;  2KEN A;  4QIW E;  1IYJ B;  1QNK A;  1UAP A;  4AYB B;  1G51 A;  1JWS D;  4K8J A;  5A2Q L;  3UE1 A;  4G7H C;  4O0A A;  3PIO A;  5EAY A;  5AJ3 L;  5M5Y B;  1UEA B;  1RDP D;  1GHK A;  3U50 C;  3CXC A;  2UUA Q;  2LY7 A;  1VMC A;  1HH2 P;  3Q24 A;  2K04 A;  1V43 A;  4V19 0;  4TQU S;  5E4W C;  5CV8 A;  1TKW B;  4A93 H;  2PNR C;  4BBR B;  1E3P A;  2E2H H;  3GTL H;  4DA2 A;  1EU3 A;  3IFT A;  3IKJ A;  3CC7 A;  2XSC A;  2B39 A;  4AQY L;  5IP9 H;  4JVZ A;  5GAE C;  4KHZ A;  2JA8 H;  4O2D A;  3JAM c;  1XMQ L;  1RCV D;  2Z0S A;  3SK8 A;  1V8Q A;  5C44 G;  1LTB D;  4DR4 L;  2UXD Q;  3ULP A;  3I4N H;  3T1Y Q;  4GKJ Q;  1HHV A;  4QF4 A;  2B29 A;  1JOO A;  1CK1 A;  5C0X I;  1Q8I A;  1JJG A;  2F0V A;  1BDO A;  4PMB A;  1SFO B;  4DPG A;  4DXF A;  3MC0 B;  3S16 B;  4IPG A;  4P73 A;  3OOC A;  5COY A;  3RLF A;  2IX1 A;  1JOR A;  3AB9 A;  2OTJ A;  3K0X A;  3JAM L;  1Q7Y C;  2E5L Q;  2RKS A;  4WRD A;  4BWG B;  4A3G G;  4JI6 L;  1HNX Q;  1B9M A;  2Q8T A;  3R2I A;  1A3T A;  4CHT B;  1TXY A;  3PIP 3;  2MGS A;  4IZ8 A;  4LUO A;  1KDC A;  2NVT H;  2EY1 A;  1OXX K;  3OSO A;  4OWW B;  2A19 A;  1VQ6 A;  2ZTE A;  1STN A;  1BUV T;  2A68 D;  1Q1B A;  4ZAI A;  5C3X A;  5JVH 3;  5JEA J;  1TR5 A;  2E2I B;  3EIV A;  4K0K L;  2F0T A;  2A73 B;  1PTO F;  3K7U C;  2RVL A;  3A5Z B;  3WOE A;  5C3E H;  1N8R C;  1LTR D;  1CSQ A;  5HGT A;  1PTO H;  4G7O C;  4R1J A;  1FL0 A;  2F0K A;  2XNA C;  3UE0 A;  1I4P A;  5J3B A;  5ELF A;  1NJI C;  1Y1V G;  1G6Z A;  4X65 Q;  3RZO H;  2R6G A;  2QA4 A;  4X66 L;  4DK3 C;  2Y0S G;  4GKK L;  4YIJ A;  3CCS A;  4IOC A;  4S3S A;  3I4L A;  5FJ8 H;  1FVI A;  2SDF A;  2B2Y C;  3TBI B;  1NNX A;  1C48 A;  4OEL B;  5ELO A;  4DV7 Q;  4X64 Q;  1VQE A;  3CAM A;  3EFX D;  5JJL A;  4GOP A;  1B9N A;  1K3B C;  1EU4 A;  1FNU A;  1Q1E A;  1CSP A;  5JEA G;  4IUP A;  3DM1 A;  3HS0 C;  2I0Q A;  1XX8 A;  2NVX B;  5IP7 G;  2PW7 A;  1QOH A;  4J8Q A;  4POG A;  3HOW G;  1QG7 A;  3Q6S A;  2DGY A;  2SEB D;  2D2C C;  4XYQ A;  2JXM B;  4IFD G;  4C3H B;  3R8B A;  3UDG A;  3CHB D;  2ZXP A;  3TP8 A;  1SBB B;  1FJG Q;  4DV2 Q;  1XNR L;  3LWU A;  4XIG S;  3SHL A;  4RA8 A;  3OMC A;  3LX0 A;  3GTK B;  3IRB A;  4A3E H;  2RDG A;  3UDI A;  1LTI D;  3VR6 A;  5D3I B;  1STY A;  3I73 A;  1I5F A;  2I5H A;  4HMJ A;  3KLR A;  1PFS A;  1IW7 C;  4ZRZ A;  2EZV A;  4GN4 B;  2V4D A;  4JI5 L;  3UDF A;  3NPP A;  4DV2 L;  2UXB L;  1BO0 A;  3MAQ A;  3QWN A;  1O78 A;  4BY1 G;  1QUQ B;  1Y14 B;  5C4X H;  1A3U A;  3KLW A;  4NPS A;  1F9R A;  3S17 B;  2KBN A;  4A3I G;  1TVX A;  3RUZ A;  1EL0 A;  4BY7 H;  2ZXO A;  