5CVWA

Crystal structure of rtx domain block v of adenylate cyclase toxin from bordetella pertussis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
150
structure length
150
Chain Sequence
GSARDDVLIGDAGANVLNGLAGNDVLSGGAGDDVLLGDEGSDLLSGDAGNDDLFGGQGDDTYLFGVGYGHDTIYESGGGHDTIRINAGADQLWFARQGNDLEIRILGTDDALTVHDWYRDADHRVEIIHAANQAVDQAGIEKLVEAMAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional hemolysin/adenylate cyclase
publication title Calcium-Driven Folding of RTX Domain beta-Rolls Ratchets Translocation of RTX Proteins through Type I Secretion Ducts.
pubmed doi rcsb
source organism Bordetella pertussis (strain atcc 9797 / dsm 5571 / nctc 10739 / 18323)
molecule tags Toxin
total genus 49
structure length 150
sequence length 150
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 5cvwA00
3VI1A 2YO1A 1P9HA 2AGMA 3LAAA 1GO7P 2QUBA 3NTNA 3ULTA 1K7IA 2ZVDA 2ZJ7A 1OM7A 2ZJ6A 5CVWA 1SMPA 1K7GA 1OM8A 3U1RA 1SATA 1KAPP 1O0TA 1SRPA 1JIWP 2ML2A 2YO0A 3A70A 3WP8A 4I35A 1G9KA 3HDAP 1OMJA 3HBUP 1H71P 1K7QA 1OM6A 2Z8XA 1AKLA 3HB2P 2XQHA 2QUAA 1GO8P 2Z8ZA 1O0QA 3LA9A 3A6ZA 3S6LA 5D7WA 5CXLA 3HBVP 1AF0A
chains in the Genus database with same CATH superfamily
3VI1A 2YO1A 1P9HA 2AGMA 3LAAA 1GO7P 2QUBA 3NTNA 3ULTA 1K7IA 2ZVDA 2ZJ7A 1OM7A 2ZJ6A 4DT5A 5CVWA 1SMPA 1K7GA 1OM8A 3U1RA 1SATA 1KAPP 1O0TA 1SRPA 1JIWP 2ML2A 2YO0A 3A70A 3WP8A 4I35A 1G9KA 3HDAP 1OMJA 3HBUP 1H71P 1K7QA 1OM6A 2Z8XA 1AKLA 3HB2P 2XQHA 2QUAA 1GO8P 2Z8ZA 1O0QA 3LA9A 3A6ZA 3S6LA 5D7WA 5CXLA 3HBVP 1AF0A
chains in the Genus database with same CATH topology
3VI1A 2YO1A 1P9HA 2AGMA 3LAAA 1GO7P 2QUBA 3NTNA 3ULTA 1K7IA 2ZVDA 2ZJ7A 1OM7A 2ZJ6A 5CVWA 1SMPA 1K7GA 1OM8A 3U1RA 1SATA 1KAPP 1O0TA 1SRPA 1JIWP 2ML2A 2YO0A 3A70A 3WP8A 4I35A 1G9KA 3HDAP 1OMJA 3HBUP 1H71P 1K7QA 1OM6A 2Z8XA 1AKLA 3HB2P 2XQHA 2QUAA 1GO8P 2Z8ZA 1O0QA 3LA9A 3A6ZA 3S6LA 5D7WA 5CXLA 3HBVP 1AF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VI1 A;  2YO1 A;  1P9H A;  2AGM A;  3LAA A;  1GO7 P;  2QUB A;  3NTN A;  3ULT A;  1K7I A;  2ZVD A;  2ZJ7 A;  1OM7 A;  2ZJ6 A;  5CVW A;  1SMP A;  1K7G A;  1OM8 A;  3U1R A;  1SAT A;  1KAP P;  1O0T A;  1SRP A;  1JIW P;  2ML2 A;  2YO0 A;  3A70 A;  3WP8 A;  4I35 A;  1G9K A;  3HDA P;  1OMJ A;  3HBU P;  1H71 P;  1K7Q A;  1OM6 A;  2Z8X A;  1AKL A;  3HB2 P;  2XQH A;  2QUA A;  1GO8 P;  2Z8Z A;  1O0Q A;  3LA9 A;  3A6Z A;  3S6L A;  5D7W A;  5CXL A;  3HBV P;  1AF0 A; 
#chains in the Genus database with same CATH topology
 3VI1 A;  2YO1 A;  1P9H A;  2AGM A;  3LAA A;  1GO7 P;  2QUB A;  3NTN A;  3ULT A;  1K7I A;  2ZVD A;  2ZJ7 A;  1OM7 A;  2ZJ6 A;  4DT5 A;  5CVW A;  1SMP A;  1K7G A;  1OM8 A;  3U1R A;  1SAT A;  1KAP P;  1O0T A;  1SRP A;  1JIW P;  2ML2 A;  2YO0 A;  3A70 A;  3WP8 A;  4I35 A;  1G9K A;  3HDA P;  1OMJ A;  3HBU P;  1H71 P;  1K7Q A;  1OM6 A;  2Z8X A;  1AKL A;  3HB2 P;  2XQH A;  2QUA A;  1GO8 P;  2Z8Z A;  1O0Q A;  3LA9 A;  3A6Z A;  3S6L A;  5D7W A;  5CXL A;  3HBV P;  1AF0 A; 
#chains in the Genus database with same CATH homology
 3VI1 A;  2YO1 A;  1P9H A;  2AGM A;  3LAA A;  1GO7 P;  2QUB A;  3NTN A;  3ULT A;  1K7I A;  2ZVD A;  2ZJ7 A;  1OM7 A;  2ZJ6 A;  5CVW A;  1SMP A;  1K7G A;  1OM8 A;  3U1R A;  1SAT A;  1KAP P;  1O0T A;  1SRP A;  1JIW P;  2ML2 A;  2YO0 A;  3A70 A;  3WP8 A;  4I35 A;  1G9K A;  3HDA P;  1OMJ A;  3HBU P;  1H71 P;  1K7Q A;  1OM6 A;  2Z8X A;  1AKL A;  3HB2 P;  2XQH A;  2QUA A;  1GO8 P;  2Z8Z A;  1O0Q A;  3LA9 A;  3A6Z A;  3S6L A;  5D7W A;  5CXL A;  3HBV P;  1AF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...