The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
49
|
sequence length |
150
|
structure length |
150
|
Chain Sequence |
GSARDDVLIGDAGANVLNGLAGNDVLSGGAGDDVLLGDEGSDLLSGDAGNDDLFGGQGDDTYLFGVGYGHDTIYESGGGHDTIRINAGADQLWFARQGNDLEIRILGTDDALTVHDWYRDADHRVEIIHAANQAVDQAGIEKLVEAMAQY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Toxin
|
| molecule keywords |
Bifunctional hemolysin/adenylate cyclase
|
| publication title |
Calcium-Driven Folding of RTX Domain beta-Rolls Ratchets Translocation of RTX Proteins through Type I Secretion Ducts.
pubmed doi rcsb |
| source organism |
Bordetella pertussis (strain atcc 9797 / dsm 5571 / nctc 10739 / 18323)
|
| total genus |
49
|
| structure length |
150
|
| sequence length |
150
|
| ec nomenclature |
ec
4.6.1.1: Adenylate cyclase. |
| pdb deposition date | 2015-07-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00353 | HemolysinCabind | RTX calcium-binding nonapeptide repeat (4 copies) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | 2 Solenoid | Alkaline Protease, subunit P, domain 1 | Serralysin-like metalloprotease, C-terminal |
#chains in the Genus database with same CATH superfamily 1GO7 P; 2AGM A; 2ZJ7 A; 2QUB A; 2ZJ6 A; 4I35 A; 5CVW A; 1OM8 A; 3U1R A; 1H71 P; 3A70 A; 2QUA A; 1GO8 P; 1O0T A; 1G9K A; 3HDA P; 2YO0 A; 5D7W A; 1P9H A; 1JIW P; 1SRP A; 3S6L A; 1K7I A; 3LAA A; 3WP8 A; 5CXL A; 3HB2 P; 2XQH A; 2Z8Z A; 1OM6 A; 1AF0 A; 1SMP A; 3HBU P; 3VI1 A; 2ZVD A; 3ULT A; 1K7Q A; 2ML2 A; 3LA9 A; 1O0Q A; 3A6Z A; 1OMJ A; 3NTN A; 2YO1 A; 1OM7 A; 1SAT A; 2Z8X A; 3HBV P; 1KAP P; 1K7G A; 1AKL A; #chains in the Genus database with same CATH topology 1GO7 P; 2AGM A; 2ZJ7 A; 2QUB A; 2ZJ6 A; 4I35 A; 5CVW A; 1OM8 A; 3U1R A; 1H71 P; 3A70 A; 2QUA A; 1GO8 P; 1O0T A; 1G9K A; 3HDA P; 2YO0 A; 5D7W A; 1P9H A; 1JIW P; 1SRP A; 3S6L A; 1K7I A; 3LAA A; 3WP8 A; 5CXL A; 3HB2 P; 2XQH A; 2Z8Z A; 1OM6 A; 1AF0 A; 1SMP A; 3HBU P; 3VI1 A; 2ZVD A; 3ULT A; 1K7Q A; 2ML2 A; 4DT5 A; 3LA9 A; 1O0Q A; 3A6Z A; 1OMJ A; 3NTN A; 2YO1 A; 1OM7 A; 1SAT A; 2Z8X A; 3HBV P; 1KAP P; 1K7G A; 1AKL A; #chains in the Genus database with same CATH homology 1GO7 P; 2AGM A; 2ZJ7 A; 2QUB A; 2ZJ6 A; 4I35 A; 5CVW A; 1OM8 A; 3U1R A; 1H71 P; 3A70 A; 2QUA A; 1GO8 P; 1O0T A; 1G9K A; 3HDA P; 2YO0 A; 5D7W A; 1P9H A; 1JIW P; 1SRP A; 3S6L A; 1K7I A; 3LAA A; 3WP8 A; 5CXL A; 3HB2 P; 2XQH A; 2Z8Z A; 1OM6 A; 1AF0 A; 1SMP A; 3HBU P; 3VI1 A; 2ZVD A; 3ULT A; 1K7Q A; 2ML2 A; 3LA9 A; 1O0Q A; 3A6Z A; 1OMJ A; 3NTN A; 2YO1 A; 1OM7 A; 1SAT A; 2Z8X A; 3HBV P; 1KAP P; 1K7G A; 1AKL A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