4OIJ A;  3NSW A;  1MD2 D;  4O1N A;  4LUV A;  5E1F A;  2RSO A;  4JI1 Q;  1L1O B;  1Y1V H;  3K0Y A;  3HZX A;  4DR2 L;  3EBE A;  1QJO A;  4YCW A;  4C56 C;  4DAY A;  1P8L A;  4HSV A;  1XMO L;  2XVS A;  3SEB A;  4ZKC B;  4DF7 A;  3S1M B;  4BA1 I;  2MFI A;  3BZK A;  4X64 L;  4YHH L;  3RN2 A;  2R7Z B;  1ESR A;  2FIN B;  1LT4 D;  4R9W A;  1GUS A;  5IGG A;  3DLL A;  3T53 B;  2VUM B;  4ODG A;  5KYI A;  2P5Z X;  1RL2 A;  1NAP A;  2K50 A;  4IFD I;  4RFB A;  2J0T D;  2VL6 A;  5LMN W;  1A63 A;  1I4H A;  3CC2 A;  4BY1 H;  2MJ8 A;  2N88 A;  2IT1 A;  4DV5 L;  2GVA A;  1ROD A;  1SXT A;  4DR6 Q;  2LFN A;  3GV3 A;  5JAV A;  1XNQ Q;  4MIU A;  4GNX C;  2ATW A;  4ME5 A;  3K58 A;  2AHO B;  3E5S A;  2Z9H A;  5DM6 3;  2OT2 A;  2O4X A;  2Q2H A;  4FF3 A;  1PH7 A;  1OXS C;  2BH8 A;  3HP3 A;  4P72 A;  3R2T A;  5E3F A;  1HR0 Q;  1VS0 A;  4C3I B;  5CC4 A;  1VQB A;  4LAA A;  4DR1 L;  1X55 A;  4BA2 I;  4A3I H;  2E2J B;  1IYV A;  1PHJ A;  5IYC G;  3MFY A;  5I9O A;  3A55 A;  1PTO B;  1BF4 A;  3BZD B;  1KDA A;  4K2L A;  3A7A B;  3K80 C;  1P16 A;  3T1H Q;  4B3R L;  4AIM A;  4PMC A;  3I4N G;  1UE6 A;  4LNQ A;  3HKZ B;  3IAY A;  1Q82 C;  4GLA C;  3H94 A;  2ZJR A;  1CZW A;  3OIP A;  4A3J H;  4JOI A;  4A3L G;  1F2Z A;  4UP7 A;  2NVY B;  1X3G A;  3ERS X;  4L5R C;  2UU9 Q;  1MJE A;  2KEE A;  2CWA A;  1B4O A;  4J6H A;  4A3F B;  2JA9 A;  1ICW A;  1VQF A;  3TP7 A;  5FO8 B;  4UY8 C;  4BBR G;  1IBL L;  5I4D A;  1WOC A;  1EFW A;  5IOC A;  2UUA L;  3AMU A;  2JA6 G;  3GTQ H;  1K3R A;  4ILW A;  4DV4 L;  2F0U A;  4DKA C;  4RGT A;  4R4I A;  2IL8 A;  4CDD C;  2K33 A;  3KFU A;  3D0F A;  3G6J B;  1FYC A;  1SE2 A;  3KF6 A;  2QEJ C;  1OTC A;  2R61 A;  2K5Q A;  3TZU A;  5C4H A;  5LMN Q;  2Q2T A;  4RAU C;  2RCF A;  2EYO A;  3H3V C;  1FNW A;  3SXH A;  3N6R A;  2RA4 A;  4NP5 A;  1SNP A;  3KK7 A;  2CWP A;  4QIW B;  1VF5 C;  3PUZ A;  1Q12 A;  4A3K G;  3M3Y B;  4QB4 A;  1D5Z C;  4FF4 A;  1JOQ A;  1D8L A;  4A3G B;  4JCV E;  1EZ6 A;  2DJG C;  4B3T L;  1KNE A;  1S5F D;  3BJU A;  3AQQ A;  4KTA A;  1D1I A;  2BE5 C;  1KDB A;  4WJ4 A;  3MHB A;  2XRQ D;  4FF2 A;  1Y69 U;  3D4D A;  3GQB A;  1D2B A;  4P75 A;  1WTV A;  1EYG A;  4ZUJ A;  4APV A;  5M3F B;  4CJ0 B;  1HQR D;  3NEL A;  1Z7T A;  4A3B G;  3NBH A;  2TMP A;  3A56 A;  1SYF A;  4RGN A;  4GNX B;  1I4R A;  4JI0 L;  4HJ8 A;  1WTQ A;  2UUC L;  2UUC Q;  4YWL A;  3RN5 A;  4HSP A;  3HOV G;  2K4K A;  3W1B A;  4HIK A;  1UWV A;  3KBG A;  1WTW A;  5C3W A;  2GA4 B;  2VB3 X;  2PO4 A;  1PMR A;  3CCQ A;  3K59 A;  4A75 A;  1IBM Q;  4EQ5 A;  4RWS C;  2JA8 B;  1VF7 A;  3F1Z A;  1BXT A;  5EPL A;  1ASY A;  5I2Y A;  3H3V H;  3S24 A;  4QUF A;  5KNB A;  1XJV A;  1EWC A;  2JE6 I;  1Q86 C;  1TT2 A;  1V1P A;  4RHR A;  2K7V A;  4LF8 L;  2B2W A;  2WKD A;  1V1O A;  3QR8 A;  3PUV A;  3T4A C;  2R93 B;  3J80 i;  1HCZ A;  4KJN A;  3E0J A;  3N52 A;  4CKE A;  4Y7N B;  3KJO A;  5IWA L;  3KLS A;  4JBW A;  3GTP B;  5CGK A;  1X3Q A;  5J39 A;  1SYD A;  2IPK D;  1EZ8 A;  4G4K A;  1AZQ A;  5M5X B;  2ZJQ A;  2B2W C;  1H9R A;  4A3E G;  1WCM H;  2L9H A;  1I50 B;  2RHQ B;  4OGQ C;  4Y7N H;  1S4Z A;  1SMY C;  3J81 E;  4IO9 A;  4JI3 L;  4O42 A;  2WKC A;  2PPB C;  3ER0 A;  2D9U A;  3HOU H;  3PO2 H;  4H02 A;  1UEB A;  1BBU A;  1TWG H;  3TRZ A;  1EY8 A;  1GUT A;  2JYO A;  3I3C A;  5M3M H;  2DNC A;  1TQO A;  1T9H A;  3VR5 A;  4DR1 Q;  4ME3 A;  2JSO A;  1VQJ A;  1WCM B;  2HHH L;  4LF9 Q;  2A68 C;  2XRS D;  1H95 A;  1I4G A;  5FLX L;  4A3J G;  1KHI A;  1IBM L;  2EYL A;  4MNO A;  5DAU A;  1K9M C;  3D6C A;  1HTP A;  3PUW A;  3RNU A;  3TS2 A;  3CCL A;  4BXX H;  1W3S A;  3OTO L;  3TEH B;  2CH4 A;  2XTI A;  1NTG A;  3FPP A;  2RDF A;  3MZ5 A;  5I9P A;  2X6L A;  3QOL A;  1KLG D;  4X3S A;  2A8V A;  3I4M H;  1LUZ A;  3KDF A;  4LF7 Q;  3CD6 A;  3DWP A;  5FLM H;  4TRD A;  4H13 C;  1HA5 A;  2BA1 A;  1H9K A;  2BOS A;  2L1B A;  3BG3 A;  1NR2 A;  1ZEQ X;  2OXP A;  5A35 A;  5LMN L;  3PO3 B;  2WV6 D;  3VDY A;  4LK1 C;  4JI4 Q;  4JW0 A;  2DN8 A;  1Q46 A;  3DUZ A;  1PH6 A;  3BYT B;  4DUZ Q;  1WFQ A;  3AEV A;  5M5W B;  1SAP A;  1YNJ D;  2KQ3 A;  2N55 A;  3QG1 A;  3IL8 A;  3UDX A;  2C9O A;  4HCS A;  4KI0 A;  4IUV A;  4H0L C;  4RKL A;  3PCO B;  3I4N B;  3HOY B;  4KY6 A;  2F1M A;  4DR2 Q;  4JBJ A;  1G29 1;  2H4O A;  4JI1 L;  3J7Y W;  3H6M A;  1EY5 A;  4DUZ L;  2EJM A;  4HTH A;  3ICE A;  2CQO A;  4DV1 L;  3J81 L;  3TDQ A;  3S16 H;  4HIO A;  1DOM A;  2I07 B;  4PG3 A;  1A3V A;  2AMC B;  1SMY D;  2LKV A; 
#chains in the Genus database with same CATH homology
 1ZXT A;  2CW0 C;  4DK1 A;  4BY7 B;  1JWU D;  5KND A;  3F2U A;  3TME A;  4HN7 A;  3GTG B;  2RQX A;  2KJX A;  4R8I A;  4IUU A;  1BCP F;  2K05 A;  1EQT A;  5C44 B;  2EY2 A;  1SJH D;  5D14 A;  2IX3 A;  5J1Z A;  2B2T C;  1A15 A;  3EVQ A;  2K28 A;  2Z4H A;  4A3D B;  3C2P A;  4A3K B;  3DEO A;  1EY0 A;  1KAB A;  2FJ2 A;  2BDN A;  1XXG A;  4B9X A;  4P2C B;  2D5D A;  4KN7 C;  5IT9 L;  3RZD B;  2YU9 B;  2IX0 A;  4MN3 A;  4UDU C;  1UUP A;  1R4Q B;  1K8O A;  1HUN A;  2H1E A;  2EY5 A;  4U67 3;  3X3N A;  1TS4 A;  3QB3 A;  2FMM A;  5EKL A;  1H9S A;  1L0X B;  1FGB D;  3FPU B;  3OW7 A;  1AW7 A;  3S2D B;  1BCP D;  4DAP A;  2D62 A;  2L5T A;  3HOV B;  2X69 A;  1X32 A;  5JOB A;  3K5O A;  2YYZ A;  4V0B A;  1FR3 A;  3P1H A;  3M4O B;  3GTM B;  2Z4I A;  4TKO B;  1BBX C;  4B9W A;  1EYC A;  3EA6 A;  1NSN S;  4KKS A;  1STE A;  4WFN 3;  2AUJ D;  3NTH A;  2NTS A;  3K5N A;  3T16 A;  2WB1 B;  1AEX A;  5EGT A;  5EJW A;  3V05 A;  1PRT B;  3H09 A;  1JCK B;  5BN4 A;  4CJ1 B;  1ESF A;  3MVV A;  1R4P B;  1GUN A;  1DYQ A;  4PQX A;  1CHP D;  3D4W A;  4EGV A;  3VA7 A;  1HFG A;  4QCL A;  4C3H G;  4L8J A;  3TSS A;  4A3E B;  2K6A A;  3GO5 A;  1YNJ C;  1B53 A;  4C1N K;  3MXN A;  2XWJ B;  3OIQ A;  3D8G A;  1LTS D;  2SNM A;  1ILP A;  1HQM C;  3PUY A;  4DNR B;  2XN9 C;  2WII B;  3D3R A;  1A2T A;  2EDG A;  4BY1 B;  4PNY A;  4H44 C;  4MHE A;  3S15 B;  2AUK A;  1I4X A;  4KKU A;  2M2L A;  4H7B A;  2XWB B;  1TU2 B;  1U4P A;  3PIO 3;  3R3O A;  4OL7 A;  2K5W A;  4KD3 A;  1F9Q A;  4DGZ A;  1FNV A;  2KCC A;  5JVG 3;  1II3 A;  2CW0 D;  4ZK9 B;  4IUR A;  1LT3 D;  4KD4 A;  3NK9 A;  3QJY A;  3S1N B;  1SEB D;  2AWO A;  4IQZ A;  3J80 L;  1IKL A;  1PZI D;  1VDZ A;  2WAC A;  1ET6 A;  3FDT A;  2F0W A;  1EEF D;  2E2D C;  4XT1 B;  1ML0 D;  1SSO A;  1CQF A;  1PRT C;  4K5X A;  1DZ1 A;  2AQ3 B;  2QF7 A;  4OO1 H;  1Z6H A;  5C0X J;  4XQN A;  2QIL A;  5M3M B;  1L0Y B;  4IUN A;  2KED A;  5KNC A;  4F8M A;  3SR1 A;  1JE4 A;  4ZLT F;  1PFN A;  5EPJ A;  2F0J A;  2F0N A;  5IGF A;  2A6E C;  2C5C A;  3BVG A;  1I3Q B;  2F0G A;  2WIN B;  2EYM A;  4IUT A;  5LL6 S;  3T13 A;  1HXY D;  2EJF C;  5CBA E;  4K6L A;  2M9V A;  1PDQ A;  1PRT D;  2HCC A;  2O5I C;  2BDO A;  1I6H B;  4E6I A;  1KAA A;  4KN4 C;  1DCZ A;  4KY5 A;  2L11 A;  3Q23 A;  5IGC A;  4EVO A;  5C5L A;  3HEJ A;  5KGU A;  3S14 B;  5FO9 B;  2FFK B;  3OPO A;  3KUP A;  2EYJ A;  4NKL A;  4FYD A;  3KBX A;  2B63 B;  5C6A A;  4RCN A;  1JIC A;  3D31 A;  3J7A F;  1O7Z A;  1DJR D;  5HUR A;  3S2H B;  1TWH B;  3JAM E;  3M85 A;  4CJ2 C;  1ZYR C;  1OXV A;  1EFI D;  3VYS A;  4ZUI A;  1SYB A;  5K36 H;  4A3B B;  3DWQ A;  1PLF A;  2QCP X;  5LHY 1;  2R3Z A;  1WTX A;  2AQ1 B;  4C3J G;  3VYR A;  1ONL A;  4RCO A;  4XT3 B;  5C0X G;  1TY2 A;  3QOJ A;  3SE0 A;  3SK6 A;  1GUG A;  2L0C A;  3VYT A;  4N9T A;  1LT5 D;  4K5V A;  4EQP A;  1V1P B;  5FOB B;  1ZKO A;  1SYC A;  1SYG A;  3K6O A;  1T5X D;  3MEH A;  2KEC A;  2DY7 A;  5CV6 A;  4DK0 A;  1DOK A;  2OF1 A;  3MFG A;  1EWH A;  4HED A;  3C3L A;  2JA5 B;  3ND8 A;  1SND A;  2JP1 A;  3FVQ A;  4DU9 A;  3WOF A;  1J9O A;  3MXG A;  4IFD J;  4C1N I;  5BN5 A;  2MHV A;  1UNS A;  4A3M B;  2RSN A;  3U9S A;  4ID6 A;  1TS5 A;  5K5P A;  2WAQ B;  4WJW A;  4N9P A;  4HAE A;  2B2V C;  3HOZ B;  2BCO A;  2EY6 A;  3P20 A;  4KKT A;  1JB3 A;  2DY8 A;  4IFD H;  3CU7 A;  3M4Y A;  3QIA A;  1Q90 A;  4A3J B;  4K5W A;  2NN6 G;  1PYW D;  1TS3 A;  2A6H D;  1M8A A;  3DWA A;  1ENF A;  1STB A;  4KY7 A;  1LAC A;  1Q3L A;  5CV5 A;  3RZO B;  3FKI B;  1PZJ D;  4XYO A;  1FD7 D;  4L6T B;  1K83 B;  1DM0 B;  5EPK A;  4X3U A;  3ITP A;  2O5J C;  2RBM A;  1E0B A;  1G2S A;  5CV4 A;  1EYA A;  4WOR A;  3W3A A;  1IHZ A;  5FKA C;  4X3T A;  3R93 A;  1KNA A;  1W6J A;  1CQV A;  5CBE E;  2A6E D;  1A6X A;  3A8K E;  3V2T A;  4CBV A;  1RHP A;  1F2M A;  3BVZ A;  4K2K A;  3C46 A;  3NTI A;  2E2H B;  2J7Z A;  3DXJ C;  2NN6 H;  4FNF A;  1LT6 D;  2EJG C;  3T51 B;  1S5D D;  1U4M A;  1D5X C;  3OWE B;  5C4X B;  1Z47 A;  3C1F A;  3H0G B;  1HTL D;  2F0H A;  4GZY C;  1U4L A;  2F3V A;  3SK5 A;  2G9D A;  2NZ1 D;  1G2T A;  5JPM C;  1SYE A;  2NBF A;  3WDN A;  5F2D A;  4R8N A;  3L7Z C;  1RTO A;  5CMD A;  4NW2 A;  2X6G A;  2IWH A;  4ULL A;  5DM7 3;  4ZKB B;  4BBS B;  1GXD C;  5CV9 A;  1IYU A;  2K32 A;  4RGO S;  5EQ0 A;  2HUG A;  1TS2 A;  3NQT A;  1VCI A;  4KV6 A;  2KCN A;  3BVM A;  5DEH A;  5JEA H;  2FHT A;  3MWY W;  1Y8O B;  5C4J B;  3NXW A;  4OIK A;  4TSS A;  2F3W A;  2ZT9 C;  1GUO A;  3MA2 B;  3K57 A;  5D3D A;  2EPB A;  2E74 C;  4K14 A;  5I6Y A;  1QCB D;  2B2Y A;  4XQQ A;  4F7X A;  3NP8 A;  5FK9 C;  1IW7 D;  2EOT A;  1JQY D;  3AU7 A;  2PCF B;  1SNO A;  4L63 B;  2J4X A;  3OHX C;  1LTG D;  1BNZ A;  1DON A;  4FVM A;  1MGS A;  3CQZ B;  3T56 B;  2OEO A;  5IOD A;  1XYI A;  2E76 C;  4Z9C B;  1J8I A;  1GHJ A;  1QWY A;  3TZD A;  5T1G A;  1B50 A;  1EEI D;  4RGM A;  4IAL A;  5ELC A;  5JPN C;  5EBC A;  2ZXR A;  4ZYS A;  2B8G A;  3PV0 A;  2VXW A;  5IGB A;  2MP1 A;  3D6W A;  5CR3 A;  5KRU A;  1GOZ A;  4CKB A;  1D1K A;  2F03 A;  2F0L A;  2HDM A;  2TSS A;  2Z8L A;  1RF2 D;  1F2L A;  3IFD A;  3BDL A;  4K6D A;  1CT1 D;  3P7J A;  4RKB A;  1TWC B;  3ZYY X;  3I8Z A;  1H9J A;  4M1U B;  1X3P A;  3DMU A;  4OHJ A;  1D6E C;  1G8Z D;  3BDC A;  4A93 B;  5NUC A;  4KMU C;  5EBD A;  1ENA A;  1PFM A;  3P75 A;  1LO5 D;  3C1E A;  2ICI A;  2PZU A;  1LTA D;  1AN8 A;  2NB0 A;  2WP8 J;  1CA5 A;  2B2V A;  4DAV A;  2HDL A;  1A2U A;  1NUC A;  3A7L A;  3ERO A;  1R9T B;  5BN3 A;  3SK4 A;  3NBI A;  3GD7 A;  5KEE A;  2FMC A;  2NUC A;  2K5D A;  5T1I A;  5FLX E;  5C4Z A;  3GTJ B;  5FO7 B;  2LMC B;  2ID0 A;  1AFP A;  1OO9 B;  4G7Z C;  2O2L D;  3M7G A;  5E4X A;  1PRT F;  5COR A;  4DXG A;  2SNS A;  3UI2 A;  2Q8I B;  3M7N A;  2EYP A;  1C8C A;  2F0O A;  1B44 D;  2EXZ A;  1WD1 A;  2K1B A;  1EY4 A;  1MI2 A;  1SE4 A;  5I6W A;  4NDX A;  3I4M B;  1QE6 A;  2F0D A;  1CA6 A;  4FXG C;  4RHS A;  5KIX A;  2L12 A;  3DEP A;  1BCP C;  3BYY B;  2JEA I;  2I46 A;  5D65 A;  2F0I A;  1OXT A;  4G57 A;  3NHH A;  4QUC A;  1B1Z A;  5A2Q E;  3HOW B;  3NQI A;  1H9M A;  1CM9 A;  2KOL A;  3I90 A;  1Y8P B;  2IJ0 A;  2BE5 D;  2A74 C;  3K5L A;  1E2Z A;  1AZP A;  2K03 A;  1DXM A;  1SJE D;  1LLR D;  1CI3 M;  1IL8 A;  4ZQ3 A;  3TP6 A;  1NCV A;  3NWS A;  3GTL B;  1RTN A;  3GTQ B;  3G7L A;  1JOK A;  4C2M B;  1BQQ T;  1EYD A;  2XIW A;  3I72 A;  4I65 A;  3GTO B;  1YNN D;  3U9O A;  2A69 D;  3K5M A;  3RD4 A;  1HRJ A;  1HUM A;  1EY9 A;  1TY0 A;  1DD2 A;  4XXE A;  3NUC A;  3OMG A;  1LV9 A;  1EOT A;  1QB5 D;  4FO2 A;  3S1R B;  1G91 A;  3KLS X;  5C5M A;  2A69 C;  5I2X A;  2A5H A;  3EQL C;  2KUM A;  4C3J B;  4U68 A;  2F0F A;  1STA A;  4FXD A;  2JA7 B;  3W2D A;  2CHB D;  1KLU D;  4QMG A;  1Y8N B;  1KTK A;  4DFA A;  1YNN C;  2F4I A;  2AQ2 B;  4IUQ A;  1ET9 A;  4KJO A;  3BS1 A;  4NMZ A;  1EIG A;  1ENC A;  1EQV A;  4FXK C;  1HPC A;  5CV7 A;  2E75 C;  1S5B D;  3PMF A;  1ILQ A;  1WTP A;  3L9A X;  1HFN A;  1S5C D;  1O7L A;  2B2U C;  3V96 A;  4HCE A;  1PZK D;  2EYF A;  3GP7 A;  1XTC D;  2G9H D;  1BCP B;  3CRL C;  4F88 A;  1SE3 A;  4RH6 A;  1U9R A;  4I7Z C;  4J1M A;  3HRZ C;  3VA5 A;  2VNU D;  1PXU A;  2ENB A;  2EE1 A;  2K01 A;  1WTR A;  3VR3 A;  2EVB A;  3FMC A;  3DHQ A;  1PTO C;  1SNQ A;  2NN6 I;  1JWM D;  2QKI C;  3URY A;  1LAB A;  4Q5V A;  1CFM A;  2RDH A;  1MBY A;  1PFB A;  2PQE A;  1WTO A;  4BS9 A;  1E2W A;  3FEW X;  1VMP A;  2F0S A;  1PTO D;  1I4Q A;  3SDZ A;  2JA6 B;  4ABN A;  1Y1W B;  1MSG A;  2PMZ B;  5ELD A;  2Q8R E;  1GUW A;  1SNC A;  2PZT A;  3HG9 A;  2KHS A;  4HMI A;  3J7A V;  1XWE A;  1MSH A;  3X3M A;  3VR4 A;  1LTT D;  5IT9 E;  2L4N A;  2PZW A;  3HOU B;  3PO2 B;  1B3A A;  4X3K A;  2MUY A;  4DNT B;  5DNF A;  4IN3 A;  3HOX B;  1EIH A;  5C0X H;  3K7A B;  3CRK C;  1RKN A;  2R92 B;  4CGY B;  3TN2 A;  5KYL A;  4OO1 I;  4PV1 C;  3Q0A A;  5ELB A;  1M4V A;  4KK7 A;  1AP0 A;  1F9S A;  3KF8 A;  3QO2 A;  4FP5 D;  1JR0 D;  4DN4 M;  3I70 A;  2MPM A;  4JK1 C;  5AFW A;  3S9W A;  3OWF A;  5G3L F;  5IGD A;  5EKK A;  1I6V C;  2B2U A;  2ICE C;  3O13 A;  1JC7 A;  1O7Y A;  4OO1 G;  1C4Q A;  3NTK A;  3I91 A;  1U4R A;  1O80 A;  1H9S B;  5J22 A;  2EYH A;  1BOS A;  5LL6 X;  4K8I A;  4PMW A;  3TP5 A;  1Y1V B;  3NWT A;  1GJX A;  1NR4 A;  2Y0S B;  1WD0 A;  5G3L D;  4XTC S;  3VR2 A;  3CKI B;  3S1Q B;  4LMQ D;  1RD9 D;  2DNE A;  2F0E A;  3EJI A;  4M8A A;  5ISR A;  2JEB I;  1SNM A;  3HGB A;  1F9P A;  4F87 A;  2NWG A;  4EQO A;  2L55 A;  2NVT B;  2NYZ D;  5CYU A;  3LNN A;  3MXP A;  1TWF B;  3ERQ A;  3D4R A;  3Q22 A;  4KHV A;  5EKI A;  1B2T A;  4UAI A;  1EY6 A;  1EY7 A;  2HCI A;  2CVR A;  2BA0 A;  1T5E A;  2PW5 A;  4EQN A;  1S5E D;  4XQJ A;  2SOB A;  2B8F A;  3A54 A;  1CTM A;  3VYU A;  1W6K A;  5IGE A;  5JJZ A;  1K8M A;  3MTS A;  1OXU A;  3H91 A;  2B2T A;  3FRP B;  1CHQ D;  3BDO A;  1TWG B;  3LWE A;  2KVM A;  2HQE A;  3SVM A;  2LS0 1;  2PYK A;  3PUX A;  4A3I B;  3MXU A;  5C3E B;  2F0M A;  4CKC A;  4FF1 A;  4LJZ C;  1TWA B;  2A6H C;  1D5M C;  1QNU A;  1STG A;  4HR7 B;  3ONA B;  3J80 E;  1TII D;  5ELE A;  2Z1C A;  3E6Z X;  2VB2 X;  3RMH A;  3L3O C;  3GV6 A;  1RJT A;  3A8I E;  4XDX A;  5K36 G;  1DOL A;  3ND9 A;  1QIL A;  2IW3 A;  1STH A;  4B08 A;  1BR9 A;  3NE5 B;  2QDB A;  2AWN A;  2M00 A;  2NTT A;  1WVL A;  5IIF A;  2CQA A;  1CZG A;  4Q0F A;  1SDF A;  4C3I G;  2NVQ B;  3A8J E;  5TSS A;  2KA7 A;  1HA6 A;  1IKM A;  1ZYR D;  1F2Y A;  5M9O A;  2F0P A;  1F77 A;  1E2V A;  2F0Q A;  1QNK A;  1UAP A;  4AYB B;  4K8J A;  1JWS D;  5A2Q L;  4G7H C;  5M5Y B;  1UEA B;  1RDP D;  1GHK A;  2LY7 A;  1VMC A;  3Q24 A;  2K04 A;  1V43 A;  4V19 0;  4TQU S;  5E4W C;  5CV8 A;  1TKW B;  2PNR C;  4BBR B;  4DA2 A;  1EU3 A;  3IFT A;  3IKJ A;  2XSC A;  2B39 A;  4KHZ A;  1RCV D;  3SK8 A;  1V8Q A;  1LTB D;  1HHV A;  4QF4 A;  1JOO A;  1CK1 A;  5C0X I;  1Q8I A;  2F0V A;  1BDO A;  4PMB A;  1SFO B;  4DXF A;  3MC0 B;  3S16 B;  3OOC A;  5COY A;  3RLF A;  2IX1 A;  1JOR A;  3AB9 A;  3JAM L;  2RKS A;  4WRD A;  4BWG B;  1B9M A;  2Q8T A;  3R2I A;  1A3T A;  4CHT B;  3PIP 3;  2MGS A;  4IZ8 A;  1KDC A;  2EY1 A;  1OXX K;  3OSO A;  1STN A;  1BUV T;  2A68 D;  1Q1B A;  4ZAI A;  5C3X A;  5JVH 3;  5JEA J;  1TR5 A;  2E2I B;  2F0T A;  2A73 B;  1PTO F;  2RVL A;  3WOE A;  1LTR D;  5HGT A;  1PTO H;  4G7O C;  2XNA C;  2F0K A;  1I4P A;  1G6Z A;  5ELF A;  2R6G A;  4YIJ A;  4S3S A;  3I4L A;  2SDF A;  2B2Y C;  3TBI B;  1C48 A;  3EFX D;  1B9N A;  1EU4 A;  1FNU A;  1Q1E A;  5JEA G;  4IUP A;  3DM1 A;  3HS0 C;  1XX8 A;  2NVX B;  2PW7 A;  1QOH A;  4J8Q A;  1QG7 A;  3Q6S A;  2SEB D;  2D2C C;  4XYQ A;  2JXM B;  4IFD G;  4C3H B;  3R8B A;  3CHB D;  2ZXP A;  3TP8 A;  1SBB B;  3LWU A;  4XIG S;  3SHL A;  4RA8 A;  3OMC A;  3LX0 A;  3GTK B;  2RDG A;  1LTI D;  3VR6 A;  5D3I B;  1STY A;  3I73 A;  4HMJ A;  3KLR A;  4ZRZ A;  1IW7 C;  2EZV A;  2V4D A;  3NPP A;  1BO0 A;  3MAQ A;  3QWN A;  1O78 A;  1A3U A;  1F9R A;  3S17 B;  1TVX A;  3RUZ A;  1EL0 A;  2ZXO A;  4OIJ A;  3NSW A;  1MD2 D;  4O1N A;  5E1F A;  2RSO A;  3K0Y A;  3HZX A;  1QJO A;  4C56 C;  4DAY A;  4HSV A;  2XVS A;  3SEB A;  4ZKC B;  4DF7 A;  3S1M B;  4BA1 I;  2R7Z B;  1ESR A;  2FIN B;  1LT4 D;  4R9W A;  1GUS A;  5IGG A;  3T53 B;  2VUM B;  4ODG A;  5KYI A;  1NAP A;  4IFD I;  4RFB A;  2J0T D;  1I4H A;  2MJ8 A;  2N88 A;  2IT1 A;  1ROD A;  1SXT A;  2LFN A;  3GV3 A;  5JAV A;  4MIU A;  4ME5 A;  3K58 A;  3E5S A;  5DM6 3;  2OT2 A;  2O4X A;  4FF3 A;  1OXS C;  3HP3 A;  3R2T A;  5E3F A;  4C3I B;  5CC4 A;  4LAA A;  4BA2 I;  2E2J B;  1IYV A;  3MFY A;  5I9O A;  3A55 A;  1PTO B;  1BF4 A;  3BZD B;  1KDA A;  4K2L A;  3A7A B;  4PMC A;  3HKZ B;  3IAY A;  3H94 A;  1CZW A;  3OIP A;  1F2Z A;  2NVY B;  2KEE A;  1B4O A;  4J6H A;  4A3F B;  1ICW A;  3TP7 A;  5FO8 B;  5I4D A;  5IOC A;  3AMU A;  4ILW A;  2F0U A;  4RGT A;  2IL8 A;  2K33 A;  3G6J B;  1FYC A;  1SE2 A;  2QEJ C;  2R61 A;  2K5Q A;  3TZU A;  5C4H A;  4RAU C;  2EYO A;  3H3V C;  1FNW A;  3SXH A;  3N6R A;  2RA4 A;  4NP5 A;  1SNP A;  3KK7 A;  4QIW B;  1VF5 C;  3PUZ A;  1Q12 A;  3M3Y B;  4QB4 A;  1D5Z C;  4FF4 A;  1JOQ A;  4A3G B;  1EZ6 A;  1KNE A;  1S5F D;  4KTA A;  1D1I A;  2BE5 C;  1KDB A;  3MHB A;  2XRQ D;  4FF2 A;  1Y69 U;  3D4D A;  3GQB A;  1D2B A;  1WTV A;  4ZUJ A;  5M3F B;  4CJ0 B;  1HQR D;  1Z7T A;  3NBH A;  2TMP A;  3A56 A;  1SYF A;  4RGN A;  1I4R A;  1WTQ A;  4HSP A;  3KBG A;  1WTW A;  5C3W A;  2GA4 B;  2VB3 X;  2PO4 A;  1PMR A;  3K59 A;  4RWS C;  2JA8 B;  1VF7 A;  1BXT A;  5EPL A;  5I2Y A;  4QUF A;  5KNB A;  1EWC A;  2JE6 I;  1TT2 A;  1V1P A;  4RHR A;  2K7V A;  2B2W A;  2WKD A;  1V1O A;  3PUV A;  3T4A C;  2R93 B;  1HCZ A;  4KJN A;  3E0J A;  3N52 A;  4CKE A;  4Y7N B;  3KLS A;  4JBW A;  3GTP B;  5CGK A;  1X3Q A;  5J39 A;  1SYD A;  2IPK D;  1EZ8 A;  4G4K A;  1AZQ A;  5M5X B;  2B2W C;  1H9R A;  2L9H A;  1I50 B;  4OGQ C;  1S4Z A;  1SMY C;  3J81 E;  2WKC A;  4O42 A;  2PPB C;  2D9U A;  1EY8 A;  1GUT A;  2JYO A;  3I3C A;  2DNC A;  1TQO A;  3VR5 A;  2JSO A;  1WCM B;  2A68 C;  2XRS D;  1I4G A;  5FLX L;  2EYL A;  5DAU A;  3D6C A;  1HTP A;  3PUW A;  3FPP A;  2RDF A;  3MZ5 A;  5I9P A;  2X6L A;  3QOL A;  1KLG D;  4X3S A;  3DWP A;  4TRD A;  4H13 C;  1HA5 A;  2BA1 A;  1H9K A;  2BOS A;  2L1B A;  3BG3 A;  1NR2 A;  1ZEQ X;  2OXP A;  5A35 A;  3PO3 B;  2WV6 D;  4LK1 C;  2DN8 A;  3DUZ A;  3BYT B;  5M5W B;  1SAP A;  1YNJ D;  2KQ3 A;  2N55 A;  3QG1 A;  3IL8 A;  2C9O A;  4HCS A;  4KI0 A;  4IUV A;  4H0L C;  4RKL A;  3I4N B;  3HOY B;  4KY6 A;  2F1M A;  1G29 1;  2H4O A;  3J7Y W;  3H6M A;  1EY5 A;  2EJM A;  4HTH A;  3J81 L;  3TDQ A;  1DOM A;  2I07 B;  1A3V A;  1SMY D;  2LKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...